F485199

General Info

Members Datasets Scaffolds Average Seq Length
902 570 1804 224

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100061797|Ga0068853_1000617973
Length 269
Sequence MQIWPPLLLSARRRIWHPFRQRAIDGRPVRRYGIRNSVFKYGPRGMIPLDPFPNLIDQVYARILEAIIDRTLPPGHRIRQNELADKLGVSRQPVSHALHLLHRQGLVAESGRRGFEVTRLDPERIRQLYEVRGAIDALAARLAAGRARSDASGRAQLEAALQAGRTIGSDTPLSRLIALDVDFHGAIHRLAGNPAIEEMIAPQWPHMRRSMATVLAELDYRESAWAEHEAIAAEIFAGNAMTAEAAALAHAQTAGRMTEERLRATDKAA

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
187 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
343 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
344 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
345 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
346 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
351 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
358 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
361 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
364 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
365 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
366 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
367 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
368 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
369 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
370 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
371 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
372 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
373 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
374 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
375 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
376 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
377 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
378 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
379 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
380 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
381 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
382 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
383 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
384 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
385 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
386 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
387 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
388 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
389 2643221651 Afipia sp. Root123D2 Isolate Unclassified
390 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
391 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
392 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
393 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
394 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
395 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
396 2791355199
397 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
398 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
399 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
400 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
401 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
402 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
403 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
404 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
405 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
406 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
407 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
408 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
409 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
410 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
411 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
412 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
413 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
414 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
415 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
416 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
417 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
418 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
419 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
420 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
421 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
422 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
423 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
424 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
425 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
426 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
427 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
428 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
429 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
430 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
431 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
432 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
433 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
434 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
435 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
436 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
437 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
438 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
439 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
440 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
441 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
442 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
443 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
444 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
445 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
446 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
447 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
448 2904699407
449 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
450 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
451 2906610324
452 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
453 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
454 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
455 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
456 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
457 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
458 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
459 2922368715
460 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
461 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
462 2922425934
463 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
464 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
465 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
466 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
467 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
468 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
469 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
470 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
471 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
472 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
473 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
474 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
475 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
476 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
477 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
478 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
479 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
480 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
481 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
482 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
483 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
484 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
485 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
486 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
487 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
488 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
489 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
490 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
491 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
492 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
493 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
494 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
495 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
496 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
497 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
498 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
499 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
500 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
501 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
502 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
503 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
504 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
505 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
506 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
507 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
508 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
509 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
510 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
511 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
512 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
513 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
514 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
515 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
516 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
517 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
518 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
519 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
520 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
521 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
522 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
523 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
524 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
525 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
526 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
527 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
528 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
529 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
530 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
531 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
532 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
533 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
534 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
535 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
536 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
537 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
538 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
539 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
540 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
541 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
542 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
543 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
544 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
545 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
546 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
547 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
548 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
549 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
552 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
553 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
554 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
555 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
558 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
559 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
560 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
561 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
562 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
563 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
564 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
565 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
566 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
567 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
568 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
569 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
570 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.37
Metatranscriptomes 0.22
Isolates 22.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 18.29
Rhizoplane 4.32
Rhizosphere 57.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100061797 3300005539 Bacteria 3240
2 JGI25406J46586_10005201 3300003203 Bacteria 6033
3 JGI25153J46596_10001483 3300003215 Bacteria 13985
4 JGI25153J46596_10003992 3300003215 Bacteria 8065
5 JGI25153J46596_10004349 3300003215 Bacteria 7645
6 JGI25153J46596_10005814 3300003215 Bacteria 6411
7 JGI25160J50197_1032416 3300003354 Bacteria 1328
8 JGI25404J52841_10025660 3300003659 Bacteria 1269
9 JGI25404J52841_10051459 3300003659 Bacteria 865
10 Ga0055531_10003960 3300003794 Bacteria 9193
11 Ga0055531_10029887 3300003794 Bacteria 1845
12 Ga0065165_1003494 3300005262 Bacteria 10960
13 Ga0065165_1007016 3300005262 Bacteria 5679
14 Ga0065165_1065086 3300005262 Bacteria 985
15 Ga0070658_10082513 3300005327 Bacteria 2641
16 Ga0070658_10407225 3300005327 Bacteria 1169
17 Ga0070676_10095103 3300005328 Bacteria 1832
18 Ga0070683_100127384 3300005329 Bacteria 2407
19 Ga0070683_100422032 3300005329 Bacteria 1272
20 Ga0070670_100120311 3300005331 Bacteria 2265
21 Ga0070670_100598217 3300005331 Bacteria 987
22 Ga0068869_100139045 3300005334 Bacteria 1873
23 Ga0070666_10238391 3300005335 Bacteria 1286
24 Ga0070666_10282136 3300005335 Bacteria 1181
25 Ga0070680_100003569 3300005336 Bacteria 11609
26 Ga0070682_100252610 3300005337 Bacteria 1272
27 Ga0070682_100296957 3300005337 Bacteria 1184
28 Ga0068868_100086867 3300005338 Bacteria 2515
29 Ga0068868_100141722 3300005338 Bacteria 1974
30 Ga0070660_100031186 3300005339 Bacteria 4002
31 Ga0070660_100293594 3300005339 Bacteria 1331
32 Ga0070660_100316266 3300005339 Bacteria 1282
33 Ga0070691_10399959 3300005341 Bacteria 774
34 Ga0070661_100186613 3300005344 Bacteria 1580
35 Ga0070668_100032483 3300005347 Bacteria 3972
36 Ga0070668_100092260 3300005347 Bacteria 2388
37 Ga0070668_100140101 3300005347 Bacteria 1948
38 Ga0070668_100391745 3300005347 Bacteria 1184
39 Ga0070669_100412207 3300005353 Bacteria 1107
40 Ga0070675_100459675 3300005354 Bacteria 1142
41 Ga0070671_100102510 3300005355 Bacteria 2401
42 Ga0070671_100129931 3300005355 Bacteria 2121
43 Ga0070671_100184228 3300005355 Bacteria 1768
44 Ga0070671_100433928 3300005355 Bacteria 1126
45 Ga0070674_100130916 3300005356 Bacteria 1870
46 Ga0070673_100175043 3300005364 Bacteria 1833
47 Ga0070673_100256944 3300005364 Bacteria 1525
48 Ga0070673_100504327 3300005364 Bacteria 1095
49 Ga0070688_100193975 3300005365 Bacteria 1417
50 Ga0070659_100010642 3300005366 Bacteria 6774
51 Ga0070709_10001461 3300005434 Bacteria 12746
52 Ga0070709_10015475 3300005434 Bacteria 4341
53 Ga0070714_100003988 3300005435 Bacteria 11098
54 Ga0070713_100030094 3300005436 Bacteria 4308
55 Ga0070713_100243402 3300005436 Bacteria 1639
56 Ga0070713_100649099 3300005436 Bacteria 1005
57 Ga0070710_10001981 3300005437 Bacteria 9708
58 Ga0070710_10003702 3300005437 Bacteria 7230
59 Ga0070711_100010613 3300005439 Bacteria 5706
60 Ga0070711_100081392 3300005439 Bacteria 2308
61 Ga0070711_100118709 3300005439 Bacteria 1952
62 Ga0070705_100567719 3300005440 Bacteria 873
63 Ga0070700_100062693 3300005441 Bacteria 2349
64 Ga0070694_100467408 3300005444 Bacteria 999
65 Ga0070708_100362225 3300005445 Bacteria 1367
66 Ga0070663_100064678 3300005455 Bacteria 2644
67 Ga0070663_100079293 3300005455 Bacteria 2409
68 Ga0070663_100106956 3300005455 Bacteria 2096
69 Ga0070663_100224068 3300005455 Bacteria 1477
70 Ga0070663_100388909 3300005455 Bacteria 1137
71 Ga0070663_100594582 3300005455 Bacteria 930
72 Ga0070663_100619601 3300005455 Bacteria 912
73 Ga0070663_100797524 3300005455 Bacteria 810
74 Ga0070678_100012349 3300005456 Bacteria 5305
75 Ga0070678_100068020 3300005456 Bacteria 2654
76 Ga0070678_100509905 3300005456 Bacteria 1062
77 Ga0070681_10113549 3300005458 Bacteria 2648
78 Ga0070681_10184264 3300005458 Bacteria 2008
79 Ga0068867_100068863 3300005459 Bacteria 2642
80 Ga0070707_100369792 3300005468 Bacteria 1393
81 Ga0070698_100261297 3300005471 Bacteria 1664
82 Ga0070679_100034955 3300005530 Bacteria 4984
83 Ga0070679_100084582 3300005530 Bacteria 3160
84 Ga0070679_100293405 3300005530 Bacteria 1577
85 Ga0070684_100051368 3300005535 Bacteria 3581
86 Ga0070684_100070850 3300005535 Bacteria 3069
87 Ga0068853_100041579 3300005539 Bacteria 3927
88 Ga0068853_100072893 3300005539 Bacteria 2993
89 Ga0068853_100109526 3300005539 Bacteria 2451
90 Ga0068853_100349597 3300005539 Bacteria 1375
91 Ga0070672_100174168 3300005543 Bacteria 1791
92 Ga0070672_100301190 3300005543 Bacteria 1359
93 Ga0070686_100253377 3300005544 Bacteria 1287
94 Ga0070665_100009458 3300005548 Bacteria 9864
95 Ga0070665_100100642 3300005548 Bacteria 2894
96 Ga0070665_100399798 3300005548 Bacteria 1382
97 Ga0070665_100451920 3300005548 Bacteria 1294
98 Ga0070665_100704727 3300005548 Bacteria 1023
99 Ga0068855_100029909 3300005563 Bacteria 6513
100 Ga0068855_100118868 3300005563 Bacteria 3026
101 Ga0068855_100288082 3300005563 Bacteria 1821
102 Ga0068855_100308447 3300005563 Bacteria 1751
103 Ga0068855_100458562 3300005563 Bacteria 1390
104 Ga0068855_100943077 3300005563 Bacteria 909
105 Ga0070664_100244429 3300005564 Bacteria 1612
106 Ga0068857_100005639 3300005577 Bacteria 10702
107 Ga0068857_100394545 3300005577 Bacteria 1287
108 Ga0068854_100005923 3300005578 Bacteria 7744
109 Ga0068854_100149892 3300005578 Bacteria 1797
110 Ga0068854_100597915 3300005578 Bacteria 941
111 Ga0068856_100000476 3300005614 Bacteria 44310
112 Ga0068856_100092183 3300005614 Bacteria 3014
113 Ga0068856_100381559 3300005614 Bacteria 1429
114 Ga0068856_100607395 3300005614 Bacteria 1115
115 Ga0070702_100186556 3300005615 Bacteria 1361
116 Ga0068852_100077797 3300005616 Bacteria 2933
117 Ga0068852_100380603 3300005616 Bacteria 1384
118 Ga0068852_100619751 3300005616 Bacteria 1087
119 Ga0068864_100029756 3300005618 Bacteria 4628
120 Ga0068864_100276046 3300005618 Bacteria 1567
121 Ga0068866_10088113 3300005718 Bacteria 1684
122 Ga0068861_100093200 3300005719 Bacteria 2381
123 Ga0068851_10347981 3300005834 Bacteria 862
124 Ga0068870_10097503 3300005840 Bacteria 1655
125 Ga0068863_100200484 3300005841 Bacteria 1920
126 Ga0068858_100023298 3300005842 Bacteria 5770
127 Ga0068858_100110037 3300005842 Bacteria 2572
128 Ga0068858_100603620 3300005842 Bacteria 1065
129 Ga0068860_100001770 3300005843 Bacteria 23032
130 Ga0068860_100140320 3300005843 Bacteria 2322
131 Ga0068860_100516006 3300005843 Bacteria 1195
132 Ga0068860_101098385 3300005843 Bacteria 815
133 Ga0068862_100098476 3300005844 Bacteria 2554
134 Ga0068862_100160010 3300005844 Bacteria 2009
135 Ga0068862_100164094 3300005844 Bacteria 1985
136 Ga0068862_100232113 3300005844 Bacteria 1674
137 Ga0068862_100278070 3300005844 Bacteria 1533
138 Ga0068862_100637346 3300005844 Bacteria 1027
139 Ga0081455_10014597 3300005937 Bacteria 7689
140 Ga0081455_10033284 3300005937 Bacteria 4634
141 Ga0081455_10051238 3300005937 Bacteria 3542
142 Ga0081455_10120077 3300005937 Bacteria 2072
143 Ga0081455_10130380 3300005937 Bacteria 1967
144 Ga0081538_10016330 3300005981 Bacteria 5697
145 Ga0081540_1004386 3300005983 Bacteria 10787
146 Ga0081540_1007475 3300005983 Bacteria 7780
147 Ga0081540_1011549 3300005983 Bacteria 5900
148 Ga0081540_1013418 3300005983 Bacteria 5324
149 Ga0081540_1013507 3300005983 Bacteria 5304
150 Ga0081540_1015666 3300005983 Bacteria 4788
151 Ga0081540_1017174 3300005983 Bacteria 4489
152 Ga0081540_1036369 3300005983 Bacteria 2626
153 Ga0081540_1052189 3300005983 Bacteria 2016
154 Ga0081540_1056212 3300005983 Bacteria 1912
155 Ga0081540_1058445 3300005983 Bacteria 1858
156 Ga0081540_1094126 3300005983 Bacteria 1310
157 Ga0081539_10001098 3300005985 Bacteria 49182
158 Ga0081539_10079861 3300005985 Bacteria 1722
159 Ga0070717_10034975 3300006028 Bacteria 4064
160 Ga0070717_10203597 3300006028 Bacteria 1734
161 Ga0075365_10003272 3300006038 Bacteria 8304
162 Ga0075365_10232541 3300006038 Bacteria 1294
163 Ga0075368_10006510 3300006042 Bacteria 4085
164 Ga0075363_100054901 3300006048 Bacteria 2132
165 Ga0075364_10072638 3300006051 Bacteria 2267
166 Ga0070716_100009999 3300006173 Bacteria 4744
167 Ga0070712_100024550 3300006175 Bacteria 3997
168 Ga0070712_100269266 3300006175 Bacteria 1368
169 Ga0070712_100436779 3300006175 Bacteria 1088
170 Ga0075362_10012679 3300006177 Bacteria 3355
171 Ga0075362_10121718 3300006177 Bacteria 1235
172 Ga0075367_10010515 3300006178 Bacteria 4863
173 Ga0075367_10088683 3300006178 Bacteria 1880
174 Ga0075367_10108320 3300006178 Bacteria 1703
175 Ga0075369_10009109 3300006186 Bacteria 3844
176 Ga0075366_10087035 3300006195 Bacteria 1869
177 Ga0075366_10180928 3300006195 Bacteria 1280
178 Ga0075366_10212494 3300006195 Bacteria 1178
179 Ga0075366_10212859 3300006195 Bacteria 1177
180 Ga0068871_100112074 3300006358 Bacteria 2295
181 Ga0068871_100831334 3300006358 Bacteria 853
182 Ga0068865_100096253 3300006881 Bacteria 2158
183 Ga0068865_100472432 3300006881 Bacteria 1041
184 Ga0075436_100578975 3300006914 Bacteria 826
185 Ga0099825_1042615 3300006941 Bacteria 1249
186 Ga0099824_1007622 3300006942 Bacteria 14251
187 Ga0099822_1015729 3300006943 Bacteria 8446
188 Ga0099794_10004947 3300007265 Bacteria 5300
189 Ga0099794_10022777 3300007265 Bacteria 2858
190 Ga0099794_10081363 3300007265 Bacteria 1598
191 Ga0099795_10013919 3300007788 Bacteria 2481
192 Ga0105250_10191747 3300009092 Bacteria 860
193 Ga0105240_10013609 3300009093 Bacteria 11162
194 Ga0105240_10031535 3300009093 Bacteria 6872
195 Ga0105240_10090662 3300009093 Bacteria 3736
196 Ga0105240_10108028 3300009093 Bacteria 3371
197 Ga0105240_10600705 3300009093 Bacteria 1211
198 Ga0111539_10397647 3300009094 Bacteria 1605
199 Ga0105245_10040715 3300009098 Bacteria 4141
200 Ga0105245_10463887 3300009098 Bacteria 1277
201 Ga0105245_10834828 3300009098 Bacteria 961
202 Ga0105247_10114731 3300009101 Bacteria 1738
203 Ga0105247_10148289 3300009101 Bacteria 1544
204 Ga0105247_10262135 3300009101 Bacteria 1185
205 Ga0114129_10801653 3300009147 Bacteria 1201
206 Ga0105243_10106308 3300009148 Bacteria 2339
207 Ga0105243_10202939 3300009148 Bacteria 1740
208 Ga0105241_10054204 3300009174 Bacteria 3069
209 Ga0105241_10071900 3300009174 Bacteria 2686
210 Ga0105241_10077006 3300009174 Bacteria 2602
211 Ga0105241_10747508 3300009174 Bacteria 897
212 Ga0105248_10048180 3300009177 Bacteria 4780
213 Ga0105248_10120916 3300009177 Bacteria 2954
214 Ga0105248_10493399 3300009177 Bacteria 1380
215 Ga0105237_10009561 3300009545 Bacteria 10380
216 Ga0105237_10045175 3300009545 Bacteria 4434
217 Ga0105237_10189124 3300009545 Bacteria 2059
218 Ga0105237_10251930 3300009545 Bacteria 1768
219 Ga0105237_10613429 3300009545 Bacteria 1095
220 Ga0105238_10053356 3300009551 Bacteria 4062
221 Ga0105238_10254351 3300009551 Bacteria 1735
222 Ga0105238_10527923 3300009551 Bacteria 1183
223 Ga0105249_10231961 3300009553 Bacteria 1821
224 Ga0099796_10020218 3300010159 Bacteria 2031
225 Ga0105239_10066209 3300010375 Bacteria 3969
226 Ga0105239_10144144 3300010375 Bacteria 2655
227 Ga0105239_10148690 3300010375 Bacteria 2614
228 Ga0105239_10205541 3300010375 Bacteria 2207
229 Ga0105239_10337480 3300010375 Bacteria 1700
230 Ga0105239_10477787 3300010375 Bacteria 1416
231 Ga0105239_11047808 3300010375 Bacteria 938
232 Ga0105246_10103983 3300011119 Bacteria 2073
233 Ga0105246_10370529 3300011119 Bacteria 1180
234 Ga0105246_10377772 3300011119 Bacteria 1170
235 Ga0157323_1004452 3300012495 Bacteria 896
236 Ga0157373_10122080 3300013100 Bacteria 1831
237 Ga0157369_10012327 3300013105 Bacteria 9710
238 Ga0157369_10013199 3300013105 Bacteria 9350
239 Ga0157369_10015220 3300013105 Bacteria 8681
240 Ga0157369_10355917 3300013105 Bacteria 1520
241 Ga0157374_10128740 3300013296 Bacteria 2448
242 Ga0157374_10140980 3300013296 Bacteria 2340
243 Ga0157374_10981688 3300013296 Bacteria 864
244 Ga0157378_10006449 3300013297 Bacteria 10260
245 Ga0157378_10041522 3300013297 Bacteria 4081
246 Ga0163162_10714376 3300013306 Bacteria 1123
247 Ga0157375_11100746 3300013308 Bacteria 930
248 Ga0163163_10084289 3300014325 Bacteria 3184
249 Ga0163163_10154954 3300014325 Bacteria 2335
250 Ga0163163_10206100 3300014325 Bacteria 2015
251 Ga0157380_10032421 3300014326 Bacteria 4019
252 Ga0157380_10666245 3300014326 Bacteria 1040
253 Ga0157377_10064689 3300014745 Bacteria 2098
254 Ga0157379_10104071 3300014968 Bacteria 2548
255 Ga0157379_10108612 3300014968 Bacteria 2491
256 Ga0157379_10190503 3300014968 Bacteria 1853
257 Ga0157379_10366539 3300014968 Bacteria 1321
258 Ga0157376_10089222 3300014969 Bacteria 2665
259 Ga0157376_10676497 3300014969 Bacteria 1035
260 Ga0163161_10325429 3300017792 Bacteria 1216
261 Ga0206356_10405422 3300020070 Bacteria 1362
262 Ga0213872_10050668 3300021361 Bacteria 1884
263 Ga0213874_10018204 3300021377 Bacteria 1896
264 Ga0213876_10080544 3300021384 Bacteria 1722
265 Ga0213876_10102933 3300021384 Bacteria 1514
266 Ga0213871_10044400 3300021441 Bacteria 1201
267 Ga0224712_10026881 3300022467 Bacteria 2040
268 Ga0207425_1013272 3300025245 Bacteria 1908
269 Ga0209148_1000490 3300025254 Bacteria 40827
270 Ga0209233_1017284 3300025261 Bacteria 1968
271 Ga0209673_1062659 3300025273 Bacteria 920
272 Ga0209564_1008738 3300025295 Bacteria 4940
273 Ga0209564_1039296 3300025295 Bacteria 1302
274 Ga0209758_1000106 3300025297 Bacteria 218450
275 Ga0209758_1000982 3300025297 Bacteria 38353
276 Ga0209758_1002038 3300025297 Bacteria 21691
277 Ga0209758_1009331 3300025297 Bacteria 6122
278 Ga0209256_1007012 3300025299 Bacteria 5721
279 Ga0207426_1000337 3300025302 Bacteria 88200
280 Ga0207426_1001470 3300025302 Bacteria 19401
281 Ga0207426_1002910 3300025302 Bacteria 10100
282 Ga0207426_1044935 3300025302 Bacteria 1347
283 Ga0209257_1001773 3300025304 Bacteria 23881
284 Ga0209257_1023168 3300025304 Bacteria 2191
285 Ga0209257_1049368 3300025304 Bacteria 1198
286 Ga0207697_10044407 3300025315 Bacteria 1828
287 Ga0207692_10002972 3300025898 Bacteria 6568
288 Ga0207710_10092206 3300025900 Bacteria 1419
289 Ga0207688_10056628 3300025901 Bacteria 2203
290 Ga0207680_10030088 3300025903 Bacteria 3058
291 Ga0207647_10063607 3300025904 Bacteria 2244
292 Ga0207699_10004093 3300025906 Bacteria 6981
293 Ga0207699_10074221 3300025906 Bacteria 2089
294 Ga0207645_10018982 3300025907 Bacteria 4515
295 Ga0207643_10055691 3300025908 Bacteria 2249
296 Ga0207705_10084256 3300025909 Bacteria 2321
297 Ga0207654_10020869 3300025911 Bacteria 3478
298 Ga0207654_10075551 3300025911 Bacteria 2014
299 Ga0207707_10005294 3300025912 Bacteria 11286
300 Ga0207707_10077652 3300025912 Bacteria 2898
301 Ga0207707_10285682 3300025912 Bacteria 1428
302 Ga0207695_10001591 3300025913 Bacteria 36866
303 Ga0207695_10109892 3300025913 Bacteria 2738
304 Ga0207695_10380381 3300025913 Bacteria 1297
305 Ga0207671_10018136 3300025914 Bacteria 5408
306 Ga0207671_10099329 3300025914 Bacteria 2203
307 Ga0207671_10236335 3300025914 Bacteria 1435
308 Ga0207693_10009468 3300025915 Bacteria 7934
309 Ga0207693_10684508 3300025915 Bacteria 795
310 Ga0207663_10106019 3300025916 Bacteria 1898
311 Ga0207663_10206449 3300025916 Bacteria 1421
312 Ga0207657_10014966 3300025919 Bacteria 7537
313 Ga0207657_10024893 3300025919 Bacteria 5532
314 Ga0207657_10117215 3300025919 Bacteria 2193
315 Ga0207657_10456624 3300025919 Bacteria 1002
316 Ga0207649_10555890 3300025920 Bacteria 878
317 Ga0207652_10019018 3300025921 Bacteria 5641
318 Ga0207652_10028789 3300025921 Bacteria 4637
319 Ga0207652_10033490 3300025921 Bacteria 4327
320 Ga0207646_10808892 3300025922 Bacteria 834
321 Ga0207694_10031537 3300025924 Bacteria 4049
322 Ga0207694_10276821 3300025924 Bacteria 1377
323 Ga0207650_10076048 3300025925 Bacteria 2536
324 Ga0207659_10175828 3300025926 Bacteria 1692
325 Ga0207687_10039925 3300025927 Bacteria 3215
326 Ga0207687_10571731 3300025927 Bacteria 950
327 Ga0207700_10035247 3300025928 Bacteria 3603
328 Ga0207700_10230012 3300025928 Bacteria 1576
329 Ga0207700_10239127 3300025928 Bacteria 1547
330 Ga0207664_10010392 3300025929 Bacteria 6574
331 Ga0207664_10125743 3300025929 Bacteria 2152
332 Ga0207644_10147971 3300025931 Bacteria 1815
333 Ga0207644_10193652 3300025931 Bacteria 1600
334 Ga0207644_10193969 3300025931 Bacteria 1598
335 Ga0207690_10379853 3300025932 Bacteria 1122
336 Ga0207706_10099050 3300025933 Bacteria 2564
337 Ga0207686_10221721 3300025934 Bacteria 1366
338 Ga0207709_10005661 3300025935 Bacteria 7063
339 Ga0207709_10066991 3300025935 Bacteria 2264
340 Ga0207709_10557923 3300025935 Bacteria 902
341 Ga0207669_10248524 3300025937 Bacteria 1323
342 Ga0207704_10385233 3300025938 Bacteria 1102
343 Ga0207665_10006342 3300025939 Bacteria 7841
344 Ga0207691_10208211 3300025940 Bacteria 1700
345 Ga0207691_10229896 3300025940 Bacteria 1606
346 Ga0207711_10097604 3300025941 Bacteria 2594
347 Ga0207689_10027871 3300025942 Bacteria 4727
348 Ga0207661_10006444 3300025944 Bacteria 8298
349 Ga0207661_10138634 3300025944 Bacteria 2091
350 Ga0207661_10653437 3300025944 Bacteria 966
351 Ga0207661_10923442 3300025944 Bacteria 804
352 Ga0207667_10040191 3300025949 Bacteria 4981
353 Ga0207667_10045315 3300025949 Bacteria 4658
354 Ga0207667_10083361 3300025949 Bacteria 3310
355 Ga0207667_10342767 3300025949 Bacteria 1525
356 Ga0207667_10506600 3300025949 Bacteria 1224
357 Ga0207651_10160015 3300025960 Bacteria 1764
358 Ga0207651_10199620 3300025960 Bacteria 1602
359 Ga0207651_10226147 3300025960 Bacteria 1516
360 Ga0207668_10022999 3300025972 Bacteria 3998
361 Ga0207668_10035943 3300025972 Bacteria 3304
362 Ga0207668_10069006 3300025972 Bacteria 2515
363 Ga0207668_10808274 3300025972 Bacteria 830
364 Ga0207640_10016570 3300025981 Bacteria 4290
365 Ga0207640_10605902 3300025981 Bacteria 928
366 Ga0207658_10097025 3300025986 Bacteria 2300
367 Ga0207658_10521531 3300025986 Bacteria 1060
368 Ga0207677_10161000 3300026023 Bacteria 1744
369 Ga0207677_10633026 3300026023 Bacteria 942
370 Ga0207703_10008374 3300026035 Bacteria 8176
371 Ga0207703_10095153 3300026035 Bacteria 2512
372 Ga0207639_10046725 3300026041 Bacteria 3268
373 Ga0207639_10098323 3300026041 Bacteria 2359
374 Ga0207639_10208939 3300026041 Bacteria 1679
375 Ga0207678_10056592 3300026067 Bacteria 3375
376 Ga0207678_10056856 3300026067 Bacteria 3367
377 Ga0207678_10231492 3300026067 Bacteria 1582
378 Ga0207678_10246400 3300026067 Bacteria 1530
379 Ga0207678_10269451 3300026067 Bacteria 1460
380 Ga0207708_10118834 3300026075 Bacteria 2059
381 Ga0207702_10000514 3300026078 Bacteria 43618
382 Ga0207641_10150418 3300026088 Bacteria 2108
383 Ga0207641_10588354 3300026088 Bacteria 1088
384 Ga0207648_10093945 3300026089 Bacteria 2622
385 Ga0207648_10138107 3300026089 Bacteria 2147
386 Ga0207676_10069542 3300026095 Bacteria 2819
387 Ga0207676_10259015 3300026095 Bacteria 1569
388 Ga0207674_10048184 3300026116 Bacteria 4362
389 Ga0207683_10093253 3300026121 Bacteria 2683
390 Ga0207683_10232802 3300026121 Bacteria 1680
391 Ga0207683_10311519 3300026121 Bacteria 1441
392 Ga0207698_10037776 3300026142 Bacteria 3560
393 Ga0207698_10176284 3300026142 Bacteria 1888
394 Ga0207698_10238519 3300026142 Bacteria 1655
395 Ga0207698_10292217 3300026142 Bacteria 1513
396 Ga0209589_1000005 3300027357 Bacteria 530958
397 Ga0209489_100005 3300027361 Bacteria 530958
398 Ga0209700_100006 3300027363 Bacteria 530958
399 Ga0209588_1015066 3300027671 Bacteria 2375
400 Ga0209588_1045243 3300027671 Bacteria 1424
401 Ga0209588_1068503 3300027671 Bacteria 1146
402 Ga0209813_10005176 3300027866 Bacteria 3153
403 Ga0268266_10015609 3300028379 Bacteria 6509
404 Ga0268266_10183705 3300028379 Bacteria 1906
405 Ga0268265_10125754 3300028380 Bacteria 2121
406 Ga0268264_10001255 3300028381 Bacteria 24177
407 Ga0268264_10238631 3300028381 Bacteria 1683
408 Ga0268264_10406397 3300028381 Bacteria 1310
409 Ga0268264_10500485 3300028381 Bacteria 1185
410 Ga0268264_10621791 3300028381 Bacteria 1066
411 Ga0307517_10018365 3300028786 Bacteria 9051
412 Ga0307517_10040971 3300028786 Bacteria 5021
413 Ga0307515_10063827 3300028794 Bacteria 5162
414 Ga0307515_10385688 3300028794 Bacteria 1032
415 Ga0307509_10012663 3300031507 Bacteria 10066
416 Ga0307508_10202761 3300031616 Bacteria 1584
417 Ga0265314_10032685 3300031711 Bacteria 3824
418 Ga0307409_100116087 3300031995 Bacteria 2255
419 Ga0307416_100288097 3300032002 Bacteria 1624
420 Ga0307416_100825189 3300032002 Bacteria 1024
421 Ga0307416_101253008 3300032002 Bacteria 847
422 Ga0307510_10005379 3300033180 Bacteria 15241
423 Ga0307510_10070953 3300033180 Bacteria 3474
424 Ga0315911_1000015 3300033442 Bacteria 185247
425 Ga0373926_0176379 3300035083 Bacteria 819
426 Ga0373934_0032194 3300035086 Bacteria 2056
427 Ga0373940_0125071 3300035088 Bacteria 801
428 Ga0373945_0007763 3300035116 Bacteria 3481
429 Ga0373960_0066202 3300035121 Bacteria 1107
430 Ga0373943_0024206 3300035170 Bacteria 2830
431 Ga0373931_0166692 3300035691 Bacteria 1295
432 Ga0373935_0012074 3300035692 Bacteria 5192
433 Ga0373933_0000784 3300035724 Bacteria 19397
434 Ga0373947_0027815 3300035725 Bacteria 3311
435 Ga0373937_0484636 3300036401 Bacteria 1175
436 Ga0373937_1028359 3300036401 Bacteria 772
437 Ga0373925_0184913 3300037068 Bacteria 1651
438 Ga0395900_0040217 3300037418 Bacteria 4819
439 Ga0395900_0214845 3300037418 Bacteria 1941
440 Ga0395898_0027756 3300037466 Bacteria 5677
441 Ga0395898_0172849 3300037466 Bacteria 2065
442 Ga0395898_0227523 3300037466 Bacteria 1779
443 Ga0395898_0452748 3300037466 Bacteria 1222
444 Ga0436364_0453785 3300037853 Bacteria 976
445 Ga0395901_0101333 3300038443 Bacteria 3022
446 Ga0395901_0118389 3300038443 Bacteria 2783
447 Ga0436365_0080880 3300039437 Bacteria 993
448 Ga0436365_0483374 3300039437 Bacteria 6820
449 Ga0436365_1608200 3300039437 Bacteria 2164
450 Ga0436361_0519449 3300039447 Bacteria 1931
451 Ga0436363_0039534 3300039450 Bacteria 3177
452 Ga0436363_0676204 3300039450 Bacteria 1097
453 Ga0466966_0088509 3300044684 Bacteria 1924
454 Ga0466966_0211545 3300044684 Bacteria 1172
455 Ga0466966_0347891 3300044684 Bacteria 891
456 Ga0466963_0305976 3300044694 Bacteria 1118
457 Ga0466964_0142914 3300044706 Bacteria 1102
458 Ga0466968_0015516 3300044735 Bacteria 3020
459 Ga0466960_0054384 3300044901 Bacteria 1943
460 Ga0451576_0641139 3300045051 Bacteria 1116
461 Ga0466967_0540431 3300045976 Bacteria 1146
462 Ga0495617_079324 3300046452 Bacteria 1076
463 Ga0495592_0102410 3300046454 Bacteria 2038
464 Ga0495603_0005606 3300046455 Bacteria 7501
465 Ga0495603_0010247 3300046455 Bacteria 5674
466 Ga0495603_0055811 3300046455 Bacteria 2340
467 Ga0495603_0149023 3300046455 Bacteria 1359
468 Ga0495603_0204365 3300046455 Bacteria 1141
469 Ga0495590_0107571 3300046457 Bacteria 994
470 Ga0495629_0009598 3300046459 Bacteria 7069
471 Ga0495629_0346224 3300046459 Bacteria 1014
472 Ga0495641_0170696 3300046461 Bacteria 973
473 Ga0495641_0268102 3300046461 Bacteria 768
474 Ga0495651_0123963 3300046462 Bacteria 1894
475 Ga0495651_0322442 3300046462 Bacteria 1029
476 Ga0495582_0020250 3300046473 Bacteria 3640
477 Ga0495582_0219434 3300046473 Bacteria 1088
478 Ga0495582_0297075 3300046473 Bacteria 928
479 Ga0495639_0066807 3300046475 Bacteria 1655
480 Ga0495662_0004658 3300046476 Bacteria 6886
481 Ga0495662_0183377 3300046476 Bacteria 1032
482 Ga0495664_0177223 3300046477 Bacteria 1293
483 Ga0495585_0034608 3300046492 Bacteria 2856
484 Ga0495585_0108476 3300046492 Bacteria 1479
485 Ga0495594_0060797 3300046499 Bacteria 2090
486 Ga0495594_0156921 3300046499 Bacteria 1293
487 Ga0495607_0196634 3300046501 Bacteria 1001
488 Ga0495606_0004773 3300046507 Bacteria 13326
489 Ga0495606_0213743 3300046507 Bacteria 1090
490 Ga0495608_0202813 3300046511 Bacteria 1249
491 Ga0495616_0092378 3300046513 Bacteria 1431
492 Ga0495616_0123265 3300046513 Bacteria 1194
493 Ga0495620_0143202 3300046515 Bacteria 934
494 Ga0495628_0108953 3300046516 Bacteria 2132
495 Ga0495630_0069715 3300046517 Bacteria 2645
496 Ga0495631_0045462 3300046518 Bacteria 1933
497 Ga0495631_0079831 3300046518 Bacteria 1412
498 Ga0495632_0077838 3300046519 Bacteria 1585
499 Ga0495632_0083840 3300046519 Bacteria 1517
500 Ga0495643_0076237 3300046522 Bacteria 1753
501 Ga0495643_0090398 3300046522 Bacteria 1580
502 Ga0495644_0029237 3300046523 Bacteria 2083
503 Ga0495648_0012715 3300046524 Bacteria 6256
504 Ga0495640_0008536 3300046533 Bacteria 8031
505 Ga0495640_0045764 3300046533 Bacteria 3036
506 Ga0495586_0337334 3300046535 Bacteria 865
507 Ga0495587_0222836 3300046536 Bacteria 1063
508 Ga0495598_0006463 3300046537 Bacteria 2649
509 Ga0495609_0090881 3300046538 Bacteria 1328
510 Ga0495621_0177226 3300046539 Bacteria 849
511 Ga0495645_0063960 3300046543 Bacteria 2663
512 Ga0495622_0009391 3300046557 Bacteria 4525
513 Ga0495622_0115358 3300046557 Bacteria 1228
514 Ga0495667_0205130 3300046559 Bacteria 1261
515 Ga0495656_0001017 3300046615 Bacteria 9073
516 Ga0495656_0042601 3300046615 Bacteria 1901
517 Ga0495656_0181871 3300046615 Bacteria 1034
518 Ga0495668_0020784 3300046616 Bacteria 3770
519 Ga0495668_0118463 3300046616 Bacteria 1448
520 Ga0495668_0135654 3300046616 Bacteria 1347
521 Ga0495634_0005863 3300046642 Bacteria 9385
522 Ga0495634_0033851 3300046642 Bacteria 3509
523 Ga0495625_0284578 3300046660 Bacteria 1063
524 Ga0495635_0083826 3300046663 Bacteria 2181
525 Ga0495635_0190829 3300046663 Bacteria 1391
526 Ga0495659_0004477 3300046664 Bacteria 4402
527 Ga0495661_0144798 3300046665 Bacteria 1289
528 Ga0495599_0032531 3300046678 Bacteria 3274
529 Ga0495599_0272077 3300046678 Bacteria 1027
530 Ga0495623_0005568 3300046679 Bacteria 8224
531 Ga0495623_0193353 3300046679 Bacteria 1174
532 Ga0495646_0033218 3300046680 Bacteria 3209
533 Ga0495646_0055639 3300046680 Bacteria 2375
534 Ga0495658_0024656 3300046683 Bacteria 3206
535 Ga0495624_0378068 3300046690 Bacteria 851
536 Ga0495670_0247418 3300046691 Bacteria 950
537 Ga0495671_0027621 3300046692 Bacteria 2929
538 Ga0495671_0095673 3300046692 Bacteria 1453
539 Ga0495649_0011028 3300046694 Bacteria 5324
540 Ga0495600_0004662 3300046809 Bacteria 8215
541 Ga0495581_0024821 3300047315 Bacteria 3474
542 Ga0495604_0007789 3300047317 Bacteria 8484
543 Ga0495674_0076379 3300047319 Bacteria 2881
544 Ga0495674_0129887 3300047319 Bacteria 2123
545 Ga0495674_0266934 3300047319 Bacteria 1405
546 Ga0495672_0042009 3300047320 Bacteria 2760
547 Ga0495672_0044096 3300047320 Bacteria 2677
548 Ga0495672_0048703 3300047320 Bacteria 2512
549 Ga0495676_0176848 3300047321 Bacteria 1498
550 Ga0495680_0018507 3300047322 Bacteria 5909
551 Ga0495683_0242935 3300047323 Bacteria 793
552 Ga0495685_144050 3300047447 Bacteria 775
553 Ga0495686_0057913 3300047472 Bacteria 2417
554 Ga0495686_0338684 3300047472 Bacteria 820
555 Ga0495593_0054666 3300047673 Bacteria 2103
556 Ga0495593_0094722 3300047673 Bacteria 1536
557 Ga0495602_0013480 3300048088 Bacteria 8354
558 Ga0495615_0006391 3300048090 Bacteria 2179
559 Ga0496100_0326312 3300048903 Bacteria 1154
560 Ga0496101_0015190 3300048904 Bacteria 5183
561 Ga0496101_0380760 3300048904 Bacteria 1110
562 Ga0496101_0463074 3300048904 Bacteria 1000
563 Ga0496101_0688206 3300048904 Bacteria 807
564 Ga0496102_0142956 3300048905 Bacteria 2244
565 Ga0496102_0597965 3300048905 Bacteria 1026
566 Ga0496102_0617543 3300048905 Bacteria 1007
567 Ga0496102_0697006 3300048905 Bacteria 939
568 Ga0496103_0082393 3300048906 Bacteria 2025
569 Ga0496103_0097719 3300048906 Bacteria 1856
570 Ga0496103_0277552 3300048906 Bacteria 1078
571 Ga0496104_0099517 3300048907 Bacteria 2783
572 Ga0496104_0427426 3300048907 Bacteria 1236
573 Ga0496105_0074450 3300048908 Bacteria 2805
574 Ga0496106_0006199 3300048909 Bacteria 8844
575 Ga0496106_0148327 3300048909 Bacteria 1849
576 Ga0496107_0004141 3300048910 Bacteria 9779
577 Ga0496107_0285843 3300048910 Bacteria 1227
578 Ga0496108_0088016 3300048911 Bacteria 2638
579 Ga0496108_0157680 3300048911 Bacteria 1960
580 Ga0496108_0286078 3300048911 Bacteria 1435
581 Ga0496109_0018992 3300048912 Bacteria 6054
582 Ga0496110_0484656 3300048913 Bacteria 1126
583 Ga0496111_0060731 3300048914 Bacteria 2740
584 Ga0496112_0125784 3300048915 Bacteria 2534
585 Ga0496112_0128805 3300048915 Bacteria 2501
586 Ga0496112_0432838 3300048915 Bacteria 1254
587 Ga0496112_0477770 3300048915 Bacteria 1183
588 Ga0496112_0626655 3300048915 Bacteria 1006
589 Ga0496113_0097561 3300048916 Bacteria 2274
590 Ga0496113_0162445 3300048916 Bacteria 1766
591 Ga0496114_0008218 3300048917 Bacteria 8270
592 Ga0496114_0073946 3300048917 Bacteria 2869
593 Ga0496114_0629159 3300048917 Bacteria 945
594 Ga0496115_0007450 3300048918 Bacteria 8054
595 Ga0496115_0118718 3300048918 Bacteria 2175
596 Ga0496115_0144101 3300048918 Bacteria 1966
597 Ga0496116_0043620 3300048919 Bacteria 3054
598 Ga0496117_0105920 3300048920 Bacteria 1766
599 Ga0496120_0227781 3300048923 Bacteria 887
600 Ga0496121_0002453 3300048924 Bacteria 28353
601 Ga0496121_0015239 3300048924 Bacteria 8077
602 Ga0496121_0088673 3300048924 Bacteria 2424
603 Ga0496121_0245349 3300048924 Bacteria 1245
604 Ga0496124_0076055 3300048927 Bacteria 2773
605 Ga0496124_0136294 3300048927 Bacteria 1943
606 Ga0496125_0099959 3300048928 Bacteria 2140
607 Ga0496125_0168792 3300048928 Bacteria 1474
608 Ga0496125_0358356 3300048928 Bacteria 868
609 Ga0496126_0035606 3300048929 Bacteria 4664
610 Ga0496126_0039611 3300048929 Bacteria 4371
611 Ga0496126_0116982 3300048929 Bacteria 2316
612 Ga0496126_0158966 3300048929 Bacteria 1932
613 Ga0496126_0311458 3300048929 Bacteria 1296
614 Ga0496126_0363042 3300048929 Bacteria 1182
615 Ga0495682_0027239 3300049460 Bacteria 2120
616 Ga0495682_0076642 3300049460 Bacteria 1203
617 Ga0495682_0160331 3300049460 Bacteria 801
618 Ga0501031_0246999 3300049568 Bacteria 1160
619 Ga0501033_0040316 3300049570 Bacteria 3486
620 Ga0501033_0116964 3300049570 Bacteria 1937
621 Ga0501034_0412197 3300049571 Bacteria 1273
622 Ga0501043_0164530 3300049579 Bacteria 1732
623 Ga0501046_0375119 3300049580 Bacteria 1030
624 Ga0501048_0138630 3300049582 Bacteria 1720
625 Ga0501067_0165113 3300049583 Bacteria 1233
626 Ga0501067_0254403 3300049583 Bacteria 978
627 Ga0501069_0072211 3300049585 Bacteria 1935
628 Ga0501070_0160555 3300049586 Bacteria 1853
629 Ga0501073_0465964 3300049589 Bacteria 873
630 Ga0501080_0468825 3300049742 Bacteria 1127
631 Ga0501081_0727882 3300049743 Bacteria 745
632 Ga0501035_0160202 3300049822 Bacteria 1948
633 Ga0501035_0355305 3300049822 Bacteria 1225
634 Ga0501035_0400275 3300049822 Bacteria 1142
635 Ga0501044_0100815 3300049823 Bacteria 2905
636 Ga0501044_0328140 3300049823 Bacteria 1453
637 Ga0501044_0565809 3300049823 Bacteria 1032
638 Ga0501044_0583154 3300049823 Bacteria 1012
639 Ga0501044_0742892 3300049823 Bacteria 864
640 Ga0501045_0352343 3300049824 Bacteria 1096
641 nmdc:mga03683_29434_c1 3300050489 Bacteria 2190
642 nmdc:mga03n38_225047_c1 3300050490 Bacteria 981
643 nmdc:mga03n38_72587_c1 3300050490 Bacteria 1596
644 nmdc:mga0yw44_158087_c1 3300050492 Bacteria 1482
645 nmdc:mga0yw44_350393_c1 3300050492 Bacteria 994
646 nmdc:mga0yw44_3757_c1 3300050492 Bacteria 6805
647 nmdc:mga0k408_124045_c1 3300050493 Bacteria 1531
648 nmdc:mga0k408_308482_c1 3300050493 Bacteria 945
649 nmdc:mga0k408_68165_c1 3300050493 Bacteria 2075
650 nmdc:mga06z11_119353_c1 3300050494 Bacteria 1470
651 nmdc:mga06z11_6110_c1 3300050494 Bacteria 4873
652 nmdc:mga06z11_93783_c1 3300050494 Bacteria 1635
653 nmdc:mga04h51_50233_c1 3300050495 Bacteria 1397
654 nmdc:mga07m45_16674_c1 3300050496 Bacteria 3934
655 nmdc:mga07m45_217124_c1 3300050496 Bacteria 1112
656 nmdc:mga07m45_48871_c1 3300050496 Bacteria 2380
657 nmdc:mga07m45_74519_c1 3300050496 Bacteria 1934
658 nmdc:mga08x19_536538_c1 3300050514 Bacteria 827
659 nmdc:mga0sz30_122076_c1 3300050516 Bacteria 1145
660 nmdc:mga0sz30_41707_c1 3300050516 Bacteria 1930
661 Ga0495601_0206882 3300053077 Bacteria 1282
662 Ga0495601_0296065 3300053077 Bacteria 1054
663 Ga0500635_0006942 3300053080 Bacteria 3047
664 Ga0495595_0019861 3300053084 Bacteria 2919
665 Ga0495619_0081520 3300053085 Bacteria 2179
666 Ga0495619_0170097 3300053085 Bacteria 1507
667 Ga0500643_000052 3300053087 Bacteria 144656
668 Ga0500646_0029624 3300053090 Bacteria 1500
669 Ga0500647_0029909 3300053091 Bacteria 2585
670 Ga0500647_0047687 3300053091 Bacteria 2059
671 Ga0500566_0000207 3300053094 Bacteria 31105
672 Ga0500566_0268709 3300053094 Bacteria 819
673 Ga0500640_003553 3300053095 Bacteria 5477
674 Ga0500641_0011096 3300053096 Bacteria 3266
675 Ga0500641_0026372 3300053096 Bacteria 2255
676 Ga0500554_005579 3300053102 Bacteria 2758
677 Ga0500556_0018657 3300053104 Bacteria 2193
678 Ga0500557_000148 3300053105 Bacteria 16266
679 Ga0500572_000676 3300053111 Bacteria 11214
680 Ga0500595_011382 3300053119 Bacteria 3487
681 Ga0500595_012032 3300053119 Bacteria 3358
682 Ga0500595_041317 3300053119 Bacteria 1482
683 Ga0500608_105728 3300053122 Bacteria 1297
684 Ga0500614_000572 3300053123 Bacteria 9506
685 Ga0500559_0003255 3300053136 Bacteria 8063
686 Ga0500568_0024114 3300053139 Bacteria 2578
687 Ga0500603_000313 3300053150 Bacteria 12755
688 Ga0500603_000691 3300053150 Bacteria 8222
689 Ga0500630_001066 3300053159 Bacteria 12827
690 Ga0500638_002777 3300053162 Bacteria 6250
691 Ga0500638_058702 3300053162 Bacteria 1852
692 Ga0500639_000072 3300053163 Bacteria 46512
693 Ga0500637_0182180 3300053178 Bacteria 1203
694 Ga0500625_030006 3300053729 Bacteria 2582
695 Ga0500596_002009 3300053735 Bacteria 4064
696 Ga0500661_021550 3300055283 Bacteria 1144
697 2507504398 2507262055 Bacteria 8048963
698 2508545830 2508501009 Bacteria 7784016
699 2508694659 2508501042 Bacteria 8719808
700 2511396436 2511231028 Bacteria 8046582
701 2513624211 2513237092 Bacteria 8341956
702 2513638703 2513237094 Bacteria 8789602
703 2513649899 2513237095 Bacteria 8976980
704 2513656195 2513237096 Bacteria 8722461
705 2513679747 2513237098 Bacteria 9902361
706 2513694658 2513237101 Bacteria 7952346
707 2513702590 2513237102 Bacteria 7703324
708 2513860702 2513237137 Bacteria 9558895
709 2513892475 2513237141 Bacteria 8496279
710 2513917625 2513237145 Bacteria 8979722
711 2514010035 2513237161 Bacteria 8871253
712 2515624419 2515154112 Bacteria 8294334
713 2517108166 2517093001 Bacteria 9002274
714 2517887715 2517572143 Bacteria 9484767
715 2524442740 2524023205 Bacteria 8918781
716 2524466632 2524023210 Bacteria 9029266
717 2524535382 2524023228 Bacteria 10118060
718 2528850468 2528768022 Bacteria 10457665
719 2617353825 2617270735 Bacteria 9163226
720 2617374417 2617270741 Bacteria 8201522
721 2644290258 2643221651 Bacteria 4798932
722 2671120773 2667528175 Bacteria 7532676
723 2723842476 2721755755 Bacteria 8322773
724 2728748283 2728368998 Bacteria 8720350
725 2745074547 2744054633 Bacteria 8678936
726 2793059330 2791355196 Bacteria 7323613
727 2793070452 2791355197 Bacteria 8420563
728 2793078671
729 2805922089 2802429603 Bacteria 8777136
730 2818240899 2816332527 Bacteria 8933356
731 2824604663 2824600985 Bacteria 8488197
732 2824618873 2824617872 Bacteria 8814715
733 2824713834 2824704595 Bacteria 9667483
734 2824759702 2824753945 Bacteria 9787441
735 2824769917 2824763712 Bacteria 9792355
736 2838126059 2838122688 Bacteria 8803140
737 2841942548 2841941048 Bacteria 8688029
738 2841953102 2841949485 Bacteria 8680857
739 2841960605 2841957949 Bacteria 8652217
740 2841970873 2841966195 Bacteria 8673214
741 2841977867 2841974524 Bacteria 8931498
742 2841984568 2841983080 Bacteria 8395090
743 2842041710 2842038055 Bacteria 8002051
744 2842049752 2842045827 Bacteria 8006841
745 2844321403 2844315083 Bacteria 8138177
746 2847932003 2847930680 Bacteria 9342022
747 2847943244 2847939898 Bacteria 8606328
748 2849076973 2849076700 Bacteria 7039503
749 2857514755 2857509624 Bacteria 7472071
750 2874595647 2874590934 Bacteria 8299676
751 2874606837 2874604998 Bacteria 7834745
752 2874620356 2874612657 Bacteria 8252029
753 2874621846 2874620515 Bacteria 8290088
754 2874630234 2874628541 Bacteria 8630250
755 2874651719 2874645413 Bacteria 8214782
756 2876766447 2876761206 Bacteria 10111113
757 2876775842 2876771140 Bacteria 8287509
758 2876821615 2876818435 Bacteria 8274608
759 2879079933 2879074833 Bacteria 8279565
760 2879085682 2879083081 Bacteria 8587928
761 2879104524 2879099564 Bacteria 10442239
762 2879112264 2879110137 Bacteria 8907982
763 2879134018 2879127579 Bacteria 8294491
764 2879148503 2879142872 Bacteria 8267021
765 2881370410 2881364244 Bacteria 7710352
766 2881666461 2881665667 Bacteria 8175609
767 2885374415 2885366525 Bacteria 8326213
768 2885382556 2885374607 Bacteria 8927485
769 2885392196 2885383462 Bacteria 9473874
770 2885411556 2885409591 Bacteria 9235467
771 2888387710 2888378607 Bacteria 9652610
772 2888391462 2888388044 Bacteria 7304136
773 2888426920 2888419890 Bacteria 7857137
774 2889034252 2889033259 Bacteria 9099371
775 2903734584 2903727486 Bacteria 8281579
776 2903753461 2903748898 Bacteria 9972761
777 2903773492 2903768456 Bacteria 9749579
778 2904669561 2904666416 Bacteria 8226587
779 2904691846 2904690495 Bacteria 9412302
780 2904709565
781 2904713628 2904711408 Bacteria 9771557
782 2906608017 2906602504 Bacteria 8295279
783 2906612725
784 2906629408 2906626472 Bacteria 8826946
785 2906640557 2906635258 Bacteria 8601019
786 2906663219 2906660503 Bacteria 8595048
787 2908745921 2908739725 Bacteria 8628932
788 2908763950 2908756301 Bacteria 8864324
789 2908776897 2908775508 Bacteria 8092255
790 2922367638 2922361189 Bacteria 7436256
791 2922376697
792 2922391613 2922386360 Bacteria 7017218
793 2922393290 2922393267 Bacteria 8285685
794 2922433206
795 2929202060 2929199973 Bacteria 7260745
796 2929619762 2929615660 Bacteria 9193770
797 2929629073 2929624759 Bacteria 9339455
798 2932789752 2932784394 Bacteria 9704911
799 2932817735 2932809354 Bacteria 9135765
800 2932827153 2932818245 Bacteria 9955613
801 2932837680 2932828146 Bacteria 9745859
802 2933581681 2933577622 Bacteria 9116884
803 2935613188 2935608549 Bacteria 8203142
804 2935624549 2935616580 Bacteria 9032984
805 2935630597 2935630451 Bacteria 8169952
806 2935647224 2935638405 Bacteria 10015038
807 2935655639 2935648319 Bacteria 8801166
808 2935664457 2935656913 Bacteria 8965014
809 2935674313 2935665750 Bacteria 9571747
810 2935684797 2935675223 Bacteria 9928132
811 2935694225 2935684952 Bacteria 9590419
812 2935697676 2935694250 Bacteria 9291695
813 2935711302 2935703347 Bacteria 10242284
814 2935720010 2935713505 Bacteria 9608509
815 2935732121 2935722832 Bacteria 9608746
816 2935741510 2935732158 Bacteria 9706831
817 2935750882 2935741537 Bacteria 9707219
818 2935757876 2935750917 Bacteria 9590372
819 2935764253 2935760218 Bacteria 9817913
820 2935775126 2935769743 Bacteria 7878163
821 2935780029 2935777560 Bacteria 8077691
822 2935790150 2935785616 Bacteria 7962367
823 2935798808 2935793552 Bacteria 8012592
824 2935809912 2935801545 Bacteria 9301974
825 2935819307 2935810662 Bacteria 9401221
826 2935824958 2935819856 Bacteria 8261050
827 2935836648 2935827899 Bacteria 10038562
828 2935846407 2935837841 Bacteria 9454360
829 2935852178 2935847175 Bacteria 8228321
830 2935863241 2935855204 Bacteria 9035059
831 2935868710 2935864058 Bacteria 9784707
832 2935879484 2935873716 Bacteria 9632195
833 2935925441 2935916978 Bacteria 9113783
834 2935933945 2935926038 Bacteria 8601059
835 2935942464 2935934488 Bacteria 8602579
836 2935950923 2935942939 Bacteria 8599779
837 2935959384 2935951376 Bacteria 8602333
838 2935965391 2935959822 Bacteria 7869783
839 2935975451 2935967501 Bacteria 8603075
840 2935980121 2935975950 Bacteria 8347125
841 2935984285 2935984226 Bacteria 8302647
842 2936000278 2935992306 Bacteria 9802711
843 2936010320 2936002035 Bacteria 9362176
844 2936018589 2936011229 Bacteria 8801034
845 2936027107 2936019824 Bacteria 8804134
846 2936035926 2936028420 Bacteria 8965941
847 2936045930 2936037263 Bacteria 9446081
848 2936054005 2936046547 Bacteria 8903709
849 2940563302 2940556831 Bacteria 9590747
850 2941507249 2941507105 Bacteria 8166816
851 2941515676 2941515067 Bacteria 8166720
852 2941523616 2941523033 Bacteria 8169134
853 2941531974 2941531003 Bacteria 7653939
854 2941546835 2941538514 Bacteria 9402094
855 3005482802 3005474847 Bacteria 9259049
856 3005485742 3005483717 Bacteria 7877331
857 3005506602 3005506211 Bacteria 6943378
858 3005588735 3005587118 Bacteria 7794411
859 3005601759 3005594810 Bacteria 8716512
860 3005717498 3005710791 Bacteria 7622528
861 3005724435 3005718088 Bacteria 8283608
862 8006935107 8006933436 Bacteria 10410654
863 8006965365 8006964411 Bacteria 8966052
864 8006975075 8006973647 Bacteria 10679141
865 8006986077 8006984368 Bacteria 9651211
866 8006999249 8006994254 Bacteria 8309700
867 8016519134 8016511872 Bacteria 9921665
868 8016525178 8016522445 Bacteria 8156687
869 8016538756 8016530956 Bacteria 8155261
870 8016550249 8016548790 Bacteria 8155074
871 8016558658 8016557553 Bacteria 8154380
872 8016568448 8016566248 Bacteria 8158151
873 8016581100 8016575299 Bacteria 8154085
874 8016587613 8016583857 Bacteria 10421953
875 8016596636 8016595262 Bacteria 8149947
876 8016607507 8016603502 Bacteria 8731218
877 8016630289 8016622563 Bacteria 7999408
878 8016636858 8016630954 Bacteria 9217207
879 8017066365 8017057580 Bacteria 10023680
880 8019538425 8019530166 Bacteria 8155624
881 8019541395 8019538911 Bacteria 7872763
882 8019549229 8019547302 Bacteria 7996444
883 8019563598 8019555841 Bacteria 9642137
884 8019573667 8019565922 Bacteria 9639779
885 8019578250 8019576017 Bacteria 10049540
886 8019596287 8019586578 Bacteria 10212056
887 8019605411 8019597564 Bacteria 10041141
888 8019613129 8019608314 Bacteria 10042931
889 8019623820 8019619141 Bacteria 9218857
890 8019638222 8019629233 Bacteria 8687553
891 8019641417 8019638758 Bacteria 9062356
892 8019651620 8019648815 Bacteria 10014479
893 8019666137 8019659431 Bacteria 8577854
894 8019675649 8019668869 Bacteria 8791617
895 8019680451 8019678201 Bacteria 8863603
896 8019695363 8019687851 Bacteria 8712826
897 8055750485 8055742211 Bacteria 9226248
898 8055911056 8055909800 Bacteria 7278581
899 8056678968 8056673599 Bacteria 7871253
900 8056685534 8056681323 Bacteria 8472857
901 8056692831 8056689827 Bacteria 6712655
902 8056971779 8056967851 Bacteria 9038162
903 Ga0068853_100061797
904 JGI25406J46586_10005201
905 JGI25153J46596_10001483
906 JGI25153J46596_10003992
907 JGI25153J46596_10004349
908 JGI25153J46596_10005814
909 JGI25160J50197_1032416
910 JGI25404J52841_10025660
911 JGI25404J52841_10051459
912 Ga0055531_10003960
913 Ga0055531_10029887
914 Ga0065165_1003494
915 Ga0065165_1007016
916 Ga0065165_1065086
917 Ga0070658_10082513
918 Ga0070658_10407225
919 Ga0070676_10095103
920 Ga0070683_100127384
921 Ga0070683_100422032
922 Ga0070670_100120311
923 Ga0070670_100598217
924 Ga0068869_100139045
925 Ga0070666_10238391
926 Ga0070666_10282136
927 Ga0070680_100003569
928 Ga0070682_100252610
929 Ga0070682_100296957
930 Ga0068868_100086867
931 Ga0068868_100141722
932 Ga0070660_100031186
933 Ga0070660_100293594
934 Ga0070660_100316266
935 Ga0070691_10399959
936 Ga0070661_100186613
937 Ga0070668_100032483
938 Ga0070668_100092260
939 Ga0070668_100140101
940 Ga0070668_100391745
941 Ga0070669_100412207
942 Ga0070675_100459675
943 Ga0070671_100102510
944 Ga0070671_100129931
945 Ga0070671_100184228
946 Ga0070671_100433928
947 Ga0070674_100130916
948 Ga0070673_100175043
949 Ga0070673_100256944
950 Ga0070673_100504327
951 Ga0070688_100193975
952 Ga0070659_100010642
953 Ga0070709_10001461
954 Ga0070709_10015475
955 Ga0070714_100003988
956 Ga0070713_100030094
957 Ga0070713_100243402
958 Ga0070713_100649099
959 Ga0070710_10001981
960 Ga0070710_10003702
961 Ga0070711_100010613
962 Ga0070711_100081392
963 Ga0070711_100118709
964 Ga0070705_100567719
965 Ga0070700_100062693
966 Ga0070694_100467408
967 Ga0070708_100362225
968 Ga0070663_100064678
969 Ga0070663_100079293
970 Ga0070663_100106956
971 Ga0070663_100224068
972 Ga0070663_100388909
973 Ga0070663_100594582
974 Ga0070663_100619601
975 Ga0070663_100797524
976 Ga0070678_100012349
977 Ga0070678_100068020
978 Ga0070678_100509905
979 Ga0070681_10113549
980 Ga0070681_10184264
981 Ga0068867_100068863
982 Ga0070707_100369792
983 Ga0070698_100261297
984 Ga0070679_100034955
985 Ga0070679_100084582
986 Ga0070679_100293405
987 Ga0070684_100051368
988 Ga0070684_100070850
989 Ga0068853_100041579
990 Ga0068853_100072893
991 Ga0068853_100109526
992 Ga0068853_100349597
993 Ga0070672_100174168
994 Ga0070672_100301190
995 Ga0070686_100253377
996 Ga0070665_100009458
997 Ga0070665_100100642
998 Ga0070665_100399798
999 Ga0070665_100451920
1000 Ga0070665_100704727
1001 Ga0068855_100029909
1002 Ga0068855_100118868
1003 Ga0068855_100288082
1004 Ga0068855_100308447
1005 Ga0068855_100458562
1006 Ga0068855_100943077
1007 Ga0070664_100244429
1008 Ga0068857_100005639
1009 Ga0068857_100394545
1010 Ga0068854_100005923
1011 Ga0068854_100149892
1012 Ga0068854_100597915
1013 Ga0068856_100000476
1014 Ga0068856_100092183
1015 Ga0068856_100381559
1016 Ga0068856_100607395
1017 Ga0070702_100186556
1018 Ga0068852_100077797
1019 Ga0068852_100380603
1020 Ga0068852_100619751
1021 Ga0068864_100029756
1022 Ga0068864_100276046
1023 Ga0068866_10088113
1024 Ga0068861_100093200
1025 Ga0068851_10347981
1026 Ga0068870_10097503
1027 Ga0068863_100200484
1028 Ga0068858_100023298
1029 Ga0068858_100110037
1030 Ga0068858_100603620
1031 Ga0068860_100001770
1032 Ga0068860_100140320
1033 Ga0068860_100516006
1034 Ga0068860_101098385
1035 Ga0068862_100098476
1036 Ga0068862_100160010
1037 Ga0068862_100164094
1038 Ga0068862_100232113
1039 Ga0068862_100278070
1040 Ga0068862_100637346
1041 Ga0081455_10014597
1042 Ga0081455_10033284
1043 Ga0081455_10051238
1044 Ga0081455_10120077
1045 Ga0081455_10130380
1046 Ga0081538_10016330
1047 Ga0081540_1004386
1048 Ga0081540_1007475
1049 Ga0081540_1011549
1050 Ga0081540_1013418
1051 Ga0081540_1013507
1052 Ga0081540_1015666
1053 Ga0081540_1017174
1054 Ga0081540_1036369
1055 Ga0081540_1052189
1056 Ga0081540_1056212
1057 Ga0081540_1058445
1058 Ga0081540_1094126
1059 Ga0081539_10001098
1060 Ga0081539_10079861
1061 Ga0070717_10034975
1062 Ga0070717_10203597
1063 Ga0075365_10003272
1064 Ga0075365_10232541
1065 Ga0075368_10006510
1066 Ga0075363_100054901
1067 Ga0075364_10072638
1068 Ga0070716_100009999
1069 Ga0070712_100024550
1070 Ga0070712_100269266
1071 Ga0070712_100436779
1072 Ga0075362_10012679
1073 Ga0075362_10121718
1074 Ga0075367_10010515
1075 Ga0075367_10088683
1076 Ga0075367_10108320
1077 Ga0075369_10009109
1078 Ga0075366_10087035
1079 Ga0075366_10180928
1080 Ga0075366_10212494
1081 Ga0075366_10212859
1082 Ga0068871_100112074
1083 Ga0068871_100831334
1084 Ga0068865_100096253
1085 Ga0068865_100472432
1086 Ga0075436_100578975
1087 Ga0099825_1042615
1088 Ga0099824_1007622
1089 Ga0099822_1015729
1090 Ga0099794_10004947
1091 Ga0099794_10022777
1092 Ga0099794_10081363
1093 Ga0099795_10013919
1094 Ga0105250_10191747
1095 Ga0105240_10013609
1096 Ga0105240_10031535
1097 Ga0105240_10090662
1098 Ga0105240_10108028
1099 Ga0105240_10600705
1100 Ga0111539_10397647
1101 Ga0105245_10040715
1102 Ga0105245_10463887
1103 Ga0105245_10834828
1104 Ga0105247_10114731
1105 Ga0105247_10148289
1106 Ga0105247_10262135
1107 Ga0114129_10801653
1108 Ga0105243_10106308
1109 Ga0105243_10202939
1110 Ga0105241_10054204
1111 Ga0105241_10071900
1112 Ga0105241_10077006
1113 Ga0105241_10747508
1114 Ga0105248_10048180
1115 Ga0105248_10120916
1116 Ga0105248_10493399
1117 Ga0105237_10009561
1118 Ga0105237_10045175
1119 Ga0105237_10189124
1120 Ga0105237_10251930
1121 Ga0105237_10613429
1122 Ga0105238_10053356
1123 Ga0105238_10254351
1124 Ga0105238_10527923
1125 Ga0105249_10231961
1126 Ga0099796_10020218
1127 Ga0105239_10066209
1128 Ga0105239_10144144
1129 Ga0105239_10148690
1130 Ga0105239_10205541
1131 Ga0105239_10337480
1132 Ga0105239_10477787
1133 Ga0105239_11047808
1134 Ga0105246_10103983
1135 Ga0105246_10370529
1136 Ga0105246_10377772
1137 Ga0157323_1004452
1138 Ga0157373_10122080
1139 Ga0157369_10012327
1140 Ga0157369_10013199
1141 Ga0157369_10015220
1142 Ga0157369_10355917
1143 Ga0157374_10128740
1144 Ga0157374_10140980
1145 Ga0157374_10981688
1146 Ga0157378_10006449
1147 Ga0157378_10041522
1148 Ga0163162_10714376
1149 Ga0157375_11100746
1150 Ga0163163_10084289
1151 Ga0163163_10154954
1152 Ga0163163_10206100
1153 Ga0157380_10032421
1154 Ga0157380_10666245
1155 Ga0157377_10064689
1156 Ga0157379_10104071
1157 Ga0157379_10108612
1158 Ga0157379_10190503
1159 Ga0157379_10366539
1160 Ga0157376_10089222
1161 Ga0157376_10676497
1162 Ga0163161_10325429
1163 Ga0206356_10405422
1164 Ga0213872_10050668
1165 Ga0213874_10018204
1166 Ga0213876_10080544
1167 Ga0213876_10102933
1168 Ga0213871_10044400
1169 Ga0224712_10026881
1170 Ga0207425_1013272
1171 Ga0209148_1000490
1172 Ga0209233_1017284
1173 Ga0209673_1062659
1174 Ga0209564_1008738
1175 Ga0209564_1039296
1176 Ga0209758_1000106
1177 Ga0209758_1000982
1178 Ga0209758_1002038
1179 Ga0209758_1009331
1180 Ga0209256_1007012
1181 Ga0207426_1000337
1182 Ga0207426_1001470
1183 Ga0207426_1002910
1184 Ga0207426_1044935
1185 Ga0209257_1001773
1186 Ga0209257_1023168
1187 Ga0209257_1049368
1188 Ga0207697_10044407
1189 Ga0207692_10002972
1190 Ga0207710_10092206
1191 Ga0207688_10056628
1192 Ga0207680_10030088
1193 Ga0207647_10063607
1194 Ga0207699_10004093
1195 Ga0207699_10074221
1196 Ga0207645_10018982
1197 Ga0207643_10055691
1198 Ga0207705_10084256
1199 Ga0207654_10020869
1200 Ga0207654_10075551
1201 Ga0207707_10005294
1202 Ga0207707_10077652
1203 Ga0207707_10285682
1204 Ga0207695_10001591
1205 Ga0207695_10109892
1206 Ga0207695_10380381
1207 Ga0207671_10018136
1208 Ga0207671_10099329
1209 Ga0207671_10236335
1210 Ga0207693_10009468
1211 Ga0207693_10684508
1212 Ga0207663_10106019
1213 Ga0207663_10206449
1214 Ga0207657_10014966
1215 Ga0207657_10024893
1216 Ga0207657_10117215
1217 Ga0207657_10456624
1218 Ga0207649_10555890
1219 Ga0207652_10019018
1220 Ga0207652_10028789
1221 Ga0207652_10033490
1222 Ga0207646_10808892
1223 Ga0207694_10031537
1224 Ga0207694_10276821
1225 Ga0207650_10076048
1226 Ga0207659_10175828
1227 Ga0207687_10039925
1228 Ga0207687_10571731
1229 Ga0207700_10035247
1230 Ga0207700_10230012
1231 Ga0207700_10239127
1232 Ga0207664_10010392
1233 Ga0207664_10125743
1234 Ga0207644_10147971
1235 Ga0207644_10193652
1236 Ga0207644_10193969
1237 Ga0207690_10379853
1238 Ga0207706_10099050
1239 Ga0207686_10221721
1240 Ga0207709_10005661
1241 Ga0207709_10066991
1242 Ga0207709_10557923
1243 Ga0207669_10248524
1244 Ga0207704_10385233
1245 Ga0207665_10006342
1246 Ga0207691_10208211
1247 Ga0207691_10229896
1248 Ga0207711_10097604
1249 Ga0207689_10027871
1250 Ga0207661_10006444
1251 Ga0207661_10138634
1252 Ga0207661_10653437
1253 Ga0207661_10923442
1254 Ga0207667_10040191
1255 Ga0207667_10045315
1256 Ga0207667_10083361
1257 Ga0207667_10342767
1258 Ga0207667_10506600
1259 Ga0207651_10160015
1260 Ga0207651_10199620
1261 Ga0207651_10226147
1262 Ga0207668_10022999
1263 Ga0207668_10035943
1264 Ga0207668_10069006
1265 Ga0207668_10808274
1266 Ga0207640_10016570
1267 Ga0207640_10605902
1268 Ga0207658_10097025
1269 Ga0207658_10521531
1270 Ga0207677_10161000
1271 Ga0207677_10633026
1272 Ga0207703_10008374
1273 Ga0207703_10095153
1274 Ga0207639_10046725
1275 Ga0207639_10098323
1276 Ga0207639_10208939
1277 Ga0207678_10056592
1278 Ga0207678_10056856
1279 Ga0207678_10231492
1280 Ga0207678_10246400
1281 Ga0207678_10269451
1282 Ga0207708_10118834
1283 Ga0207702_10000514
1284 Ga0207641_10150418
1285 Ga0207641_10588354
1286 Ga0207648_10093945
1287 Ga0207648_10138107
1288 Ga0207676_10069542
1289 Ga0207676_10259015
1290 Ga0207674_10048184
1291 Ga0207683_10093253
1292 Ga0207683_10232802
1293 Ga0207683_10311519
1294 Ga0207698_10037776
1295 Ga0207698_10176284
1296 Ga0207698_10238519
1297 Ga0207698_10292217
1298 Ga0209589_1000005
1299 Ga0209489_100005
1300 Ga0209700_100006
1301 Ga0209588_1015066
1302 Ga0209588_1045243
1303 Ga0209588_1068503
1304 Ga0209813_10005176
1305 Ga0268266_10015609
1306 Ga0268266_10183705
1307 Ga0268265_10125754
1308 Ga0268264_10001255
1309 Ga0268264_10238631
1310 Ga0268264_10406397
1311 Ga0268264_10500485
1312 Ga0268264_10621791
1313 Ga0307517_10018365
1314 Ga0307517_10040971
1315 Ga0307515_10063827
1316 Ga0307515_10385688
1317 Ga0307509_10012663
1318 Ga0307508_10202761
1319 Ga0265314_10032685
1320 Ga0307409_100116087
1321 Ga0307416_100288097
1322 Ga0307416_100825189
1323 Ga0307416_101253008
1324 Ga0307510_10005379
1325 Ga0307510_10070953
1326 Ga0315911_1000015
1327 Ga0373926_0176379
1328 Ga0373934_0032194
1329 Ga0373940_0125071
1330 Ga0373945_0007763
1331 Ga0373960_0066202
1332 Ga0373943_0024206
1333 Ga0373931_0166692
1334 Ga0373935_0012074
1335 Ga0373933_0000784
1336 Ga0373947_0027815
1337 Ga0373937_0484636
1338 Ga0373937_1028359
1339 Ga0373925_0184913
1340 Ga0395900_0040217
1341 Ga0395900_0214845
1342 Ga0395898_0027756
1343 Ga0395898_0172849
1344 Ga0395898_0227523
1345 Ga0395898_0452748
1346 Ga0436364_0453785
1347 Ga0395901_0101333
1348 Ga0395901_0118389
1349 Ga0436365_0080880
1350 Ga0436365_0483374
1351 Ga0436365_1608200
1352 Ga0436361_0519449
1353 Ga0436363_0039534
1354 Ga0436363_0676204
1355 Ga0466966_0088509
1356 Ga0466966_0211545
1357 Ga0466966_0347891
1358 Ga0466963_0305976
1359 Ga0466964_0142914
1360 Ga0466968_0015516
1361 Ga0466960_0054384
1362 Ga0451576_0641139
1363 Ga0466967_0540431
1364 Ga0495617_079324
1365 Ga0495592_0102410
1366 Ga0495603_0005606
1367 Ga0495603_0010247
1368 Ga0495603_0055811
1369 Ga0495603_0149023
1370 Ga0495603_0204365
1371 Ga0495590_0107571
1372 Ga0495629_0009598
1373 Ga0495629_0346224
1374 Ga0495641_0170696
1375 Ga0495641_0268102
1376 Ga0495651_0123963
1377 Ga0495651_0322442
1378 Ga0495582_0020250
1379 Ga0495582_0219434
1380 Ga0495582_0297075
1381 Ga0495639_0066807
1382 Ga0495662_0004658
1383 Ga0495662_0183377
1384 Ga0495664_0177223
1385 Ga0495585_0034608
1386 Ga0495585_0108476
1387 Ga0495594_0060797
1388 Ga0495594_0156921
1389 Ga0495607_0196634
1390 Ga0495606_0004773
1391 Ga0495606_0213743
1392 Ga0495608_0202813
1393 Ga0495616_0092378
1394 Ga0495616_0123265
1395 Ga0495620_0143202
1396 Ga0495628_0108953
1397 Ga0495630_0069715
1398 Ga0495631_0045462
1399 Ga0495631_0079831
1400 Ga0495632_0077838
1401 Ga0495632_0083840
1402 Ga0495643_0076237
1403 Ga0495643_0090398
1404 Ga0495644_0029237
1405 Ga0495648_0012715
1406 Ga0495640_0008536
1407 Ga0495640_0045764
1408 Ga0495586_0337334
1409 Ga0495587_0222836
1410 Ga0495598_0006463
1411 Ga0495609_0090881
1412 Ga0495621_0177226
1413 Ga0495645_0063960
1414 Ga0495622_0009391
1415 Ga0495622_0115358
1416 Ga0495667_0205130
1417 Ga0495656_0001017
1418 Ga0495656_0042601
1419 Ga0495656_0181871
1420 Ga0495668_0020784
1421 Ga0495668_0118463
1422 Ga0495668_0135654
1423 Ga0495634_0005863
1424 Ga0495634_0033851
1425 Ga0495625_0284578
1426 Ga0495635_0083826
1427 Ga0495635_0190829
1428 Ga0495659_0004477
1429 Ga0495661_0144798
1430 Ga0495599_0032531
1431 Ga0495599_0272077
1432 Ga0495623_0005568
1433 Ga0495623_0193353
1434 Ga0495646_0033218
1435 Ga0495646_0055639
1436 Ga0495658_0024656
1437 Ga0495624_0378068
1438 Ga0495670_0247418
1439 Ga0495671_0027621
1440 Ga0495671_0095673
1441 Ga0495649_0011028
1442 Ga0495600_0004662
1443 Ga0495581_0024821
1444 Ga0495604_0007789
1445 Ga0495674_0076379
1446 Ga0495674_0129887
1447 Ga0495674_0266934
1448 Ga0495672_0042009
1449 Ga0495672_0044096
1450 Ga0495672_0048703
1451 Ga0495676_0176848
1452 Ga0495680_0018507
1453 Ga0495683_0242935
1454 Ga0495685_144050
1455 Ga0495686_0057913
1456 Ga0495686_0338684
1457 Ga0495593_0054666
1458 Ga0495593_0094722
1459 Ga0495602_0013480
1460 Ga0495615_0006391
1461 Ga0496100_0326312
1462 Ga0496101_0015190
1463 Ga0496101_0380760
1464 Ga0496101_0463074
1465 Ga0496101_0688206
1466 Ga0496102_0142956
1467 Ga0496102_0597965
1468 Ga0496102_0617543
1469 Ga0496102_0697006
1470 Ga0496103_0082393
1471 Ga0496103_0097719
1472 Ga0496103_0277552
1473 Ga0496104_0099517
1474 Ga0496104_0427426
1475 Ga0496105_0074450
1476 Ga0496106_0006199
1477 Ga0496106_0148327
1478 Ga0496107_0004141
1479 Ga0496107_0285843
1480 Ga0496108_0088016
1481 Ga0496108_0157680
1482 Ga0496108_0286078
1483 Ga0496109_0018992
1484 Ga0496110_0484656
1485 Ga0496111_0060731
1486 Ga0496112_0125784
1487 Ga0496112_0128805
1488 Ga0496112_0432838
1489 Ga0496112_0477770
1490 Ga0496112_0626655
1491 Ga0496113_0097561
1492 Ga0496113_0162445
1493 Ga0496114_0008218
1494 Ga0496114_0073946
1495 Ga0496114_0629159
1496 Ga0496115_0007450
1497 Ga0496115_0118718
1498 Ga0496115_0144101
1499 Ga0496116_0043620
1500 Ga0496117_0105920
1501 Ga0496120_0227781
1502 Ga0496121_0002453
1503 Ga0496121_0015239
1504 Ga0496121_0088673
1505 Ga0496121_0245349
1506 Ga0496124_0076055
1507 Ga0496124_0136294
1508 Ga0496125_0099959
1509 Ga0496125_0168792
1510 Ga0496125_0358356
1511 Ga0496126_0035606
1512 Ga0496126_0039611
1513 Ga0496126_0116982
1514 Ga0496126_0158966
1515 Ga0496126_0311458
1516 Ga0496126_0363042
1517 Ga0495682_0027239
1518 Ga0495682_0076642
1519 Ga0495682_0160331
1520 Ga0501031_0246999
1521 Ga0501033_0040316
1522 Ga0501033_0116964
1523 Ga0501034_0412197
1524 Ga0501043_0164530
1525 Ga0501046_0375119
1526 Ga0501048_0138630
1527 Ga0501067_0165113
1528 Ga0501067_0254403
1529 Ga0501069_0072211
1530 Ga0501070_0160555
1531 Ga0501073_0465964
1532 Ga0501080_0468825
1533 Ga0501081_0727882
1534 Ga0501035_0160202
1535 Ga0501035_0355305
1536 Ga0501035_0400275
1537 Ga0501044_0100815
1538 Ga0501044_0328140
1539 Ga0501044_0565809
1540 Ga0501044_0583154
1541 Ga0501044_0742892
1542 Ga0501045_0352343
1543 nmdc:mga03683_29434_c1
1544 nmdc:mga03n38_225047_c1
1545 nmdc:mga03n38_72587_c1
1546 nmdc:mga0yw44_158087_c1
1547 nmdc:mga0yw44_350393_c1
1548 nmdc:mga0yw44_3757_c1
1549 nmdc:mga0k408_124045_c1
1550 nmdc:mga0k408_308482_c1
1551 nmdc:mga0k408_68165_c1
1552 nmdc:mga06z11_119353_c1
1553 nmdc:mga06z11_6110_c1
1554 nmdc:mga06z11_93783_c1
1555 nmdc:mga04h51_50233_c1
1556 nmdc:mga07m45_16674_c1
1557 nmdc:mga07m45_217124_c1
1558 nmdc:mga07m45_48871_c1
1559 nmdc:mga07m45_74519_c1
1560 nmdc:mga08x19_536538_c1
1561 nmdc:mga0sz30_122076_c1
1562 nmdc:mga0sz30_41707_c1
1563 Ga0495601_0206882
1564 Ga0495601_0296065
1565 Ga0500635_0006942
1566 Ga0495595_0019861
1567 Ga0495619_0081520
1568 Ga0495619_0170097
1569 Ga0500643_000052
1570 Ga0500646_0029624
1571 Ga0500647_0029909
1572 Ga0500647_0047687
1573 Ga0500566_0000207
1574 Ga0500566_0268709
1575 Ga0500640_003553
1576 Ga0500641_0011096
1577 Ga0500641_0026372
1578 Ga0500554_005579
1579 Ga0500556_0018657
1580 Ga0500557_000148
1581 Ga0500572_000676
1582 Ga0500595_011382
1583 Ga0500595_012032
1584 Ga0500595_041317
1585 Ga0500608_105728
1586 Ga0500614_000572
1587 Ga0500559_0003255
1588 Ga0500568_0024114
1589 Ga0500603_000313
1590 Ga0500603_000691
1591 Ga0500630_001066
1592 Ga0500638_002777
1593 Ga0500638_058702
1594 Ga0500639_000072
1595 Ga0500637_0182180
1596 Ga0500625_030006
1597 Ga0500596_002009
1598 Ga0500661_021550
1599 2507504398
1600 2508545830
1601 2508694659
1602 2511396436
1603 2513624211
1604 2513638703
1605 2513649899
1606 2513656195
1607 2513679747
1608 2513694658
1609 2513702590
1610 2513860702
1611 2513892475
1612 2513917625
1613 2514010035
1614 2515624419
1615 2517108166
1616 2517887715
1617 2524442740
1618 2524466632
1619 2524535382
1620 2528850468
1621 2617353825
1622 2617374417
1623 2644290258
1624 2671120773
1625 2723842476
1626 2728748283
1627 2745074547
1628 2793059330
1629 2793070452
1630 2793078671
1631 2805922089
1632 2818240899
1633 2824604663
1634 2824618873
1635 2824713834
1636 2824759702
1637 2824769917
1638 2838126059
1639 2841942548
1640 2841953102
1641 2841960605
1642 2841970873
1643 2841977867
1644 2841984568
1645 2842041710
1646 2842049752
1647 2844321403
1648 2847932003
1649 2847943244
1650 2849076973
1651 2857514755
1652 2874595647
1653 2874606837
1654 2874620356
1655 2874621846
1656 2874630234
1657 2874651719
1658 2876766447
1659 2876775842
1660 2876821615
1661 2879079933
1662 2879085682
1663 2879104524
1664 2879112264
1665 2879134018
1666 2879148503
1667 2881370410
1668 2881666461
1669 2885374415
1670 2885382556
1671 2885392196
1672 2885411556
1673 2888387710
1674 2888391462
1675 2888426920
1676 2889034252
1677 2903734584
1678 2903753461
1679 2903773492
1680 2904669561
1681 2904691846
1682 2904709565
1683 2904713628
1684 2906608017
1685 2906612725
1686 2906629408
1687 2906640557
1688 2906663219
1689 2908745921
1690 2908763950
1691 2908776897
1692 2922367638
1693 2922376697
1694 2922391613
1695 2922393290
1696 2922433206
1697 2929202060
1698 2929619762
1699 2929629073
1700 2932789752
1701 2932817735
1702 2932827153
1703 2932837680
1704 2933581681
1705 2935613188
1706 2935624549
1707 2935630597
1708 2935647224
1709 2935655639
1710 2935664457
1711 2935674313
1712 2935684797
1713 2935694225
1714 2935697676
1715 2935711302
1716 2935720010
1717 2935732121
1718 2935741510
1719 2935750882
1720 2935757876
1721 2935764253
1722 2935775126
1723 2935780029
1724 2935790150
1725 2935798808
1726 2935809912
1727 2935819307
1728 2935824958
1729 2935836648
1730 2935846407
1731 2935852178
1732 2935863241
1733 2935868710
1734 2935879484
1735 2935925441
1736 2935933945
1737 2935942464
1738 2935950923
1739 2935959384
1740 2935965391
1741 2935975451
1742 2935980121
1743 2935984285
1744 2936000278
1745 2936010320
1746 2936018589
1747 2936027107
1748 2936035926
1749 2936045930
1750 2936054005
1751 2940563302
1752 2941507249
1753 2941515676
1754 2941523616
1755 2941531974
1756 2941546835
1757 3005482802
1758 3005485742
1759 3005506602
1760 3005588735
1761 3005601759
1762 3005717498
1763 3005724435
1764 8006935107
1765 8006965365
1766 8006975075
1767 8006986077
1768 8006999249
1769 8016519134
1770 8016525178
1771 8016538756
1772 8016550249
1773 8016558658
1774 8016568448
1775 8016581100
1776 8016587613
1777 8016596636
1778 8016607507
1779 8016630289
1780 8016636858
1781 8017066365
1782 8019538425
1783 8019541395
1784 8019549229
1785 8019563598
1786 8019573667
1787 8019578250
1788 8019596287
1789 8019605411
1790 8019613129
1791 8019623820
1792 8019638222
1793 8019641417
1794 8019651620
1795 8019666137
1796 8019675649
1797 8019680451
1798 8019695363
1799 8055750485
1800 8055911056
1801 8056678968
1802 8056685534
1803 8056692831
1804 8056971779

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

55

117

0.97

PF07729

FCD

FCD domain

127

253

0.97

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

61

128

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kvr-assembly1.cif.gz_A-2 x-ray crystal structure of a fragment (1-75) of a transcriptional regulator pdhr from escherichia coli cft073 0.9025 8 72
7b5y-assembly1.cif.gz_D s. agalactiae busr in complex with its busab-promotor dna 0.8888 7 74
5d4r-assembly1.cif.gz_A crystal structure of arar(dbd) in complex with operator ore1 0.8804 11 72
7u5q-assembly2.cif.gz_B crystal structure of transcriptional regulator, gntr family, from brucella melitensis 0.8795 11 220
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8761 34 74
ID Description Score Start End Superfamily
af_Q79G00_16_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 11 72 1.10.10.10
4p9fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9598 8 74 1.10.10.10
4p9fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9461 8 74 1.10.10.10
3sxyB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 13 74 1.10.10.10
af_Q2G208_13_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9314 8 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2E7QDL2-F1-model_v4 GntR family transcriptional regulator 0.9404 11 215 GO:0003677
GO:0003700
AF-A0A7Z0MFT2-F1-model_v4 GntR family transcriptional regulator 0.9348 11 223 GO:0003677
GO:0003700
AF-A0A3B8P5K0-F1-model_v4 GntR family transcriptional regulator 0.9341 94 222 GO:0003677
AF-A0A7Y3LGB1-F1-model_v4 GntR family transcriptional regulator 0.9292 8 215 GO:0003677
GO:0003700
AF-A0A6B2SER2-F1-model_v4 GntR family transcriptional regulator 0.9273 9 86 GO:0003677
GO:0003700

Map