F485186

General Info

Members Datasets Scaffolds Average Seq Length
901 440 1784 253

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0000244|Ga0495637_0000244_16937_17773
Length 278
Sequence MVVVYLSFRKFMPCFLPFSATGILFMQLTDNTILITGGASGIGRGLAEAFHKLGNKVIIAGRRKALLDEVITANPGMEGIELDINDPASIQEVASTLISRYPSLNVLVNNAGIMPFDDAAGHIDDATMIGTITTNFMGPIRLTSALIEHLKSQPRSVIINNTSVLAFVPLACNAVYSATKAALHSYSLSQRFTLLGTSVRVQEIAPPWVNTDLIHKGDDPRAMPLDAFIEQTMVGLATDVPEVVVDAIRPLRDNPGSQEHALIHGFNQSVVENPIPVG

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
162 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
301 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
302 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
303 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
304 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
305 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
306 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
307 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
308 2519103095 Burkholderia sp. KJ006 Isolate Nodule
309 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
310 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
311 2547132181 Kosakonia sacchari SP1 Isolate Stem
312 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
313 2561511199 Enterobacter sp. R4-368 Isolate Nodule
314 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
315 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
316 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
317 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
318 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
319 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
320 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
321 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
322 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
323 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
324 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
325 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
326 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
327 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
328 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
329 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
330 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
331 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
332 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
333 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
334 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
335 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
336 2643221556 Massilia sp. Root1485 Isolate Unclassified
337 2643221569 Achromobacter sp. Root565 Isolate Unclassified
338 2643221594 Achromobacter sp. Root170 Isolate Unclassified
339 2643221684 Massilia sp. Root133 Isolate Unclassified
340 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
341 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
342 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
343 2738541293 Rhizobium sp. GV031 Isolate Unclassified
344 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
345 2738541297 Duganella sp. GV083 Isolate Unclassified
346 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
347 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
348 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
349 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
350 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
351 2738541357 Duganella sp. GV053 Isolate Unclassified
352 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
353 2738543003 Duganella sp. GV066 Isolate Unclassified
354 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
355 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
356 2738543026 Duganella sp. GV089 Isolate Unclassified
357 2738543029 Duganella sp. GV039 Isolate Unclassified
358 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
359 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
360 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
361 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
362 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
363 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
364 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
365 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
366 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
367 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
368 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
369 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
370 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
371 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
372 2818991452 Burkholderia cepacia 561 Isolate Unclassified
373 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
374 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
375 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
376 2821131069 Duganella sp. 1224 Isolate Unclassified
377 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
378 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
379 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
380 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
381 2855730933 Achromobacter sp. HZ28 Isolate Nodule
382 2855767633 Achromobacter sp. HZ34 Isolate Nodule
383 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
384 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
385 2857564685 Duganella sp. R-74599 Isolate Unclassified
386 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
387 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
388 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
389 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
390 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
391 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
392 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
393 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
394 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
395 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
396 2904564687 Burkholderia sp. 571 Isolate Unclassified
397 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
398 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
399 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
400 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
401 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
402 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
403 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
404 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
405 2919150387 Rahnella aceris 1817 Isolate Unclassified
406 2919404418 Luteibacter sp. 3190 Isolate Unclassified
407 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
408 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
409 2927143783 Rahnella sp. 2050 Isolate Unclassified
410 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
411 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
412 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
413 2928536128 Burkholderia sola 565 Isolate Unclassified
414 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
415 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
416 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
417 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
418 2941479691
419 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
420 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
421 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
422 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
423 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
424 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
425 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
426 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
427 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
428 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
429 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
430 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
431 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
432 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
433 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
434 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
435 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
436 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
437 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
438 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
439 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
440 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.35
Metatranscriptomes 0
Isolates 16.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 7.55
Nodule 2.44
Rhizoplane 3.66
Rhizosphere 65.93
Stem 0.11
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0000244 3300046520 Bacteria 42635
2 JGI24736J21556_1001233 3300001904 Bacteria 4694
3 JGI24736J21556_1001981 3300001904 Bacteria 3634
4 JGI24741J21665_1000662 3300001915 Bacteria 10392
5 JGI24740J21852_10000277 3300001979 Bacteria 21763
6 JGI24740J21852_10000508 3300001979 Bacteria 16707
7 JGI24740J21852_10000713 3300001979 Bacteria 14435
8 JGI24739J22299_10009515 3300001989 Bacteria 3621
9 JGI24737J22298_10008204 3300001990 Bacteria 3504
10 JGI24737J22298_10033240 3300001990 Bacteria 1603
11 JGI24735J21928_10000021 3300002067 Bacteria 99198
12 JGI24735J21928_10007696 3300002067 Bacteria 3504
13 JGI24738J21930_10000526 3300002075 Bacteria 10934
14 JGI24738J21930_10000873 3300002075 Bacteria 8637
15 JGI24738J21930_10004414 3300002075 Bacteria 3448
16 JGI25156J39149_1002739 3300002705 Bacteria 6132
17 JGI25154J39366_1000101 3300002738 Bacteria 76597
18 JGI25150J39212_1007501 3300002774 Bacteria 2185
19 JGI25151J46595_10000095 3300003187 Bacteria 118630
20 rootH1_10075527 3300003316 Bacteria 3992
21 rootH2_10062714 3300003320 Bacteria 3198
22 rootH2_10295700 3300003320 Bacteria 4693
23 rootL2_10030614 3300003322 Bacteria 8189
24 rootL2_10266319 3300003322 Bacteria 1855
25 rootL2_10290088 3300003322 Bacteria 1322
26 Ga0055532_1000284 3300003758 Bacteria 32514
27 Ga0055527_1000313 3300003760 Bacteria 26120
28 Ga0055535_1000539 3300003761 Bacteria 32550
29 Ga0055542_1000566 3300003762 Bacteria 32550
30 Ga0055529_1000536 3300003763 Bacteria 32550
31 Ga0055526_1000046 3300003771 Bacteria 120614
32 Ga0055526_1001445 3300003771 Bacteria 16887
33 Ga0055526_1005130 3300003771 Bacteria 7638
34 Ga0055524_1003093 3300003775 Bacteria 8216
35 Ga0055536_1034238 3300003781 Bacteria 1285
36 Ga0055534_1001027 3300003784 Bacteria 12210
37 Ga0055528_1003289 3300003790 Bacteria 8216
38 Ga0055530_10000002 3300003791 Bacteria 300466
39 Ga0055540_1000009 3300003792 Bacteria 300466
40 Ga0055541_1002938 3300003841 Bacteria 3289
41 Ga0058692_1000656 3300003856 Bacteria 14297
42 Ga0058692_1001690 3300003856 Bacteria 7911
43 Ga0058692_1002190 3300003856 Bacteria 6667
44 Ga0058692_1002228 3300003856 Bacteria 6588
45 Ga0058692_1013806 3300003856 Bacteria 1869
46 Ga0065165_1026239 3300005262 Bacteria 1920
47 Ga0065704_10119594 3300005289 Bacteria 1797
48 Ga0070658_10017861 3300005327 Bacteria 5673
49 Ga0070658_10274817 3300005327 Bacteria 1433
50 Ga0070660_100117882 3300005339 Bacteria 2117
51 Ga0070661_100035472 3300005344 Bacteria 3622
52 Ga0070661_100110686 3300005344 Bacteria 2050
53 Ga0070659_100032579 3300005366 Bacteria 4043
54 Ga0070659_100260263 3300005366 Bacteria 1439
55 Ga0070667_100486324 3300005367 Bacteria 1130
56 Ga0070709_10289311 3300005434 Bacteria 1193
57 Ga0070708_100024397 3300005445 Bacteria 5159
58 Ga0070663_100003167 3300005455 Bacteria 9441
59 Ga0070662_100012478 3300005457 Bacteria 5635
60 Ga0070681_10124825 3300005458 Bacteria 2507
61 Ga0070679_100467822 3300005530 Bacteria 1205
62 Ga0068853_100003004 3300005539 Bacteria 12869
63 Ga0070672_100292849 3300005543 Bacteria 1378
64 Ga0068855_100001434 3300005563 Bacteria 29666
65 Ga0068855_100006170 3300005563 Bacteria 14615
66 Ga0068855_100008770 3300005563 Bacteria 12223
67 Ga0068855_100639907 3300005563 Bacteria 1143
68 Ga0070664_100021923 3300005564 Bacteria 5267
69 Ga0070664_100049201 3300005564 Bacteria 3564
70 Ga0068857_100023547 3300005577 Bacteria 5421
71 Ga0068857_100146831 3300005577 Bacteria 2134
72 Ga0068854_100011318 3300005578 Bacteria 5802
73 Ga0068854_100022527 3300005578 Bacteria 4294
74 Ga0068854_100026953 3300005578 Bacteria 3954
75 Ga0068854_100101726 3300005578 Bacteria 2155
76 Ga0068856_100359604 3300005614 Bacteria 1474
77 Ga0068852_100052480 3300005616 Bacteria 3504
78 Ga0068851_10001303 3300005834 Bacteria 10881
79 Ga0068851_10012595 3300005834 Bacteria 3990
80 Ga0081455_10096976 3300005937 Bacteria 2377
81 Ga0075365_10086137 3300006038 Bacteria 2135
82 Ga0070716_100399959 3300006173 Bacteria 987
83 Ga0075362_10027427 3300006177 Bacteria 2439
84 Ga0075369_10018717 3300006186 Bacteria 2822
85 Ga0075366_10054159 3300006195 Bacteria 2383
86 Ga0075370_10282953 3300006353 Bacteria 985
87 Ga0075370_10339046 3300006353 Bacteria 897
88 Ga0075434_100623264 3300006871 Bacteria 1097
89 Ga0079104_1000132 3300006946 Bacteria 106080
90 Ga0079104_1000203 3300006946 Bacteria 83190
91 Ga0079104_1003432 3300006946 Bacteria 7379
92 Ga0105251_10000356 3300009011 Bacteria 45089
93 Ga0105251_10000769 3300009011 Bacteria 29167
94 Ga0105251_10012640 3300009011 Bacteria 4768
95 Ga0105244_10001922 3300009036 Bacteria 16144
96 Ga0105244_10004262 3300009036 Bacteria 9921
97 Ga0105244_10044564 3300009036 Bacteria 2285
98 Ga0105250_10002204 3300009092 Bacteria 9931
99 Ga0105240_10008537 3300009093 Bacteria 14639
100 Ga0105240_10039399 3300009093 Bacteria 6051
101 Ga0105240_10250248 3300009093 Bacteria 2050
102 Ga0105247_10111565 3300009101 Bacteria 1761
103 Ga0105237_10000038 3300009545 Bacteria 190707
104 Ga0105237_10026074 3300009545 Bacteria 5974
105 Ga0105237_10121606 3300009545 Bacteria 2605
106 Ga0105238_10000113 3300009551 Bacteria 89675
107 Ga0105238_10070171 3300009551 Bacteria 3504
108 Ga0105239_10000108 3300010375 Bacteria 116364
109 Ga0105239_10000289 3300010375 Bacteria 74109
110 Ga0105239_10089321 3300010375 Bacteria 3398
111 Ga0105239_10129259 3300010375 Bacteria 2808
112 Ga0157371_10036811 3300013102 Bacteria 3504
113 Ga0157370_10032974 3300013104 Bacteria 5052
114 Ga0157370_10063322 3300013104 Bacteria 3504
115 Ga0157369_10084304 3300013105 Bacteria 3397
116 Ga0157369_10127899 3300013105 Bacteria 2692
117 Ga0157378_10169053 3300013297 Bacteria 2049
118 Ga0157378_10523116 3300013297 Unclassified 1188
119 Ga0157372_10011302 3300013307 Bacteria 9499
120 Ga0157372_10567604 3300013307 Bacteria 1323
121 Ga0182008_10003440 3300014497 Bacteria 9555
122 Ga0182008_10006469 3300014497 Bacteria 6546
123 Ga0182008_10017810 3300014497 Bacteria 3682
124 Ga0182006_1000021 3300015261 Bacteria 280808
125 Ga0182006_1000133 3300015261 Bacteria 80418
126 Ga0182006_1000828 3300015261 Bacteria 20724
127 Ga0182006_1006409 3300015261 Bacteria 5472
128 Ga0182006_1011619 3300015261 Bacteria 3870
129 Ga0182006_1041071 3300015261 Bacteria 1818
130 Ga0182007_10000890 3300015262 Bacteria 16558
131 Ga0182007_10004221 3300015262 Bacteria 6567
132 Ga0182005_1000020 3300015265 Bacteria 278671
133 Ga0182005_1012297 3300015265 Bacteria 2420
134 Ga0182005_1019100 3300015265 Bacteria 1891
135 Ga0213872_10016149 3300021361 Bacteria 3466
136 Ga0209435_100069 3300025206 Bacteria 64808
137 Ga0209566_100201 3300025225 Bacteria 61860
138 Ga0209674_101903 3300025226 Bacteria 4912
139 Ga0209672_100200 3300025228 Bacteria 47502
140 Ga0209147_100265 3300025229 Bacteria 47502
141 Ga0209258_100439 3300025242 Bacteria 47500
142 Ga0207425_1000966 3300025245 Bacteria 13521
143 Ga0209646_1000108 3300025246 Bacteria 158853
144 Ga0209026_1003394 3300025250 Bacteria 5254
145 Ga0209148_1000422 3300025254 Bacteria 47502
146 Ga0209759_1000173 3300025256 Bacteria 107724
147 Ga0209759_1007482 3300025256 Bacteria 3507
148 Ga0209129_1002466 3300025258 Bacteria 9056
149 Ga0209233_1017020 3300025261 Bacteria 1990
150 Ga0209455_1000322 3300025272 Bacteria 47502
151 Ga0209673_1000621 3300025273 Bacteria 54117
152 Ga0209675_1001449 3300025291 Bacteria 13701
153 Ga0209676_1000065 3300025292 Bacteria 318605
154 Ga0209676_1002272 3300025292 Bacteria 14115
155 Ga0209676_1002993 3300025292 Bacteria 10996
156 Ga0209676_1027871 3300025292 Bacteria 1770
157 Ga0209025_1000055 3300025294 Bacteria 316748
158 Ga0209025_1001131 3300025294 Bacteria 38214
159 Ga0209025_1004585 3300025294 Bacteria 11852
160 Ga0209564_1000277 3300025295 Bacteria 105818
161 Ga0209564_1001607 3300025295 Bacteria 21963
162 Ga0209564_1006862 3300025295 Bacteria 6009
163 Ga0209758_1007033 3300025297 Bacteria 7813
164 Ga0209758_1010525 3300025297 Bacteria 5517
165 Ga0209050_1000009 3300025298 Bacteria 1047265
166 Ga0209050_1000402 3300025298 Bacteria 80873
167 Ga0209050_1000638 3300025298 Bacteria 54267
168 Ga0209050_1004144 3300025298 Bacteria 10048
169 Ga0209050_1015329 3300025298 Bacteria 3226
170 Ga0209256_1000176 3300025299 Bacteria 126545
171 Ga0209256_1000565 3300025299 Bacteria 52844
172 Ga0209256_1003140 3300025299 Bacteria 12033
173 Ga0209256_1036857 3300025299 Bacteria 1280
174 Ga0209051_1000008 3300025303 Bacteria 706935
175 Ga0209051_1005572 3300025303 Bacteria 7317
176 Ga0209257_1012568 3300025304 Bacteria 3895
177 Ga0207656_10000147 3300025321 Bacteria 26381
178 Ga0207696_1002130 3300025711 Bacteria 9939
179 Ga0207655_1065809 3300025728 Bacteria 1373
180 Ga0207713_1000173 3300025735 Bacteria 92859
181 Ga0207713_1003281 3300025735 Bacteria 11130
182 Ga0207710_10144539 3300025900 Bacteria 1150
183 Ga0207647_10028441 3300025904 Bacteria 3630
184 Ga0207647_10028600 3300025904 Bacteria 3618
185 Ga0207699_10257948 3300025906 Bacteria 1204
186 Ga0207705_10023962 3300025909 Bacteria 4356
187 Ga0207705_10228503 3300025909 Bacteria 1415
188 Ga0207695_10034752 3300025913 Bacteria 5477
189 Ga0207695_10621604 3300025913 Bacteria 961
190 Ga0207671_10000045 3300025914 Bacteria 201245
191 Ga0207671_10055090 3300025914 Bacteria 2946
192 Ga0207671_10108299 3300025914 Bacteria 2112
193 Ga0207657_10051927 3300025919 Bacteria 3562
194 Ga0207649_10050358 3300025920 Bacteria 2576
195 Ga0207652_10419613 3300025921 Bacteria 1207
196 Ga0207694_10000075 3300025924 Bacteria 114693
197 Ga0207694_10004601 3300025924 Bacteria 10741
198 Ga0207694_10082401 3300025924 Bacteria 2529
199 Ga0207659_10082640 3300025926 Bacteria 2378
200 Ga0207690_10056761 3300025932 Bacteria 2643
201 Ga0207690_10100616 3300025932 Bacteria 2063
202 Ga0207706_10013921 3300025933 Bacteria 7294
203 Ga0207706_10065602 3300025933 Bacteria 3197
204 Ga0207706_10397731 3300025933 Bacteria 1195
205 Ga0207691_10074219 3300025940 Bacteria 3068
206 Ga0207691_10407896 3300025940 Bacteria 1159
207 Ga0207679_10058513 3300025945 Bacteria 2856
208 Ga0207679_10182669 3300025945 Bacteria 1736
209 Ga0207667_10000110 3300025949 Bacteria 131872
210 Ga0207667_10008274 3300025949 Bacteria 12377
211 Ga0207667_10014624 3300025949 Bacteria 8936
212 Ga0207667_10358060 3300025949 Bacteria 1488
213 Ga0207640_10008103 3300025981 Bacteria 5816
214 Ga0207640_10020501 3300025981 Bacteria 3926
215 Ga0207640_10064184 3300025981 Bacteria 2444
216 Ga0207640_10085884 3300025981 Bacteria 2165
217 Ga0207658_10453019 3300025986 Bacteria 1136
218 Ga0207639_10021179 3300026041 Bacteria 4666
219 Ga0207678_10004943 3300026067 Bacteria 11966
220 Ga0207674_10031842 3300026116 Bacteria 5535
221 Ga0207674_10038235 3300026116 Bacteria 4985
222 Ga0207674_10218567 3300026116 Bacteria 1854
223 Ga0207674_10299265 3300026116 Bacteria 1558
224 Ga0207698_10013615 3300026142 Bacteria 5376
225 Ga0209281_1000061 3300027111 Bacteria 293814
226 Ga0209281_1000338 3300027111 Bacteria 79936
227 Ga0209281_1002766 3300027111 Bacteria 6523
228 Ga0209371_1000017 3300027312 Bacteria 625776
229 Ga0209371_1000104 3300027312 Bacteria 148080
230 Ga0209371_1000261 3300027312 Bacteria 62369
231 Ga0209371_1000735 3300027312 Bacteria 27499
232 Ga0209371_1001024 3300027312 Bacteria 21216
233 Ga0209371_1001702 3300027312 Bacteria 13942
234 Ga0209371_1002099 3300027312 Bacteria 11822
235 Ga0209371_1013351 3300027312 Bacteria 2312
236 Ga0209371_1013910 3300027312 Bacteria 2232
237 Ga0265338_10193551 3300028800 Bacteria 1539
238 Ga0268256_1000017 3300030500 Bacteria 600718
239 Ga0268256_1000091 3300030500 Bacteria 148069
240 Ga0268256_1000221 3300030500 Bacteria 62368
241 Ga0268256_1000625 3300030500 Bacteria 27486
242 Ga0268256_1001484 3300030500 Bacteria 13942
243 Ga0268256_1001761 3300030500 Bacteria 12220
244 Ga0268256_1014690 3300030500 Bacteria 2312
245 Ga0268256_1015407 3300030500 Bacteria 2232
246 Ga0268256_1025257 3300030500 Bacteria 1512
247 Ga0316181_1099275 3300030744 Bacteria 3002
248 Ga0265320_10004108 3300031240 Archaea 9566
249 Ga0265316_10016742 3300031344 Bacteria 6351
250 Ga0307408_100000496 3300031548 Bacteria 34230
251 Ga0265314_10089573 3300031711 Bacteria 2006
252 Ga0307405_10000146 3300031731 Bacteria 27243
253 Ga0307405_10007923 3300031731 Bacteria 5354
254 Ga0307405_10147446 3300031731 Bacteria 1650
255 Ga0307410_10039396 3300031852 Bacteria 3102
256 Ga0307406_10000533 3300031901 Bacteria 21888
257 Ga0307406_10016152 3300031901 Bacteria 4333
258 Ga0307407_10076195 3300031903 Bacteria 2013
259 Ga0307412_10000021 3300031911 Bacteria 250629
260 Ga0307412_10000293 3300031911 Bacteria 31670
261 Ga0307412_10000588 3300031911 Bacteria 21547
262 Ga0307412_10001067 3300031911 Bacteria 15677
263 Ga0307412_10002729 3300031911 Bacteria 9816
264 Ga0307412_10003827 3300031911 Bacteria 8369
265 Ga0307412_10016080 3300031911 Bacteria 4448
266 Ga0307412_10051061 3300031911 Bacteria 2731
267 Ga0307409_100010476 3300031995 Bacteria 5769
268 Ga0307416_100027556 3300032002 Bacteria 4210
269 Ga0307414_10048401 3300032004 Bacteria 2932
270 Ga0307411_10015914 3300032005 Bacteria 4241
271 Ga0307411_10195735 3300032005 Bacteria 1547
272 Ga0307510_10341578 3300033180 Bacteria 949
273 Ga0373954_0033662 3300035118 Bacteria 2371
274 Ga0373927_0017128 3300035695 Bacteria 4774
275 Ga0395899_0009592 3300037312 Bacteria 7430
276 Ga0395899_0172005 3300037312 Bacteria 1525
277 Ga0395899_0225791 3300037312 Bacteria 1295
278 Ga0395899_0236053 3300037312 Bacteria 1260
279 Ga0395900_0003038 3300037418 Bacteria 18275
280 Ga0395900_0020385 3300037418 Bacteria 6767
281 Ga0395900_0111243 3300037418 Bacteria 2813
282 Ga0395900_0154581 3300037418 Bacteria 2343
283 Ga0395900_0216071 3300037418 Bacteria 1934
284 Ga0395900_0299259 3300037418 Bacteria 1595
285 Ga0395900_0529340 3300037418 Bacteria 1125
286 Ga0395898_0020964 3300037466 Bacteria 6631
287 Ga0395898_0039617 3300037466 Bacteria 4663
288 Ga0395898_0187136 3300037466 Bacteria 1978
289 Ga0395898_0212647 3300037466 Bacteria 1844
290 Ga0395898_0395158 3300037466 Bacteria 1318
291 Ga0395905_0024058 3300037471 Bacteria 5748
292 Ga0395905_0125591 3300037471 Bacteria 2412
293 Ga0395901_0002761 3300038443 Bacteria 17695
294 Ga0395901_0017776 3300038443 Bacteria 7258
295 Ga0395901_0300410 3300038443 Bacteria 1664
296 Ga0395901_0308878 3300038443 Bacteria 1638
297 Ga0395901_0398512 3300038443 Bacteria 1414
298 Ga0436361_0982462 3300039447 Bacteria 3746
299 Ga0436362_0607000 3300039453 Bacteria 1026
300 Ga0439436_0000004 3300041404 Bacteria 175137
301 Ga0439465_0005025 3300041413 Bacteria 4249
302 Ga0451841_1227815 3300041498 Bacteria 1709
303 Ga0451845_0676067 3300041501 Bacteria 6832
304 Ga0451845_0757030 3300041501 Bacteria 1569
305 Ga0451849_0647590 3300041505 Bacteria 1260
306 Ga0451849_0783247 3300041505 Bacteria 2077
307 Ga0451851_0083621 3300041507 Bacteria 3922
308 Ga0451853_0372391 3300041512 Bacteria 4474
309 Ga0451853_1588158 3300041512 Bacteria 16227
310 Ga0439448_0058928 3300042005 Bacteria 1267
311 Ga0439432_000046 3300042006 Bacteria 37489
312 Ga0439452_002719 3300042010 Bacteria 6412
313 Ga0439463_000428 3300042016 Bacteria 11730
314 Ga0439463_001729 3300042016 Bacteria 5696
315 Ga0439458_0014536 3300042157 Bacteria 1777
316 Ga0439460_0004486 3300042461 Bacteria 3403
317 Ga0451577_0003066 3300042876 Bacteria 18912
318 Ga0453683_0032497 3300044673 Bacteria 3293
319 Ga0466965_0044765 3300044683 Bacteria 2188
320 Ga0466966_0005946 3300044684 Bacteria 8051
321 Ga0466966_0076288 3300044684 Bacteria 2093
322 Ga0466961_0034846 3300044693 Bacteria 3232
323 Ga0466961_0098739 3300044693 Bacteria 1841
324 Ga0453684_0109875 3300044712 Bacteria 3352
325 Ga0453684_0325207 3300044712 Bacteria 1740
326 Ga0466968_0000252 3300044735 Bacteria 16931
327 Ga0466968_0001162 3300044735 Bacteria 9333
328 Ga0466968_0001355 3300044735 Bacteria 8750
329 Ga0466957_0004847 3300044842 Bacteria 7527
330 Ga0466957_0020666 3300044842 Bacteria 3875
331 Ga0466957_0194640 3300044842 Bacteria 1329
332 Ga0466957_0334546 3300044842 Bacteria 1024
333 Ga0466957_0388405 3300044842 Bacteria 953
334 Ga0466960_0007900 3300044901 Bacteria 4341
335 Ga0466959_0009671 3300045049 Bacteria 6863
336 Ga0451576_0015427 3300045051 Bacteria 8464
337 Ga0451576_0326133 3300045051 Bacteria 1607
338 Ga0466958_0024632 3300045836 Bacteria 3541
339 Ga0466958_0209648 3300045836 Bacteria 1241
340 Ga0466967_0039746 3300045976 Bacteria 4046
341 Ga0495617_001589 3300046452 Bacteria 9814
342 Ga0495617_017344 3300046452 Bacteria 2432
343 Ga0495627_005467 3300046453 Bacteria 5117
344 Ga0495627_020344 3300046453 Bacteria 2213
345 Ga0495592_0008506 3300046454 Bacteria 7703
346 Ga0495603_0010045 3300046455 Bacteria 5726
347 Ga0495590_0000134 3300046457 Bacteria 43957
348 Ga0495590_0012826 3300046457 Bacteria 3095
349 Ga0495591_000664 3300046458 Bacteria 25437
350 Ga0495591_001628 3300046458 Bacteria 13590
351 Ga0495591_002206 3300046458 Bacteria 11117
352 Ga0495591_002641 3300046458 Bacteria 9801
353 Ga0495591_006302 3300046458 Bacteria 5273
354 Ga0495591_017210 3300046458 Bacteria 2491
355 Ga0495629_0034053 3300046459 Bacteria 3601
356 Ga0495629_0153340 3300046459 Bacteria 1601
357 Ga0495641_0077978 3300046461 Bacteria 1485
358 Ga0495651_0088505 3300046462 Bacteria 2327
359 Ga0495651_0151542 3300046462 Bacteria 1671
360 Ga0495653_0000014 3300046463 Bacteria 215253
361 Ga0495653_0017374 3300046463 Bacteria 5851
362 Ga0495653_0287608 3300046463 Bacteria 1076
363 Ga0495650_0000395 3300046471 Bacteria 73239
364 Ga0495650_0000477 3300046471 Bacteria 61376
365 Ga0495650_0005567 3300046471 Bacteria 8125
366 Ga0495650_0061847 3300046471 Bacteria 1498
367 Ga0495580_0048110 3300046472 Bacteria 3022
368 Ga0495580_0051544 3300046472 Bacteria 2909
369 Ga0495580_0167604 3300046472 Bacteria 1519
370 Ga0495582_0032514 3300046473 Bacteria 2868
371 Ga0495605_0000002 3300046474 Bacteria 522417
372 Ga0495605_0000128 3300046474 Bacteria 100439
373 Ga0495605_0001426 3300046474 Bacteria 15680
374 Ga0495605_0001502 3300046474 Bacteria 15196
375 Ga0495605_0004552 3300046474 Bacteria 8118
376 Ga0495605_0019847 3300046474 Bacteria 3581
377 Ga0495664_0011943 3300046477 Bacteria 4906
378 Ga0495664_0316595 3300046477 Bacteria 941
379 Ga0495584_0000276 3300046491 Bacteria 36518
380 Ga0495584_0004273 3300046491 Bacteria 7700
381 Ga0495584_0004668 3300046491 Bacteria 7342
382 Ga0495584_0065569 3300046491 Bacteria 1827
383 Ga0495584_0260839 3300046491 Bacteria 881
384 Ga0495585_0000431 3300046492 Bacteria 40250
385 Ga0495585_0002527 3300046492 Bacteria 13000
386 Ga0495585_0016035 3300046492 Bacteria 4343
387 Ga0495585_0056107 3300046492 Unclassified 2176
388 Ga0495585_0095284 3300046492 Bacteria 1598
389 Ga0495594_0001858 3300046499 Bacteria 10988
390 Ga0495594_0008275 3300046499 Bacteria 5355
391 Ga0495596_0008499 3300046500 Bacteria 4566
392 Ga0495596_0013598 3300046500 Bacteria 3445
393 Ga0495596_0045876 3300046500 Bacteria 1717
394 Ga0495596_0131530 3300046500 Unclassified 971
395 Ga0495607_0000053 3300046501 Bacteria 118035
396 Ga0495607_0000091 3300046501 Bacteria 93971
397 Ga0495607_0000796 3300046501 Bacteria 29891
398 Ga0495607_0005144 3300046501 Bacteria 9449
399 Ga0495607_0005520 3300046501 Bacteria 9022
400 Ga0495607_0009605 3300046501 Bacteria 6538
401 Ga0495607_0011329 3300046501 Bacteria 5943
402 Ga0495607_0024909 3300046501 Bacteria 3725
403 Ga0495607_0199214 3300046501 Bacteria 992
404 Ga0495583_0000211 3300046506 Bacteria 98257
405 Ga0495583_0001129 3300046506 Bacteria 29317
406 Ga0495583_0001581 3300046506 Bacteria 22479
407 Ga0495583_0002351 3300046506 Bacteria 16376
408 Ga0495583_0003844 3300046506 Bacteria 11127
409 Ga0495583_0061663 3300046506 Bacteria 1672
410 Ga0495583_0138171 3300046506 Bacteria 1016
411 Ga0495606_0000022 3300046507 Bacteria 265567
412 Ga0495606_0000085 3300046507 Bacteria 158006
413 Ga0495606_0000498 3300046507 Bacteria 64198
414 Ga0495606_0000701 3300046507 Bacteria 51937
415 Ga0495606_0001498 3300046507 Bacteria 31033
416 Ga0495606_0022604 3300046507 Bacteria 4576
417 Ga0495606_0024860 3300046507 Bacteria 4304
418 Ga0495606_0059724 3300046507 Bacteria 2445
419 Ga0495606_0128269 3300046507 Bacteria 1510
420 Ga0495606_0184118 3300046507 Bacteria 1202
421 Ga0495610_0000261 3300046512 Bacteria 55310
422 Ga0495610_0001663 3300046512 Bacteria 19543
423 Ga0495610_0009971 3300046512 Bacteria 5940
424 Ga0495610_0093707 3300046512 Bacteria 1356
425 Ga0495616_0002519 3300046513 Bacteria 12114
426 Ga0495616_0095538 3300046513 Bacteria 1400
427 Ga0495616_0106173 3300046513 Bacteria 1310
428 Ga0495618_0009332 3300046514 Bacteria 5921
429 Ga0495618_0065783 3300046514 Bacteria 2304
430 Ga0495620_0000286 3300046515 Bacteria 36451
431 Ga0495620_0001285 3300046515 Bacteria 15297
432 Ga0495620_0002038 3300046515 Bacteria 11786
433 Ga0495628_0031807 3300046516 Bacteria 4265
434 Ga0495630_0000759 3300046517 Bacteria 22642
435 Ga0495630_0130115 3300046517 Bacteria 1911
436 Ga0495631_0000279 3300046518 Bacteria 35571
437 Ga0495631_0001036 3300046518 Bacteria 17251
438 Ga0495631_0003195 3300046518 Bacteria 9022
439 Ga0495631_0043409 3300046518 Bacteria 1983
440 Ga0495632_0000004 3300046519 Bacteria 381372
441 Ga0495632_0000630 3300046519 Bacteria 32470
442 Ga0495632_0009205 3300046519 Bacteria 5969
443 Ga0495632_0016039 3300046519 Bacteria 4178
444 Ga0495632_0021176 3300046519 Bacteria 3507
445 Ga0495632_0022796 3300046519 Bacteria 3351
446 Ga0495632_0048810 3300046519 Bacteria 2094
447 Ga0495632_0067368 3300046519 Bacteria 1726
448 Ga0495637_0000015 3300046520 Bacteria 228949
449 Ga0495637_0000349 3300046520 Bacteria 35312
450 Ga0495637_0001375 3300046520 Bacteria 14567
451 Ga0495637_0005031 3300046520 Bacteria 6794
452 Ga0495637_0014385 3300046520 Bacteria 3732
453 Ga0495637_0107975 3300046520 Bacteria 1081
454 Ga0495643_0001000 3300046522 Bacteria 28866
455 Ga0495643_0005586 3300046522 Bacteria 8463
456 Ga0495643_0012467 3300046522 Bacteria 5129
457 Ga0495644_0000109 3300046523 Bacteria 39201
458 Ga0495644_0001378 3300046523 Bacteria 9927
459 Ga0495644_0004285 3300046523 Bacteria 5604
460 Ga0495648_0000254 3300046524 Bacteria 60626
461 Ga0495648_0000383 3300046524 Bacteria 48567
462 Ga0495648_0001658 3300046524 Bacteria 21602
463 Ga0495648_0001921 3300046524 Bacteria 19799
464 Ga0495648_0002682 3300046524 Bacteria 16088
465 Ga0495648_0018195 3300046524 Bacteria 4990
466 Ga0495648_0049295 3300046524 Bacteria 2583
467 Ga0495648_0053348 3300046524 Bacteria 2450
468 Ga0495648_0107318 3300046524 Bacteria 1527
469 Ga0495666_0002908 3300046526 Bacteria 8581
470 Ga0495642_0007418 3300046528 Bacteria 4204
471 Ga0495652_0007270 3300046529 Bacteria 10220
472 Ga0495652_0040607 3300046529 Bacteria 4021
473 Ga0495652_0212668 3300046529 Bacteria 1458
474 Ga0495654_0001946 3300046530 Bacteria 13646
475 Ga0495654_0007649 3300046530 Bacteria 6016
476 Ga0495654_0012037 3300046530 Bacteria 4661
477 Ga0495654_0015830 3300046530 Bacteria 3999
478 Ga0495665_0080126 3300046531 Bacteria 1718
479 Ga0495640_0049024 3300046533 Bacteria 2915
480 Ga0495586_0032338 3300046535 Bacteria 2805
481 Ga0495586_0116698 3300046535 Bacteria 1489
482 Ga0495609_0000018 3300046538 Bacteria 302609
483 Ga0495609_0000051 3300046538 Bacteria 153822
484 Ga0495609_0000168 3300046538 Bacteria 68840
485 Ga0495609_0006536 3300046538 Bacteria 5939
486 Ga0495609_0022589 3300046538 Bacteria 2897
487 Ga0495609_0099849 3300046538 Bacteria 1258
488 Ga0495597_0001305 3300046542 Bacteria 18289
489 Ga0495645_0151677 3300046543 Bacteria 1609
490 Ga0495633_0000590 3300046558 Bacteria 35117
491 Ga0495633_0004033 3300046558 Bacteria 9499
492 Ga0495633_0008171 3300046558 Bacteria 5926
493 Ga0495633_0010560 3300046558 Bacteria 5032
494 Ga0495633_0077894 3300046558 Unclassified 1543
495 Ga0495633_0117054 3300046558 Bacteria 1235
496 Ga0495656_0112427 3300046615 Bacteria 1276
497 Ga0495668_0000019 3300046616 Bacteria 416042
498 Ga0495668_0000025 3300046616 Bacteria 304546
499 Ga0495668_0000117 3300046616 Bacteria 122379
500 Ga0495668_0003441 3300046616 Bacteria 11853
501 Ga0495668_0013643 3300046616 Bacteria 4784
502 Ga0495668_0020025 3300046616 Bacteria 3848
503 Ga0495668_0022859 3300046616 Bacteria 3571
504 Ga0495634_0015824 3300046642 Bacteria 5406
505 Ga0495611_0001575 3300046648 Bacteria 11166
506 Ga0495611_0002939 3300046648 Bacteria 7597
507 Ga0495611_0013043 3300046648 Bacteria 3534
508 Ga0495625_0042110 3300046660 Bacteria 3321
509 Ga0495635_0006662 3300046663 Bacteria 8067
510 Ga0495635_0008292 3300046663 Bacteria 7250
511 Ga0495661_0000006 3300046665 Bacteria 427288
512 Ga0495661_0000056 3300046665 Bacteria 138115
513 Ga0495661_0004721 3300046665 Bacteria 9789
514 Ga0495661_0011746 3300046665 Bacteria 5933
515 Ga0495661_0012243 3300046665 Bacteria 5794
516 Ga0495661_0013965 3300046665 Bacteria 5385
517 Ga0495661_0014140 3300046665 Bacteria 5346
518 Ga0495661_0021111 3300046665 Bacteria 4248
519 Ga0495588_0000261 3300046674 Bacteria 42963
520 Ga0495588_0182703 3300046674 Bacteria 1108
521 Ga0495657_0046199 3300046675 Bacteria 2950
522 Ga0495623_0103942 3300046679 Bacteria 1727
523 Ga0495646_0039333 3300046680 Bacteria 2916
524 Ga0495646_0098112 3300046680 Bacteria 1683
525 Ga0495669_0002308 3300046684 Bacteria 7812
526 Ga0495669_0010844 3300046684 Bacteria 3858
527 Ga0495669_0015611 3300046684 Bacteria 3253
528 Ga0495613_0168107 3300046689 Bacteria 1557
529 Ga0495670_0013405 3300046691 Bacteria 4033
530 Ga0495670_0041239 3300046691 Bacteria 2303
531 Ga0495671_0000009 3300046692 Bacteria 369875
532 Ga0495671_0000420 3300046692 Bacteria 33802
533 Ga0495671_0004110 3300046692 Bacteria 8773
534 Ga0495671_0020652 3300046692 Bacteria 3468
535 Ga0495671_0077495 3300046692 Bacteria 1629
536 Ga0495671_0219727 3300046692 Bacteria 920
537 Ga0495671_0252539 3300046692 Bacteria 851
538 Ga0495649_0001375 3300046694 Bacteria 18424
539 Ga0495649_0002169 3300046694 Bacteria 14050
540 Ga0495649_0085538 3300046694 Bacteria 1683
541 Ga0495589_0000473 3300046794 Bacteria 29321
542 Ga0495589_0002639 3300046794 Bacteria 9928
543 Ga0495589_0019046 3300046794 Bacteria 3520
544 Ga0495600_0007339 3300046809 Bacteria 6736
545 Ga0495600_0014728 3300046809 Bacteria 4931
546 Ga0495600_0049384 3300046809 Bacteria 2745
547 Ga0495660_0001412 3300046810 Bacteria 16457
548 Ga0495660_0001522 3300046810 Bacteria 15646
549 Ga0495660_0001919 3300046810 Bacteria 13580
550 Ga0495660_0011210 3300046810 Bacteria 5204
551 Ga0495660_0066359 3300046810 Bacteria 1924
552 Ga0495581_0020373 3300047315 Bacteria 3849
553 Ga0495604_0024198 3300047317 Bacteria 4846
554 Ga0495604_0051909 3300047317 Bacteria 3176
555 Ga0495674_0016448 3300047319 Bacteria 6900
556 Ga0495674_0035359 3300047319 Bacteria 4508
557 Ga0495674_0369607 3300047319 Bacteria 1161
558 Ga0495672_0000432 3300047320 Bacteria 50120
559 Ga0495672_0000525 3300047320 Bacteria 43794
560 Ga0495672_0000529 3300047320 Bacteria 43533
561 Ga0495672_0000732 3300047320 Bacteria 36104
562 Ga0495672_0000769 3300047320 Bacteria 34882
563 Ga0495672_0007159 3300047320 Bacteria 8438
564 Ga0495672_0015882 3300047320 Bacteria 5097
565 Ga0495672_0126015 3300047320 Bacteria 1354
566 Ga0495676_0000004 3300047321 Bacteria 313696
567 Ga0495680_0016216 3300047322 Bacteria 6407
568 Ga0495680_0032351 3300047322 Bacteria 4246
569 Ga0495680_0079238 3300047322 Bacteria 2484
570 Ga0495683_0000374 3300047323 Bacteria 36566
571 Ga0495683_0003551 3300047323 Bacteria 9063
572 Ga0495683_0004174 3300047323 Bacteria 8257
573 Ga0495683_0010027 3300047323 Bacteria 5024
574 Ga0495683_0013500 3300047323 Bacteria 4271
575 Ga0495683_0025905 3300047323 Bacteria 3003
576 Ga0495683_0082827 3300047323 Bacteria 1562
577 Ga0495683_0087467 3300047323 Bacteria 1513
578 Ga0495683_0129714 3300047323 Bacteria 1190
579 Ga0495683_0159658 3300047323 Unclassified 1043
580 Ga0495687_001917 3300047443 Bacteria 17860
581 Ga0495687_003411 3300047443 Bacteria 11562
582 Ga0495687_007220 3300047443 Bacteria 6601
583 Ga0495687_020176 3300047443 Bacteria 3254
584 Ga0495687_033197 3300047443 Bacteria 2344
585 Ga0495675_0033332 3300047444 Bacteria 3288
586 Ga0495675_0092941 3300047444 Bacteria 1892
587 Ga0495677_0000361 3300047445 Bacteria 19630
588 Ga0495677_0001955 3300047445 Bacteria 8226
589 Ga0495677_0004524 3300047445 Bacteria 5323
590 Ga0495679_000015 3300047446 Bacteria 287256
591 Ga0495679_000744 3300047446 Bacteria 20874
592 Ga0495679_012531 3300047446 Bacteria 3221
593 Ga0495685_034125 3300047447 Bacteria 1748
594 Ga0495673_0000012 3300047469 Bacteria 656908
595 Ga0495673_0000032 3300047469 Bacteria 375856
596 Ga0495673_0000292 3300047469 Bacteria 67107
597 Ga0495673_0001595 3300047469 Bacteria 17672
598 Ga0495673_0001788 3300047469 Bacteria 16309
599 Ga0495673_0003532 3300047469 Bacteria 10292
600 Ga0495673_0010862 3300047469 Bacteria 4927
601 Ga0495673_0029761 3300047469 Bacteria 2574
602 Ga0495673_0068479 3300047469 Bacteria 1499
603 Ga0495681_0037898 3300047470 Bacteria 2369
604 Ga0495684_0033332 3300047471 Bacteria 3952
605 Ga0495684_0122244 3300047471 Bacteria 1960
606 Ga0495686_0001068 3300047472 Bacteria 32627
607 Ga0495686_0001432 3300047472 Bacteria 26052
608 Ga0495686_0002004 3300047472 Bacteria 20174
609 Ga0495686_0002642 3300047472 Bacteria 16562
610 Ga0495686_0013979 3300047472 Bacteria 5549
611 Ga0495686_0028821 3300047472 Bacteria 3614
612 Ga0495686_0049126 3300047472 Bacteria 2655
613 Ga0495686_0248863 3300047472 Bacteria 999
614 Ga0495593_0047740 3300047673 Bacteria 2276
615 Ga0495602_0024473 3300048088 Bacteria 5857
616 Ga0495602_0045747 3300048088 Bacteria 3958
617 Ga0495626_0000012 3300048091 Bacteria 258483
618 Ga0495626_0000550 3300048091 Bacteria 37251
619 Ga0495626_0005686 3300048091 Bacteria 7218
620 Ga0495626_0008588 3300048091 Bacteria 5583
621 Ga0495626_0172107 3300048091 Bacteria 902
622 Ga0496100_0002600 3300048903 Bacteria 9204
623 Ga0496100_0017905 3300048903 Bacteria 4192
624 Ga0496101_0570802 3300048904 Bacteria 894
625 Ga0496102_0001444 3300048905 Bacteria 21038
626 Ga0496102_0042805 3300048905 Bacteria 4105
627 Ga0496103_0000734 3300048906 Bacteria 24126
628 Ga0496103_0004871 3300048906 Bacteria 8107
629 Ga0496104_0000110 3300048907 Bacteria 77994
630 Ga0496105_0232098 3300048908 Bacteria 1499
631 Ga0496106_0211987 3300048909 Bacteria 1543
632 Ga0496109_0840681 3300048912 Bacteria 856
633 Ga0496110_0519563 3300048913 Bacteria 1083
634 Ga0496114_0216222 3300048917 Bacteria 1682
635 Ga0496116_0004036 3300048919 Bacteria 14208
636 Ga0496116_0029046 3300048919 Bacteria 3992
637 Ga0496116_0031164 3300048919 Bacteria 3822
638 Ga0496116_0037446 3300048919 Bacteria 3383
639 Ga0496116_0062507 3300048919 Bacteria 2404
640 Ga0496117_0002291 3300048920 Bacteria 24692
641 Ga0496117_0006577 3300048920 Bacteria 11694
642 Ga0496117_0009529 3300048920 Bacteria 9017
643 Ga0496117_0033321 3300048920 Bacteria 3897
644 Ga0496117_0210897 3300048920 Bacteria 1089
645 Ga0496118_0001035 3300048921 Bacteria 43294
646 Ga0496118_0005824 3300048921 Bacteria 13812
647 Ga0496118_0010884 3300048921 Bacteria 8948
648 Ga0496118_0059946 3300048921 Bacteria 2829
649 Ga0496118_0241430 3300048921 Bacteria 1034
650 Ga0496119_0000417 3300048922 Bacteria 58548
651 Ga0496119_0005043 3300048922 Bacteria 12833
652 Ga0496119_0005126 3300048922 Bacteria 12695
653 Ga0496119_0009416 3300048922 Bacteria 8387
654 Ga0496119_0033975 3300048922 Bacteria 3369
655 Ga0496119_0088366 3300048922 Bacteria 1767
656 Ga0496120_0001322 3300048923 Bacteria 30608
657 Ga0496120_0002817 3300048923 Bacteria 16797
658 Ga0496120_0003406 3300048923 Bacteria 14541
659 Ga0496120_0006611 3300048923 Bacteria 8842
660 Ga0496120_0079612 3300048923 Bacteria 1778
661 Ga0496121_0000444 3300048924 Bacteria 81596
662 Ga0496121_0000936 3300048924 Bacteria 52789
663 Ga0496121_0001548 3300048924 Bacteria 38493
664 Ga0496121_0002548 3300048924 Bacteria 27634
665 Ga0496121_0007028 3300048924 Bacteria 13673
666 Ga0496121_0036106 3300048924 Bacteria 4410
667 Ga0496121_0052686 3300048924 Bacteria 3414
668 Ga0496121_0202791 3300048924 Bacteria 1412
669 Ga0496122_0000920 3300048925 Bacteria 53931
670 Ga0496122_0000961 3300048925 Bacteria 51914
671 Ga0496122_0001281 3300048925 Bacteria 41818
672 Ga0496122_0006050 3300048925 Bacteria 14099
673 Ga0496122_0010980 3300048925 Bacteria 9254
674 Ga0496122_0014123 3300048925 Bacteria 7744
675 Ga0496122_0031786 3300048925 Bacteria 4381
676 Ga0496122_0045935 3300048925 Bacteria 3388
677 Ga0496122_0048785 3300048925 Bacteria 3251
678 Ga0496122_0064518 3300048925 Bacteria 2664
679 Ga0496123_0000301 3300048926 Bacteria 96158
680 Ga0496123_0000315 3300048926 Bacteria 92845
681 Ga0496123_0003524 3300048926 Bacteria 17435
682 Ga0496123_0004053 3300048926 Bacteria 15787
683 Ga0496123_0005838 3300048926 Bacteria 12203
684 Ga0496123_0007296 3300048926 Bacteria 10487
685 Ga0496123_0008946 3300048926 Bacteria 9106
686 Ga0496123_0017221 3300048926 Bacteria 5828
687 Ga0496123_0027488 3300048926 Bacteria 4236
688 Ga0496123_0056631 3300048926 Bacteria 2560
689 Ga0496123_0066063 3300048926 Bacteria 2294
690 Ga0496123_0076156 3300048926 Bacteria 2067
691 Ga0496124_0000023 3300048927 Bacteria 415226
692 Ga0496124_0000188 3300048927 Bacteria 122361
693 Ga0496124_0000284 3300048927 Bacteria 96345
694 Ga0496124_0000293 3300048927 Bacteria 93590
695 Ga0496124_0000674 3300048927 Bacteria 56134
696 Ga0496124_0001109 3300048927 Bacteria 42348
697 Ga0496124_0007208 3300048927 Bacteria 11880
698 Ga0496124_0008028 3300048927 Bacteria 11101
699 Ga0496124_0009058 3300048927 Bacteria 10295
700 Ga0496124_0013847 3300048927 Bacteria 7844
701 Ga0496124_0015652 3300048927 Bacteria 7258
702 Ga0496124_0017190 3300048927 Bacteria 6829
703 Ga0496124_0029271 3300048927 Bacteria 4911
704 Ga0496124_0048548 3300048927 Bacteria 3626
705 Ga0496124_0084389 3300048927 Bacteria 2605
706 Ga0496124_0098106 3300048927 Bacteria 2378
707 Ga0496124_0240360 3300048927 Bacteria 1347
708 Ga0496124_0264308 3300048927 Bacteria 1264
709 Ga0496125_0000259 3300048928 Bacteria 109184
710 Ga0496125_0000561 3300048928 Bacteria 64016
711 Ga0496125_0001676 3300048928 Bacteria 31048
712 Ga0496125_0005984 3300048928 Bacteria 13313
713 Ga0496125_0159619 3300048928 Bacteria 1534
714 Ga0496126_0005432 3300048929 Bacteria 14531
715 Ga0496126_0073801 3300048929 Bacteria 3032
716 Ga0495678_000146 3300049459 Bacteria 85995
717 Ga0495678_000273 3300049459 Bacteria 57219
718 Ga0495678_000520 3300049459 Bacteria 37556
719 Ga0495678_001866 3300049459 Bacteria 15348
720 Ga0495678_003713 3300049459 Bacteria 9233
721 Ga0495678_004000 3300049459 Bacteria 8795
722 Ga0495678_077164 3300049459 Bacteria 1205
723 Ga0495682_0000014 3300049460 Bacteria 249706
724 Ga0495682_0006668 3300049460 Bacteria 4664
725 Ga0495682_0009432 3300049460 Bacteria 3808
726 Ga0495682_0014939 3300049460 Bacteria 2942
727 Ga0495682_0037591 3300049460 Bacteria 1781
728 Ga0501034_0439626 3300049571 Bacteria 1223
729 Ga0501037_0006588 3300049573 Bacteria 8494
730 Ga0501209_000017 3300049656 Bacteria 17319
731 Ga0501249_000128 3300049679 Bacteria 23652
732 Ga0501035_0014127 3300049822 Bacteria 7364
733 nmdc:mga0yw44_79351_c1 3300050492 Bacteria 2053
734 nmdc:mga0n895_341795_c1 3300050512 Bacteria 1516
735 Ga0495601_0097921 3300053077 Bacteria 1892
736 Ga0495619_0080979 3300053085 Bacteria 2186
737 Ga0500618_000550 3300053125 Bacteria 23305
738 Ga0500618_004669 3300053125 Bacteria 4316
739 Ga0500618_012596 3300053125 Bacteria 2210
740 Ga0500586_000731 3300053145 Bacteria 6740
741 Ga0500645_000415 3300053730 Bacteria 29692
742 Ga0500645_003031 3300053730 Bacteria 7079
743 2501085068 2501025502 Bacteria 9641094
744 2509391404 2509276021 Bacteria 7634384
745 2510282596 2510065053 Bacteria 5005518
746 2510295248 2510065055 Bacteria 5037935
747 2510311124 2510065058 Bacteria 5005894
748 2511090492 2510917013 Bacteria 9951648
749 2517098918 2517093000 Bacteria 7412387
750 2517098965 2517093000 Bacteria 7412387
751 2517407880 2517287029 Bacteria 6905599
752 2517407926 2517287029 Bacteria 6905599
753 2519460917 2519103095 Bacteria 6629912
754 2521560550 2521172590 Bacteria 5047645
755 2524610037 2524023250 Bacteria 5457705
756 2547697990 2547132181 Bacteria 4945084
757 2553005655 2551306416 Bacteria 6152985
758 2562464151 2561511199 Bacteria 5155034
759 2585283206 2582581308 Bacteria 7413247
760 2585283643 2582581308 Bacteria 7413247
761 2585289819 2582581311 Bacteria 6763856
762 2595451955 2593339239 Bacteria 4124669
763 2599723409 2599185236 Bacteria 6875203
764 2599907407 2599185292 Bacteria 6290804
765 2599944482 2599185302 Bacteria 5954930
766 2599954954 2599185304 Bacteria 5951361
767 2599970928 2599185307 Bacteria 6194719
768 2599984117 2599185309 Bacteria 5969593
769 2599988782 2599185310 Bacteria 6014457
770 2600001314 2599185312 Bacteria 5912071
771 2600049084 2599185320 Bacteria 5963263
772 2600203691 2599185354 Bacteria 4398675
773 2600446869 2600254954 Bacteria 5100516
774 2601531597 2600255256 Bacteria 5597742
775 2601536969 2600255257 Bacteria 5597196
776 2601623652 2600255283 Bacteria 6061572
777 2601628047 2600255283 Bacteria 6061572
778 2601755315 2600255310 Bacteria 5600903
779 2601760682 2600255311 Bacteria 5598766
780 2603639273 2602042046 Bacteria 5483348
781 2609913650 2609459761 Bacteria 5513740
782 2616309737 2615840626 Bacteria 7921970
783 2616313085 2615840626 Bacteria 7921970
784 2643797177 2643221556 Bacteria 7251154
785 2643863954 2643221569 Bacteria 6064337
786 2643979463 2643221594 Bacteria 5811388
787 2643982533 2643221594 Bacteria 5811388
788 2644469719 2643221684 Bacteria 7145183
789 2707100526 2706794495 Bacteria 4536932
790 2720617946 2718218233 Bacteria 6662049
791 2738712648 2738541275 Bacteria 4830863
792 2738801643 2738541293 Bacteria 7065685
793 2738818517 2738541296 Bacteria 7285013
794 2738827537 2738541297 Bacteria 6549566
795 2738831326 2738541298 Bacteria 7286732
796 2738851072 2738541301 Bacteria 4834102
797 2738866802 2738541304 Bacteria 4833665
798 2738872854 2738541306 Bacteria 7284992
799 2739034496 2738541333 Bacteria 7106503
800 2739151333 2738541357 Bacteria 6549408
801 2739184484 2738543002 Bacteria 7284546
802 2739193253 2738543003 Bacteria 6549560
803 2739219453 2738543008 Bacteria 7282815
804 2739299319 2738543022 Bacteria 4835059
805 2739319729 2738543026 Bacteria 6549408
806 2739337970 2738543029 Bacteria 6549249
807 2739360998 2738543033 Bacteria 4833336
808 2765570293 2765235838 Bacteria 5445269
809 2792313866 2791355010 Bacteria 4864581
810 2806069846 2802429636 Bacteria 7597525
811 2809034643 2808606395 Bacteria 6020352
812 2809035734 2808606395 Bacteria 6020352
813 2813730318 2811995292 Bacteria 5303342
814 2814697909 2814123068 Bacteria 5687681
815 2817259235 2816332253 Bacteria 6764532
816 2817280356 2816332256 Bacteria 6891714
817 2817452460 2816332286 Bacteria 6853759
818 2819554564 2818991438 Bacteria 5793701
819 2819555545 2818991438 Bacteria 5793701
820 2819561596 2818991439 Bacteria 6907412
821 2819565424 2818991440 Bacteria 4774720
822 2819617241 2818991449 Bacteria 5518009
823 2819635076 2818991452 Bacteria 8442785
824 2819687749 2818991461 Bacteria 7026071
825 2819713626 2818991466 Bacteria 4748179
826 2821129923 2821123053 Bacteria 7836056
827 2821136078 2821131069 Bacteria 6108407
828 2834644041 2834641062 Bacteria 5559922
829 2839096763 2839094727 Bacteria 5534556
830 2842316485 2842311132 Bacteria 6616990
831 2842920995 2842918807 Bacteria 4289178
832 2855736706 2855730933 Bacteria 7047938
833 2855773643 2855767633 Bacteria 7049357
834 2856290527 2856287931 Bacteria 7223934
835 2857359059 2857357740 Bacteria 9937880
836 2857565279 2857564685 Bacteria 6290584
837 2857577612 2857576091 Bacteria 5465855
838 2870072652 2870068957 Bacteria 8925310
839 2879164106 2879163058 Bacteria 4223965
840 2881417466 2881412998 Bacteria 6492157
841 2881418463 2881412998 Bacteria 6492157
842 2893070788 2893066018 Bacteria 6158120
843 2900638584 2900634093 Bacteria 10263517
844 2904442879 2904439833 Bacteria 5931679
845 2904466725 2904463128 Bacteria 4775606
846 2904479114 2904474040 Bacteria 5504324
847 2904534923 2904530477 Bacteria 5876334
848 2904570969 2904564687 Bacteria 7609577
849 2904578077 2904571731 Bacteria 7608790
850 2904588738 2904584206 Bacteria 6028872
851 2904594188 2904589729 Bacteria 6113573
852 2904604972 2904601388 Bacteria 5884906
853 2919048625 2919046199 Bacteria 5567169
854 2919083207 2919079590 Bacteria 5946433
855 2919119397 2919114240 Bacteria 5700270
856 2919140785 2919138771 Bacteria 5281312
857 2919155223 2919150387 Bacteria 5500879
858 2919405686 2919404418 Bacteria 4232372
859 2923514328 2923510766 Bacteria 5926163
860 2923586713 2923586266 Bacteria 6565975
861 2927148805 2927143783 Bacteria 5504251
862 2928102073 2928100450 Bacteria 4837635
863 2928133061 2928130867 Bacteria 5467269
864 2928530068 2928526807 Bacteria 4760224
865 2928543053 2928536128 Bacteria 7657547
866 2928962009 2928959182 Bacteria 4725774
867 2928969742 2928968154 Bacteria 4633371
868 2931369929 2931369376 Bacteria 6847892
869 2939603736 2939602548 Bacteria 4950493
870 2941482683
871 2945878088 2945874760 Bacteria 5527237
872 2945937232 2945934425 Bacteria 7444609
873 2953996263 2953994433 Bacteria 4303959
874 2984513908 2984509177 Bacteria 5274802
875 2984522940 2984518228 Bacteria 5277463
876 2984542523 2984537506 Bacteria 5277481
877 2984559301 2984559226 Bacteria 5683096
878 2984595828 2984595703 Bacteria 5682994
879 2984606631 2984601300 Bacteria 5455244
880 2990706033 2990703756 Bacteria 7715990
881 2998142270 2998139840 Bacteria 6073514
882 642425769 641736151 Bacteria 7477263
883 8005302010 8005301065 Bacteria 6614431
884 8005651172 8005645114 Bacteria 6950293
885 8018154934 8018150411 Bacteria 5549903
886 8020813093 8020807995 Bacteria 6801506
887 8034966093 8034962539 Bacteria 4884839
888 8040167750 8040167225 Bacteria 6542727
889 8040178507 8040173305 Bacteria 6827067
890 8047676539 8047673197 Bacteria 7395230
891 8054007532 8054002106 Bacteria 7987183
892 8055436186 8055431914 Bacteria 4551896
893 Ga0495637_0000244
894 JGI24736J21556_1001233
895 JGI24736J21556_1001981
896 JGI24741J21665_1000662
897 JGI24740J21852_10000277
898 JGI24740J21852_10000508
899 JGI24740J21852_10000713
900 JGI24739J22299_10009515
901 JGI24737J22298_10008204
902 JGI24737J22298_10033240
903 JGI24735J21928_10000021
904 JGI24735J21928_10007696
905 JGI24738J21930_10000526
906 JGI24738J21930_10000873
907 JGI24738J21930_10004414
908 JGI25156J39149_1002739
909 JGI25154J39366_1000101
910 JGI25150J39212_1007501
911 JGI25151J46595_10000095
912 rootH1_10075527
913 rootH2_10062714
914 rootH2_10295700
915 rootL2_10030614
916 rootL2_10266319
917 rootL2_10290088
918 Ga0055532_1000284
919 Ga0055527_1000313
920 Ga0055535_1000539
921 Ga0055542_1000566
922 Ga0055529_1000536
923 Ga0055526_1000046
924 Ga0055526_1001445
925 Ga0055526_1005130
926 Ga0055524_1003093
927 Ga0055536_1034238
928 Ga0055534_1001027
929 Ga0055528_1003289
930 Ga0055530_10000002
931 Ga0055540_1000009
932 Ga0055541_1002938
933 Ga0058692_1000656
934 Ga0058692_1001690
935 Ga0058692_1002190
936 Ga0058692_1002228
937 Ga0058692_1013806
938 Ga0065165_1026239
939 Ga0065704_10119594
940 Ga0070658_10017861
941 Ga0070658_10274817
942 Ga0070660_100117882
943 Ga0070661_100035472
944 Ga0070661_100110686
945 Ga0070659_100032579
946 Ga0070659_100260263
947 Ga0070667_100486324
948 Ga0070709_10289311
949 Ga0070708_100024397
950 Ga0070663_100003167
951 Ga0070662_100012478
952 Ga0070681_10124825
953 Ga0070679_100467822
954 Ga0068853_100003004
955 Ga0070672_100292849
956 Ga0068855_100001434
957 Ga0068855_100006170
958 Ga0068855_100008770
959 Ga0068855_100639907
960 Ga0070664_100021923
961 Ga0070664_100049201
962 Ga0068857_100023547
963 Ga0068857_100146831
964 Ga0068854_100011318
965 Ga0068854_100022527
966 Ga0068854_100026953
967 Ga0068854_100101726
968 Ga0068856_100359604
969 Ga0068852_100052480
970 Ga0068851_10001303
971 Ga0068851_10012595
972 Ga0081455_10096976
973 Ga0075365_10086137
974 Ga0070716_100399959
975 Ga0075362_10027427
976 Ga0075369_10018717
977 Ga0075366_10054159
978 Ga0075370_10282953
979 Ga0075370_10339046
980 Ga0075434_100623264
981 Ga0079104_1000132
982 Ga0079104_1000203
983 Ga0079104_1003432
984 Ga0105251_10000356
985 Ga0105251_10000769
986 Ga0105251_10012640
987 Ga0105244_10001922
988 Ga0105244_10004262
989 Ga0105244_10044564
990 Ga0105250_10002204
991 Ga0105240_10008537
992 Ga0105240_10039399
993 Ga0105240_10250248
994 Ga0105247_10111565
995 Ga0105237_10000038
996 Ga0105237_10026074
997 Ga0105237_10121606
998 Ga0105238_10000113
999 Ga0105238_10070171
1000 Ga0105239_10000108
1001 Ga0105239_10000289
1002 Ga0105239_10089321
1003 Ga0105239_10129259
1004 Ga0157371_10036811
1005 Ga0157370_10032974
1006 Ga0157370_10063322
1007 Ga0157369_10084304
1008 Ga0157369_10127899
1009 Ga0157378_10169053
1010 Ga0157378_10523116
1011 Ga0157372_10011302
1012 Ga0157372_10567604
1013 Ga0182008_10003440
1014 Ga0182008_10006469
1015 Ga0182008_10017810
1016 Ga0182006_1000021
1017 Ga0182006_1000133
1018 Ga0182006_1000828
1019 Ga0182006_1006409
1020 Ga0182006_1011619
1021 Ga0182006_1041071
1022 Ga0182007_10000890
1023 Ga0182007_10004221
1024 Ga0182005_1000020
1025 Ga0182005_1012297
1026 Ga0182005_1019100
1027 Ga0213872_10016149
1028 Ga0209435_100069
1029 Ga0209566_100201
1030 Ga0209674_101903
1031 Ga0209672_100200
1032 Ga0209147_100265
1033 Ga0209258_100439
1034 Ga0207425_1000966
1035 Ga0209646_1000108
1036 Ga0209026_1003394
1037 Ga0209148_1000422
1038 Ga0209759_1000173
1039 Ga0209759_1007482
1040 Ga0209129_1002466
1041 Ga0209233_1017020
1042 Ga0209455_1000322
1043 Ga0209673_1000621
1044 Ga0209675_1001449
1045 Ga0209676_1000065
1046 Ga0209676_1002272
1047 Ga0209676_1002993
1048 Ga0209676_1027871
1049 Ga0209025_1000055
1050 Ga0209025_1001131
1051 Ga0209025_1004585
1052 Ga0209564_1000277
1053 Ga0209564_1001607
1054 Ga0209564_1006862
1055 Ga0209758_1007033
1056 Ga0209758_1010525
1057 Ga0209050_1000009
1058 Ga0209050_1000402
1059 Ga0209050_1000638
1060 Ga0209050_1004144
1061 Ga0209050_1015329
1062 Ga0209256_1000176
1063 Ga0209256_1000565
1064 Ga0209256_1003140
1065 Ga0209256_1036857
1066 Ga0209051_1000008
1067 Ga0209051_1005572
1068 Ga0209257_1012568
1069 Ga0207656_10000147
1070 Ga0207696_1002130
1071 Ga0207655_1065809
1072 Ga0207713_1000173
1073 Ga0207713_1003281
1074 Ga0207710_10144539
1075 Ga0207647_10028441
1076 Ga0207647_10028600
1077 Ga0207699_10257948
1078 Ga0207705_10023962
1079 Ga0207705_10228503
1080 Ga0207695_10034752
1081 Ga0207695_10621604
1082 Ga0207671_10000045
1083 Ga0207671_10055090
1084 Ga0207671_10108299
1085 Ga0207657_10051927
1086 Ga0207649_10050358
1087 Ga0207652_10419613
1088 Ga0207694_10000075
1089 Ga0207694_10004601
1090 Ga0207694_10082401
1091 Ga0207659_10082640
1092 Ga0207690_10056761
1093 Ga0207690_10100616
1094 Ga0207706_10013921
1095 Ga0207706_10065602
1096 Ga0207706_10397731
1097 Ga0207691_10074219
1098 Ga0207691_10407896
1099 Ga0207679_10058513
1100 Ga0207679_10182669
1101 Ga0207667_10000110
1102 Ga0207667_10008274
1103 Ga0207667_10014624
1104 Ga0207667_10358060
1105 Ga0207640_10008103
1106 Ga0207640_10020501
1107 Ga0207640_10064184
1108 Ga0207640_10085884
1109 Ga0207658_10453019
1110 Ga0207639_10021179
1111 Ga0207678_10004943
1112 Ga0207674_10031842
1113 Ga0207674_10038235
1114 Ga0207674_10218567
1115 Ga0207674_10299265
1116 Ga0207698_10013615
1117 Ga0209281_1000061
1118 Ga0209281_1000338
1119 Ga0209281_1002766
1120 Ga0209371_1000017
1121 Ga0209371_1000104
1122 Ga0209371_1000261
1123 Ga0209371_1000735
1124 Ga0209371_1001024
1125 Ga0209371_1001702
1126 Ga0209371_1002099
1127 Ga0209371_1013351
1128 Ga0209371_1013910
1129 Ga0265338_10193551
1130 Ga0268256_1000017
1131 Ga0268256_1000091
1132 Ga0268256_1000221
1133 Ga0268256_1000625
1134 Ga0268256_1001484
1135 Ga0268256_1001761
1136 Ga0268256_1014690
1137 Ga0268256_1015407
1138 Ga0268256_1025257
1139 Ga0316181_1099275
1140 Ga0265320_10004108
1141 Ga0265316_10016742
1142 Ga0307408_100000496
1143 Ga0265314_10089573
1144 Ga0307405_10000146
1145 Ga0307405_10007923
1146 Ga0307405_10147446
1147 Ga0307410_10039396
1148 Ga0307406_10000533
1149 Ga0307406_10016152
1150 Ga0307407_10076195
1151 Ga0307412_10000021
1152 Ga0307412_10000293
1153 Ga0307412_10000588
1154 Ga0307412_10001067
1155 Ga0307412_10002729
1156 Ga0307412_10003827
1157 Ga0307412_10016080
1158 Ga0307412_10051061
1159 Ga0307409_100010476
1160 Ga0307416_100027556
1161 Ga0307414_10048401
1162 Ga0307411_10015914
1163 Ga0307411_10195735
1164 Ga0307510_10341578
1165 Ga0373954_0033662
1166 Ga0373927_0017128
1167 Ga0395899_0009592
1168 Ga0395899_0172005
1169 Ga0395899_0225791
1170 Ga0395899_0236053
1171 Ga0395900_0003038
1172 Ga0395900_0020385
1173 Ga0395900_0111243
1174 Ga0395900_0154581
1175 Ga0395900_0216071
1176 Ga0395900_0299259
1177 Ga0395900_0529340
1178 Ga0395898_0020964
1179 Ga0395898_0039617
1180 Ga0395898_0187136
1181 Ga0395898_0212647
1182 Ga0395898_0395158
1183 Ga0395905_0024058
1184 Ga0395905_0125591
1185 Ga0395901_0002761
1186 Ga0395901_0017776
1187 Ga0395901_0300410
1188 Ga0395901_0308878
1189 Ga0395901_0398512
1190 Ga0436361_0982462
1191 Ga0436362_0607000
1192 Ga0439436_0000004
1193 Ga0439465_0005025
1194 Ga0451841_1227815
1195 Ga0451845_0676067
1196 Ga0451845_0757030
1197 Ga0451849_0647590
1198 Ga0451849_0783247
1199 Ga0451851_0083621
1200 Ga0451853_0372391
1201 Ga0451853_1588158
1202 Ga0439448_0058928
1203 Ga0439432_000046
1204 Ga0439452_002719
1205 Ga0439463_000428
1206 Ga0439463_001729
1207 Ga0439458_0014536
1208 Ga0439460_0004486
1209 Ga0451577_0003066
1210 Ga0453683_0032497
1211 Ga0466965_0044765
1212 Ga0466966_0005946
1213 Ga0466966_0076288
1214 Ga0466961_0034846
1215 Ga0466961_0098739
1216 Ga0453684_0109875
1217 Ga0453684_0325207
1218 Ga0466968_0000252
1219 Ga0466968_0001162
1220 Ga0466968_0001355
1221 Ga0466957_0004847
1222 Ga0466957_0020666
1223 Ga0466957_0194640
1224 Ga0466957_0334546
1225 Ga0466957_0388405
1226 Ga0466960_0007900
1227 Ga0466959_0009671
1228 Ga0451576_0015427
1229 Ga0451576_0326133
1230 Ga0466958_0024632
1231 Ga0466958_0209648
1232 Ga0466967_0039746
1233 Ga0495617_001589
1234 Ga0495617_017344
1235 Ga0495627_005467
1236 Ga0495627_020344
1237 Ga0495592_0008506
1238 Ga0495603_0010045
1239 Ga0495590_0000134
1240 Ga0495590_0012826
1241 Ga0495591_000664
1242 Ga0495591_001628
1243 Ga0495591_002206
1244 Ga0495591_002641
1245 Ga0495591_006302
1246 Ga0495591_017210
1247 Ga0495629_0034053
1248 Ga0495629_0153340
1249 Ga0495641_0077978
1250 Ga0495651_0088505
1251 Ga0495651_0151542
1252 Ga0495653_0000014
1253 Ga0495653_0017374
1254 Ga0495653_0287608
1255 Ga0495650_0000395
1256 Ga0495650_0000477
1257 Ga0495650_0005567
1258 Ga0495650_0061847
1259 Ga0495580_0048110
1260 Ga0495580_0051544
1261 Ga0495580_0167604
1262 Ga0495582_0032514
1263 Ga0495605_0000002
1264 Ga0495605_0000128
1265 Ga0495605_0001426
1266 Ga0495605_0001502
1267 Ga0495605_0004552
1268 Ga0495605_0019847
1269 Ga0495664_0011943
1270 Ga0495664_0316595
1271 Ga0495584_0000276
1272 Ga0495584_0004273
1273 Ga0495584_0004668
1274 Ga0495584_0065569
1275 Ga0495584_0260839
1276 Ga0495585_0000431
1277 Ga0495585_0002527
1278 Ga0495585_0016035
1279 Ga0495585_0056107
1280 Ga0495585_0095284
1281 Ga0495594_0001858
1282 Ga0495594_0008275
1283 Ga0495596_0008499
1284 Ga0495596_0013598
1285 Ga0495596_0045876
1286 Ga0495596_0131530
1287 Ga0495607_0000053
1288 Ga0495607_0000091
1289 Ga0495607_0000796
1290 Ga0495607_0005144
1291 Ga0495607_0005520
1292 Ga0495607_0009605
1293 Ga0495607_0011329
1294 Ga0495607_0024909
1295 Ga0495607_0199214
1296 Ga0495583_0000211
1297 Ga0495583_0001129
1298 Ga0495583_0001581
1299 Ga0495583_0002351
1300 Ga0495583_0003844
1301 Ga0495583_0061663
1302 Ga0495583_0138171
1303 Ga0495606_0000022
1304 Ga0495606_0000085
1305 Ga0495606_0000498
1306 Ga0495606_0000701
1307 Ga0495606_0001498
1308 Ga0495606_0022604
1309 Ga0495606_0024860
1310 Ga0495606_0059724
1311 Ga0495606_0128269
1312 Ga0495606_0184118
1313 Ga0495610_0000261
1314 Ga0495610_0001663
1315 Ga0495610_0009971
1316 Ga0495610_0093707
1317 Ga0495616_0002519
1318 Ga0495616_0095538
1319 Ga0495616_0106173
1320 Ga0495618_0009332
1321 Ga0495618_0065783
1322 Ga0495620_0000286
1323 Ga0495620_0001285
1324 Ga0495620_0002038
1325 Ga0495628_0031807
1326 Ga0495630_0000759
1327 Ga0495630_0130115
1328 Ga0495631_0000279
1329 Ga0495631_0001036
1330 Ga0495631_0003195
1331 Ga0495631_0043409
1332 Ga0495632_0000004
1333 Ga0495632_0000630
1334 Ga0495632_0009205
1335 Ga0495632_0016039
1336 Ga0495632_0021176
1337 Ga0495632_0022796
1338 Ga0495632_0048810
1339 Ga0495632_0067368
1340 Ga0495637_0000015
1341 Ga0495637_0000349
1342 Ga0495637_0001375
1343 Ga0495637_0005031
1344 Ga0495637_0014385
1345 Ga0495637_0107975
1346 Ga0495643_0001000
1347 Ga0495643_0005586
1348 Ga0495643_0012467
1349 Ga0495644_0000109
1350 Ga0495644_0001378
1351 Ga0495644_0004285
1352 Ga0495648_0000254
1353 Ga0495648_0000383
1354 Ga0495648_0001658
1355 Ga0495648_0001921
1356 Ga0495648_0002682
1357 Ga0495648_0018195
1358 Ga0495648_0049295
1359 Ga0495648_0053348
1360 Ga0495648_0107318
1361 Ga0495666_0002908
1362 Ga0495642_0007418
1363 Ga0495652_0007270
1364 Ga0495652_0040607
1365 Ga0495652_0212668
1366 Ga0495654_0001946
1367 Ga0495654_0007649
1368 Ga0495654_0012037
1369 Ga0495654_0015830
1370 Ga0495665_0080126
1371 Ga0495640_0049024
1372 Ga0495586_0032338
1373 Ga0495586_0116698
1374 Ga0495609_0000018
1375 Ga0495609_0000051
1376 Ga0495609_0000168
1377 Ga0495609_0006536
1378 Ga0495609_0022589
1379 Ga0495609_0099849
1380 Ga0495597_0001305
1381 Ga0495645_0151677
1382 Ga0495633_0000590
1383 Ga0495633_0004033
1384 Ga0495633_0008171
1385 Ga0495633_0010560
1386 Ga0495633_0077894
1387 Ga0495633_0117054
1388 Ga0495656_0112427
1389 Ga0495668_0000019
1390 Ga0495668_0000025
1391 Ga0495668_0000117
1392 Ga0495668_0003441
1393 Ga0495668_0013643
1394 Ga0495668_0020025
1395 Ga0495668_0022859
1396 Ga0495634_0015824
1397 Ga0495611_0001575
1398 Ga0495611_0002939
1399 Ga0495611_0013043
1400 Ga0495625_0042110
1401 Ga0495635_0006662
1402 Ga0495635_0008292
1403 Ga0495661_0000006
1404 Ga0495661_0000056
1405 Ga0495661_0004721
1406 Ga0495661_0011746
1407 Ga0495661_0012243
1408 Ga0495661_0013965
1409 Ga0495661_0014140
1410 Ga0495661_0021111
1411 Ga0495588_0000261
1412 Ga0495588_0182703
1413 Ga0495657_0046199
1414 Ga0495623_0103942
1415 Ga0495646_0039333
1416 Ga0495646_0098112
1417 Ga0495669_0002308
1418 Ga0495669_0010844
1419 Ga0495669_0015611
1420 Ga0495613_0168107
1421 Ga0495670_0013405
1422 Ga0495670_0041239
1423 Ga0495671_0000009
1424 Ga0495671_0000420
1425 Ga0495671_0004110
1426 Ga0495671_0020652
1427 Ga0495671_0077495
1428 Ga0495671_0219727
1429 Ga0495671_0252539
1430 Ga0495649_0001375
1431 Ga0495649_0002169
1432 Ga0495649_0085538
1433 Ga0495589_0000473
1434 Ga0495589_0002639
1435 Ga0495589_0019046
1436 Ga0495600_0007339
1437 Ga0495600_0014728
1438 Ga0495600_0049384
1439 Ga0495660_0001412
1440 Ga0495660_0001522
1441 Ga0495660_0001919
1442 Ga0495660_0011210
1443 Ga0495660_0066359
1444 Ga0495581_0020373
1445 Ga0495604_0024198
1446 Ga0495604_0051909
1447 Ga0495674_0016448
1448 Ga0495674_0035359
1449 Ga0495674_0369607
1450 Ga0495672_0000432
1451 Ga0495672_0000525
1452 Ga0495672_0000529
1453 Ga0495672_0000732
1454 Ga0495672_0000769
1455 Ga0495672_0007159
1456 Ga0495672_0015882
1457 Ga0495672_0126015
1458 Ga0495676_0000004
1459 Ga0495680_0016216
1460 Ga0495680_0032351
1461 Ga0495680_0079238
1462 Ga0495683_0000374
1463 Ga0495683_0003551
1464 Ga0495683_0004174
1465 Ga0495683_0010027
1466 Ga0495683_0013500
1467 Ga0495683_0025905
1468 Ga0495683_0082827
1469 Ga0495683_0087467
1470 Ga0495683_0129714
1471 Ga0495683_0159658
1472 Ga0495687_001917
1473 Ga0495687_003411
1474 Ga0495687_007220
1475 Ga0495687_020176
1476 Ga0495687_033197
1477 Ga0495675_0033332
1478 Ga0495675_0092941
1479 Ga0495677_0000361
1480 Ga0495677_0001955
1481 Ga0495677_0004524
1482 Ga0495679_000015
1483 Ga0495679_000744
1484 Ga0495679_012531
1485 Ga0495685_034125
1486 Ga0495673_0000012
1487 Ga0495673_0000032
1488 Ga0495673_0000292
1489 Ga0495673_0001595
1490 Ga0495673_0001788
1491 Ga0495673_0003532
1492 Ga0495673_0010862
1493 Ga0495673_0029761
1494 Ga0495673_0068479
1495 Ga0495681_0037898
1496 Ga0495684_0033332
1497 Ga0495684_0122244
1498 Ga0495686_0001068
1499 Ga0495686_0001432
1500 Ga0495686_0002004
1501 Ga0495686_0002642
1502 Ga0495686_0013979
1503 Ga0495686_0028821
1504 Ga0495686_0049126
1505 Ga0495686_0248863
1506 Ga0495593_0047740
1507 Ga0495602_0024473
1508 Ga0495602_0045747
1509 Ga0495626_0000012
1510 Ga0495626_0000550
1511 Ga0495626_0005686
1512 Ga0495626_0008588
1513 Ga0495626_0172107
1514 Ga0496100_0002600
1515 Ga0496100_0017905
1516 Ga0496101_0570802
1517 Ga0496102_0001444
1518 Ga0496102_0042805
1519 Ga0496103_0000734
1520 Ga0496103_0004871
1521 Ga0496104_0000110
1522 Ga0496105_0232098
1523 Ga0496106_0211987
1524 Ga0496109_0840681
1525 Ga0496110_0519563
1526 Ga0496114_0216222
1527 Ga0496116_0004036
1528 Ga0496116_0029046
1529 Ga0496116_0031164
1530 Ga0496116_0037446
1531 Ga0496116_0062507
1532 Ga0496117_0002291
1533 Ga0496117_0006577
1534 Ga0496117_0009529
1535 Ga0496117_0033321
1536 Ga0496117_0210897
1537 Ga0496118_0001035
1538 Ga0496118_0005824
1539 Ga0496118_0010884
1540 Ga0496118_0059946
1541 Ga0496118_0241430
1542 Ga0496119_0000417
1543 Ga0496119_0005043
1544 Ga0496119_0005126
1545 Ga0496119_0009416
1546 Ga0496119_0033975
1547 Ga0496119_0088366
1548 Ga0496120_0001322
1549 Ga0496120_0002817
1550 Ga0496120_0003406
1551 Ga0496120_0006611
1552 Ga0496120_0079612
1553 Ga0496121_0000444
1554 Ga0496121_0000936
1555 Ga0496121_0001548
1556 Ga0496121_0002548
1557 Ga0496121_0007028
1558 Ga0496121_0036106
1559 Ga0496121_0052686
1560 Ga0496121_0202791
1561 Ga0496122_0000920
1562 Ga0496122_0000961
1563 Ga0496122_0001281
1564 Ga0496122_0006050
1565 Ga0496122_0010980
1566 Ga0496122_0014123
1567 Ga0496122_0031786
1568 Ga0496122_0045935
1569 Ga0496122_0048785
1570 Ga0496122_0064518
1571 Ga0496123_0000301
1572 Ga0496123_0000315
1573 Ga0496123_0003524
1574 Ga0496123_0004053
1575 Ga0496123_0005838
1576 Ga0496123_0007296
1577 Ga0496123_0008946
1578 Ga0496123_0017221
1579 Ga0496123_0027488
1580 Ga0496123_0056631
1581 Ga0496123_0066063
1582 Ga0496123_0076156
1583 Ga0496124_0000023
1584 Ga0496124_0000188
1585 Ga0496124_0000284
1586 Ga0496124_0000293
1587 Ga0496124_0000674
1588 Ga0496124_0001109
1589 Ga0496124_0007208
1590 Ga0496124_0008028
1591 Ga0496124_0009058
1592 Ga0496124_0013847
1593 Ga0496124_0015652
1594 Ga0496124_0017190
1595 Ga0496124_0029271
1596 Ga0496124_0048548
1597 Ga0496124_0084389
1598 Ga0496124_0098106
1599 Ga0496124_0240360
1600 Ga0496124_0264308
1601 Ga0496125_0000259
1602 Ga0496125_0000561
1603 Ga0496125_0001676
1604 Ga0496125_0005984
1605 Ga0496125_0159619
1606 Ga0496126_0005432
1607 Ga0496126_0073801
1608 Ga0495678_000146
1609 Ga0495678_000273
1610 Ga0495678_000520
1611 Ga0495678_001866
1612 Ga0495678_003713
1613 Ga0495678_004000
1614 Ga0495678_077164
1615 Ga0495682_0000014
1616 Ga0495682_0006668
1617 Ga0495682_0009432
1618 Ga0495682_0014939
1619 Ga0495682_0037591
1620 Ga0501034_0439626
1621 Ga0501037_0006588
1622 Ga0501209_000017
1623 Ga0501249_000128
1624 Ga0501035_0014127
1625 nmdc:mga0yw44_79351_c1
1626 nmdc:mga0n895_341795_c1
1627 Ga0495601_0097921
1628 Ga0495619_0080979
1629 Ga0500618_000550
1630 Ga0500618_004669
1631 Ga0500618_012596
1632 Ga0500586_000731
1633 Ga0500645_000415
1634 Ga0500645_003031
1635 2501085068
1636 2509391404
1637 2510282596
1638 2510295248
1639 2510311124
1640 2511090492
1641 2517098918
1642 2517098965
1643 2517407880
1644 2517407926
1645 2519460917
1646 2521560550
1647 2524610037
1648 2547697990
1649 2553005655
1650 2562464151
1651 2585283206
1652 2585283643
1653 2585289819
1654 2595451955
1655 2599723409
1656 2599907407
1657 2599944482
1658 2599954954
1659 2599970928
1660 2599984117
1661 2599988782
1662 2600001314
1663 2600049084
1664 2600203691
1665 2600446869
1666 2601531597
1667 2601536969
1668 2601623652
1669 2601628047
1670 2601755315
1671 2601760682
1672 2603639273
1673 2609913650
1674 2616309737
1675 2616313085
1676 2643797177
1677 2643863954
1678 2643979463
1679 2643982533
1680 2644469719
1681 2707100526
1682 2720617946
1683 2738712648
1684 2738801643
1685 2738818517
1686 2738827537
1687 2738831326
1688 2738851072
1689 2738866802
1690 2738872854
1691 2739034496
1692 2739151333
1693 2739184484
1694 2739193253
1695 2739219453
1696 2739299319
1697 2739319729
1698 2739337970
1699 2739360998
1700 2765570293
1701 2792313866
1702 2806069846
1703 2809034643
1704 2809035734
1705 2813730318
1706 2814697909
1707 2817259235
1708 2817280356
1709 2817452460
1710 2819554564
1711 2819555545
1712 2819561596
1713 2819565424
1714 2819617241
1715 2819635076
1716 2819687749
1717 2819713626
1718 2821129923
1719 2821136078
1720 2834644041
1721 2839096763
1722 2842316485
1723 2842920995
1724 2855736706
1725 2855773643
1726 2856290527
1727 2857359059
1728 2857565279
1729 2857577612
1730 2870072652
1731 2879164106
1732 2881417466
1733 2881418463
1734 2893070788
1735 2900638584
1736 2904442879
1737 2904466725
1738 2904479114
1739 2904534923
1740 2904570969
1741 2904578077
1742 2904588738
1743 2904594188
1744 2904604972
1745 2919048625
1746 2919083207
1747 2919119397
1748 2919140785
1749 2919155223
1750 2919405686
1751 2923514328
1752 2923586713
1753 2927148805
1754 2928102073
1755 2928133061
1756 2928530068
1757 2928543053
1758 2928962009
1759 2928969742
1760 2931369929
1761 2939603736
1762 2941482683
1763 2945878088
1764 2945937232
1765 2953996263
1766 2984513908
1767 2984522940
1768 2984542523
1769 2984559301
1770 2984595828
1771 2984606631
1772 2990706033
1773 2998142270
1774 642425769
1775 8005302010
1776 8005651172
1777 8018154934
1778 8020813093
1779 8034966093
1780 8040167750
1781 8040178507
1782 8047676539
1783 8054007532
1784 8055436186

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

221

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

249

0.88

PF08659

KR

KR domain

31

204

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

224

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_C crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9392 1 185
3f5s-assembly1.cif.gz_A crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 0.93 3 181
6m5n-assembly1.cif.gz_A apo-form structure of borneol dehydrogenase 0.9126 3 188
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9125 3 223
3lls-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium tuberculosis 0.9093 3 185
ID Description Score Start End Superfamily
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 58 180 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 86 181 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 6 178 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9227 2 187 3.40.50.720
4e6pC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.922 1 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A328Y3L5-F1-model_v4 deleted 0.9925 1 189
AF-A0A6M5CZK2-F1-model_v4 deleted 0.9915 1 253
AF-A0A7W6DIN9-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9914 1 252 GO:0016491
AF-A0A4Y9SPW3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.991 1 220 GO:0016020
GO:0016491
AF-A0A3R8VK59-F1-model_v4 deleted 0.9896 1 253

Map