F485186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 440 | 1784 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300046520|Ga0495637_0000244|Ga0495637_0000244_16937_17773 |
| Length | 278 |
| Sequence | MVVVYLSFRKFMPCFLPFSATGILFMQLTDNTILITGGASGIGRGLAEAFHKLGNKVIIAGRRKALLDEVITANPGMEGIELDINDPASIQEVASTLISRYPSLNVLVNNAGIMPFDDAAGHIDDATMIGTITTNFMGPIRLTSALIEHLKSQPRSVIINNTSVLAFVPLACNAVYSATKAALHSYSLSQRFTLLGTSVRVQEIAPPWVNTDLIHKGDDPRAMPLDAFIEQTMVGLATDVPEVVVDAIRPLRDNPGSQEHALIHGFNQSVVENPIPVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 160 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 161 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 162 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 165 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 166 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 167 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 168 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 169 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 301 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 302 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 303 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 304 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 305 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 306 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 307 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 308 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 309 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 310 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 311 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 312 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 313 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 314 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 315 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 316 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 317 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 318 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 319 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 320 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 321 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 322 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 323 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 324 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 325 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 326 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 327 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 328 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 329 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 330 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 331 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 332 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 333 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 334 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 335 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 336 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 337 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 338 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 339 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 340 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 341 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 342 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 343 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 344 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 345 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 346 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 347 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 348 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 349 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 350 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 351 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 352 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 353 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 354 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 355 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 356 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 357 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 358 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 359 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 360 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 361 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 362 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 363 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 364 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 365 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 366 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 367 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 368 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 369 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 370 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 371 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 372 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 373 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 374 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 375 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 376 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 377 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 378 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 379 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 380 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 381 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 382 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 383 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 384 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 385 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 386 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 387 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 388 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 389 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 390 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 391 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 392 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 393 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 394 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 395 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 396 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 397 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 398 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 399 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 400 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 401 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 402 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 403 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 404 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 405 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 406 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 407 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 408 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 409 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 410 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 411 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 412 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 413 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 414 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 415 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 416 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 417 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 418 | 2941479691 | |||
| 419 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 420 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 421 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 422 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 423 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 424 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 425 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 426 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 427 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 428 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 429 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 430 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 431 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 432 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 433 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 434 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 435 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 436 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 437 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 438 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 439 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 440 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.35 |
| Metatranscriptomes | 0 |
| Isolates | 16.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.67 |
| Bulb | 0 |
| Endosphere | 7.55 |
| Nodule | 2.44 |
| Rhizoplane | 3.66 |
| Rhizosphere | 65.93 |
| Stem | 0.11 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495637_0000244 | 3300046520 | Bacteria | 42635 |
| 2 | JGI24736J21556_1001233 | 3300001904 | Bacteria | 4694 |
| 3 | JGI24736J21556_1001981 | 3300001904 | Bacteria | 3634 |
| 4 | JGI24741J21665_1000662 | 3300001915 | Bacteria | 10392 |
| 5 | JGI24740J21852_10000277 | 3300001979 | Bacteria | 21763 |
| 6 | JGI24740J21852_10000508 | 3300001979 | Bacteria | 16707 |
| 7 | JGI24740J21852_10000713 | 3300001979 | Bacteria | 14435 |
| 8 | JGI24739J22299_10009515 | 3300001989 | Bacteria | 3621 |
| 9 | JGI24737J22298_10008204 | 3300001990 | Bacteria | 3504 |
| 10 | JGI24737J22298_10033240 | 3300001990 | Bacteria | 1603 |
| 11 | JGI24735J21928_10000021 | 3300002067 | Bacteria | 99198 |
| 12 | JGI24735J21928_10007696 | 3300002067 | Bacteria | 3504 |
| 13 | JGI24738J21930_10000526 | 3300002075 | Bacteria | 10934 |
| 14 | JGI24738J21930_10000873 | 3300002075 | Bacteria | 8637 |
| 15 | JGI24738J21930_10004414 | 3300002075 | Bacteria | 3448 |
| 16 | JGI25156J39149_1002739 | 3300002705 | Bacteria | 6132 |
| 17 | JGI25154J39366_1000101 | 3300002738 | Bacteria | 76597 |
| 18 | JGI25150J39212_1007501 | 3300002774 | Bacteria | 2185 |
| 19 | JGI25151J46595_10000095 | 3300003187 | Bacteria | 118630 |
| 20 | rootH1_10075527 | 3300003316 | Bacteria | 3992 |
| 21 | rootH2_10062714 | 3300003320 | Bacteria | 3198 |
| 22 | rootH2_10295700 | 3300003320 | Bacteria | 4693 |
| 23 | rootL2_10030614 | 3300003322 | Bacteria | 8189 |
| 24 | rootL2_10266319 | 3300003322 | Bacteria | 1855 |
| 25 | rootL2_10290088 | 3300003322 | Bacteria | 1322 |
| 26 | Ga0055532_1000284 | 3300003758 | Bacteria | 32514 |
| 27 | Ga0055527_1000313 | 3300003760 | Bacteria | 26120 |
| 28 | Ga0055535_1000539 | 3300003761 | Bacteria | 32550 |
| 29 | Ga0055542_1000566 | 3300003762 | Bacteria | 32550 |
| 30 | Ga0055529_1000536 | 3300003763 | Bacteria | 32550 |
| 31 | Ga0055526_1000046 | 3300003771 | Bacteria | 120614 |
| 32 | Ga0055526_1001445 | 3300003771 | Bacteria | 16887 |
| 33 | Ga0055526_1005130 | 3300003771 | Bacteria | 7638 |
| 34 | Ga0055524_1003093 | 3300003775 | Bacteria | 8216 |
| 35 | Ga0055536_1034238 | 3300003781 | Bacteria | 1285 |
| 36 | Ga0055534_1001027 | 3300003784 | Bacteria | 12210 |
| 37 | Ga0055528_1003289 | 3300003790 | Bacteria | 8216 |
| 38 | Ga0055530_10000002 | 3300003791 | Bacteria | 300466 |
| 39 | Ga0055540_1000009 | 3300003792 | Bacteria | 300466 |
| 40 | Ga0055541_1002938 | 3300003841 | Bacteria | 3289 |
| 41 | Ga0058692_1000656 | 3300003856 | Bacteria | 14297 |
| 42 | Ga0058692_1001690 | 3300003856 | Bacteria | 7911 |
| 43 | Ga0058692_1002190 | 3300003856 | Bacteria | 6667 |
| 44 | Ga0058692_1002228 | 3300003856 | Bacteria | 6588 |
| 45 | Ga0058692_1013806 | 3300003856 | Bacteria | 1869 |
| 46 | Ga0065165_1026239 | 3300005262 | Bacteria | 1920 |
| 47 | Ga0065704_10119594 | 3300005289 | Bacteria | 1797 |
| 48 | Ga0070658_10017861 | 3300005327 | Bacteria | 5673 |
| 49 | Ga0070658_10274817 | 3300005327 | Bacteria | 1433 |
| 50 | Ga0070660_100117882 | 3300005339 | Bacteria | 2117 |
| 51 | Ga0070661_100035472 | 3300005344 | Bacteria | 3622 |
| 52 | Ga0070661_100110686 | 3300005344 | Bacteria | 2050 |
| 53 | Ga0070659_100032579 | 3300005366 | Bacteria | 4043 |
| 54 | Ga0070659_100260263 | 3300005366 | Bacteria | 1439 |
| 55 | Ga0070667_100486324 | 3300005367 | Bacteria | 1130 |
| 56 | Ga0070709_10289311 | 3300005434 | Bacteria | 1193 |
| 57 | Ga0070708_100024397 | 3300005445 | Bacteria | 5159 |
| 58 | Ga0070663_100003167 | 3300005455 | Bacteria | 9441 |
| 59 | Ga0070662_100012478 | 3300005457 | Bacteria | 5635 |
| 60 | Ga0070681_10124825 | 3300005458 | Bacteria | 2507 |
| 61 | Ga0070679_100467822 | 3300005530 | Bacteria | 1205 |
| 62 | Ga0068853_100003004 | 3300005539 | Bacteria | 12869 |
| 63 | Ga0070672_100292849 | 3300005543 | Bacteria | 1378 |
| 64 | Ga0068855_100001434 | 3300005563 | Bacteria | 29666 |
| 65 | Ga0068855_100006170 | 3300005563 | Bacteria | 14615 |
| 66 | Ga0068855_100008770 | 3300005563 | Bacteria | 12223 |
| 67 | Ga0068855_100639907 | 3300005563 | Bacteria | 1143 |
| 68 | Ga0070664_100021923 | 3300005564 | Bacteria | 5267 |
| 69 | Ga0070664_100049201 | 3300005564 | Bacteria | 3564 |
| 70 | Ga0068857_100023547 | 3300005577 | Bacteria | 5421 |
| 71 | Ga0068857_100146831 | 3300005577 | Bacteria | 2134 |
| 72 | Ga0068854_100011318 | 3300005578 | Bacteria | 5802 |
| 73 | Ga0068854_100022527 | 3300005578 | Bacteria | 4294 |
| 74 | Ga0068854_100026953 | 3300005578 | Bacteria | 3954 |
| 75 | Ga0068854_100101726 | 3300005578 | Bacteria | 2155 |
| 76 | Ga0068856_100359604 | 3300005614 | Bacteria | 1474 |
| 77 | Ga0068852_100052480 | 3300005616 | Bacteria | 3504 |
| 78 | Ga0068851_10001303 | 3300005834 | Bacteria | 10881 |
| 79 | Ga0068851_10012595 | 3300005834 | Bacteria | 3990 |
| 80 | Ga0081455_10096976 | 3300005937 | Bacteria | 2377 |
| 81 | Ga0075365_10086137 | 3300006038 | Bacteria | 2135 |
| 82 | Ga0070716_100399959 | 3300006173 | Bacteria | 987 |
| 83 | Ga0075362_10027427 | 3300006177 | Bacteria | 2439 |
| 84 | Ga0075369_10018717 | 3300006186 | Bacteria | 2822 |
| 85 | Ga0075366_10054159 | 3300006195 | Bacteria | 2383 |
| 86 | Ga0075370_10282953 | 3300006353 | Bacteria | 985 |
| 87 | Ga0075370_10339046 | 3300006353 | Bacteria | 897 |
| 88 | Ga0075434_100623264 | 3300006871 | Bacteria | 1097 |
| 89 | Ga0079104_1000132 | 3300006946 | Bacteria | 106080 |
| 90 | Ga0079104_1000203 | 3300006946 | Bacteria | 83190 |
| 91 | Ga0079104_1003432 | 3300006946 | Bacteria | 7379 |
| 92 | Ga0105251_10000356 | 3300009011 | Bacteria | 45089 |
| 93 | Ga0105251_10000769 | 3300009011 | Bacteria | 29167 |
| 94 | Ga0105251_10012640 | 3300009011 | Bacteria | 4768 |
| 95 | Ga0105244_10001922 | 3300009036 | Bacteria | 16144 |
| 96 | Ga0105244_10004262 | 3300009036 | Bacteria | 9921 |
| 97 | Ga0105244_10044564 | 3300009036 | Bacteria | 2285 |
| 98 | Ga0105250_10002204 | 3300009092 | Bacteria | 9931 |
| 99 | Ga0105240_10008537 | 3300009093 | Bacteria | 14639 |
| 100 | Ga0105240_10039399 | 3300009093 | Bacteria | 6051 |
| 101 | Ga0105240_10250248 | 3300009093 | Bacteria | 2050 |
| 102 | Ga0105247_10111565 | 3300009101 | Bacteria | 1761 |
| 103 | Ga0105237_10000038 | 3300009545 | Bacteria | 190707 |
| 104 | Ga0105237_10026074 | 3300009545 | Bacteria | 5974 |
| 105 | Ga0105237_10121606 | 3300009545 | Bacteria | 2605 |
| 106 | Ga0105238_10000113 | 3300009551 | Bacteria | 89675 |
| 107 | Ga0105238_10070171 | 3300009551 | Bacteria | 3504 |
| 108 | Ga0105239_10000108 | 3300010375 | Bacteria | 116364 |
| 109 | Ga0105239_10000289 | 3300010375 | Bacteria | 74109 |
| 110 | Ga0105239_10089321 | 3300010375 | Bacteria | 3398 |
| 111 | Ga0105239_10129259 | 3300010375 | Bacteria | 2808 |
| 112 | Ga0157371_10036811 | 3300013102 | Bacteria | 3504 |
| 113 | Ga0157370_10032974 | 3300013104 | Bacteria | 5052 |
| 114 | Ga0157370_10063322 | 3300013104 | Bacteria | 3504 |
| 115 | Ga0157369_10084304 | 3300013105 | Bacteria | 3397 |
| 116 | Ga0157369_10127899 | 3300013105 | Bacteria | 2692 |
| 117 | Ga0157378_10169053 | 3300013297 | Bacteria | 2049 |
| 118 | Ga0157378_10523116 | 3300013297 | Unclassified | 1188 |
| 119 | Ga0157372_10011302 | 3300013307 | Bacteria | 9499 |
| 120 | Ga0157372_10567604 | 3300013307 | Bacteria | 1323 |
| 121 | Ga0182008_10003440 | 3300014497 | Bacteria | 9555 |
| 122 | Ga0182008_10006469 | 3300014497 | Bacteria | 6546 |
| 123 | Ga0182008_10017810 | 3300014497 | Bacteria | 3682 |
| 124 | Ga0182006_1000021 | 3300015261 | Bacteria | 280808 |
| 125 | Ga0182006_1000133 | 3300015261 | Bacteria | 80418 |
| 126 | Ga0182006_1000828 | 3300015261 | Bacteria | 20724 |
| 127 | Ga0182006_1006409 | 3300015261 | Bacteria | 5472 |
| 128 | Ga0182006_1011619 | 3300015261 | Bacteria | 3870 |
| 129 | Ga0182006_1041071 | 3300015261 | Bacteria | 1818 |
| 130 | Ga0182007_10000890 | 3300015262 | Bacteria | 16558 |
| 131 | Ga0182007_10004221 | 3300015262 | Bacteria | 6567 |
| 132 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 133 | Ga0182005_1012297 | 3300015265 | Bacteria | 2420 |
| 134 | Ga0182005_1019100 | 3300015265 | Bacteria | 1891 |
| 135 | Ga0213872_10016149 | 3300021361 | Bacteria | 3466 |
| 136 | Ga0209435_100069 | 3300025206 | Bacteria | 64808 |
| 137 | Ga0209566_100201 | 3300025225 | Bacteria | 61860 |
| 138 | Ga0209674_101903 | 3300025226 | Bacteria | 4912 |
| 139 | Ga0209672_100200 | 3300025228 | Bacteria | 47502 |
| 140 | Ga0209147_100265 | 3300025229 | Bacteria | 47502 |
| 141 | Ga0209258_100439 | 3300025242 | Bacteria | 47500 |
| 142 | Ga0207425_1000966 | 3300025245 | Bacteria | 13521 |
| 143 | Ga0209646_1000108 | 3300025246 | Bacteria | 158853 |
| 144 | Ga0209026_1003394 | 3300025250 | Bacteria | 5254 |
| 145 | Ga0209148_1000422 | 3300025254 | Bacteria | 47502 |
| 146 | Ga0209759_1000173 | 3300025256 | Bacteria | 107724 |
| 147 | Ga0209759_1007482 | 3300025256 | Bacteria | 3507 |
| 148 | Ga0209129_1002466 | 3300025258 | Bacteria | 9056 |
| 149 | Ga0209233_1017020 | 3300025261 | Bacteria | 1990 |
| 150 | Ga0209455_1000322 | 3300025272 | Bacteria | 47502 |
| 151 | Ga0209673_1000621 | 3300025273 | Bacteria | 54117 |
| 152 | Ga0209675_1001449 | 3300025291 | Bacteria | 13701 |
| 153 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 154 | Ga0209676_1002272 | 3300025292 | Bacteria | 14115 |
| 155 | Ga0209676_1002993 | 3300025292 | Bacteria | 10996 |
| 156 | Ga0209676_1027871 | 3300025292 | Bacteria | 1770 |
| 157 | Ga0209025_1000055 | 3300025294 | Bacteria | 316748 |
| 158 | Ga0209025_1001131 | 3300025294 | Bacteria | 38214 |
| 159 | Ga0209025_1004585 | 3300025294 | Bacteria | 11852 |
| 160 | Ga0209564_1000277 | 3300025295 | Bacteria | 105818 |
| 161 | Ga0209564_1001607 | 3300025295 | Bacteria | 21963 |
| 162 | Ga0209564_1006862 | 3300025295 | Bacteria | 6009 |
| 163 | Ga0209758_1007033 | 3300025297 | Bacteria | 7813 |
| 164 | Ga0209758_1010525 | 3300025297 | Bacteria | 5517 |
| 165 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 166 | Ga0209050_1000402 | 3300025298 | Bacteria | 80873 |
| 167 | Ga0209050_1000638 | 3300025298 | Bacteria | 54267 |
| 168 | Ga0209050_1004144 | 3300025298 | Bacteria | 10048 |
| 169 | Ga0209050_1015329 | 3300025298 | Bacteria | 3226 |
| 170 | Ga0209256_1000176 | 3300025299 | Bacteria | 126545 |
| 171 | Ga0209256_1000565 | 3300025299 | Bacteria | 52844 |
| 172 | Ga0209256_1003140 | 3300025299 | Bacteria | 12033 |
| 173 | Ga0209256_1036857 | 3300025299 | Bacteria | 1280 |
| 174 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 175 | Ga0209051_1005572 | 3300025303 | Bacteria | 7317 |
| 176 | Ga0209257_1012568 | 3300025304 | Bacteria | 3895 |
| 177 | Ga0207656_10000147 | 3300025321 | Bacteria | 26381 |
| 178 | Ga0207696_1002130 | 3300025711 | Bacteria | 9939 |
| 179 | Ga0207655_1065809 | 3300025728 | Bacteria | 1373 |
| 180 | Ga0207713_1000173 | 3300025735 | Bacteria | 92859 |
| 181 | Ga0207713_1003281 | 3300025735 | Bacteria | 11130 |
| 182 | Ga0207710_10144539 | 3300025900 | Bacteria | 1150 |
| 183 | Ga0207647_10028441 | 3300025904 | Bacteria | 3630 |
| 184 | Ga0207647_10028600 | 3300025904 | Bacteria | 3618 |
| 185 | Ga0207699_10257948 | 3300025906 | Bacteria | 1204 |
| 186 | Ga0207705_10023962 | 3300025909 | Bacteria | 4356 |
| 187 | Ga0207705_10228503 | 3300025909 | Bacteria | 1415 |
| 188 | Ga0207695_10034752 | 3300025913 | Bacteria | 5477 |
| 189 | Ga0207695_10621604 | 3300025913 | Bacteria | 961 |
| 190 | Ga0207671_10000045 | 3300025914 | Bacteria | 201245 |
| 191 | Ga0207671_10055090 | 3300025914 | Bacteria | 2946 |
| 192 | Ga0207671_10108299 | 3300025914 | Bacteria | 2112 |
| 193 | Ga0207657_10051927 | 3300025919 | Bacteria | 3562 |
| 194 | Ga0207649_10050358 | 3300025920 | Bacteria | 2576 |
| 195 | Ga0207652_10419613 | 3300025921 | Bacteria | 1207 |
| 196 | Ga0207694_10000075 | 3300025924 | Bacteria | 114693 |
| 197 | Ga0207694_10004601 | 3300025924 | Bacteria | 10741 |
| 198 | Ga0207694_10082401 | 3300025924 | Bacteria | 2529 |
| 199 | Ga0207659_10082640 | 3300025926 | Bacteria | 2378 |
| 200 | Ga0207690_10056761 | 3300025932 | Bacteria | 2643 |
| 201 | Ga0207690_10100616 | 3300025932 | Bacteria | 2063 |
| 202 | Ga0207706_10013921 | 3300025933 | Bacteria | 7294 |
| 203 | Ga0207706_10065602 | 3300025933 | Bacteria | 3197 |
| 204 | Ga0207706_10397731 | 3300025933 | Bacteria | 1195 |
| 205 | Ga0207691_10074219 | 3300025940 | Bacteria | 3068 |
| 206 | Ga0207691_10407896 | 3300025940 | Bacteria | 1159 |
| 207 | Ga0207679_10058513 | 3300025945 | Bacteria | 2856 |
| 208 | Ga0207679_10182669 | 3300025945 | Bacteria | 1736 |
| 209 | Ga0207667_10000110 | 3300025949 | Bacteria | 131872 |
| 210 | Ga0207667_10008274 | 3300025949 | Bacteria | 12377 |
| 211 | Ga0207667_10014624 | 3300025949 | Bacteria | 8936 |
| 212 | Ga0207667_10358060 | 3300025949 | Bacteria | 1488 |
| 213 | Ga0207640_10008103 | 3300025981 | Bacteria | 5816 |
| 214 | Ga0207640_10020501 | 3300025981 | Bacteria | 3926 |
| 215 | Ga0207640_10064184 | 3300025981 | Bacteria | 2444 |
| 216 | Ga0207640_10085884 | 3300025981 | Bacteria | 2165 |
| 217 | Ga0207658_10453019 | 3300025986 | Bacteria | 1136 |
| 218 | Ga0207639_10021179 | 3300026041 | Bacteria | 4666 |
| 219 | Ga0207678_10004943 | 3300026067 | Bacteria | 11966 |
| 220 | Ga0207674_10031842 | 3300026116 | Bacteria | 5535 |
| 221 | Ga0207674_10038235 | 3300026116 | Bacteria | 4985 |
| 222 | Ga0207674_10218567 | 3300026116 | Bacteria | 1854 |
| 223 | Ga0207674_10299265 | 3300026116 | Bacteria | 1558 |
| 224 | Ga0207698_10013615 | 3300026142 | Bacteria | 5376 |
| 225 | Ga0209281_1000061 | 3300027111 | Bacteria | 293814 |
| 226 | Ga0209281_1000338 | 3300027111 | Bacteria | 79936 |
| 227 | Ga0209281_1002766 | 3300027111 | Bacteria | 6523 |
| 228 | Ga0209371_1000017 | 3300027312 | Bacteria | 625776 |
| 229 | Ga0209371_1000104 | 3300027312 | Bacteria | 148080 |
| 230 | Ga0209371_1000261 | 3300027312 | Bacteria | 62369 |
| 231 | Ga0209371_1000735 | 3300027312 | Bacteria | 27499 |
| 232 | Ga0209371_1001024 | 3300027312 | Bacteria | 21216 |
| 233 | Ga0209371_1001702 | 3300027312 | Bacteria | 13942 |
| 234 | Ga0209371_1002099 | 3300027312 | Bacteria | 11822 |
| 235 | Ga0209371_1013351 | 3300027312 | Bacteria | 2312 |
| 236 | Ga0209371_1013910 | 3300027312 | Bacteria | 2232 |
| 237 | Ga0265338_10193551 | 3300028800 | Bacteria | 1539 |
| 238 | Ga0268256_1000017 | 3300030500 | Bacteria | 600718 |
| 239 | Ga0268256_1000091 | 3300030500 | Bacteria | 148069 |
| 240 | Ga0268256_1000221 | 3300030500 | Bacteria | 62368 |
| 241 | Ga0268256_1000625 | 3300030500 | Bacteria | 27486 |
| 242 | Ga0268256_1001484 | 3300030500 | Bacteria | 13942 |
| 243 | Ga0268256_1001761 | 3300030500 | Bacteria | 12220 |
| 244 | Ga0268256_1014690 | 3300030500 | Bacteria | 2312 |
| 245 | Ga0268256_1015407 | 3300030500 | Bacteria | 2232 |
| 246 | Ga0268256_1025257 | 3300030500 | Bacteria | 1512 |
| 247 | Ga0316181_1099275 | 3300030744 | Bacteria | 3002 |
| 248 | Ga0265320_10004108 | 3300031240 | Archaea | 9566 |
| 249 | Ga0265316_10016742 | 3300031344 | Bacteria | 6351 |
| 250 | Ga0307408_100000496 | 3300031548 | Bacteria | 34230 |
| 251 | Ga0265314_10089573 | 3300031711 | Bacteria | 2006 |
| 252 | Ga0307405_10000146 | 3300031731 | Bacteria | 27243 |
| 253 | Ga0307405_10007923 | 3300031731 | Bacteria | 5354 |
| 254 | Ga0307405_10147446 | 3300031731 | Bacteria | 1650 |
| 255 | Ga0307410_10039396 | 3300031852 | Bacteria | 3102 |
| 256 | Ga0307406_10000533 | 3300031901 | Bacteria | 21888 |
| 257 | Ga0307406_10016152 | 3300031901 | Bacteria | 4333 |
| 258 | Ga0307407_10076195 | 3300031903 | Bacteria | 2013 |
| 259 | Ga0307412_10000021 | 3300031911 | Bacteria | 250629 |
| 260 | Ga0307412_10000293 | 3300031911 | Bacteria | 31670 |
| 261 | Ga0307412_10000588 | 3300031911 | Bacteria | 21547 |
| 262 | Ga0307412_10001067 | 3300031911 | Bacteria | 15677 |
| 263 | Ga0307412_10002729 | 3300031911 | Bacteria | 9816 |
| 264 | Ga0307412_10003827 | 3300031911 | Bacteria | 8369 |
| 265 | Ga0307412_10016080 | 3300031911 | Bacteria | 4448 |
| 266 | Ga0307412_10051061 | 3300031911 | Bacteria | 2731 |
| 267 | Ga0307409_100010476 | 3300031995 | Bacteria | 5769 |
| 268 | Ga0307416_100027556 | 3300032002 | Bacteria | 4210 |
| 269 | Ga0307414_10048401 | 3300032004 | Bacteria | 2932 |
| 270 | Ga0307411_10015914 | 3300032005 | Bacteria | 4241 |
| 271 | Ga0307411_10195735 | 3300032005 | Bacteria | 1547 |
| 272 | Ga0307510_10341578 | 3300033180 | Bacteria | 949 |
| 273 | Ga0373954_0033662 | 3300035118 | Bacteria | 2371 |
| 274 | Ga0373927_0017128 | 3300035695 | Bacteria | 4774 |
| 275 | Ga0395899_0009592 | 3300037312 | Bacteria | 7430 |
| 276 | Ga0395899_0172005 | 3300037312 | Bacteria | 1525 |
| 277 | Ga0395899_0225791 | 3300037312 | Bacteria | 1295 |
| 278 | Ga0395899_0236053 | 3300037312 | Bacteria | 1260 |
| 279 | Ga0395900_0003038 | 3300037418 | Bacteria | 18275 |
| 280 | Ga0395900_0020385 | 3300037418 | Bacteria | 6767 |
| 281 | Ga0395900_0111243 | 3300037418 | Bacteria | 2813 |
| 282 | Ga0395900_0154581 | 3300037418 | Bacteria | 2343 |
| 283 | Ga0395900_0216071 | 3300037418 | Bacteria | 1934 |
| 284 | Ga0395900_0299259 | 3300037418 | Bacteria | 1595 |
| 285 | Ga0395900_0529340 | 3300037418 | Bacteria | 1125 |
| 286 | Ga0395898_0020964 | 3300037466 | Bacteria | 6631 |
| 287 | Ga0395898_0039617 | 3300037466 | Bacteria | 4663 |
| 288 | Ga0395898_0187136 | 3300037466 | Bacteria | 1978 |
| 289 | Ga0395898_0212647 | 3300037466 | Bacteria | 1844 |
| 290 | Ga0395898_0395158 | 3300037466 | Bacteria | 1318 |
| 291 | Ga0395905_0024058 | 3300037471 | Bacteria | 5748 |
| 292 | Ga0395905_0125591 | 3300037471 | Bacteria | 2412 |
| 293 | Ga0395901_0002761 | 3300038443 | Bacteria | 17695 |
| 294 | Ga0395901_0017776 | 3300038443 | Bacteria | 7258 |
| 295 | Ga0395901_0300410 | 3300038443 | Bacteria | 1664 |
| 296 | Ga0395901_0308878 | 3300038443 | Bacteria | 1638 |
| 297 | Ga0395901_0398512 | 3300038443 | Bacteria | 1414 |
| 298 | Ga0436361_0982462 | 3300039447 | Bacteria | 3746 |
| 299 | Ga0436362_0607000 | 3300039453 | Bacteria | 1026 |
| 300 | Ga0439436_0000004 | 3300041404 | Bacteria | 175137 |
| 301 | Ga0439465_0005025 | 3300041413 | Bacteria | 4249 |
| 302 | Ga0451841_1227815 | 3300041498 | Bacteria | 1709 |
| 303 | Ga0451845_0676067 | 3300041501 | Bacteria | 6832 |
| 304 | Ga0451845_0757030 | 3300041501 | Bacteria | 1569 |
| 305 | Ga0451849_0647590 | 3300041505 | Bacteria | 1260 |
| 306 | Ga0451849_0783247 | 3300041505 | Bacteria | 2077 |
| 307 | Ga0451851_0083621 | 3300041507 | Bacteria | 3922 |
| 308 | Ga0451853_0372391 | 3300041512 | Bacteria | 4474 |
| 309 | Ga0451853_1588158 | 3300041512 | Bacteria | 16227 |
| 310 | Ga0439448_0058928 | 3300042005 | Bacteria | 1267 |
| 311 | Ga0439432_000046 | 3300042006 | Bacteria | 37489 |
| 312 | Ga0439452_002719 | 3300042010 | Bacteria | 6412 |
| 313 | Ga0439463_000428 | 3300042016 | Bacteria | 11730 |
| 314 | Ga0439463_001729 | 3300042016 | Bacteria | 5696 |
| 315 | Ga0439458_0014536 | 3300042157 | Bacteria | 1777 |
| 316 | Ga0439460_0004486 | 3300042461 | Bacteria | 3403 |
| 317 | Ga0451577_0003066 | 3300042876 | Bacteria | 18912 |
| 318 | Ga0453683_0032497 | 3300044673 | Bacteria | 3293 |
| 319 | Ga0466965_0044765 | 3300044683 | Bacteria | 2188 |
| 320 | Ga0466966_0005946 | 3300044684 | Bacteria | 8051 |
| 321 | Ga0466966_0076288 | 3300044684 | Bacteria | 2093 |
| 322 | Ga0466961_0034846 | 3300044693 | Bacteria | 3232 |
| 323 | Ga0466961_0098739 | 3300044693 | Bacteria | 1841 |
| 324 | Ga0453684_0109875 | 3300044712 | Bacteria | 3352 |
| 325 | Ga0453684_0325207 | 3300044712 | Bacteria | 1740 |
| 326 | Ga0466968_0000252 | 3300044735 | Bacteria | 16931 |
| 327 | Ga0466968_0001162 | 3300044735 | Bacteria | 9333 |
| 328 | Ga0466968_0001355 | 3300044735 | Bacteria | 8750 |
| 329 | Ga0466957_0004847 | 3300044842 | Bacteria | 7527 |
| 330 | Ga0466957_0020666 | 3300044842 | Bacteria | 3875 |
| 331 | Ga0466957_0194640 | 3300044842 | Bacteria | 1329 |
| 332 | Ga0466957_0334546 | 3300044842 | Bacteria | 1024 |
| 333 | Ga0466957_0388405 | 3300044842 | Bacteria | 953 |
| 334 | Ga0466960_0007900 | 3300044901 | Bacteria | 4341 |
| 335 | Ga0466959_0009671 | 3300045049 | Bacteria | 6863 |
| 336 | Ga0451576_0015427 | 3300045051 | Bacteria | 8464 |
| 337 | Ga0451576_0326133 | 3300045051 | Bacteria | 1607 |
| 338 | Ga0466958_0024632 | 3300045836 | Bacteria | 3541 |
| 339 | Ga0466958_0209648 | 3300045836 | Bacteria | 1241 |
| 340 | Ga0466967_0039746 | 3300045976 | Bacteria | 4046 |
| 341 | Ga0495617_001589 | 3300046452 | Bacteria | 9814 |
| 342 | Ga0495617_017344 | 3300046452 | Bacteria | 2432 |
| 343 | Ga0495627_005467 | 3300046453 | Bacteria | 5117 |
| 344 | Ga0495627_020344 | 3300046453 | Bacteria | 2213 |
| 345 | Ga0495592_0008506 | 3300046454 | Bacteria | 7703 |
| 346 | Ga0495603_0010045 | 3300046455 | Bacteria | 5726 |
| 347 | Ga0495590_0000134 | 3300046457 | Bacteria | 43957 |
| 348 | Ga0495590_0012826 | 3300046457 | Bacteria | 3095 |
| 349 | Ga0495591_000664 | 3300046458 | Bacteria | 25437 |
| 350 | Ga0495591_001628 | 3300046458 | Bacteria | 13590 |
| 351 | Ga0495591_002206 | 3300046458 | Bacteria | 11117 |
| 352 | Ga0495591_002641 | 3300046458 | Bacteria | 9801 |
| 353 | Ga0495591_006302 | 3300046458 | Bacteria | 5273 |
| 354 | Ga0495591_017210 | 3300046458 | Bacteria | 2491 |
| 355 | Ga0495629_0034053 | 3300046459 | Bacteria | 3601 |
| 356 | Ga0495629_0153340 | 3300046459 | Bacteria | 1601 |
| 357 | Ga0495641_0077978 | 3300046461 | Bacteria | 1485 |
| 358 | Ga0495651_0088505 | 3300046462 | Bacteria | 2327 |
| 359 | Ga0495651_0151542 | 3300046462 | Bacteria | 1671 |
| 360 | Ga0495653_0000014 | 3300046463 | Bacteria | 215253 |
| 361 | Ga0495653_0017374 | 3300046463 | Bacteria | 5851 |
| 362 | Ga0495653_0287608 | 3300046463 | Bacteria | 1076 |
| 363 | Ga0495650_0000395 | 3300046471 | Bacteria | 73239 |
| 364 | Ga0495650_0000477 | 3300046471 | Bacteria | 61376 |
| 365 | Ga0495650_0005567 | 3300046471 | Bacteria | 8125 |
| 366 | Ga0495650_0061847 | 3300046471 | Bacteria | 1498 |
| 367 | Ga0495580_0048110 | 3300046472 | Bacteria | 3022 |
| 368 | Ga0495580_0051544 | 3300046472 | Bacteria | 2909 |
| 369 | Ga0495580_0167604 | 3300046472 | Bacteria | 1519 |
| 370 | Ga0495582_0032514 | 3300046473 | Bacteria | 2868 |
| 371 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 372 | Ga0495605_0000128 | 3300046474 | Bacteria | 100439 |
| 373 | Ga0495605_0001426 | 3300046474 | Bacteria | 15680 |
| 374 | Ga0495605_0001502 | 3300046474 | Bacteria | 15196 |
| 375 | Ga0495605_0004552 | 3300046474 | Bacteria | 8118 |
| 376 | Ga0495605_0019847 | 3300046474 | Bacteria | 3581 |
| 377 | Ga0495664_0011943 | 3300046477 | Bacteria | 4906 |
| 378 | Ga0495664_0316595 | 3300046477 | Bacteria | 941 |
| 379 | Ga0495584_0000276 | 3300046491 | Bacteria | 36518 |
| 380 | Ga0495584_0004273 | 3300046491 | Bacteria | 7700 |
| 381 | Ga0495584_0004668 | 3300046491 | Bacteria | 7342 |
| 382 | Ga0495584_0065569 | 3300046491 | Bacteria | 1827 |
| 383 | Ga0495584_0260839 | 3300046491 | Bacteria | 881 |
| 384 | Ga0495585_0000431 | 3300046492 | Bacteria | 40250 |
| 385 | Ga0495585_0002527 | 3300046492 | Bacteria | 13000 |
| 386 | Ga0495585_0016035 | 3300046492 | Bacteria | 4343 |
| 387 | Ga0495585_0056107 | 3300046492 | Unclassified | 2176 |
| 388 | Ga0495585_0095284 | 3300046492 | Bacteria | 1598 |
| 389 | Ga0495594_0001858 | 3300046499 | Bacteria | 10988 |
| 390 | Ga0495594_0008275 | 3300046499 | Bacteria | 5355 |
| 391 | Ga0495596_0008499 | 3300046500 | Bacteria | 4566 |
| 392 | Ga0495596_0013598 | 3300046500 | Bacteria | 3445 |
| 393 | Ga0495596_0045876 | 3300046500 | Bacteria | 1717 |
| 394 | Ga0495596_0131530 | 3300046500 | Unclassified | 971 |
| 395 | Ga0495607_0000053 | 3300046501 | Bacteria | 118035 |
| 396 | Ga0495607_0000091 | 3300046501 | Bacteria | 93971 |
| 397 | Ga0495607_0000796 | 3300046501 | Bacteria | 29891 |
| 398 | Ga0495607_0005144 | 3300046501 | Bacteria | 9449 |
| 399 | Ga0495607_0005520 | 3300046501 | Bacteria | 9022 |
| 400 | Ga0495607_0009605 | 3300046501 | Bacteria | 6538 |
| 401 | Ga0495607_0011329 | 3300046501 | Bacteria | 5943 |
| 402 | Ga0495607_0024909 | 3300046501 | Bacteria | 3725 |
| 403 | Ga0495607_0199214 | 3300046501 | Bacteria | 992 |
| 404 | Ga0495583_0000211 | 3300046506 | Bacteria | 98257 |
| 405 | Ga0495583_0001129 | 3300046506 | Bacteria | 29317 |
| 406 | Ga0495583_0001581 | 3300046506 | Bacteria | 22479 |
| 407 | Ga0495583_0002351 | 3300046506 | Bacteria | 16376 |
| 408 | Ga0495583_0003844 | 3300046506 | Bacteria | 11127 |
| 409 | Ga0495583_0061663 | 3300046506 | Bacteria | 1672 |
| 410 | Ga0495583_0138171 | 3300046506 | Bacteria | 1016 |
| 411 | Ga0495606_0000022 | 3300046507 | Bacteria | 265567 |
| 412 | Ga0495606_0000085 | 3300046507 | Bacteria | 158006 |
| 413 | Ga0495606_0000498 | 3300046507 | Bacteria | 64198 |
| 414 | Ga0495606_0000701 | 3300046507 | Bacteria | 51937 |
| 415 | Ga0495606_0001498 | 3300046507 | Bacteria | 31033 |
| 416 | Ga0495606_0022604 | 3300046507 | Bacteria | 4576 |
| 417 | Ga0495606_0024860 | 3300046507 | Bacteria | 4304 |
| 418 | Ga0495606_0059724 | 3300046507 | Bacteria | 2445 |
| 419 | Ga0495606_0128269 | 3300046507 | Bacteria | 1510 |
| 420 | Ga0495606_0184118 | 3300046507 | Bacteria | 1202 |
| 421 | Ga0495610_0000261 | 3300046512 | Bacteria | 55310 |
| 422 | Ga0495610_0001663 | 3300046512 | Bacteria | 19543 |
| 423 | Ga0495610_0009971 | 3300046512 | Bacteria | 5940 |
| 424 | Ga0495610_0093707 | 3300046512 | Bacteria | 1356 |
| 425 | Ga0495616_0002519 | 3300046513 | Bacteria | 12114 |
| 426 | Ga0495616_0095538 | 3300046513 | Bacteria | 1400 |
| 427 | Ga0495616_0106173 | 3300046513 | Bacteria | 1310 |
| 428 | Ga0495618_0009332 | 3300046514 | Bacteria | 5921 |
| 429 | Ga0495618_0065783 | 3300046514 | Bacteria | 2304 |
| 430 | Ga0495620_0000286 | 3300046515 | Bacteria | 36451 |
| 431 | Ga0495620_0001285 | 3300046515 | Bacteria | 15297 |
| 432 | Ga0495620_0002038 | 3300046515 | Bacteria | 11786 |
| 433 | Ga0495628_0031807 | 3300046516 | Bacteria | 4265 |
| 434 | Ga0495630_0000759 | 3300046517 | Bacteria | 22642 |
| 435 | Ga0495630_0130115 | 3300046517 | Bacteria | 1911 |
| 436 | Ga0495631_0000279 | 3300046518 | Bacteria | 35571 |
| 437 | Ga0495631_0001036 | 3300046518 | Bacteria | 17251 |
| 438 | Ga0495631_0003195 | 3300046518 | Bacteria | 9022 |
| 439 | Ga0495631_0043409 | 3300046518 | Bacteria | 1983 |
| 440 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 441 | Ga0495632_0000630 | 3300046519 | Bacteria | 32470 |
| 442 | Ga0495632_0009205 | 3300046519 | Bacteria | 5969 |
| 443 | Ga0495632_0016039 | 3300046519 | Bacteria | 4178 |
| 444 | Ga0495632_0021176 | 3300046519 | Bacteria | 3507 |
| 445 | Ga0495632_0022796 | 3300046519 | Bacteria | 3351 |
| 446 | Ga0495632_0048810 | 3300046519 | Bacteria | 2094 |
| 447 | Ga0495632_0067368 | 3300046519 | Bacteria | 1726 |
| 448 | Ga0495637_0000015 | 3300046520 | Bacteria | 228949 |
| 449 | Ga0495637_0000349 | 3300046520 | Bacteria | 35312 |
| 450 | Ga0495637_0001375 | 3300046520 | Bacteria | 14567 |
| 451 | Ga0495637_0005031 | 3300046520 | Bacteria | 6794 |
| 452 | Ga0495637_0014385 | 3300046520 | Bacteria | 3732 |
| 453 | Ga0495637_0107975 | 3300046520 | Bacteria | 1081 |
| 454 | Ga0495643_0001000 | 3300046522 | Bacteria | 28866 |
| 455 | Ga0495643_0005586 | 3300046522 | Bacteria | 8463 |
| 456 | Ga0495643_0012467 | 3300046522 | Bacteria | 5129 |
| 457 | Ga0495644_0000109 | 3300046523 | Bacteria | 39201 |
| 458 | Ga0495644_0001378 | 3300046523 | Bacteria | 9927 |
| 459 | Ga0495644_0004285 | 3300046523 | Bacteria | 5604 |
| 460 | Ga0495648_0000254 | 3300046524 | Bacteria | 60626 |
| 461 | Ga0495648_0000383 | 3300046524 | Bacteria | 48567 |
| 462 | Ga0495648_0001658 | 3300046524 | Bacteria | 21602 |
| 463 | Ga0495648_0001921 | 3300046524 | Bacteria | 19799 |
| 464 | Ga0495648_0002682 | 3300046524 | Bacteria | 16088 |
| 465 | Ga0495648_0018195 | 3300046524 | Bacteria | 4990 |
| 466 | Ga0495648_0049295 | 3300046524 | Bacteria | 2583 |
| 467 | Ga0495648_0053348 | 3300046524 | Bacteria | 2450 |
| 468 | Ga0495648_0107318 | 3300046524 | Bacteria | 1527 |
| 469 | Ga0495666_0002908 | 3300046526 | Bacteria | 8581 |
| 470 | Ga0495642_0007418 | 3300046528 | Bacteria | 4204 |
| 471 | Ga0495652_0007270 | 3300046529 | Bacteria | 10220 |
| 472 | Ga0495652_0040607 | 3300046529 | Bacteria | 4021 |
| 473 | Ga0495652_0212668 | 3300046529 | Bacteria | 1458 |
| 474 | Ga0495654_0001946 | 3300046530 | Bacteria | 13646 |
| 475 | Ga0495654_0007649 | 3300046530 | Bacteria | 6016 |
| 476 | Ga0495654_0012037 | 3300046530 | Bacteria | 4661 |
| 477 | Ga0495654_0015830 | 3300046530 | Bacteria | 3999 |
| 478 | Ga0495665_0080126 | 3300046531 | Bacteria | 1718 |
| 479 | Ga0495640_0049024 | 3300046533 | Bacteria | 2915 |
| 480 | Ga0495586_0032338 | 3300046535 | Bacteria | 2805 |
| 481 | Ga0495586_0116698 | 3300046535 | Bacteria | 1489 |
| 482 | Ga0495609_0000018 | 3300046538 | Bacteria | 302609 |
| 483 | Ga0495609_0000051 | 3300046538 | Bacteria | 153822 |
| 484 | Ga0495609_0000168 | 3300046538 | Bacteria | 68840 |
| 485 | Ga0495609_0006536 | 3300046538 | Bacteria | 5939 |
| 486 | Ga0495609_0022589 | 3300046538 | Bacteria | 2897 |
| 487 | Ga0495609_0099849 | 3300046538 | Bacteria | 1258 |
| 488 | Ga0495597_0001305 | 3300046542 | Bacteria | 18289 |
| 489 | Ga0495645_0151677 | 3300046543 | Bacteria | 1609 |
| 490 | Ga0495633_0000590 | 3300046558 | Bacteria | 35117 |
| 491 | Ga0495633_0004033 | 3300046558 | Bacteria | 9499 |
| 492 | Ga0495633_0008171 | 3300046558 | Bacteria | 5926 |
| 493 | Ga0495633_0010560 | 3300046558 | Bacteria | 5032 |
| 494 | Ga0495633_0077894 | 3300046558 | Unclassified | 1543 |
| 495 | Ga0495633_0117054 | 3300046558 | Bacteria | 1235 |
| 496 | Ga0495656_0112427 | 3300046615 | Bacteria | 1276 |
| 497 | Ga0495668_0000019 | 3300046616 | Bacteria | 416042 |
| 498 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 499 | Ga0495668_0000117 | 3300046616 | Bacteria | 122379 |
| 500 | Ga0495668_0003441 | 3300046616 | Bacteria | 11853 |
| 501 | Ga0495668_0013643 | 3300046616 | Bacteria | 4784 |
| 502 | Ga0495668_0020025 | 3300046616 | Bacteria | 3848 |
| 503 | Ga0495668_0022859 | 3300046616 | Bacteria | 3571 |
| 504 | Ga0495634_0015824 | 3300046642 | Bacteria | 5406 |
| 505 | Ga0495611_0001575 | 3300046648 | Bacteria | 11166 |
| 506 | Ga0495611_0002939 | 3300046648 | Bacteria | 7597 |
| 507 | Ga0495611_0013043 | 3300046648 | Bacteria | 3534 |
| 508 | Ga0495625_0042110 | 3300046660 | Bacteria | 3321 |
| 509 | Ga0495635_0006662 | 3300046663 | Bacteria | 8067 |
| 510 | Ga0495635_0008292 | 3300046663 | Bacteria | 7250 |
| 511 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 512 | Ga0495661_0000056 | 3300046665 | Bacteria | 138115 |
| 513 | Ga0495661_0004721 | 3300046665 | Bacteria | 9789 |
| 514 | Ga0495661_0011746 | 3300046665 | Bacteria | 5933 |
| 515 | Ga0495661_0012243 | 3300046665 | Bacteria | 5794 |
| 516 | Ga0495661_0013965 | 3300046665 | Bacteria | 5385 |
| 517 | Ga0495661_0014140 | 3300046665 | Bacteria | 5346 |
| 518 | Ga0495661_0021111 | 3300046665 | Bacteria | 4248 |
| 519 | Ga0495588_0000261 | 3300046674 | Bacteria | 42963 |
| 520 | Ga0495588_0182703 | 3300046674 | Bacteria | 1108 |
| 521 | Ga0495657_0046199 | 3300046675 | Bacteria | 2950 |
| 522 | Ga0495623_0103942 | 3300046679 | Bacteria | 1727 |
| 523 | Ga0495646_0039333 | 3300046680 | Bacteria | 2916 |
| 524 | Ga0495646_0098112 | 3300046680 | Bacteria | 1683 |
| 525 | Ga0495669_0002308 | 3300046684 | Bacteria | 7812 |
| 526 | Ga0495669_0010844 | 3300046684 | Bacteria | 3858 |
| 527 | Ga0495669_0015611 | 3300046684 | Bacteria | 3253 |
| 528 | Ga0495613_0168107 | 3300046689 | Bacteria | 1557 |
| 529 | Ga0495670_0013405 | 3300046691 | Bacteria | 4033 |
| 530 | Ga0495670_0041239 | 3300046691 | Bacteria | 2303 |
| 531 | Ga0495671_0000009 | 3300046692 | Bacteria | 369875 |
| 532 | Ga0495671_0000420 | 3300046692 | Bacteria | 33802 |
| 533 | Ga0495671_0004110 | 3300046692 | Bacteria | 8773 |
| 534 | Ga0495671_0020652 | 3300046692 | Bacteria | 3468 |
| 535 | Ga0495671_0077495 | 3300046692 | Bacteria | 1629 |
| 536 | Ga0495671_0219727 | 3300046692 | Bacteria | 920 |
| 537 | Ga0495671_0252539 | 3300046692 | Bacteria | 851 |
| 538 | Ga0495649_0001375 | 3300046694 | Bacteria | 18424 |
| 539 | Ga0495649_0002169 | 3300046694 | Bacteria | 14050 |
| 540 | Ga0495649_0085538 | 3300046694 | Bacteria | 1683 |
| 541 | Ga0495589_0000473 | 3300046794 | Bacteria | 29321 |
| 542 | Ga0495589_0002639 | 3300046794 | Bacteria | 9928 |
| 543 | Ga0495589_0019046 | 3300046794 | Bacteria | 3520 |
| 544 | Ga0495600_0007339 | 3300046809 | Bacteria | 6736 |
| 545 | Ga0495600_0014728 | 3300046809 | Bacteria | 4931 |
| 546 | Ga0495600_0049384 | 3300046809 | Bacteria | 2745 |
| 547 | Ga0495660_0001412 | 3300046810 | Bacteria | 16457 |
| 548 | Ga0495660_0001522 | 3300046810 | Bacteria | 15646 |
| 549 | Ga0495660_0001919 | 3300046810 | Bacteria | 13580 |
| 550 | Ga0495660_0011210 | 3300046810 | Bacteria | 5204 |
| 551 | Ga0495660_0066359 | 3300046810 | Bacteria | 1924 |
| 552 | Ga0495581_0020373 | 3300047315 | Bacteria | 3849 |
| 553 | Ga0495604_0024198 | 3300047317 | Bacteria | 4846 |
| 554 | Ga0495604_0051909 | 3300047317 | Bacteria | 3176 |
| 555 | Ga0495674_0016448 | 3300047319 | Bacteria | 6900 |
| 556 | Ga0495674_0035359 | 3300047319 | Bacteria | 4508 |
| 557 | Ga0495674_0369607 | 3300047319 | Bacteria | 1161 |
| 558 | Ga0495672_0000432 | 3300047320 | Bacteria | 50120 |
| 559 | Ga0495672_0000525 | 3300047320 | Bacteria | 43794 |
| 560 | Ga0495672_0000529 | 3300047320 | Bacteria | 43533 |
| 561 | Ga0495672_0000732 | 3300047320 | Bacteria | 36104 |
| 562 | Ga0495672_0000769 | 3300047320 | Bacteria | 34882 |
| 563 | Ga0495672_0007159 | 3300047320 | Bacteria | 8438 |
| 564 | Ga0495672_0015882 | 3300047320 | Bacteria | 5097 |
| 565 | Ga0495672_0126015 | 3300047320 | Bacteria | 1354 |
| 566 | Ga0495676_0000004 | 3300047321 | Bacteria | 313696 |
| 567 | Ga0495680_0016216 | 3300047322 | Bacteria | 6407 |
| 568 | Ga0495680_0032351 | 3300047322 | Bacteria | 4246 |
| 569 | Ga0495680_0079238 | 3300047322 | Bacteria | 2484 |
| 570 | Ga0495683_0000374 | 3300047323 | Bacteria | 36566 |
| 571 | Ga0495683_0003551 | 3300047323 | Bacteria | 9063 |
| 572 | Ga0495683_0004174 | 3300047323 | Bacteria | 8257 |
| 573 | Ga0495683_0010027 | 3300047323 | Bacteria | 5024 |
| 574 | Ga0495683_0013500 | 3300047323 | Bacteria | 4271 |
| 575 | Ga0495683_0025905 | 3300047323 | Bacteria | 3003 |
| 576 | Ga0495683_0082827 | 3300047323 | Bacteria | 1562 |
| 577 | Ga0495683_0087467 | 3300047323 | Bacteria | 1513 |
| 578 | Ga0495683_0129714 | 3300047323 | Bacteria | 1190 |
| 579 | Ga0495683_0159658 | 3300047323 | Unclassified | 1043 |
| 580 | Ga0495687_001917 | 3300047443 | Bacteria | 17860 |
| 581 | Ga0495687_003411 | 3300047443 | Bacteria | 11562 |
| 582 | Ga0495687_007220 | 3300047443 | Bacteria | 6601 |
| 583 | Ga0495687_020176 | 3300047443 | Bacteria | 3254 |
| 584 | Ga0495687_033197 | 3300047443 | Bacteria | 2344 |
| 585 | Ga0495675_0033332 | 3300047444 | Bacteria | 3288 |
| 586 | Ga0495675_0092941 | 3300047444 | Bacteria | 1892 |
| 587 | Ga0495677_0000361 | 3300047445 | Bacteria | 19630 |
| 588 | Ga0495677_0001955 | 3300047445 | Bacteria | 8226 |
| 589 | Ga0495677_0004524 | 3300047445 | Bacteria | 5323 |
| 590 | Ga0495679_000015 | 3300047446 | Bacteria | 287256 |
| 591 | Ga0495679_000744 | 3300047446 | Bacteria | 20874 |
| 592 | Ga0495679_012531 | 3300047446 | Bacteria | 3221 |
| 593 | Ga0495685_034125 | 3300047447 | Bacteria | 1748 |
| 594 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 595 | Ga0495673_0000032 | 3300047469 | Bacteria | 375856 |
| 596 | Ga0495673_0000292 | 3300047469 | Bacteria | 67107 |
| 597 | Ga0495673_0001595 | 3300047469 | Bacteria | 17672 |
| 598 | Ga0495673_0001788 | 3300047469 | Bacteria | 16309 |
| 599 | Ga0495673_0003532 | 3300047469 | Bacteria | 10292 |
| 600 | Ga0495673_0010862 | 3300047469 | Bacteria | 4927 |
| 601 | Ga0495673_0029761 | 3300047469 | Bacteria | 2574 |
| 602 | Ga0495673_0068479 | 3300047469 | Bacteria | 1499 |
| 603 | Ga0495681_0037898 | 3300047470 | Bacteria | 2369 |
| 604 | Ga0495684_0033332 | 3300047471 | Bacteria | 3952 |
| 605 | Ga0495684_0122244 | 3300047471 | Bacteria | 1960 |
| 606 | Ga0495686_0001068 | 3300047472 | Bacteria | 32627 |
| 607 | Ga0495686_0001432 | 3300047472 | Bacteria | 26052 |
| 608 | Ga0495686_0002004 | 3300047472 | Bacteria | 20174 |
| 609 | Ga0495686_0002642 | 3300047472 | Bacteria | 16562 |
| 610 | Ga0495686_0013979 | 3300047472 | Bacteria | 5549 |
| 611 | Ga0495686_0028821 | 3300047472 | Bacteria | 3614 |
| 612 | Ga0495686_0049126 | 3300047472 | Bacteria | 2655 |
| 613 | Ga0495686_0248863 | 3300047472 | Bacteria | 999 |
| 614 | Ga0495593_0047740 | 3300047673 | Bacteria | 2276 |
| 615 | Ga0495602_0024473 | 3300048088 | Bacteria | 5857 |
| 616 | Ga0495602_0045747 | 3300048088 | Bacteria | 3958 |
| 617 | Ga0495626_0000012 | 3300048091 | Bacteria | 258483 |
| 618 | Ga0495626_0000550 | 3300048091 | Bacteria | 37251 |
| 619 | Ga0495626_0005686 | 3300048091 | Bacteria | 7218 |
| 620 | Ga0495626_0008588 | 3300048091 | Bacteria | 5583 |
| 621 | Ga0495626_0172107 | 3300048091 | Bacteria | 902 |
| 622 | Ga0496100_0002600 | 3300048903 | Bacteria | 9204 |
| 623 | Ga0496100_0017905 | 3300048903 | Bacteria | 4192 |
| 624 | Ga0496101_0570802 | 3300048904 | Bacteria | 894 |
| 625 | Ga0496102_0001444 | 3300048905 | Bacteria | 21038 |
| 626 | Ga0496102_0042805 | 3300048905 | Bacteria | 4105 |
| 627 | Ga0496103_0000734 | 3300048906 | Bacteria | 24126 |
| 628 | Ga0496103_0004871 | 3300048906 | Bacteria | 8107 |
| 629 | Ga0496104_0000110 | 3300048907 | Bacteria | 77994 |
| 630 | Ga0496105_0232098 | 3300048908 | Bacteria | 1499 |
| 631 | Ga0496106_0211987 | 3300048909 | Bacteria | 1543 |
| 632 | Ga0496109_0840681 | 3300048912 | Bacteria | 856 |
| 633 | Ga0496110_0519563 | 3300048913 | Bacteria | 1083 |
| 634 | Ga0496114_0216222 | 3300048917 | Bacteria | 1682 |
| 635 | Ga0496116_0004036 | 3300048919 | Bacteria | 14208 |
| 636 | Ga0496116_0029046 | 3300048919 | Bacteria | 3992 |
| 637 | Ga0496116_0031164 | 3300048919 | Bacteria | 3822 |
| 638 | Ga0496116_0037446 | 3300048919 | Bacteria | 3383 |
| 639 | Ga0496116_0062507 | 3300048919 | Bacteria | 2404 |
| 640 | Ga0496117_0002291 | 3300048920 | Bacteria | 24692 |
| 641 | Ga0496117_0006577 | 3300048920 | Bacteria | 11694 |
| 642 | Ga0496117_0009529 | 3300048920 | Bacteria | 9017 |
| 643 | Ga0496117_0033321 | 3300048920 | Bacteria | 3897 |
| 644 | Ga0496117_0210897 | 3300048920 | Bacteria | 1089 |
| 645 | Ga0496118_0001035 | 3300048921 | Bacteria | 43294 |
| 646 | Ga0496118_0005824 | 3300048921 | Bacteria | 13812 |
| 647 | Ga0496118_0010884 | 3300048921 | Bacteria | 8948 |
| 648 | Ga0496118_0059946 | 3300048921 | Bacteria | 2829 |
| 649 | Ga0496118_0241430 | 3300048921 | Bacteria | 1034 |
| 650 | Ga0496119_0000417 | 3300048922 | Bacteria | 58548 |
| 651 | Ga0496119_0005043 | 3300048922 | Bacteria | 12833 |
| 652 | Ga0496119_0005126 | 3300048922 | Bacteria | 12695 |
| 653 | Ga0496119_0009416 | 3300048922 | Bacteria | 8387 |
| 654 | Ga0496119_0033975 | 3300048922 | Bacteria | 3369 |
| 655 | Ga0496119_0088366 | 3300048922 | Bacteria | 1767 |
| 656 | Ga0496120_0001322 | 3300048923 | Bacteria | 30608 |
| 657 | Ga0496120_0002817 | 3300048923 | Bacteria | 16797 |
| 658 | Ga0496120_0003406 | 3300048923 | Bacteria | 14541 |
| 659 | Ga0496120_0006611 | 3300048923 | Bacteria | 8842 |
| 660 | Ga0496120_0079612 | 3300048923 | Bacteria | 1778 |
| 661 | Ga0496121_0000444 | 3300048924 | Bacteria | 81596 |
| 662 | Ga0496121_0000936 | 3300048924 | Bacteria | 52789 |
| 663 | Ga0496121_0001548 | 3300048924 | Bacteria | 38493 |
| 664 | Ga0496121_0002548 | 3300048924 | Bacteria | 27634 |
| 665 | Ga0496121_0007028 | 3300048924 | Bacteria | 13673 |
| 666 | Ga0496121_0036106 | 3300048924 | Bacteria | 4410 |
| 667 | Ga0496121_0052686 | 3300048924 | Bacteria | 3414 |
| 668 | Ga0496121_0202791 | 3300048924 | Bacteria | 1412 |
| 669 | Ga0496122_0000920 | 3300048925 | Bacteria | 53931 |
| 670 | Ga0496122_0000961 | 3300048925 | Bacteria | 51914 |
| 671 | Ga0496122_0001281 | 3300048925 | Bacteria | 41818 |
| 672 | Ga0496122_0006050 | 3300048925 | Bacteria | 14099 |
| 673 | Ga0496122_0010980 | 3300048925 | Bacteria | 9254 |
| 674 | Ga0496122_0014123 | 3300048925 | Bacteria | 7744 |
| 675 | Ga0496122_0031786 | 3300048925 | Bacteria | 4381 |
| 676 | Ga0496122_0045935 | 3300048925 | Bacteria | 3388 |
| 677 | Ga0496122_0048785 | 3300048925 | Bacteria | 3251 |
| 678 | Ga0496122_0064518 | 3300048925 | Bacteria | 2664 |
| 679 | Ga0496123_0000301 | 3300048926 | Bacteria | 96158 |
| 680 | Ga0496123_0000315 | 3300048926 | Bacteria | 92845 |
| 681 | Ga0496123_0003524 | 3300048926 | Bacteria | 17435 |
| 682 | Ga0496123_0004053 | 3300048926 | Bacteria | 15787 |
| 683 | Ga0496123_0005838 | 3300048926 | Bacteria | 12203 |
| 684 | Ga0496123_0007296 | 3300048926 | Bacteria | 10487 |
| 685 | Ga0496123_0008946 | 3300048926 | Bacteria | 9106 |
| 686 | Ga0496123_0017221 | 3300048926 | Bacteria | 5828 |
| 687 | Ga0496123_0027488 | 3300048926 | Bacteria | 4236 |
| 688 | Ga0496123_0056631 | 3300048926 | Bacteria | 2560 |
| 689 | Ga0496123_0066063 | 3300048926 | Bacteria | 2294 |
| 690 | Ga0496123_0076156 | 3300048926 | Bacteria | 2067 |
| 691 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 692 | Ga0496124_0000188 | 3300048927 | Bacteria | 122361 |
| 693 | Ga0496124_0000284 | 3300048927 | Bacteria | 96345 |
| 694 | Ga0496124_0000293 | 3300048927 | Bacteria | 93590 |
| 695 | Ga0496124_0000674 | 3300048927 | Bacteria | 56134 |
| 696 | Ga0496124_0001109 | 3300048927 | Bacteria | 42348 |
| 697 | Ga0496124_0007208 | 3300048927 | Bacteria | 11880 |
| 698 | Ga0496124_0008028 | 3300048927 | Bacteria | 11101 |
| 699 | Ga0496124_0009058 | 3300048927 | Bacteria | 10295 |
| 700 | Ga0496124_0013847 | 3300048927 | Bacteria | 7844 |
| 701 | Ga0496124_0015652 | 3300048927 | Bacteria | 7258 |
| 702 | Ga0496124_0017190 | 3300048927 | Bacteria | 6829 |
| 703 | Ga0496124_0029271 | 3300048927 | Bacteria | 4911 |
| 704 | Ga0496124_0048548 | 3300048927 | Bacteria | 3626 |
| 705 | Ga0496124_0084389 | 3300048927 | Bacteria | 2605 |
| 706 | Ga0496124_0098106 | 3300048927 | Bacteria | 2378 |
| 707 | Ga0496124_0240360 | 3300048927 | Bacteria | 1347 |
| 708 | Ga0496124_0264308 | 3300048927 | Bacteria | 1264 |
| 709 | Ga0496125_0000259 | 3300048928 | Bacteria | 109184 |
| 710 | Ga0496125_0000561 | 3300048928 | Bacteria | 64016 |
| 711 | Ga0496125_0001676 | 3300048928 | Bacteria | 31048 |
| 712 | Ga0496125_0005984 | 3300048928 | Bacteria | 13313 |
| 713 | Ga0496125_0159619 | 3300048928 | Bacteria | 1534 |
| 714 | Ga0496126_0005432 | 3300048929 | Bacteria | 14531 |
| 715 | Ga0496126_0073801 | 3300048929 | Bacteria | 3032 |
| 716 | Ga0495678_000146 | 3300049459 | Bacteria | 85995 |
| 717 | Ga0495678_000273 | 3300049459 | Bacteria | 57219 |
| 718 | Ga0495678_000520 | 3300049459 | Bacteria | 37556 |
| 719 | Ga0495678_001866 | 3300049459 | Bacteria | 15348 |
| 720 | Ga0495678_003713 | 3300049459 | Bacteria | 9233 |
| 721 | Ga0495678_004000 | 3300049459 | Bacteria | 8795 |
| 722 | Ga0495678_077164 | 3300049459 | Bacteria | 1205 |
| 723 | Ga0495682_0000014 | 3300049460 | Bacteria | 249706 |
| 724 | Ga0495682_0006668 | 3300049460 | Bacteria | 4664 |
| 725 | Ga0495682_0009432 | 3300049460 | Bacteria | 3808 |
| 726 | Ga0495682_0014939 | 3300049460 | Bacteria | 2942 |
| 727 | Ga0495682_0037591 | 3300049460 | Bacteria | 1781 |
| 728 | Ga0501034_0439626 | 3300049571 | Bacteria | 1223 |
| 729 | Ga0501037_0006588 | 3300049573 | Bacteria | 8494 |
| 730 | Ga0501209_000017 | 3300049656 | Bacteria | 17319 |
| 731 | Ga0501249_000128 | 3300049679 | Bacteria | 23652 |
| 732 | Ga0501035_0014127 | 3300049822 | Bacteria | 7364 |
| 733 | nmdc:mga0yw44_79351_c1 | 3300050492 | Bacteria | 2053 |
| 734 | nmdc:mga0n895_341795_c1 | 3300050512 | Bacteria | 1516 |
| 735 | Ga0495601_0097921 | 3300053077 | Bacteria | 1892 |
| 736 | Ga0495619_0080979 | 3300053085 | Bacteria | 2186 |
| 737 | Ga0500618_000550 | 3300053125 | Bacteria | 23305 |
| 738 | Ga0500618_004669 | 3300053125 | Bacteria | 4316 |
| 739 | Ga0500618_012596 | 3300053125 | Bacteria | 2210 |
| 740 | Ga0500586_000731 | 3300053145 | Bacteria | 6740 |
| 741 | Ga0500645_000415 | 3300053730 | Bacteria | 29692 |
| 742 | Ga0500645_003031 | 3300053730 | Bacteria | 7079 |
| 743 | 2501085068 | 2501025502 | Bacteria | 9641094 |
| 744 | 2509391404 | 2509276021 | Bacteria | 7634384 |
| 745 | 2510282596 | 2510065053 | Bacteria | 5005518 |
| 746 | 2510295248 | 2510065055 | Bacteria | 5037935 |
| 747 | 2510311124 | 2510065058 | Bacteria | 5005894 |
| 748 | 2511090492 | 2510917013 | Bacteria | 9951648 |
| 749 | 2517098918 | 2517093000 | Bacteria | 7412387 |
| 750 | 2517098965 | 2517093000 | Bacteria | 7412387 |
| 751 | 2517407880 | 2517287029 | Bacteria | 6905599 |
| 752 | 2517407926 | 2517287029 | Bacteria | 6905599 |
| 753 | 2519460917 | 2519103095 | Bacteria | 6629912 |
| 754 | 2521560550 | 2521172590 | Bacteria | 5047645 |
| 755 | 2524610037 | 2524023250 | Bacteria | 5457705 |
| 756 | 2547697990 | 2547132181 | Bacteria | 4945084 |
| 757 | 2553005655 | 2551306416 | Bacteria | 6152985 |
| 758 | 2562464151 | 2561511199 | Bacteria | 5155034 |
| 759 | 2585283206 | 2582581308 | Bacteria | 7413247 |
| 760 | 2585283643 | 2582581308 | Bacteria | 7413247 |
| 761 | 2585289819 | 2582581311 | Bacteria | 6763856 |
| 762 | 2595451955 | 2593339239 | Bacteria | 4124669 |
| 763 | 2599723409 | 2599185236 | Bacteria | 6875203 |
| 764 | 2599907407 | 2599185292 | Bacteria | 6290804 |
| 765 | 2599944482 | 2599185302 | Bacteria | 5954930 |
| 766 | 2599954954 | 2599185304 | Bacteria | 5951361 |
| 767 | 2599970928 | 2599185307 | Bacteria | 6194719 |
| 768 | 2599984117 | 2599185309 | Bacteria | 5969593 |
| 769 | 2599988782 | 2599185310 | Bacteria | 6014457 |
| 770 | 2600001314 | 2599185312 | Bacteria | 5912071 |
| 771 | 2600049084 | 2599185320 | Bacteria | 5963263 |
| 772 | 2600203691 | 2599185354 | Bacteria | 4398675 |
| 773 | 2600446869 | 2600254954 | Bacteria | 5100516 |
| 774 | 2601531597 | 2600255256 | Bacteria | 5597742 |
| 775 | 2601536969 | 2600255257 | Bacteria | 5597196 |
| 776 | 2601623652 | 2600255283 | Bacteria | 6061572 |
| 777 | 2601628047 | 2600255283 | Bacteria | 6061572 |
| 778 | 2601755315 | 2600255310 | Bacteria | 5600903 |
| 779 | 2601760682 | 2600255311 | Bacteria | 5598766 |
| 780 | 2603639273 | 2602042046 | Bacteria | 5483348 |
| 781 | 2609913650 | 2609459761 | Bacteria | 5513740 |
| 782 | 2616309737 | 2615840626 | Bacteria | 7921970 |
| 783 | 2616313085 | 2615840626 | Bacteria | 7921970 |
| 784 | 2643797177 | 2643221556 | Bacteria | 7251154 |
| 785 | 2643863954 | 2643221569 | Bacteria | 6064337 |
| 786 | 2643979463 | 2643221594 | Bacteria | 5811388 |
| 787 | 2643982533 | 2643221594 | Bacteria | 5811388 |
| 788 | 2644469719 | 2643221684 | Bacteria | 7145183 |
| 789 | 2707100526 | 2706794495 | Bacteria | 4536932 |
| 790 | 2720617946 | 2718218233 | Bacteria | 6662049 |
| 791 | 2738712648 | 2738541275 | Bacteria | 4830863 |
| 792 | 2738801643 | 2738541293 | Bacteria | 7065685 |
| 793 | 2738818517 | 2738541296 | Bacteria | 7285013 |
| 794 | 2738827537 | 2738541297 | Bacteria | 6549566 |
| 795 | 2738831326 | 2738541298 | Bacteria | 7286732 |
| 796 | 2738851072 | 2738541301 | Bacteria | 4834102 |
| 797 | 2738866802 | 2738541304 | Bacteria | 4833665 |
| 798 | 2738872854 | 2738541306 | Bacteria | 7284992 |
| 799 | 2739034496 | 2738541333 | Bacteria | 7106503 |
| 800 | 2739151333 | 2738541357 | Bacteria | 6549408 |
| 801 | 2739184484 | 2738543002 | Bacteria | 7284546 |
| 802 | 2739193253 | 2738543003 | Bacteria | 6549560 |
| 803 | 2739219453 | 2738543008 | Bacteria | 7282815 |
| 804 | 2739299319 | 2738543022 | Bacteria | 4835059 |
| 805 | 2739319729 | 2738543026 | Bacteria | 6549408 |
| 806 | 2739337970 | 2738543029 | Bacteria | 6549249 |
| 807 | 2739360998 | 2738543033 | Bacteria | 4833336 |
| 808 | 2765570293 | 2765235838 | Bacteria | 5445269 |
| 809 | 2792313866 | 2791355010 | Bacteria | 4864581 |
| 810 | 2806069846 | 2802429636 | Bacteria | 7597525 |
| 811 | 2809034643 | 2808606395 | Bacteria | 6020352 |
| 812 | 2809035734 | 2808606395 | Bacteria | 6020352 |
| 813 | 2813730318 | 2811995292 | Bacteria | 5303342 |
| 814 | 2814697909 | 2814123068 | Bacteria | 5687681 |
| 815 | 2817259235 | 2816332253 | Bacteria | 6764532 |
| 816 | 2817280356 | 2816332256 | Bacteria | 6891714 |
| 817 | 2817452460 | 2816332286 | Bacteria | 6853759 |
| 818 | 2819554564 | 2818991438 | Bacteria | 5793701 |
| 819 | 2819555545 | 2818991438 | Bacteria | 5793701 |
| 820 | 2819561596 | 2818991439 | Bacteria | 6907412 |
| 821 | 2819565424 | 2818991440 | Bacteria | 4774720 |
| 822 | 2819617241 | 2818991449 | Bacteria | 5518009 |
| 823 | 2819635076 | 2818991452 | Bacteria | 8442785 |
| 824 | 2819687749 | 2818991461 | Bacteria | 7026071 |
| 825 | 2819713626 | 2818991466 | Bacteria | 4748179 |
| 826 | 2821129923 | 2821123053 | Bacteria | 7836056 |
| 827 | 2821136078 | 2821131069 | Bacteria | 6108407 |
| 828 | 2834644041 | 2834641062 | Bacteria | 5559922 |
| 829 | 2839096763 | 2839094727 | Bacteria | 5534556 |
| 830 | 2842316485 | 2842311132 | Bacteria | 6616990 |
| 831 | 2842920995 | 2842918807 | Bacteria | 4289178 |
| 832 | 2855736706 | 2855730933 | Bacteria | 7047938 |
| 833 | 2855773643 | 2855767633 | Bacteria | 7049357 |
| 834 | 2856290527 | 2856287931 | Bacteria | 7223934 |
| 835 | 2857359059 | 2857357740 | Bacteria | 9937880 |
| 836 | 2857565279 | 2857564685 | Bacteria | 6290584 |
| 837 | 2857577612 | 2857576091 | Bacteria | 5465855 |
| 838 | 2870072652 | 2870068957 | Bacteria | 8925310 |
| 839 | 2879164106 | 2879163058 | Bacteria | 4223965 |
| 840 | 2881417466 | 2881412998 | Bacteria | 6492157 |
| 841 | 2881418463 | 2881412998 | Bacteria | 6492157 |
| 842 | 2893070788 | 2893066018 | Bacteria | 6158120 |
| 843 | 2900638584 | 2900634093 | Bacteria | 10263517 |
| 844 | 2904442879 | 2904439833 | Bacteria | 5931679 |
| 845 | 2904466725 | 2904463128 | Bacteria | 4775606 |
| 846 | 2904479114 | 2904474040 | Bacteria | 5504324 |
| 847 | 2904534923 | 2904530477 | Bacteria | 5876334 |
| 848 | 2904570969 | 2904564687 | Bacteria | 7609577 |
| 849 | 2904578077 | 2904571731 | Bacteria | 7608790 |
| 850 | 2904588738 | 2904584206 | Bacteria | 6028872 |
| 851 | 2904594188 | 2904589729 | Bacteria | 6113573 |
| 852 | 2904604972 | 2904601388 | Bacteria | 5884906 |
| 853 | 2919048625 | 2919046199 | Bacteria | 5567169 |
| 854 | 2919083207 | 2919079590 | Bacteria | 5946433 |
| 855 | 2919119397 | 2919114240 | Bacteria | 5700270 |
| 856 | 2919140785 | 2919138771 | Bacteria | 5281312 |
| 857 | 2919155223 | 2919150387 | Bacteria | 5500879 |
| 858 | 2919405686 | 2919404418 | Bacteria | 4232372 |
| 859 | 2923514328 | 2923510766 | Bacteria | 5926163 |
| 860 | 2923586713 | 2923586266 | Bacteria | 6565975 |
| 861 | 2927148805 | 2927143783 | Bacteria | 5504251 |
| 862 | 2928102073 | 2928100450 | Bacteria | 4837635 |
| 863 | 2928133061 | 2928130867 | Bacteria | 5467269 |
| 864 | 2928530068 | 2928526807 | Bacteria | 4760224 |
| 865 | 2928543053 | 2928536128 | Bacteria | 7657547 |
| 866 | 2928962009 | 2928959182 | Bacteria | 4725774 |
| 867 | 2928969742 | 2928968154 | Bacteria | 4633371 |
| 868 | 2931369929 | 2931369376 | Bacteria | 6847892 |
| 869 | 2939603736 | 2939602548 | Bacteria | 4950493 |
| 870 | 2941482683 | |||
| 871 | 2945878088 | 2945874760 | Bacteria | 5527237 |
| 872 | 2945937232 | 2945934425 | Bacteria | 7444609 |
| 873 | 2953996263 | 2953994433 | Bacteria | 4303959 |
| 874 | 2984513908 | 2984509177 | Bacteria | 5274802 |
| 875 | 2984522940 | 2984518228 | Bacteria | 5277463 |
| 876 | 2984542523 | 2984537506 | Bacteria | 5277481 |
| 877 | 2984559301 | 2984559226 | Bacteria | 5683096 |
| 878 | 2984595828 | 2984595703 | Bacteria | 5682994 |
| 879 | 2984606631 | 2984601300 | Bacteria | 5455244 |
| 880 | 2990706033 | 2990703756 | Bacteria | 7715990 |
| 881 | 2998142270 | 2998139840 | Bacteria | 6073514 |
| 882 | 642425769 | 641736151 | Bacteria | 7477263 |
| 883 | 8005302010 | 8005301065 | Bacteria | 6614431 |
| 884 | 8005651172 | 8005645114 | Bacteria | 6950293 |
| 885 | 8018154934 | 8018150411 | Bacteria | 5549903 |
| 886 | 8020813093 | 8020807995 | Bacteria | 6801506 |
| 887 | 8034966093 | 8034962539 | Bacteria | 4884839 |
| 888 | 8040167750 | 8040167225 | Bacteria | 6542727 |
| 889 | 8040178507 | 8040173305 | Bacteria | 6827067 |
| 890 | 8047676539 | 8047673197 | Bacteria | 7395230 |
| 891 | 8054007532 | 8054002106 | Bacteria | 7987183 |
| 892 | 8055436186 | 8055431914 | Bacteria | 4551896 |
| 893 | Ga0495637_0000244 | |||
| 894 | JGI24736J21556_1001233 | |||
| 895 | JGI24736J21556_1001981 | |||
| 896 | JGI24741J21665_1000662 | |||
| 897 | JGI24740J21852_10000277 | |||
| 898 | JGI24740J21852_10000508 | |||
| 899 | JGI24740J21852_10000713 | |||
| 900 | JGI24739J22299_10009515 | |||
| 901 | JGI24737J22298_10008204 | |||
| 902 | JGI24737J22298_10033240 | |||
| 903 | JGI24735J21928_10000021 | |||
| 904 | JGI24735J21928_10007696 | |||
| 905 | JGI24738J21930_10000526 | |||
| 906 | JGI24738J21930_10000873 | |||
| 907 | JGI24738J21930_10004414 | |||
| 908 | JGI25156J39149_1002739 | |||
| 909 | JGI25154J39366_1000101 | |||
| 910 | JGI25150J39212_1007501 | |||
| 911 | JGI25151J46595_10000095 | |||
| 912 | rootH1_10075527 | |||
| 913 | rootH2_10062714 | |||
| 914 | rootH2_10295700 | |||
| 915 | rootL2_10030614 | |||
| 916 | rootL2_10266319 | |||
| 917 | rootL2_10290088 | |||
| 918 | Ga0055532_1000284 | |||
| 919 | Ga0055527_1000313 | |||
| 920 | Ga0055535_1000539 | |||
| 921 | Ga0055542_1000566 | |||
| 922 | Ga0055529_1000536 | |||
| 923 | Ga0055526_1000046 | |||
| 924 | Ga0055526_1001445 | |||
| 925 | Ga0055526_1005130 | |||
| 926 | Ga0055524_1003093 | |||
| 927 | Ga0055536_1034238 | |||
| 928 | Ga0055534_1001027 | |||
| 929 | Ga0055528_1003289 | |||
| 930 | Ga0055530_10000002 | |||
| 931 | Ga0055540_1000009 | |||
| 932 | Ga0055541_1002938 | |||
| 933 | Ga0058692_1000656 | |||
| 934 | Ga0058692_1001690 | |||
| 935 | Ga0058692_1002190 | |||
| 936 | Ga0058692_1002228 | |||
| 937 | Ga0058692_1013806 | |||
| 938 | Ga0065165_1026239 | |||
| 939 | Ga0065704_10119594 | |||
| 940 | Ga0070658_10017861 | |||
| 941 | Ga0070658_10274817 | |||
| 942 | Ga0070660_100117882 | |||
| 943 | Ga0070661_100035472 | |||
| 944 | Ga0070661_100110686 | |||
| 945 | Ga0070659_100032579 | |||
| 946 | Ga0070659_100260263 | |||
| 947 | Ga0070667_100486324 | |||
| 948 | Ga0070709_10289311 | |||
| 949 | Ga0070708_100024397 | |||
| 950 | Ga0070663_100003167 | |||
| 951 | Ga0070662_100012478 | |||
| 952 | Ga0070681_10124825 | |||
| 953 | Ga0070679_100467822 | |||
| 954 | Ga0068853_100003004 | |||
| 955 | Ga0070672_100292849 | |||
| 956 | Ga0068855_100001434 | |||
| 957 | Ga0068855_100006170 | |||
| 958 | Ga0068855_100008770 | |||
| 959 | Ga0068855_100639907 | |||
| 960 | Ga0070664_100021923 | |||
| 961 | Ga0070664_100049201 | |||
| 962 | Ga0068857_100023547 | |||
| 963 | Ga0068857_100146831 | |||
| 964 | Ga0068854_100011318 | |||
| 965 | Ga0068854_100022527 | |||
| 966 | Ga0068854_100026953 | |||
| 967 | Ga0068854_100101726 | |||
| 968 | Ga0068856_100359604 | |||
| 969 | Ga0068852_100052480 | |||
| 970 | Ga0068851_10001303 | |||
| 971 | Ga0068851_10012595 | |||
| 972 | Ga0081455_10096976 | |||
| 973 | Ga0075365_10086137 | |||
| 974 | Ga0070716_100399959 | |||
| 975 | Ga0075362_10027427 | |||
| 976 | Ga0075369_10018717 | |||
| 977 | Ga0075366_10054159 | |||
| 978 | Ga0075370_10282953 | |||
| 979 | Ga0075370_10339046 | |||
| 980 | Ga0075434_100623264 | |||
| 981 | Ga0079104_1000132 | |||
| 982 | Ga0079104_1000203 | |||
| 983 | Ga0079104_1003432 | |||
| 984 | Ga0105251_10000356 | |||
| 985 | Ga0105251_10000769 | |||
| 986 | Ga0105251_10012640 | |||
| 987 | Ga0105244_10001922 | |||
| 988 | Ga0105244_10004262 | |||
| 989 | Ga0105244_10044564 | |||
| 990 | Ga0105250_10002204 | |||
| 991 | Ga0105240_10008537 | |||
| 992 | Ga0105240_10039399 | |||
| 993 | Ga0105240_10250248 | |||
| 994 | Ga0105247_10111565 | |||
| 995 | Ga0105237_10000038 | |||
| 996 | Ga0105237_10026074 | |||
| 997 | Ga0105237_10121606 | |||
| 998 | Ga0105238_10000113 | |||
| 999 | Ga0105238_10070171 | |||
| 1000 | Ga0105239_10000108 | |||
| 1001 | Ga0105239_10000289 | |||
| 1002 | Ga0105239_10089321 | |||
| 1003 | Ga0105239_10129259 | |||
| 1004 | Ga0157371_10036811 | |||
| 1005 | Ga0157370_10032974 | |||
| 1006 | Ga0157370_10063322 | |||
| 1007 | Ga0157369_10084304 | |||
| 1008 | Ga0157369_10127899 | |||
| 1009 | Ga0157378_10169053 | |||
| 1010 | Ga0157378_10523116 | |||
| 1011 | Ga0157372_10011302 | |||
| 1012 | Ga0157372_10567604 | |||
| 1013 | Ga0182008_10003440 | |||
| 1014 | Ga0182008_10006469 | |||
| 1015 | Ga0182008_10017810 | |||
| 1016 | Ga0182006_1000021 | |||
| 1017 | Ga0182006_1000133 | |||
| 1018 | Ga0182006_1000828 | |||
| 1019 | Ga0182006_1006409 | |||
| 1020 | Ga0182006_1011619 | |||
| 1021 | Ga0182006_1041071 | |||
| 1022 | Ga0182007_10000890 | |||
| 1023 | Ga0182007_10004221 | |||
| 1024 | Ga0182005_1000020 | |||
| 1025 | Ga0182005_1012297 | |||
| 1026 | Ga0182005_1019100 | |||
| 1027 | Ga0213872_10016149 | |||
| 1028 | Ga0209435_100069 | |||
| 1029 | Ga0209566_100201 | |||
| 1030 | Ga0209674_101903 | |||
| 1031 | Ga0209672_100200 | |||
| 1032 | Ga0209147_100265 | |||
| 1033 | Ga0209258_100439 | |||
| 1034 | Ga0207425_1000966 | |||
| 1035 | Ga0209646_1000108 | |||
| 1036 | Ga0209026_1003394 | |||
| 1037 | Ga0209148_1000422 | |||
| 1038 | Ga0209759_1000173 | |||
| 1039 | Ga0209759_1007482 | |||
| 1040 | Ga0209129_1002466 | |||
| 1041 | Ga0209233_1017020 | |||
| 1042 | Ga0209455_1000322 | |||
| 1043 | Ga0209673_1000621 | |||
| 1044 | Ga0209675_1001449 | |||
| 1045 | Ga0209676_1000065 | |||
| 1046 | Ga0209676_1002272 | |||
| 1047 | Ga0209676_1002993 | |||
| 1048 | Ga0209676_1027871 | |||
| 1049 | Ga0209025_1000055 | |||
| 1050 | Ga0209025_1001131 | |||
| 1051 | Ga0209025_1004585 | |||
| 1052 | Ga0209564_1000277 | |||
| 1053 | Ga0209564_1001607 | |||
| 1054 | Ga0209564_1006862 | |||
| 1055 | Ga0209758_1007033 | |||
| 1056 | Ga0209758_1010525 | |||
| 1057 | Ga0209050_1000009 | |||
| 1058 | Ga0209050_1000402 | |||
| 1059 | Ga0209050_1000638 | |||
| 1060 | Ga0209050_1004144 | |||
| 1061 | Ga0209050_1015329 | |||
| 1062 | Ga0209256_1000176 | |||
| 1063 | Ga0209256_1000565 | |||
| 1064 | Ga0209256_1003140 | |||
| 1065 | Ga0209256_1036857 | |||
| 1066 | Ga0209051_1000008 | |||
| 1067 | Ga0209051_1005572 | |||
| 1068 | Ga0209257_1012568 | |||
| 1069 | Ga0207656_10000147 | |||
| 1070 | Ga0207696_1002130 | |||
| 1071 | Ga0207655_1065809 | |||
| 1072 | Ga0207713_1000173 | |||
| 1073 | Ga0207713_1003281 | |||
| 1074 | Ga0207710_10144539 | |||
| 1075 | Ga0207647_10028441 | |||
| 1076 | Ga0207647_10028600 | |||
| 1077 | Ga0207699_10257948 | |||
| 1078 | Ga0207705_10023962 | |||
| 1079 | Ga0207705_10228503 | |||
| 1080 | Ga0207695_10034752 | |||
| 1081 | Ga0207695_10621604 | |||
| 1082 | Ga0207671_10000045 | |||
| 1083 | Ga0207671_10055090 | |||
| 1084 | Ga0207671_10108299 | |||
| 1085 | Ga0207657_10051927 | |||
| 1086 | Ga0207649_10050358 | |||
| 1087 | Ga0207652_10419613 | |||
| 1088 | Ga0207694_10000075 | |||
| 1089 | Ga0207694_10004601 | |||
| 1090 | Ga0207694_10082401 | |||
| 1091 | Ga0207659_10082640 | |||
| 1092 | Ga0207690_10056761 | |||
| 1093 | Ga0207690_10100616 | |||
| 1094 | Ga0207706_10013921 | |||
| 1095 | Ga0207706_10065602 | |||
| 1096 | Ga0207706_10397731 | |||
| 1097 | Ga0207691_10074219 | |||
| 1098 | Ga0207691_10407896 | |||
| 1099 | Ga0207679_10058513 | |||
| 1100 | Ga0207679_10182669 | |||
| 1101 | Ga0207667_10000110 | |||
| 1102 | Ga0207667_10008274 | |||
| 1103 | Ga0207667_10014624 | |||
| 1104 | Ga0207667_10358060 | |||
| 1105 | Ga0207640_10008103 | |||
| 1106 | Ga0207640_10020501 | |||
| 1107 | Ga0207640_10064184 | |||
| 1108 | Ga0207640_10085884 | |||
| 1109 | Ga0207658_10453019 | |||
| 1110 | Ga0207639_10021179 | |||
| 1111 | Ga0207678_10004943 | |||
| 1112 | Ga0207674_10031842 | |||
| 1113 | Ga0207674_10038235 | |||
| 1114 | Ga0207674_10218567 | |||
| 1115 | Ga0207674_10299265 | |||
| 1116 | Ga0207698_10013615 | |||
| 1117 | Ga0209281_1000061 | |||
| 1118 | Ga0209281_1000338 | |||
| 1119 | Ga0209281_1002766 | |||
| 1120 | Ga0209371_1000017 | |||
| 1121 | Ga0209371_1000104 | |||
| 1122 | Ga0209371_1000261 | |||
| 1123 | Ga0209371_1000735 | |||
| 1124 | Ga0209371_1001024 | |||
| 1125 | Ga0209371_1001702 | |||
| 1126 | Ga0209371_1002099 | |||
| 1127 | Ga0209371_1013351 | |||
| 1128 | Ga0209371_1013910 | |||
| 1129 | Ga0265338_10193551 | |||
| 1130 | Ga0268256_1000017 | |||
| 1131 | Ga0268256_1000091 | |||
| 1132 | Ga0268256_1000221 | |||
| 1133 | Ga0268256_1000625 | |||
| 1134 | Ga0268256_1001484 | |||
| 1135 | Ga0268256_1001761 | |||
| 1136 | Ga0268256_1014690 | |||
| 1137 | Ga0268256_1015407 | |||
| 1138 | Ga0268256_1025257 | |||
| 1139 | Ga0316181_1099275 | |||
| 1140 | Ga0265320_10004108 | |||
| 1141 | Ga0265316_10016742 | |||
| 1142 | Ga0307408_100000496 | |||
| 1143 | Ga0265314_10089573 | |||
| 1144 | Ga0307405_10000146 | |||
| 1145 | Ga0307405_10007923 | |||
| 1146 | Ga0307405_10147446 | |||
| 1147 | Ga0307410_10039396 | |||
| 1148 | Ga0307406_10000533 | |||
| 1149 | Ga0307406_10016152 | |||
| 1150 | Ga0307407_10076195 | |||
| 1151 | Ga0307412_10000021 | |||
| 1152 | Ga0307412_10000293 | |||
| 1153 | Ga0307412_10000588 | |||
| 1154 | Ga0307412_10001067 | |||
| 1155 | Ga0307412_10002729 | |||
| 1156 | Ga0307412_10003827 | |||
| 1157 | Ga0307412_10016080 | |||
| 1158 | Ga0307412_10051061 | |||
| 1159 | Ga0307409_100010476 | |||
| 1160 | Ga0307416_100027556 | |||
| 1161 | Ga0307414_10048401 | |||
| 1162 | Ga0307411_10015914 | |||
| 1163 | Ga0307411_10195735 | |||
| 1164 | Ga0307510_10341578 | |||
| 1165 | Ga0373954_0033662 | |||
| 1166 | Ga0373927_0017128 | |||
| 1167 | Ga0395899_0009592 | |||
| 1168 | Ga0395899_0172005 | |||
| 1169 | Ga0395899_0225791 | |||
| 1170 | Ga0395899_0236053 | |||
| 1171 | Ga0395900_0003038 | |||
| 1172 | Ga0395900_0020385 | |||
| 1173 | Ga0395900_0111243 | |||
| 1174 | Ga0395900_0154581 | |||
| 1175 | Ga0395900_0216071 | |||
| 1176 | Ga0395900_0299259 | |||
| 1177 | Ga0395900_0529340 | |||
| 1178 | Ga0395898_0020964 | |||
| 1179 | Ga0395898_0039617 | |||
| 1180 | Ga0395898_0187136 | |||
| 1181 | Ga0395898_0212647 | |||
| 1182 | Ga0395898_0395158 | |||
| 1183 | Ga0395905_0024058 | |||
| 1184 | Ga0395905_0125591 | |||
| 1185 | Ga0395901_0002761 | |||
| 1186 | Ga0395901_0017776 | |||
| 1187 | Ga0395901_0300410 | |||
| 1188 | Ga0395901_0308878 | |||
| 1189 | Ga0395901_0398512 | |||
| 1190 | Ga0436361_0982462 | |||
| 1191 | Ga0436362_0607000 | |||
| 1192 | Ga0439436_0000004 | |||
| 1193 | Ga0439465_0005025 | |||
| 1194 | Ga0451841_1227815 | |||
| 1195 | Ga0451845_0676067 | |||
| 1196 | Ga0451845_0757030 | |||
| 1197 | Ga0451849_0647590 | |||
| 1198 | Ga0451849_0783247 | |||
| 1199 | Ga0451851_0083621 | |||
| 1200 | Ga0451853_0372391 | |||
| 1201 | Ga0451853_1588158 | |||
| 1202 | Ga0439448_0058928 | |||
| 1203 | Ga0439432_000046 | |||
| 1204 | Ga0439452_002719 | |||
| 1205 | Ga0439463_000428 | |||
| 1206 | Ga0439463_001729 | |||
| 1207 | Ga0439458_0014536 | |||
| 1208 | Ga0439460_0004486 | |||
| 1209 | Ga0451577_0003066 | |||
| 1210 | Ga0453683_0032497 | |||
| 1211 | Ga0466965_0044765 | |||
| 1212 | Ga0466966_0005946 | |||
| 1213 | Ga0466966_0076288 | |||
| 1214 | Ga0466961_0034846 | |||
| 1215 | Ga0466961_0098739 | |||
| 1216 | Ga0453684_0109875 | |||
| 1217 | Ga0453684_0325207 | |||
| 1218 | Ga0466968_0000252 | |||
| 1219 | Ga0466968_0001162 | |||
| 1220 | Ga0466968_0001355 | |||
| 1221 | Ga0466957_0004847 | |||
| 1222 | Ga0466957_0020666 | |||
| 1223 | Ga0466957_0194640 | |||
| 1224 | Ga0466957_0334546 | |||
| 1225 | Ga0466957_0388405 | |||
| 1226 | Ga0466960_0007900 | |||
| 1227 | Ga0466959_0009671 | |||
| 1228 | Ga0451576_0015427 | |||
| 1229 | Ga0451576_0326133 | |||
| 1230 | Ga0466958_0024632 | |||
| 1231 | Ga0466958_0209648 | |||
| 1232 | Ga0466967_0039746 | |||
| 1233 | Ga0495617_001589 | |||
| 1234 | Ga0495617_017344 | |||
| 1235 | Ga0495627_005467 | |||
| 1236 | Ga0495627_020344 | |||
| 1237 | Ga0495592_0008506 | |||
| 1238 | Ga0495603_0010045 | |||
| 1239 | Ga0495590_0000134 | |||
| 1240 | Ga0495590_0012826 | |||
| 1241 | Ga0495591_000664 | |||
| 1242 | Ga0495591_001628 | |||
| 1243 | Ga0495591_002206 | |||
| 1244 | Ga0495591_002641 | |||
| 1245 | Ga0495591_006302 | |||
| 1246 | Ga0495591_017210 | |||
| 1247 | Ga0495629_0034053 | |||
| 1248 | Ga0495629_0153340 | |||
| 1249 | Ga0495641_0077978 | |||
| 1250 | Ga0495651_0088505 | |||
| 1251 | Ga0495651_0151542 | |||
| 1252 | Ga0495653_0000014 | |||
| 1253 | Ga0495653_0017374 | |||
| 1254 | Ga0495653_0287608 | |||
| 1255 | Ga0495650_0000395 | |||
| 1256 | Ga0495650_0000477 | |||
| 1257 | Ga0495650_0005567 | |||
| 1258 | Ga0495650_0061847 | |||
| 1259 | Ga0495580_0048110 | |||
| 1260 | Ga0495580_0051544 | |||
| 1261 | Ga0495580_0167604 | |||
| 1262 | Ga0495582_0032514 | |||
| 1263 | Ga0495605_0000002 | |||
| 1264 | Ga0495605_0000128 | |||
| 1265 | Ga0495605_0001426 | |||
| 1266 | Ga0495605_0001502 | |||
| 1267 | Ga0495605_0004552 | |||
| 1268 | Ga0495605_0019847 | |||
| 1269 | Ga0495664_0011943 | |||
| 1270 | Ga0495664_0316595 | |||
| 1271 | Ga0495584_0000276 | |||
| 1272 | Ga0495584_0004273 | |||
| 1273 | Ga0495584_0004668 | |||
| 1274 | Ga0495584_0065569 | |||
| 1275 | Ga0495584_0260839 | |||
| 1276 | Ga0495585_0000431 | |||
| 1277 | Ga0495585_0002527 | |||
| 1278 | Ga0495585_0016035 | |||
| 1279 | Ga0495585_0056107 | |||
| 1280 | Ga0495585_0095284 | |||
| 1281 | Ga0495594_0001858 | |||
| 1282 | Ga0495594_0008275 | |||
| 1283 | Ga0495596_0008499 | |||
| 1284 | Ga0495596_0013598 | |||
| 1285 | Ga0495596_0045876 | |||
| 1286 | Ga0495596_0131530 | |||
| 1287 | Ga0495607_0000053 | |||
| 1288 | Ga0495607_0000091 | |||
| 1289 | Ga0495607_0000796 | |||
| 1290 | Ga0495607_0005144 | |||
| 1291 | Ga0495607_0005520 | |||
| 1292 | Ga0495607_0009605 | |||
| 1293 | Ga0495607_0011329 | |||
| 1294 | Ga0495607_0024909 | |||
| 1295 | Ga0495607_0199214 | |||
| 1296 | Ga0495583_0000211 | |||
| 1297 | Ga0495583_0001129 | |||
| 1298 | Ga0495583_0001581 | |||
| 1299 | Ga0495583_0002351 | |||
| 1300 | Ga0495583_0003844 | |||
| 1301 | Ga0495583_0061663 | |||
| 1302 | Ga0495583_0138171 | |||
| 1303 | Ga0495606_0000022 | |||
| 1304 | Ga0495606_0000085 | |||
| 1305 | Ga0495606_0000498 | |||
| 1306 | Ga0495606_0000701 | |||
| 1307 | Ga0495606_0001498 | |||
| 1308 | Ga0495606_0022604 | |||
| 1309 | Ga0495606_0024860 | |||
| 1310 | Ga0495606_0059724 | |||
| 1311 | Ga0495606_0128269 | |||
| 1312 | Ga0495606_0184118 | |||
| 1313 | Ga0495610_0000261 | |||
| 1314 | Ga0495610_0001663 | |||
| 1315 | Ga0495610_0009971 | |||
| 1316 | Ga0495610_0093707 | |||
| 1317 | Ga0495616_0002519 | |||
| 1318 | Ga0495616_0095538 | |||
| 1319 | Ga0495616_0106173 | |||
| 1320 | Ga0495618_0009332 | |||
| 1321 | Ga0495618_0065783 | |||
| 1322 | Ga0495620_0000286 | |||
| 1323 | Ga0495620_0001285 | |||
| 1324 | Ga0495620_0002038 | |||
| 1325 | Ga0495628_0031807 | |||
| 1326 | Ga0495630_0000759 | |||
| 1327 | Ga0495630_0130115 | |||
| 1328 | Ga0495631_0000279 | |||
| 1329 | Ga0495631_0001036 | |||
| 1330 | Ga0495631_0003195 | |||
| 1331 | Ga0495631_0043409 | |||
| 1332 | Ga0495632_0000004 | |||
| 1333 | Ga0495632_0000630 | |||
| 1334 | Ga0495632_0009205 | |||
| 1335 | Ga0495632_0016039 | |||
| 1336 | Ga0495632_0021176 | |||
| 1337 | Ga0495632_0022796 | |||
| 1338 | Ga0495632_0048810 | |||
| 1339 | Ga0495632_0067368 | |||
| 1340 | Ga0495637_0000015 | |||
| 1341 | Ga0495637_0000349 | |||
| 1342 | Ga0495637_0001375 | |||
| 1343 | Ga0495637_0005031 | |||
| 1344 | Ga0495637_0014385 | |||
| 1345 | Ga0495637_0107975 | |||
| 1346 | Ga0495643_0001000 | |||
| 1347 | Ga0495643_0005586 | |||
| 1348 | Ga0495643_0012467 | |||
| 1349 | Ga0495644_0000109 | |||
| 1350 | Ga0495644_0001378 | |||
| 1351 | Ga0495644_0004285 | |||
| 1352 | Ga0495648_0000254 | |||
| 1353 | Ga0495648_0000383 | |||
| 1354 | Ga0495648_0001658 | |||
| 1355 | Ga0495648_0001921 | |||
| 1356 | Ga0495648_0002682 | |||
| 1357 | Ga0495648_0018195 | |||
| 1358 | Ga0495648_0049295 | |||
| 1359 | Ga0495648_0053348 | |||
| 1360 | Ga0495648_0107318 | |||
| 1361 | Ga0495666_0002908 | |||
| 1362 | Ga0495642_0007418 | |||
| 1363 | Ga0495652_0007270 | |||
| 1364 | Ga0495652_0040607 | |||
| 1365 | Ga0495652_0212668 | |||
| 1366 | Ga0495654_0001946 | |||
| 1367 | Ga0495654_0007649 | |||
| 1368 | Ga0495654_0012037 | |||
| 1369 | Ga0495654_0015830 | |||
| 1370 | Ga0495665_0080126 | |||
| 1371 | Ga0495640_0049024 | |||
| 1372 | Ga0495586_0032338 | |||
| 1373 | Ga0495586_0116698 | |||
| 1374 | Ga0495609_0000018 | |||
| 1375 | Ga0495609_0000051 | |||
| 1376 | Ga0495609_0000168 | |||
| 1377 | Ga0495609_0006536 | |||
| 1378 | Ga0495609_0022589 | |||
| 1379 | Ga0495609_0099849 | |||
| 1380 | Ga0495597_0001305 | |||
| 1381 | Ga0495645_0151677 | |||
| 1382 | Ga0495633_0000590 | |||
| 1383 | Ga0495633_0004033 | |||
| 1384 | Ga0495633_0008171 | |||
| 1385 | Ga0495633_0010560 | |||
| 1386 | Ga0495633_0077894 | |||
| 1387 | Ga0495633_0117054 | |||
| 1388 | Ga0495656_0112427 | |||
| 1389 | Ga0495668_0000019 | |||
| 1390 | Ga0495668_0000025 | |||
| 1391 | Ga0495668_0000117 | |||
| 1392 | Ga0495668_0003441 | |||
| 1393 | Ga0495668_0013643 | |||
| 1394 | Ga0495668_0020025 | |||
| 1395 | Ga0495668_0022859 | |||
| 1396 | Ga0495634_0015824 | |||
| 1397 | Ga0495611_0001575 | |||
| 1398 | Ga0495611_0002939 | |||
| 1399 | Ga0495611_0013043 | |||
| 1400 | Ga0495625_0042110 | |||
| 1401 | Ga0495635_0006662 | |||
| 1402 | Ga0495635_0008292 | |||
| 1403 | Ga0495661_0000006 | |||
| 1404 | Ga0495661_0000056 | |||
| 1405 | Ga0495661_0004721 | |||
| 1406 | Ga0495661_0011746 | |||
| 1407 | Ga0495661_0012243 | |||
| 1408 | Ga0495661_0013965 | |||
| 1409 | Ga0495661_0014140 | |||
| 1410 | Ga0495661_0021111 | |||
| 1411 | Ga0495588_0000261 | |||
| 1412 | Ga0495588_0182703 | |||
| 1413 | Ga0495657_0046199 | |||
| 1414 | Ga0495623_0103942 | |||
| 1415 | Ga0495646_0039333 | |||
| 1416 | Ga0495646_0098112 | |||
| 1417 | Ga0495669_0002308 | |||
| 1418 | Ga0495669_0010844 | |||
| 1419 | Ga0495669_0015611 | |||
| 1420 | Ga0495613_0168107 | |||
| 1421 | Ga0495670_0013405 | |||
| 1422 | Ga0495670_0041239 | |||
| 1423 | Ga0495671_0000009 | |||
| 1424 | Ga0495671_0000420 | |||
| 1425 | Ga0495671_0004110 | |||
| 1426 | Ga0495671_0020652 | |||
| 1427 | Ga0495671_0077495 | |||
| 1428 | Ga0495671_0219727 | |||
| 1429 | Ga0495671_0252539 | |||
| 1430 | Ga0495649_0001375 | |||
| 1431 | Ga0495649_0002169 | |||
| 1432 | Ga0495649_0085538 | |||
| 1433 | Ga0495589_0000473 | |||
| 1434 | Ga0495589_0002639 | |||
| 1435 | Ga0495589_0019046 | |||
| 1436 | Ga0495600_0007339 | |||
| 1437 | Ga0495600_0014728 | |||
| 1438 | Ga0495600_0049384 | |||
| 1439 | Ga0495660_0001412 | |||
| 1440 | Ga0495660_0001522 | |||
| 1441 | Ga0495660_0001919 | |||
| 1442 | Ga0495660_0011210 | |||
| 1443 | Ga0495660_0066359 | |||
| 1444 | Ga0495581_0020373 | |||
| 1445 | Ga0495604_0024198 | |||
| 1446 | Ga0495604_0051909 | |||
| 1447 | Ga0495674_0016448 | |||
| 1448 | Ga0495674_0035359 | |||
| 1449 | Ga0495674_0369607 | |||
| 1450 | Ga0495672_0000432 | |||
| 1451 | Ga0495672_0000525 | |||
| 1452 | Ga0495672_0000529 | |||
| 1453 | Ga0495672_0000732 | |||
| 1454 | Ga0495672_0000769 | |||
| 1455 | Ga0495672_0007159 | |||
| 1456 | Ga0495672_0015882 | |||
| 1457 | Ga0495672_0126015 | |||
| 1458 | Ga0495676_0000004 | |||
| 1459 | Ga0495680_0016216 | |||
| 1460 | Ga0495680_0032351 | |||
| 1461 | Ga0495680_0079238 | |||
| 1462 | Ga0495683_0000374 | |||
| 1463 | Ga0495683_0003551 | |||
| 1464 | Ga0495683_0004174 | |||
| 1465 | Ga0495683_0010027 | |||
| 1466 | Ga0495683_0013500 | |||
| 1467 | Ga0495683_0025905 | |||
| 1468 | Ga0495683_0082827 | |||
| 1469 | Ga0495683_0087467 | |||
| 1470 | Ga0495683_0129714 | |||
| 1471 | Ga0495683_0159658 | |||
| 1472 | Ga0495687_001917 | |||
| 1473 | Ga0495687_003411 | |||
| 1474 | Ga0495687_007220 | |||
| 1475 | Ga0495687_020176 | |||
| 1476 | Ga0495687_033197 | |||
| 1477 | Ga0495675_0033332 | |||
| 1478 | Ga0495675_0092941 | |||
| 1479 | Ga0495677_0000361 | |||
| 1480 | Ga0495677_0001955 | |||
| 1481 | Ga0495677_0004524 | |||
| 1482 | Ga0495679_000015 | |||
| 1483 | Ga0495679_000744 | |||
| 1484 | Ga0495679_012531 | |||
| 1485 | Ga0495685_034125 | |||
| 1486 | Ga0495673_0000012 | |||
| 1487 | Ga0495673_0000032 | |||
| 1488 | Ga0495673_0000292 | |||
| 1489 | Ga0495673_0001595 | |||
| 1490 | Ga0495673_0001788 | |||
| 1491 | Ga0495673_0003532 | |||
| 1492 | Ga0495673_0010862 | |||
| 1493 | Ga0495673_0029761 | |||
| 1494 | Ga0495673_0068479 | |||
| 1495 | Ga0495681_0037898 | |||
| 1496 | Ga0495684_0033332 | |||
| 1497 | Ga0495684_0122244 | |||
| 1498 | Ga0495686_0001068 | |||
| 1499 | Ga0495686_0001432 | |||
| 1500 | Ga0495686_0002004 | |||
| 1501 | Ga0495686_0002642 | |||
| 1502 | Ga0495686_0013979 | |||
| 1503 | Ga0495686_0028821 | |||
| 1504 | Ga0495686_0049126 | |||
| 1505 | Ga0495686_0248863 | |||
| 1506 | Ga0495593_0047740 | |||
| 1507 | Ga0495602_0024473 | |||
| 1508 | Ga0495602_0045747 | |||
| 1509 | Ga0495626_0000012 | |||
| 1510 | Ga0495626_0000550 | |||
| 1511 | Ga0495626_0005686 | |||
| 1512 | Ga0495626_0008588 | |||
| 1513 | Ga0495626_0172107 | |||
| 1514 | Ga0496100_0002600 | |||
| 1515 | Ga0496100_0017905 | |||
| 1516 | Ga0496101_0570802 | |||
| 1517 | Ga0496102_0001444 | |||
| 1518 | Ga0496102_0042805 | |||
| 1519 | Ga0496103_0000734 | |||
| 1520 | Ga0496103_0004871 | |||
| 1521 | Ga0496104_0000110 | |||
| 1522 | Ga0496105_0232098 | |||
| 1523 | Ga0496106_0211987 | |||
| 1524 | Ga0496109_0840681 | |||
| 1525 | Ga0496110_0519563 | |||
| 1526 | Ga0496114_0216222 | |||
| 1527 | Ga0496116_0004036 | |||
| 1528 | Ga0496116_0029046 | |||
| 1529 | Ga0496116_0031164 | |||
| 1530 | Ga0496116_0037446 | |||
| 1531 | Ga0496116_0062507 | |||
| 1532 | Ga0496117_0002291 | |||
| 1533 | Ga0496117_0006577 | |||
| 1534 | Ga0496117_0009529 | |||
| 1535 | Ga0496117_0033321 | |||
| 1536 | Ga0496117_0210897 | |||
| 1537 | Ga0496118_0001035 | |||
| 1538 | Ga0496118_0005824 | |||
| 1539 | Ga0496118_0010884 | |||
| 1540 | Ga0496118_0059946 | |||
| 1541 | Ga0496118_0241430 | |||
| 1542 | Ga0496119_0000417 | |||
| 1543 | Ga0496119_0005043 | |||
| 1544 | Ga0496119_0005126 | |||
| 1545 | Ga0496119_0009416 | |||
| 1546 | Ga0496119_0033975 | |||
| 1547 | Ga0496119_0088366 | |||
| 1548 | Ga0496120_0001322 | |||
| 1549 | Ga0496120_0002817 | |||
| 1550 | Ga0496120_0003406 | |||
| 1551 | Ga0496120_0006611 | |||
| 1552 | Ga0496120_0079612 | |||
| 1553 | Ga0496121_0000444 | |||
| 1554 | Ga0496121_0000936 | |||
| 1555 | Ga0496121_0001548 | |||
| 1556 | Ga0496121_0002548 | |||
| 1557 | Ga0496121_0007028 | |||
| 1558 | Ga0496121_0036106 | |||
| 1559 | Ga0496121_0052686 | |||
| 1560 | Ga0496121_0202791 | |||
| 1561 | Ga0496122_0000920 | |||
| 1562 | Ga0496122_0000961 | |||
| 1563 | Ga0496122_0001281 | |||
| 1564 | Ga0496122_0006050 | |||
| 1565 | Ga0496122_0010980 | |||
| 1566 | Ga0496122_0014123 | |||
| 1567 | Ga0496122_0031786 | |||
| 1568 | Ga0496122_0045935 | |||
| 1569 | Ga0496122_0048785 | |||
| 1570 | Ga0496122_0064518 | |||
| 1571 | Ga0496123_0000301 | |||
| 1572 | Ga0496123_0000315 | |||
| 1573 | Ga0496123_0003524 | |||
| 1574 | Ga0496123_0004053 | |||
| 1575 | Ga0496123_0005838 | |||
| 1576 | Ga0496123_0007296 | |||
| 1577 | Ga0496123_0008946 | |||
| 1578 | Ga0496123_0017221 | |||
| 1579 | Ga0496123_0027488 | |||
| 1580 | Ga0496123_0056631 | |||
| 1581 | Ga0496123_0066063 | |||
| 1582 | Ga0496123_0076156 | |||
| 1583 | Ga0496124_0000023 | |||
| 1584 | Ga0496124_0000188 | |||
| 1585 | Ga0496124_0000284 | |||
| 1586 | Ga0496124_0000293 | |||
| 1587 | Ga0496124_0000674 | |||
| 1588 | Ga0496124_0001109 | |||
| 1589 | Ga0496124_0007208 | |||
| 1590 | Ga0496124_0008028 | |||
| 1591 | Ga0496124_0009058 | |||
| 1592 | Ga0496124_0013847 | |||
| 1593 | Ga0496124_0015652 | |||
| 1594 | Ga0496124_0017190 | |||
| 1595 | Ga0496124_0029271 | |||
| 1596 | Ga0496124_0048548 | |||
| 1597 | Ga0496124_0084389 | |||
| 1598 | Ga0496124_0098106 | |||
| 1599 | Ga0496124_0240360 | |||
| 1600 | Ga0496124_0264308 | |||
| 1601 | Ga0496125_0000259 | |||
| 1602 | Ga0496125_0000561 | |||
| 1603 | Ga0496125_0001676 | |||
| 1604 | Ga0496125_0005984 | |||
| 1605 | Ga0496125_0159619 | |||
| 1606 | Ga0496126_0005432 | |||
| 1607 | Ga0496126_0073801 | |||
| 1608 | Ga0495678_000146 | |||
| 1609 | Ga0495678_000273 | |||
| 1610 | Ga0495678_000520 | |||
| 1611 | Ga0495678_001866 | |||
| 1612 | Ga0495678_003713 | |||
| 1613 | Ga0495678_004000 | |||
| 1614 | Ga0495678_077164 | |||
| 1615 | Ga0495682_0000014 | |||
| 1616 | Ga0495682_0006668 | |||
| 1617 | Ga0495682_0009432 | |||
| 1618 | Ga0495682_0014939 | |||
| 1619 | Ga0495682_0037591 | |||
| 1620 | Ga0501034_0439626 | |||
| 1621 | Ga0501037_0006588 | |||
| 1622 | Ga0501209_000017 | |||
| 1623 | Ga0501249_000128 | |||
| 1624 | Ga0501035_0014127 | |||
| 1625 | nmdc:mga0yw44_79351_c1 | |||
| 1626 | nmdc:mga0n895_341795_c1 | |||
| 1627 | Ga0495601_0097921 | |||
| 1628 | Ga0495619_0080979 | |||
| 1629 | Ga0500618_000550 | |||
| 1630 | Ga0500618_004669 | |||
| 1631 | Ga0500618_012596 | |||
| 1632 | Ga0500586_000731 | |||
| 1633 | Ga0500645_000415 | |||
| 1634 | Ga0500645_003031 | |||
| 1635 | 2501085068 | |||
| 1636 | 2509391404 | |||
| 1637 | 2510282596 | |||
| 1638 | 2510295248 | |||
| 1639 | 2510311124 | |||
| 1640 | 2511090492 | |||
| 1641 | 2517098918 | |||
| 1642 | 2517098965 | |||
| 1643 | 2517407880 | |||
| 1644 | 2517407926 | |||
| 1645 | 2519460917 | |||
| 1646 | 2521560550 | |||
| 1647 | 2524610037 | |||
| 1648 | 2547697990 | |||
| 1649 | 2553005655 | |||
| 1650 | 2562464151 | |||
| 1651 | 2585283206 | |||
| 1652 | 2585283643 | |||
| 1653 | 2585289819 | |||
| 1654 | 2595451955 | |||
| 1655 | 2599723409 | |||
| 1656 | 2599907407 | |||
| 1657 | 2599944482 | |||
| 1658 | 2599954954 | |||
| 1659 | 2599970928 | |||
| 1660 | 2599984117 | |||
| 1661 | 2599988782 | |||
| 1662 | 2600001314 | |||
| 1663 | 2600049084 | |||
| 1664 | 2600203691 | |||
| 1665 | 2600446869 | |||
| 1666 | 2601531597 | |||
| 1667 | 2601536969 | |||
| 1668 | 2601623652 | |||
| 1669 | 2601628047 | |||
| 1670 | 2601755315 | |||
| 1671 | 2601760682 | |||
| 1672 | 2603639273 | |||
| 1673 | 2609913650 | |||
| 1674 | 2616309737 | |||
| 1675 | 2616313085 | |||
| 1676 | 2643797177 | |||
| 1677 | 2643863954 | |||
| 1678 | 2643979463 | |||
| 1679 | 2643982533 | |||
| 1680 | 2644469719 | |||
| 1681 | 2707100526 | |||
| 1682 | 2720617946 | |||
| 1683 | 2738712648 | |||
| 1684 | 2738801643 | |||
| 1685 | 2738818517 | |||
| 1686 | 2738827537 | |||
| 1687 | 2738831326 | |||
| 1688 | 2738851072 | |||
| 1689 | 2738866802 | |||
| 1690 | 2738872854 | |||
| 1691 | 2739034496 | |||
| 1692 | 2739151333 | |||
| 1693 | 2739184484 | |||
| 1694 | 2739193253 | |||
| 1695 | 2739219453 | |||
| 1696 | 2739299319 | |||
| 1697 | 2739319729 | |||
| 1698 | 2739337970 | |||
| 1699 | 2739360998 | |||
| 1700 | 2765570293 | |||
| 1701 | 2792313866 | |||
| 1702 | 2806069846 | |||
| 1703 | 2809034643 | |||
| 1704 | 2809035734 | |||
| 1705 | 2813730318 | |||
| 1706 | 2814697909 | |||
| 1707 | 2817259235 | |||
| 1708 | 2817280356 | |||
| 1709 | 2817452460 | |||
| 1710 | 2819554564 | |||
| 1711 | 2819555545 | |||
| 1712 | 2819561596 | |||
| 1713 | 2819565424 | |||
| 1714 | 2819617241 | |||
| 1715 | 2819635076 | |||
| 1716 | 2819687749 | |||
| 1717 | 2819713626 | |||
| 1718 | 2821129923 | |||
| 1719 | 2821136078 | |||
| 1720 | 2834644041 | |||
| 1721 | 2839096763 | |||
| 1722 | 2842316485 | |||
| 1723 | 2842920995 | |||
| 1724 | 2855736706 | |||
| 1725 | 2855773643 | |||
| 1726 | 2856290527 | |||
| 1727 | 2857359059 | |||
| 1728 | 2857565279 | |||
| 1729 | 2857577612 | |||
| 1730 | 2870072652 | |||
| 1731 | 2879164106 | |||
| 1732 | 2881417466 | |||
| 1733 | 2881418463 | |||
| 1734 | 2893070788 | |||
| 1735 | 2900638584 | |||
| 1736 | 2904442879 | |||
| 1737 | 2904466725 | |||
| 1738 | 2904479114 | |||
| 1739 | 2904534923 | |||
| 1740 | 2904570969 | |||
| 1741 | 2904578077 | |||
| 1742 | 2904588738 | |||
| 1743 | 2904594188 | |||
| 1744 | 2904604972 | |||
| 1745 | 2919048625 | |||
| 1746 | 2919083207 | |||
| 1747 | 2919119397 | |||
| 1748 | 2919140785 | |||
| 1749 | 2919155223 | |||
| 1750 | 2919405686 | |||
| 1751 | 2923514328 | |||
| 1752 | 2923586713 | |||
| 1753 | 2927148805 | |||
| 1754 | 2928102073 | |||
| 1755 | 2928133061 | |||
| 1756 | 2928530068 | |||
| 1757 | 2928543053 | |||
| 1758 | 2928962009 | |||
| 1759 | 2928969742 | |||
| 1760 | 2931369929 | |||
| 1761 | 2939603736 | |||
| 1762 | 2941482683 | |||
| 1763 | 2945878088 | |||
| 1764 | 2945937232 | |||
| 1765 | 2953996263 | |||
| 1766 | 2984513908 | |||
| 1767 | 2984522940 | |||
| 1768 | 2984542523 | |||
| 1769 | 2984559301 | |||
| 1770 | 2984595828 | |||
| 1771 | 2984606631 | |||
| 1772 | 2990706033 | |||
| 1773 | 2998142270 | |||
| 1774 | 642425769 | |||
| 1775 | 8005302010 | |||
| 1776 | 8005651172 | |||
| 1777 | 8018154934 | |||
| 1778 | 8020813093 | |||
| 1779 | 8034966093 | |||
| 1780 | 8040167750 | |||
| 1781 | 8040178507 | |||
| 1782 | 8047676539 | |||
| 1783 | 8054007532 | |||
| 1784 | 8055436186 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e6o-assembly1.cif.gz_C | crystal structure of polyol dehydrogenase from paracoccus denitrificans | 0.9392 | 1 | 185 |
| 3f5s-assembly1.cif.gz_A | crystal structure of putatitve short chain dehydrogenase from shigella flexneri 2a str. 301 | 0.93 | 3 | 181 |
| 6m5n-assembly1.cif.gz_A | apo-form structure of borneol dehydrogenase | 0.9126 | 3 | 188 |
| 3awd-assembly1.cif.gz_D | crystal structure of gox2181 | 0.9125 | 3 | 223 |
| 3lls-assembly1.cif.gz_B | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium tuberculosis | 0.9093 | 3 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IEI4_1_176_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9451 | 58 | 180 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.936 | 86 | 181 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9304 | 6 | 178 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9227 | 2 | 187 | 3.40.50.720 |
| 4e6pC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.922 | 1 | 185 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328Y3L5-F1-model_v4 | deleted | 0.9925 | 1 | 189 |
|
| AF-A0A6M5CZK2-F1-model_v4 | deleted | 0.9915 | 1 | 253 |
|
| AF-A0A7W6DIN9-F1-model_v4 | Putative oxidoreductase (EC 1.-.-.-) | 0.9914 | 1 | 252 |
GO:0016491
|
| AF-A0A4Y9SPW3-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.991 | 1 | 220 |
GO:0016020
GO:0016491 |
| AF-A0A3R8VK59-F1-model_v4 | deleted | 0.9896 | 1 | 253 |
|