F485176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 381 | 1802 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10342389|Ga0207681_103423891 |
| Length | 299 |
| Sequence | MTSPRPITVITGASSGIGVALARVFAQHGHELALVARREDRLHALAEEIAGSGARRPIVIAADLFKTGAARVIGEALTAQGAEPQFVVNNAGFGLVGPAGALDRDEQLQMIDLNVRALTELSLAFVDSLARHRGGLLNVGSMAGFLPGPGMAVYYASKAYVLSFTEALHSELGPHGIRVAVLCPGPVPTEFAERAGVRDGLAPNILTQSADFVAEAGYRGLMAGHRTIVPGLINKLVTMLIRMTSVTPPPLWQVWLSIGIGVASAFAAIWFAAKVFRIGLLMYGKPPDFATLIRWARAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 128 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 265 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 266 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 267 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 268 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 269 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 270 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0 |
| Rhizoplane | 9.32 |
| Rhizosphere | 89.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207681_10342389 | 3300025923 | Bacteria | 1195 |
| 2 | 2214736889 | 2209111006 | Bacteria | 4052 |
| 3 | ARSoilYngRDRAFT_c00112 | 3300000042 | Bacteria | 13838 |
| 4 | ARcpr5yngRDRAFT_c000099 | 3300000043 | Bacteria | 13598 |
| 5 | ARSoilOldRDRAFT_c000057 | 3300000044 | Bacteria | 23572 |
| 6 | ARCol0oldRDRAFT_c00030 | 3300000045 | Bacteria | 10913 |
| 7 | ARCol0yngRDRAFT_1000002 | 3300000652 | Bacteria | 55259 |
| 8 | JGI24746J21847_1001839 | 3300001977 | Bacteria | 3391 |
| 9 | JGI24747J21853_1003188 | 3300001978 | Bacteria | 1404 |
| 10 | JGI24739J22299_10001524 | 3300001989 | Bacteria | 8748 |
| 11 | JGI24737J22298_10002379 | 3300001990 | Bacteria | 6710 |
| 12 | JGI24737J22298_10008384 | 3300001990 | Bacteria | 3462 |
| 13 | JGI24750J21931_1000794 | 3300002070 | Bacteria | 4401 |
| 14 | JGI24745J21846_1000127 | 3300002073 | Bacteria | 5827 |
| 15 | JGI24738J21930_10000067 | 3300002075 | Bacteria | 21834 |
| 16 | JGI24749J21850_1000340 | 3300002076 | Bacteria | 7024 |
| 17 | JGI24744J21845_10006801 | 3300002077 | Bacteria | 2365 |
| 18 | JGI24742J22300_10002047 | 3300002244 | Bacteria | 3215 |
| 19 | JGI24751J29686_10005863 | 3300002459 | Bacteria | 2506 |
| 20 | Ga0065717_1002506 | 3300005276 | Bacteria | 1886 |
| 21 | Ga0065716_1001523 | 3300005277 | Bacteria | 10216 |
| 22 | Ga0065704_10073824 | 3300005289 | Bacteria | 6761 |
| 23 | Ga0065712_10000677 | 3300005290 | Bacteria | 11212 |
| 24 | Ga0065712_10001663 | 3300005290 | Bacteria | 9900 |
| 25 | Ga0065715_10004205 | 3300005293 | Bacteria | 11517 |
| 26 | Ga0065715_10089460 | 3300005293 | Bacteria | 10071 |
| 27 | Ga0070658_10001079 | 3300005327 | Bacteria | 23302 |
| 28 | Ga0070658_10014490 | 3300005327 | Bacteria | 6327 |
| 29 | Ga0070676_10000332 | 3300005328 | Bacteria | 21434 |
| 30 | Ga0070683_100004171 | 3300005329 | Bacteria | 11837 |
| 31 | Ga0070683_100059710 | 3300005329 | Bacteria | 3543 |
| 32 | Ga0070683_100172655 | 3300005329 | Bacteria | 2052 |
| 33 | Ga0070690_100002091 | 3300005330 | Bacteria | 10668 |
| 34 | Ga0070690_100004635 | 3300005330 | Bacteria | 7653 |
| 35 | Ga0070670_100072626 | 3300005331 | Bacteria | 2955 |
| 36 | Ga0070670_100081360 | 3300005331 | Bacteria | 2783 |
| 37 | Ga0070677_10000258 | 3300005333 | Bacteria | 18304 |
| 38 | Ga0068869_100000510 | 3300005334 | Bacteria | 21648 |
| 39 | Ga0068869_100148482 | 3300005334 | Bacteria | 1816 |
| 40 | Ga0070666_10004570 | 3300005335 | Bacteria | 8438 |
| 41 | Ga0070666_10327083 | 3300005335 | Bacteria | 1094 |
| 42 | Ga0070680_100001476 | 3300005336 | Bacteria | 17088 |
| 43 | Ga0070680_100012038 | 3300005336 | Bacteria | 6712 |
| 44 | Ga0070680_100018732 | 3300005336 | Bacteria | 5477 |
| 45 | Ga0070680_100052973 | 3300005336 | Bacteria | 3312 |
| 46 | Ga0070680_100059311 | 3300005336 | Bacteria | 3130 |
| 47 | Ga0070680_100237010 | 3300005336 | Bacteria | 1542 |
| 48 | Ga0070682_100003255 | 3300005337 | Bacteria | 9005 |
| 49 | Ga0070682_100208161 | 3300005337 | Bacteria | 1384 |
| 50 | Ga0070682_100343969 | 3300005337 | Bacteria | 1110 |
| 51 | Ga0070682_100344801 | 3300005337 | Bacteria | 1108 |
| 52 | Ga0068868_100000148 | 3300005338 | Bacteria | 45833 |
| 53 | Ga0068868_100233511 | 3300005338 | Bacteria | 1543 |
| 54 | Ga0070660_100001314 | 3300005339 | Bacteria | 16922 |
| 55 | Ga0070660_100052383 | 3300005339 | Bacteria | 3146 |
| 56 | Ga0070660_100118376 | 3300005339 | Bacteria | 2112 |
| 57 | Ga0070689_100003363 | 3300005340 | Bacteria | 10634 |
| 58 | Ga0070689_100009190 | 3300005340 | Bacteria | 6996 |
| 59 | Ga0070689_100027599 | 3300005340 | Bacteria | 4280 |
| 60 | Ga0070689_100207091 | 3300005340 | Bacteria | 1604 |
| 61 | Ga0070691_10001528 | 3300005341 | Bacteria | 9952 |
| 62 | Ga0070691_10018465 | 3300005341 | Bacteria | 3216 |
| 63 | Ga0070691_10061486 | 3300005341 | Bacteria | 1807 |
| 64 | Ga0070687_100000318 | 3300005343 | Bacteria | 16315 |
| 65 | Ga0070687_100146049 | 3300005343 | Bacteria | 1383 |
| 66 | Ga0070661_100000768 | 3300005344 | Bacteria | 23141 |
| 67 | Ga0070661_100127742 | 3300005344 | Bacteria | 1908 |
| 68 | Ga0070692_10000347 | 3300005345 | Bacteria | 13504 |
| 69 | Ga0070692_10012428 | 3300005345 | Bacteria | 3941 |
| 70 | Ga0070668_100004879 | 3300005347 | Bacteria | 9938 |
| 71 | Ga0070668_100013661 | 3300005347 | Bacteria | 6062 |
| 72 | Ga0070668_100052404 | 3300005347 | Bacteria | 3145 |
| 73 | Ga0070669_100003445 | 3300005353 | Bacteria | 11403 |
| 74 | Ga0070669_100016339 | 3300005353 | Bacteria | 5294 |
| 75 | Ga0070675_100001491 | 3300005354 | Bacteria | 17261 |
| 76 | Ga0070675_100065209 | 3300005354 | Unclassified | 3011 |
| 77 | Ga0070671_100003997 | 3300005355 | Bacteria | 11616 |
| 78 | Ga0070671_100084859 | 3300005355 | Bacteria | 2648 |
| 79 | Ga0070671_100154987 | 3300005355 | Bacteria | 1935 |
| 80 | Ga0070671_100292504 | 3300005355 | Bacteria | 1386 |
| 81 | Ga0070671_100415033 | 3300005355 | Bacteria | 1152 |
| 82 | Ga0070674_100001355 | 3300005356 | Bacteria | 12909 |
| 83 | Ga0070674_100197893 | 3300005356 | Bacteria | 1550 |
| 84 | Ga0070673_100000670 | 3300005364 | Bacteria | 18859 |
| 85 | Ga0070673_100024615 | 3300005364 | Bacteria | 4418 |
| 86 | Ga0070673_100031738 | 3300005364 | Bacteria | 3968 |
| 87 | Ga0070673_100036546 | 3300005364 | Bacteria | 3734 |
| 88 | Ga0070673_100322502 | 3300005364 | Bacteria | 1365 |
| 89 | Ga0070688_100001144 | 3300005365 | Bacteria | 13256 |
| 90 | Ga0070688_100065435 | 3300005365 | Bacteria | 2310 |
| 91 | Ga0070688_100210521 | 3300005365 | Bacteria | 1365 |
| 92 | Ga0070659_100001400 | 3300005366 | Bacteria | 17383 |
| 93 | Ga0070659_100164843 | 3300005366 | Bacteria | 1813 |
| 94 | Ga0070667_100002340 | 3300005367 | Bacteria | 16596 |
| 95 | Ga0070667_100009705 | 3300005367 | Bacteria | 7978 |
| 96 | Ga0070667_100120377 | 3300005367 | Unclassified | 2283 |
| 97 | Ga0070667_100157440 | 3300005367 | Bacteria | 1999 |
| 98 | Ga0070667_100320683 | 3300005367 | Bacteria | 1398 |
| 99 | Ga0070703_10015511 | 3300005406 | Bacteria | 2181 |
| 100 | Ga0070709_10034062 | 3300005434 | Bacteria | 3085 |
| 101 | Ga0070714_100015272 | 3300005435 | Bacteria | 6177 |
| 102 | Ga0070714_100116764 | 3300005435 | Bacteria | 2369 |
| 103 | Ga0070713_100000838 | 3300005436 | Bacteria | 19660 |
| 104 | Ga0070710_10021271 | 3300005437 | Bacteria | 3378 |
| 105 | Ga0070710_10037732 | 3300005437 | Bacteria | 2651 |
| 106 | Ga0070710_10060067 | 3300005437 | Bacteria | 2161 |
| 107 | Ga0070701_10000066 | 3300005438 | Bacteria | 28271 |
| 108 | Ga0070701_10031475 | 3300005438 | Bacteria | 2632 |
| 109 | Ga0070711_100010309 | 3300005439 | Bacteria | 5780 |
| 110 | Ga0070711_100120995 | 3300005439 | Bacteria | 1936 |
| 111 | Ga0070711_100218055 | 3300005439 | Bacteria | 1481 |
| 112 | Ga0070711_100343361 | 3300005439 | Bacteria | 1198 |
| 113 | Ga0070705_100001500 | 3300005440 | Bacteria | 12285 |
| 114 | Ga0070705_100076919 | 3300005440 | Bacteria | 2037 |
| 115 | Ga0070700_100001568 | 3300005441 | Bacteria | 11405 |
| 116 | Ga0070700_100174838 | 3300005441 | Bacteria | 1489 |
| 117 | Ga0070700_100200606 | 3300005441 | Bacteria | 1401 |
| 118 | Ga0070694_100002175 | 3300005444 | Bacteria | 11621 |
| 119 | Ga0070694_100008394 | 3300005444 | Bacteria | 6319 |
| 120 | Ga0070708_100021510 | 3300005445 | Bacteria | 5454 |
| 121 | Ga0070708_100146688 | 3300005445 | Bacteria | 2192 |
| 122 | Ga0070663_100001857 | 3300005455 | Bacteria | 11779 |
| 123 | Ga0070663_100281834 | 3300005455 | Bacteria | 1324 |
| 124 | Ga0070678_100000391 | 3300005456 | Bacteria | 20585 |
| 125 | Ga0070678_100025652 | 3300005456 | Bacteria | 3970 |
| 126 | Ga0070678_100069453 | 3300005456 | Bacteria | 2630 |
| 127 | Ga0070662_100001285 | 3300005457 | Bacteria | 15435 |
| 128 | Ga0070662_100073731 | 3300005457 | Bacteria | 2523 |
| 129 | Ga0070681_10002720 | 3300005458 | Bacteria | 16283 |
| 130 | Ga0070681_10016797 | 3300005458 | Bacteria | 7308 |
| 131 | Ga0070681_10081723 | 3300005458 | Bacteria | 3187 |
| 132 | Ga0070681_10207236 | 3300005458 | Bacteria | 1877 |
| 133 | Ga0068867_100001688 | 3300005459 | Bacteria | 15398 |
| 134 | Ga0068867_100032643 | 3300005459 | Unclassified | 3766 |
| 135 | Ga0070685_10000496 | 3300005466 | Bacteria | 22749 |
| 136 | Ga0070685_10010561 | 3300005466 | Bacteria | 4802 |
| 137 | Ga0070679_100007687 | 3300005530 | Bacteria | 10092 |
| 138 | Ga0070679_100048889 | 3300005530 | Unclassified | 4213 |
| 139 | Ga0070679_100101875 | 3300005530 | Bacteria | 2858 |
| 140 | Ga0070679_100254502 | 3300005530 | Bacteria | 1712 |
| 141 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 142 | Ga0070684_100020653 | 3300005535 | Bacteria | 5462 |
| 143 | Ga0070684_100287676 | 3300005535 | Bacteria | 1506 |
| 144 | Ga0068853_100005490 | 3300005539 | Bacteria | 9938 |
| 145 | Ga0068853_100193278 | 3300005539 | Bacteria | 1850 |
| 146 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 147 | Ga0070672_100039509 | 3300005543 | Unclassified | 3615 |
| 148 | Ga0070672_100042518 | 3300005543 | Bacteria | 3499 |
| 149 | Ga0070686_100002195 | 3300005544 | Bacteria | 10783 |
| 150 | Ga0070686_100026174 | 3300005544 | Bacteria | 3518 |
| 151 | Ga0070686_100096472 | 3300005544 | Bacteria | 1988 |
| 152 | Ga0070695_100000225 | 3300005545 | Bacteria | 27760 |
| 153 | Ga0070695_100005011 | 3300005545 | Bacteria | 7804 |
| 154 | Ga0070696_100002898 | 3300005546 | Bacteria | 11405 |
| 155 | Ga0070696_100010256 | 3300005546 | Bacteria | 6271 |
| 156 | Ga0070693_100000138 | 3300005547 | Bacteria | 32988 |
| 157 | Ga0070693_100055005 | 3300005547 | Unclassified | 2291 |
| 158 | Ga0070693_100116771 | 3300005547 | Bacteria | 1650 |
| 159 | Ga0070665_100009456 | 3300005548 | Bacteria | 9865 |
| 160 | Ga0070665_100044585 | 3300005548 | Bacteria | 4453 |
| 161 | Ga0070665_100212479 | 3300005548 | Bacteria | 1935 |
| 162 | Ga0070665_100789659 | 3300005548 | Bacteria | 962 |
| 163 | Ga0070704_100003148 | 3300005549 | Bacteria | 9414 |
| 164 | Ga0070704_100027532 | 3300005549 | Unclassified | 3772 |
| 165 | Ga0070704_100200936 | 3300005549 | Bacteria | 1609 |
| 166 | Ga0068855_100008651 | 3300005563 | Bacteria | 12299 |
| 167 | Ga0068855_100018870 | 3300005563 | Bacteria | 8290 |
| 168 | Ga0068855_100032667 | 3300005563 | Bacteria | 6213 |
| 169 | Ga0068855_100079966 | 3300005563 | Bacteria | 3791 |
| 170 | Ga0068855_100197592 | 3300005563 | Bacteria | 2265 |
| 171 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 172 | Ga0070664_100022080 | 3300005564 | Bacteria | 5248 |
| 173 | Ga0070664_100034890 | 3300005564 | Bacteria | 4222 |
| 174 | Ga0070664_100038096 | 3300005564 | Bacteria | 4046 |
| 175 | Ga0068857_100000275 | 3300005577 | Bacteria | 35176 |
| 176 | Ga0068857_100060516 | 3300005577 | Bacteria | 3364 |
| 177 | Ga0068854_100002271 | 3300005578 | Bacteria | 11828 |
| 178 | Ga0068854_100395576 | 3300005578 | Bacteria | 1142 |
| 179 | Ga0068856_100001016 | 3300005614 | Bacteria | 29871 |
| 180 | Ga0068856_100103150 | 3300005614 | Bacteria | 2846 |
| 181 | Ga0068856_100235161 | 3300005614 | Bacteria | 1848 |
| 182 | Ga0068856_100460215 | 3300005614 | Bacteria | 1293 |
| 183 | Ga0068856_100486022 | 3300005614 | Bacteria | 1256 |
| 184 | Ga0068856_100575853 | 3300005614 | Bacteria | 1147 |
| 185 | Ga0068856_100973681 | 3300005614 | Bacteria | 867 |
| 186 | Ga0070702_100000175 | 3300005615 | Bacteria | 20470 |
| 187 | Ga0068852_100000611 | 3300005616 | Bacteria | 23441 |
| 188 | Ga0068852_100139477 | 3300005616 | Bacteria | 2242 |
| 189 | Ga0068852_100185344 | 3300005616 | Bacteria | 1960 |
| 190 | Ga0068852_100233343 | 3300005616 | Bacteria | 1755 |
| 191 | Ga0068852_100263402 | 3300005616 | Bacteria | 1656 |
| 192 | Ga0068852_100279190 | 3300005616 | Bacteria | 1610 |
| 193 | Ga0068859_100002948 | 3300005617 | Bacteria | 17261 |
| 194 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 195 | Ga0068864_100381709 | 3300005618 | Bacteria | 1335 |
| 196 | Ga0068864_100726187 | 3300005618 | Bacteria | 972 |
| 197 | Ga0068866_10002176 | 3300005718 | Bacteria | 8161 |
| 198 | Ga0068861_100000317 | 3300005719 | Bacteria | 27073 |
| 199 | Ga0068861_100030808 | 3300005719 | Bacteria | 3935 |
| 200 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 201 | Ga0068863_100001729 | 3300005841 | Bacteria | 21634 |
| 202 | Ga0068863_100296329 | 3300005841 | Bacteria | 1568 |
| 203 | Ga0068858_100001059 | 3300005842 | Bacteria | 28468 |
| 204 | Ga0068858_100046203 | 3300005842 | Bacteria | 4037 |
| 205 | Ga0068858_100083371 | 3300005842 | Bacteria | 2973 |
| 206 | Ga0068858_100128294 | 3300005842 | Bacteria | 2377 |
| 207 | Ga0068858_100349923 | 3300005842 | Bacteria | 1415 |
| 208 | Ga0068860_100003167 | 3300005843 | Bacteria | 16980 |
| 209 | Ga0068860_100131881 | 3300005843 | Bacteria | 2398 |
| 210 | Ga0068860_100147282 | 3300005843 | Bacteria | 2266 |
| 211 | Ga0068862_100030207 | 3300005844 | Bacteria | 4566 |
| 212 | Ga0081455_10008146 | 3300005937 | Bacteria | 10932 |
| 213 | Ga0081540_1000374 | 3300005983 | Bacteria | 44794 |
| 214 | Ga0070717_10025214 | 3300006028 | Bacteria | 4726 |
| 215 | Ga0070717_10066122 | 3300006028 | Bacteria | 3006 |
| 216 | Ga0070717_10096851 | 3300006028 | Bacteria | 2499 |
| 217 | Ga0075432_10002492 | 3300006058 | Bacteria | 6119 |
| 218 | Ga0070715_10055615 | 3300006163 | Bacteria | 1719 |
| 219 | Ga0070715_10110172 | 3300006163 | Bacteria | 1298 |
| 220 | Ga0070716_100040093 | 3300006173 | Bacteria | 2604 |
| 221 | Ga0070712_100068122 | 3300006175 | Bacteria | 2535 |
| 222 | Ga0070712_100201467 | 3300006175 | Bacteria | 1564 |
| 223 | Ga0070712_100263293 | 3300006175 | Bacteria | 1382 |
| 224 | Ga0075367_10104289 | 3300006178 | Bacteria | 1736 |
| 225 | Ga0075367_10149404 | 3300006178 | Bacteria | 1449 |
| 226 | Ga0097621_100010706 | 3300006237 | Bacteria | 6723 |
| 227 | Ga0097621_100076109 | 3300006237 | Bacteria | 2783 |
| 228 | Ga0097621_100468937 | 3300006237 | Bacteria | 1137 |
| 229 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 230 | Ga0075430_100008278 | 3300006846 | Bacteria | 8782 |
| 231 | Ga0075433_10000072 | 3300006852 | Bacteria | 45390 |
| 232 | Ga0075433_10057417 | 3300006852 | Bacteria | 3402 |
| 233 | Ga0075434_100000756 | 3300006871 | Bacteria | 25483 |
| 234 | Ga0075434_100001819 | 3300006871 | Bacteria | 18406 |
| 235 | Ga0075434_100111340 | 3300006871 | Bacteria | 2748 |
| 236 | Ga0075434_100148836 | 3300006871 | Bacteria | 2361 |
| 237 | Ga0075434_100329671 | 3300006871 | Bacteria | 1547 |
| 238 | Ga0075429_100001133 | 3300006880 | Bacteria | 21502 |
| 239 | Ga0068865_100000355 | 3300006881 | Bacteria | 25325 |
| 240 | Ga0075436_100072071 | 3300006914 | Bacteria | 2390 |
| 241 | Ga0097620_100002948 | 3300006931 | Bacteria | 17261 |
| 242 | Ga0075435_100167022 | 3300007076 | Bacteria | 1856 |
| 243 | Ga0099794_10005086 | 3300007265 | Bacteria | 5243 |
| 244 | Ga0105251_10036599 | 3300009011 | Bacteria | 2414 |
| 245 | Ga0105240_10035122 | 3300009093 | Bacteria | 6464 |
| 246 | Ga0111539_10001688 | 3300009094 | Bacteria | 29450 |
| 247 | Ga0111539_10002781 | 3300009094 | Bacteria | 23232 |
| 248 | Ga0111539_10005411 | 3300009094 | Bacteria | 16521 |
| 249 | Ga0111539_10060689 | 3300009094 | Unclassified | 4481 |
| 250 | Ga0111539_10182139 | 3300009094 | Bacteria | 2453 |
| 251 | Ga0111539_10344488 | 3300009094 | Bacteria | 1735 |
| 252 | Ga0105245_10000409 | 3300009098 | Bacteria | 39920 |
| 253 | Ga0105245_10019441 | 3300009098 | Bacteria | 5951 |
| 254 | Ga0105247_10004080 | 3300009101 | Bacteria | 9386 |
| 255 | Ga0105247_10018620 | 3300009101 | Bacteria | 4167 |
| 256 | Ga0105247_10045268 | 3300009101 | Bacteria | 2699 |
| 257 | Ga0105247_10319810 | 3300009101 | Bacteria | 1082 |
| 258 | Ga0114129_10003162 | 3300009147 | Bacteria | 23098 |
| 259 | Ga0114129_10026034 | 3300009147 | Bacteria | 8283 |
| 260 | Ga0105243_10004202 | 3300009148 | Bacteria | 11415 |
| 261 | Ga0105243_10005740 | 3300009148 | Bacteria | 9637 |
| 262 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 263 | Ga0105241_10021735 | 3300009174 | Bacteria | 4746 |
| 264 | Ga0105241_10101496 | 3300009174 | Bacteria | 2287 |
| 265 | Ga0105241_10133544 | 3300009174 | Bacteria | 2012 |
| 266 | Ga0105241_10190110 | 3300009174 | Bacteria | 1709 |
| 267 | Ga0105242_10001586 | 3300009176 | Bacteria | 17880 |
| 268 | Ga0105242_10104613 | 3300009176 | Bacteria | 2403 |
| 269 | Ga0105242_10106125 | 3300009176 | Bacteria | 2387 |
| 270 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 271 | Ga0105248_10005691 | 3300009177 | Bacteria | 13695 |
| 272 | Ga0105248_10009701 | 3300009177 | Bacteria | 10604 |
| 273 | Ga0105248_10156233 | 3300009177 | Bacteria | 2574 |
| 274 | Ga0105248_10363371 | 3300009177 | Bacteria | 1630 |
| 275 | Ga0105248_10441280 | 3300009177 | Bacteria | 1466 |
| 276 | Ga0105237_10005630 | 3300009545 | Bacteria | 14111 |
| 277 | Ga0105237_10015365 | 3300009545 | Bacteria | 7971 |
| 278 | Ga0105238_10162248 | 3300009551 | Bacteria | 2211 |
| 279 | Ga0105238_10638600 | 3300009551 | Bacteria | 1074 |
| 280 | Ga0105249_10003451 | 3300009553 | Bacteria | 13696 |
| 281 | Ga0105249_10058537 | 3300009553 | Bacteria | 3531 |
| 282 | Ga0105249_10151551 | 3300009553 | Bacteria | 2233 |
| 283 | Ga0105239_10007939 | 3300010375 | Bacteria | 12129 |
| 284 | Ga0105239_10029753 | 3300010375 | Bacteria | 6005 |
| 285 | Ga0105239_10379007 | 3300010375 | Bacteria | 1599 |
| 286 | Ga0105246_10002040 | 3300011119 | Bacteria | 12194 |
| 287 | Ga0157329_1000662 | 3300012491 | Bacteria | 1463 |
| 288 | Ga0157338_1005577 | 3300012515 | Bacteria | 1136 |
| 289 | Ga0157373_10012578 | 3300013100 | Bacteria | 6221 |
| 290 | Ga0157371_10006362 | 3300013102 | Bacteria | 9768 |
| 291 | Ga0157371_10066724 | 3300013102 | Bacteria | 2548 |
| 292 | Ga0157370_10054295 | 3300013104 | Bacteria | 3819 |
| 293 | Ga0157369_10359452 | 3300013105 | Bacteria | 1512 |
| 294 | Ga0157374_10000452 | 3300013296 | Bacteria | 37355 |
| 295 | Ga0157374_10054238 | 3300013296 | Bacteria | 3739 |
| 296 | Ga0157374_10185048 | 3300013296 | Bacteria | 2036 |
| 297 | Ga0157378_10006920 | 3300013297 | Bacteria | 9903 |
| 298 | Ga0163162_10000796 | 3300013306 | Bacteria | 29342 |
| 299 | Ga0163162_10012138 | 3300013306 | Bacteria | 8407 |
| 300 | Ga0163162_10055472 | 3300013306 | Bacteria | 3989 |
| 301 | Ga0157372_10008710 | 3300013307 | Bacteria | 10774 |
| 302 | Ga0157372_10175622 | 3300013307 | Bacteria | 2479 |
| 303 | Ga0157372_10365119 | 3300013307 | Bacteria | 1682 |
| 304 | Ga0157375_10004563 | 3300013308 | Bacteria | 12034 |
| 305 | Ga0157375_10022988 | 3300013308 | Bacteria | 5747 |
| 306 | Ga0157375_10143331 | 3300013308 | Bacteria | 2518 |
| 307 | Ga0157375_10491475 | 3300013308 | Bacteria | 1392 |
| 308 | Ga0163163_10001104 | 3300014325 | Bacteria | 22905 |
| 309 | Ga0163163_10011726 | 3300014325 | Bacteria | 7963 |
| 310 | Ga0163163_10144094 | 3300014325 | Bacteria | 2425 |
| 311 | Ga0157380_10017908 | 3300014326 | Bacteria | 5252 |
| 312 | Ga0157377_10000538 | 3300014745 | Bacteria | 16011 |
| 313 | Ga0157379_10009254 | 3300014968 | Bacteria | 8576 |
| 314 | Ga0157379_10094730 | 3300014968 | Bacteria | 2679 |
| 315 | Ga0157379_10258962 | 3300014968 | Bacteria | 1580 |
| 316 | Ga0157376_10002295 | 3300014969 | Bacteria | 12921 |
| 317 | Ga0157376_10141931 | 3300014969 | Bacteria | 2156 |
| 318 | Ga0157376_10276156 | 3300014969 | Bacteria | 1580 |
| 319 | Ga0157376_10650290 | 3300014969 | Bacteria | 1054 |
| 320 | Ga0163161_10000499 | 3300017792 | Bacteria | 32280 |
| 321 | Ga0206353_10474572 | 3300020082 | Bacteria | 1741 |
| 322 | Ga0207666_1000313 | 3300025271 | Bacteria | 6754 |
| 323 | Ga0207666_1001193 | 3300025271 | Bacteria | 3064 |
| 324 | Ga0207697_10000252 | 3300025315 | Bacteria | 29548 |
| 325 | Ga0207653_10001924 | 3300025885 | Bacteria | 6639 |
| 326 | Ga0207653_10027745 | 3300025885 | Bacteria | 1817 |
| 327 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 328 | Ga0207692_10002625 | 3300025898 | Bacteria | 6916 |
| 329 | Ga0207692_10004448 | 3300025898 | Bacteria | 5550 |
| 330 | Ga0207692_10062536 | 3300025898 | Bacteria | 1932 |
| 331 | Ga0207692_10068998 | 3300025898 | Bacteria | 1856 |
| 332 | Ga0207642_10000713 | 3300025899 | Bacteria | 10287 |
| 333 | Ga0207710_10032756 | 3300025900 | Bacteria | 2277 |
| 334 | Ga0207710_10060468 | 3300025900 | Bacteria | 1717 |
| 335 | Ga0207710_10067238 | 3300025900 | Bacteria | 1636 |
| 336 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 337 | Ga0207680_10001555 | 3300025903 | Bacteria | 10815 |
| 338 | Ga0207680_10303050 | 3300025903 | Bacteria | 1114 |
| 339 | Ga0207647_10004457 | 3300025904 | Bacteria | 10378 |
| 340 | Ga0207647_10004529 | 3300025904 | Bacteria | 10300 |
| 341 | Ga0207685_10014773 | 3300025905 | Bacteria | 2453 |
| 342 | Ga0207699_10019161 | 3300025906 | Bacteria | 3642 |
| 343 | Ga0207699_10047171 | 3300025906 | Bacteria | 2525 |
| 344 | Ga0207645_10000108 | 3300025907 | Bacteria | 61630 |
| 345 | Ga0207645_10215252 | 3300025907 | Bacteria | 1266 |
| 346 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 347 | Ga0207705_10015497 | 3300025909 | Bacteria | 5470 |
| 348 | Ga0207705_10019507 | 3300025909 | Bacteria | 4848 |
| 349 | Ga0207654_10000143 | 3300025911 | Bacteria | 45654 |
| 350 | Ga0207654_10123379 | 3300025911 | Bacteria | 1630 |
| 351 | Ga0207654_10197266 | 3300025911 | Bacteria | 1323 |
| 352 | Ga0207707_10002475 | 3300025912 | Bacteria | 16630 |
| 353 | Ga0207707_10030589 | 3300025912 | Bacteria | 4710 |
| 354 | Ga0207707_10054545 | 3300025912 | Bacteria | 3480 |
| 355 | Ga0207707_10157482 | 3300025912 | Bacteria | 1986 |
| 356 | Ga0207707_10204552 | 3300025912 | Bacteria | 1721 |
| 357 | Ga0207707_10378188 | 3300025912 | Bacteria | 1218 |
| 358 | Ga0207671_10009506 | 3300025914 | Bacteria | 8121 |
| 359 | Ga0207693_10000831 | 3300025915 | Bacteria | 27450 |
| 360 | Ga0207693_10005608 | 3300025915 | Bacteria | 10436 |
| 361 | Ga0207693_10067898 | 3300025915 | Bacteria | 2791 |
| 362 | Ga0207693_10153627 | 3300025915 | Bacteria | 1811 |
| 363 | Ga0207693_10191504 | 3300025915 | Bacteria | 1609 |
| 364 | Ga0207663_10027032 | 3300025916 | Bacteria | 3339 |
| 365 | Ga0207663_10324202 | 3300025916 | Bacteria | 1158 |
| 366 | Ga0207660_10000543 | 3300025917 | Bacteria | 25357 |
| 367 | Ga0207660_10031238 | 3300025917 | Bacteria | 3665 |
| 368 | Ga0207660_10034606 | 3300025917 | Bacteria | 3503 |
| 369 | Ga0207660_10077574 | 3300025917 | Bacteria | 2432 |
| 370 | Ga0207660_10397105 | 3300025917 | Bacteria | 1110 |
| 371 | Ga0207660_10402371 | 3300025917 | Bacteria | 1103 |
| 372 | Ga0207662_10000104 | 3300025918 | Bacteria | 40365 |
| 373 | Ga0207662_10009837 | 3300025918 | Bacteria | 5276 |
| 374 | Ga0207662_10158113 | 3300025918 | Bacteria | 1446 |
| 375 | Ga0207657_10001453 | 3300025919 | Bacteria | 25334 |
| 376 | Ga0207657_10004676 | 3300025919 | Bacteria | 14449 |
| 377 | Ga0207657_10020064 | 3300025919 | Bacteria | 6330 |
| 378 | Ga0207657_10068005 | 3300025919 | Bacteria | 3027 |
| 379 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 380 | Ga0207652_10000916 | 3300025921 | Bacteria | 27831 |
| 381 | Ga0207652_10006960 | 3300025921 | Bacteria | 9111 |
| 382 | Ga0207652_10087443 | 3300025921 | Bacteria | 2733 |
| 383 | Ga0207652_10168332 | 3300025921 | Bacteria | 1966 |
| 384 | Ga0207652_10312748 | 3300025921 | Bacteria | 1418 |
| 385 | Ga0207681_10001187 | 3300025923 | Bacteria | 16757 |
| 386 | Ga0207650_10001534 | 3300025925 | Bacteria | 16557 |
| 387 | Ga0207650_10023478 | 3300025925 | Bacteria | 4374 |
| 388 | Ga0207650_10140424 | 3300025925 | Bacteria | 1899 |
| 389 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 390 | Ga0207659_10019591 | 3300025926 | Bacteria | 4457 |
| 391 | Ga0207659_10155742 | 3300025926 | Bacteria | 1788 |
| 392 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 393 | Ga0207687_10046599 | 3300025927 | Bacteria | 3002 |
| 394 | Ga0207687_10143690 | 3300025927 | Bacteria | 1813 |
| 395 | Ga0207700_10078743 | 3300025928 | Bacteria | 2565 |
| 396 | Ga0207700_10192552 | 3300025928 | Bacteria | 1714 |
| 397 | Ga0207664_10095859 | 3300025929 | Bacteria | 2441 |
| 398 | Ga0207644_10000194 | 3300025931 | Bacteria | 43567 |
| 399 | Ga0207644_10007311 | 3300025931 | Bacteria | 7188 |
| 400 | Ga0207644_10029098 | 3300025931 | Bacteria | 3829 |
| 401 | Ga0207644_10077254 | 3300025931 | Bacteria | 2451 |
| 402 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 403 | Ga0207706_10001293 | 3300025933 | Bacteria | 25199 |
| 404 | Ga0207706_10010554 | 3300025933 | Bacteria | 8439 |
| 405 | Ga0207706_10088706 | 3300025933 | Bacteria | 2719 |
| 406 | Ga0207686_10000530 | 3300025934 | Bacteria | 24694 |
| 407 | Ga0207686_10025146 | 3300025934 | Bacteria | 3459 |
| 408 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 409 | Ga0207709_10082888 | 3300025935 | Bacteria | 2072 |
| 410 | Ga0207670_10000434 | 3300025936 | Bacteria | 23430 |
| 411 | Ga0207670_10047843 | 3300025936 | Bacteria | 2851 |
| 412 | Ga0207670_10204360 | 3300025936 | Bacteria | 1502 |
| 413 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 414 | Ga0207669_10154652 | 3300025937 | Bacteria | 1611 |
| 415 | Ga0207669_10271354 | 3300025937 | Bacteria | 1274 |
| 416 | Ga0207704_10000438 | 3300025938 | Bacteria | 18608 |
| 417 | Ga0207665_10001157 | 3300025939 | Bacteria | 17725 |
| 418 | Ga0207691_10001047 | 3300025940 | Bacteria | 27463 |
| 419 | Ga0207691_10042370 | 3300025940 | Bacteria | 4197 |
| 420 | Ga0207691_10043271 | 3300025940 | Bacteria | 4151 |
| 421 | Ga0207691_10091890 | 3300025940 | Bacteria | 2718 |
| 422 | Ga0207711_10007089 | 3300025941 | Bacteria | 9389 |
| 423 | Ga0207711_10008817 | 3300025941 | Bacteria | 8433 |
| 424 | Ga0207711_10491374 | 3300025941 | Bacteria | 1144 |
| 425 | Ga0207689_10001160 | 3300025942 | Bacteria | 25357 |
| 426 | Ga0207689_10096196 | 3300025942 | Bacteria | 2432 |
| 427 | Ga0207661_10000126 | 3300025944 | Bacteria | 48665 |
| 428 | Ga0207661_10312350 | 3300025944 | Bacteria | 1411 |
| 429 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 430 | Ga0207679_10030446 | 3300025945 | Bacteria | 3769 |
| 431 | Ga0207679_10119600 | 3300025945 | Bacteria | 2094 |
| 432 | Ga0207679_10555968 | 3300025945 | Bacteria | 1030 |
| 433 | Ga0207667_10016786 | 3300025949 | Bacteria | 8259 |
| 434 | Ga0207667_10022484 | 3300025949 | Bacteria | 6963 |
| 435 | Ga0207667_10029280 | 3300025949 | Bacteria | 5973 |
| 436 | Ga0207667_10299030 | 3300025949 | Bacteria | 1644 |
| 437 | Ga0207651_10001232 | 3300025960 | Bacteria | 11489 |
| 438 | Ga0207651_10085430 | 3300025960 | Bacteria | 2289 |
| 439 | Ga0207651_10123202 | 3300025960 | Bacteria | 1970 |
| 440 | Ga0207651_10130302 | 3300025960 | Bacteria | 1924 |
| 441 | Ga0207712_10002654 | 3300025961 | Bacteria | 11451 |
| 442 | Ga0207712_10018907 | 3300025961 | Bacteria | 4494 |
| 443 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 444 | Ga0207668_10163464 | 3300025972 | Bacteria | 1737 |
| 445 | Ga0207640_10004275 | 3300025981 | Bacteria | 7729 |
| 446 | Ga0207658_10001093 | 3300025986 | Bacteria | 21888 |
| 447 | Ga0207658_10037209 | 3300025986 | Bacteria | 3495 |
| 448 | Ga0207658_10130831 | 3300025986 | Bacteria | 2016 |
| 449 | Ga0207658_10283800 | 3300025986 | Bacteria | 1420 |
| 450 | Ga0207658_10340989 | 3300025986 | Bacteria | 1302 |
| 451 | Ga0207658_10600720 | 3300025986 | Bacteria | 988 |
| 452 | Ga0207677_10000229 | 3300026023 | Bacteria | 44154 |
| 453 | Ga0207677_10049748 | 3300026023 | Bacteria | 2830 |
| 454 | Ga0207677_10083255 | 3300026023 | Bacteria | 2302 |
| 455 | Ga0207703_10000780 | 3300026035 | Bacteria | 31340 |
| 456 | Ga0207703_10016660 | 3300026035 | Bacteria | 5732 |
| 457 | Ga0207703_10054060 | 3300026035 | Bacteria | 3265 |
| 458 | Ga0207703_10069167 | 3300026035 | Bacteria | 2911 |
| 459 | Ga0207703_10071010 | 3300026035 | Bacteria | 2875 |
| 460 | Ga0207639_10002735 | 3300026041 | Bacteria | 11838 |
| 461 | Ga0207639_10041347 | 3300026041 | Bacteria | 3448 |
| 462 | Ga0207639_10067384 | 3300026041 | Bacteria | 2785 |
| 463 | Ga0207678_10000403 | 3300026067 | Bacteria | 39172 |
| 464 | Ga0207678_10040152 | 3300026067 | Bacteria | 4059 |
| 465 | Ga0207708_10000669 | 3300026075 | Bacteria | 26302 |
| 466 | Ga0207708_10005479 | 3300026075 | Bacteria | 9367 |
| 467 | Ga0207708_10229896 | 3300026075 | Bacteria | 1489 |
| 468 | Ga0207708_10244491 | 3300026075 | Bacteria | 1444 |
| 469 | Ga0207702_10006536 | 3300026078 | Bacteria | 10027 |
| 470 | Ga0207702_10143680 | 3300026078 | Bacteria | 2162 |
| 471 | Ga0207702_10156396 | 3300026078 | Bacteria | 2078 |
| 472 | Ga0207702_10181108 | 3300026078 | Bacteria | 1941 |
| 473 | Ga0207702_10189336 | 3300026078 | Bacteria | 1900 |
| 474 | Ga0207702_10195395 | 3300026078 | Bacteria | 1872 |
| 475 | Ga0207702_10826128 | 3300026078 | Bacteria | 917 |
| 476 | Ga0207641_10000542 | 3300026088 | Bacteria | 42352 |
| 477 | Ga0207641_10318386 | 3300026088 | Bacteria | 1474 |
| 478 | Ga0207641_10629406 | 3300026088 | Bacteria | 1052 |
| 479 | Ga0207648_10001244 | 3300026089 | Bacteria | 28553 |
| 480 | Ga0207648_10017537 | 3300026089 | Bacteria | 6507 |
| 481 | Ga0207676_10000672 | 3300026095 | Bacteria | 27349 |
| 482 | Ga0207676_10035605 | 3300026095 | Bacteria | 3780 |
| 483 | Ga0207676_10367384 | 3300026095 | Bacteria | 1335 |
| 484 | Ga0207674_10001968 | 3300026116 | Bacteria | 26001 |
| 485 | Ga0207675_100001274 | 3300026118 | Bacteria | 25219 |
| 486 | Ga0207675_100056051 | 3300026118 | Bacteria | 3677 |
| 487 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 488 | Ga0207683_10000880 | 3300026121 | Bacteria | 27550 |
| 489 | Ga0207683_10019963 | 3300026121 | Bacteria | 5725 |
| 490 | Ga0207698_10001780 | 3300026142 | Bacteria | 12577 |
| 491 | Ga0207698_10164946 | 3300026142 | Bacteria | 1943 |
| 492 | Ga0207698_10190227 | 3300026142 | Bacteria | 1827 |
| 493 | Ga0207698_10204016 | 3300026142 | Bacteria | 1773 |
| 494 | Ga0209996_1003302 | 3300027395 | Bacteria | 2023 |
| 495 | Ga0210002_1000151 | 3300027617 | Bacteria | 10314 |
| 496 | Ga0209588_1034985 | 3300027671 | Bacteria | 1614 |
| 497 | Ga0209971_1038720 | 3300027682 | Bacteria | 1148 |
| 498 | Ga0209966_1001368 | 3300027695 | Bacteria | 4266 |
| 499 | Ga0209966_1002416 | 3300027695 | Bacteria | 3117 |
| 500 | Ga0209998_10000830 | 3300027717 | Bacteria | 7984 |
| 501 | Ga0209998_10000899 | 3300027717 | Bacteria | 7635 |
| 502 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 503 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 504 | Ga0207428_10000701 | 3300027907 | Bacteria | 38862 |
| 505 | Ga0268266_10010845 | 3300028379 | Bacteria | 7938 |
| 506 | Ga0268266_10066865 | 3300028379 | Bacteria | 3109 |
| 507 | Ga0268266_10237921 | 3300028379 | Bacteria | 1679 |
| 508 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 509 | Ga0268265_10008133 | 3300028380 | Bacteria | 7089 |
| 510 | Ga0268264_10001567 | 3300028381 | Bacteria | 21210 |
| 511 | Ga0268264_10164771 | 3300028381 | Bacteria | 2000 |
| 512 | Ga0265336_10029893 | 3300028666 | Bacteria | 1698 |
| 513 | Ga0265338_10012066 | 3300028800 | Bacteria | 9882 |
| 514 | Ga0265338_10219689 | 3300028800 | Bacteria | 1420 |
| 515 | Ga0265325_10056250 | 3300031241 | Bacteria | 2010 |
| 516 | Ga0265340_10096387 | 3300031247 | Bacteria | 1378 |
| 517 | Ga0265339_10021871 | 3300031249 | Bacteria | 3712 |
| 518 | Ga0265339_10059070 | 3300031249 | Bacteria | 2069 |
| 519 | Ga0265339_10190761 | 3300031249 | Bacteria | 1016 |
| 520 | Ga0265339_10198739 | 3300031249 | Bacteria | 990 |
| 521 | Ga0265316_10308415 | 3300031344 | Bacteria | 1152 |
| 522 | Ga0265313_10007635 | 3300031595 | Bacteria | 7334 |
| 523 | Ga0265313_10020128 | 3300031595 | Bacteria | 3689 |
| 524 | Ga0265313_10021404 | 3300031595 | Bacteria | 3536 |
| 525 | Ga0265313_10022693 | 3300031595 | Bacteria | 3398 |
| 526 | Ga0265314_10005096 | 3300031711 | Bacteria | 11967 |
| 527 | Ga0265314_10185576 | 3300031711 | Bacteria | 1242 |
| 528 | Ga0265342_10000912 | 3300031712 | Bacteria | 29335 |
| 529 | Ga0265342_10157545 | 3300031712 | Bacteria | 1257 |
| 530 | Ga0316583_10000300 | 3300032133 | Bacteria | 13878 |
| 531 | Ga0373930_0000948 | 3300034816 | Bacteria | 4151 |
| 532 | Ga0373930_0009551 | 3300034816 | Bacteria | 1718 |
| 533 | Ga0373930_0036029 | 3300034816 | Bacteria | 1037 |
| 534 | Ga0373948_0000060 | 3300034817 | Bacteria | 11545 |
| 535 | Ga0373950_0000151 | 3300034818 | Bacteria | 10644 |
| 536 | Ga0373958_0000640 | 3300034819 | Bacteria | 4376 |
| 537 | Ga0373958_0001109 | 3300034819 | Bacteria | 3557 |
| 538 | Ga0373959_0003990 | 3300034820 | Unclassified | 2364 |
| 539 | Ga0373938_0000265 | 3300034957 | Bacteria | 8266 |
| 540 | Ga0373938_0000851 | 3300034957 | Bacteria | 4927 |
| 541 | Ga0373928_0002719 | 3300035084 | Unclassified | 3416 |
| 542 | Ga0373928_0047247 | 3300035084 | Bacteria | 1006 |
| 543 | Ga0373929_0006649 | 3300035085 | Bacteria | 2093 |
| 544 | Ga0373940_0001617 | 3300035088 | Bacteria | 4136 |
| 545 | Ga0373940_0005020 | 3300035088 | Bacteria | 2841 |
| 546 | Ga0373944_0040298 | 3300035089 | Bacteria | 1441 |
| 547 | Ga0373949_0001017 | 3300035090 | Bacteria | 8644 |
| 548 | Ga0373949_0001292 | 3300035090 | Bacteria | 7292 |
| 549 | Ga0373951_0001079 | 3300035091 | Bacteria | 7294 |
| 550 | Ga0373951_0006738 | 3300035091 | Bacteria | 2623 |
| 551 | Ga0373952_0000144 | 3300035092 | Bacteria | 10452 |
| 552 | Ga0373952_0003531 | 3300035092 | Bacteria | 2819 |
| 553 | Ga0373952_0003549 | 3300035092 | Bacteria | 2812 |
| 554 | Ga0373952_0030830 | 3300035092 | Bacteria | 1189 |
| 555 | Ga0373932_0001474 | 3300035112 | Bacteria | 6576 |
| 556 | Ga0373932_0002399 | 3300035112 | Bacteria | 4751 |
| 557 | Ga0373932_0003771 | 3300035112 | Bacteria | 3617 |
| 558 | Ga0373939_0000633 | 3300035114 | Bacteria | 8744 |
| 559 | Ga0373939_0000683 | 3300035114 | Bacteria | 8411 |
| 560 | Ga0373939_0001140 | 3300035114 | Bacteria | 6532 |
| 561 | Ga0373941_0000506 | 3300035115 | Bacteria | 7782 |
| 562 | Ga0373941_0000613 | 3300035115 | Bacteria | 7197 |
| 563 | Ga0373941_0004805 | 3300035115 | Bacteria | 3144 |
| 564 | Ga0373941_0011897 | 3300035115 | Bacteria | 2261 |
| 565 | Ga0373941_0042292 | 3300035115 | Bacteria | 1414 |
| 566 | Ga0373945_0002918 | 3300035116 | Bacteria | 5373 |
| 567 | Ga0373953_0009947 | 3300035117 | Bacteria | 3296 |
| 568 | Ga0373954_0002508 | 3300035118 | Bacteria | 7701 |
| 569 | Ga0373954_0005440 | 3300035118 | Bacteria | 5510 |
| 570 | Ga0373956_0024480 | 3300035119 | Bacteria | 2602 |
| 571 | Ga0373957_0001422 | 3300035120 | Bacteria | 6480 |
| 572 | Ga0373957_0002239 | 3300035120 | Bacteria | 5477 |
| 573 | Ga0373957_0079124 | 3300035120 | Bacteria | 1295 |
| 574 | Ga0373960_0000369 | 3300035121 | Bacteria | 8691 |
| 575 | Ga0373960_0006235 | 3300035121 | Bacteria | 2791 |
| 576 | Ga0373960_0007623 | 3300035121 | Bacteria | 2570 |
| 577 | Ga0373943_0011614 | 3300035170 | Bacteria | 3963 |
| 578 | Ga0373946_0004728 | 3300035171 | Bacteria | 4893 |
| 579 | Ga0373946_0014660 | 3300035171 | Bacteria | 2958 |
| 580 | Ga0373955_0000744 | 3300035172 | Bacteria | 14004 |
| 581 | Ga0373955_0002809 | 3300035172 | Bacteria | 7652 |
| 582 | Ga0373955_0045720 | 3300035172 | Bacteria | 2363 |
| 583 | Ga0373942_0000425 | 3300035207 | Bacteria | 11867 |
| 584 | Ga0373942_0001723 | 3300035207 | Bacteria | 5561 |
| 585 | Ga0373942_0007645 | 3300035207 | Bacteria | 2511 |
| 586 | Ga0373942_0029590 | 3300035207 | Bacteria | 1438 |
| 587 | Ga0373961_0001150 | 3300035241 | Bacteria | 8276 |
| 588 | Ga0373961_0001699 | 3300035241 | Bacteria | 6134 |
| 589 | Ga0373961_0006662 | 3300035241 | Bacteria | 2777 |
| 590 | Ga0373961_0026069 | 3300035241 | Bacteria | 1594 |
| 591 | Ga0373962_0000209 | 3300035242 | Bacteria | 12428 |
| 592 | Ga0373962_0000258 | 3300035242 | Bacteria | 11309 |
| 593 | Ga0373962_0003978 | 3300035242 | Bacteria | 3559 |
| 594 | Ga0373962_0022289 | 3300035242 | Bacteria | 1678 |
| 595 | Ga0373924_0011954 | 3300035410 | Bacteria | 3233 |
| 596 | Ga0373924_0025618 | 3300035410 | Bacteria | 2332 |
| 597 | Ga0373931_0001019 | 3300035691 | Bacteria | 11824 |
| 598 | Ga0373931_0020943 | 3300035691 | Bacteria | 3275 |
| 599 | Ga0373931_0022983 | 3300035691 | Bacteria | 3143 |
| 600 | Ga0373931_0169813 | 3300035691 | Bacteria | 1284 |
| 601 | Ga0373927_0079590 | 3300035695 | Unclassified | 2123 |
| 602 | Ga0373933_0000842 | 3300035724 | Bacteria | 18781 |
| 603 | Ga0373933_0016370 | 3300035724 | Bacteria | 4145 |
| 604 | Ga0373933_0037328 | 3300035724 | Bacteria | 2849 |
| 605 | Ga0373933_0115928 | 3300035724 | Bacteria | 1674 |
| 606 | Ga0373947_0001071 | 3300035725 | Bacteria | 16758 |
| 607 | Ga0373947_0074885 | 3300035725 | Bacteria | 2084 |
| 608 | Ga0373947_0322951 | 3300035725 | Unclassified | 1032 |
| 609 | Ga0373937_0002444 | 3300036401 | Bacteria | 15436 |
| 610 | Ga0373937_0004304 | 3300036401 | Bacteria | 12068 |
| 611 | Ga0373937_0186711 | 3300036401 | Unclassified | 1947 |
| 612 | Ga0316582_0070685 | 3300036647 | Bacteria | 2259 |
| 613 | Ga0373925_0020933 | 3300037068 | Bacteria | 4766 |
| 614 | Ga0373925_0058812 | 3300037068 | Bacteria | 2883 |
| 615 | Ga0373925_0086417 | 3300037068 | Bacteria | 2392 |
| 616 | Ga0373925_0190429 | 3300037068 | Unclassified | 1627 |
| 617 | Ga0395900_0005590 | 3300037418 | Bacteria | 13152 |
| 618 | Ga0395900_0582933 | 3300037418 | Bacteria | 1060 |
| 619 | Ga0395898_0003040 | 3300037466 | Bacteria | 19011 |
| 620 | Ga0439450_017390 | 3300042008 | Bacteria | 1498 |
| 621 | Ga0439455_0014150 | 3300042012 | Bacteria | 1818 |
| 622 | Ga0439463_019888 | 3300042016 | Bacteria | 1673 |
| 623 | Ga0451577_0195565 | 3300042876 | Bacteria | 1825 |
| 624 | Ga0439440_0064746 | 3300042993 | Bacteria | 940 |
| 625 | Ga0466963_0136357 | 3300044694 | Bacteria | 1698 |
| 626 | Ga0453684_0219997 | 3300044712 | Bacteria | 2200 |
| 627 | Ga0451576_0013835 | 3300045051 | Bacteria | 9014 |
| 628 | Ga0466958_0041961 | 3300045836 | Bacteria | 2754 |
| 629 | Ga0466967_0038326 | 3300045976 | Bacteria | 4109 |
| 630 | Ga0466967_0272755 | 3300045976 | Bacteria | 1621 |
| 631 | Ga0495592_0012089 | 3300046454 | Bacteria | 6546 |
| 632 | Ga0495592_0024911 | 3300046454 | Bacteria | 4547 |
| 633 | Ga0495592_0136335 | 3300046454 | Bacteria | 1711 |
| 634 | Ga0495603_0003522 | 3300046455 | Bacteria | 9319 |
| 635 | Ga0495603_0133959 | 3300046455 | Unclassified | 1442 |
| 636 | Ga0495629_0000527 | 3300046459 | Bacteria | 31973 |
| 637 | Ga0495629_0160533 | 3300046459 | Bacteria | 1561 |
| 638 | Ga0495629_0254586 | 3300046459 | Bacteria | 1207 |
| 639 | Ga0495641_0029112 | 3300046461 | Bacteria | 2664 |
| 640 | Ga0495641_0033030 | 3300046461 | Bacteria | 2459 |
| 641 | Ga0495641_0042184 | 3300046461 | Unclassified | 2116 |
| 642 | Ga0495651_0000908 | 3300046462 | Bacteria | 22960 |
| 643 | Ga0495651_0003856 | 3300046462 | Bacteria | 11462 |
| 644 | Ga0495651_0013633 | 3300046462 | Bacteria | 6282 |
| 645 | Ga0495653_0000912 | 3300046463 | Bacteria | 22874 |
| 646 | Ga0495653_0052486 | 3300046463 | Bacteria | 3124 |
| 647 | Ga0495653_0067885 | 3300046463 | Bacteria | 2676 |
| 648 | Ga0495580_0052811 | 3300046472 | Bacteria | 2869 |
| 649 | Ga0495580_0057151 | 3300046472 | Bacteria | 2746 |
| 650 | Ga0495582_0012645 | 3300046473 | Bacteria | 4654 |
| 651 | Ga0495582_0015881 | 3300046473 | Bacteria | 4128 |
| 652 | Ga0495582_0203261 | 3300046473 | Unclassified | 1131 |
| 653 | Ga0495639_0085854 | 3300046475 | Bacteria | 1471 |
| 654 | Ga0495662_0018163 | 3300046476 | Bacteria | 3402 |
| 655 | Ga0495662_0245232 | 3300046476 | Bacteria | 883 |
| 656 | Ga0495664_0016385 | 3300046477 | Bacteria | 4220 |
| 657 | Ga0495664_0126183 | 3300046477 | Bacteria | 1548 |
| 658 | Ga0495584_0066615 | 3300046491 | Bacteria | 1811 |
| 659 | Ga0495594_0026475 | 3300046499 | Bacteria | 3120 |
| 660 | Ga0495608_0008704 | 3300046511 | Bacteria | 7100 |
| 661 | Ga0495608_0044974 | 3300046511 | Bacteria | 2945 |
| 662 | Ga0495618_0003244 | 3300046514 | Bacteria | 10188 |
| 663 | Ga0495618_0077276 | 3300046514 | Unclassified | 2121 |
| 664 | Ga0495618_0124343 | 3300046514 | Bacteria | 1652 |
| 665 | Ga0495628_0009709 | 3300046516 | Bacteria | 8210 |
| 666 | Ga0495628_0011083 | 3300046516 | Bacteria | 7628 |
| 667 | Ga0495628_0029193 | 3300046516 | Bacteria | 4474 |
| 668 | Ga0495630_0101055 | 3300046517 | Bacteria | 2182 |
| 669 | Ga0495630_0195665 | 3300046517 | Unclassified | 1542 |
| 670 | Ga0495630_0244310 | 3300046517 | Bacteria | 1371 |
| 671 | Ga0495637_0043852 | 3300046520 | Bacteria | 1907 |
| 672 | Ga0495644_0003683 | 3300046523 | Bacteria | 6033 |
| 673 | Ga0495663_0053003 | 3300046525 | Bacteria | 1260 |
| 674 | Ga0495652_0011801 | 3300046529 | Bacteria | 7893 |
| 675 | Ga0495652_0042003 | 3300046529 | Bacteria | 3943 |
| 676 | Ga0495652_0059568 | 3300046529 | Bacteria | 3230 |
| 677 | Ga0495652_0205523 | 3300046529 | Bacteria | 1491 |
| 678 | Ga0495665_0032193 | 3300046531 | Bacteria | 2804 |
| 679 | Ga0495640_0003572 | 3300046533 | Bacteria | 12483 |
| 680 | Ga0495640_0150259 | 3300046533 | Bacteria | 1497 |
| 681 | Ga0495586_0128107 | 3300046535 | Bacteria | 1420 |
| 682 | Ga0495587_0002348 | 3300046536 | Bacteria | 12651 |
| 683 | Ga0495587_0004743 | 3300046536 | Bacteria | 8925 |
| 684 | Ga0495587_0111571 | 3300046536 | Bacteria | 1570 |
| 685 | Ga0495587_0256213 | 3300046536 | Unclassified | 983 |
| 686 | Ga0495598_0009095 | 3300046537 | Bacteria | 2336 |
| 687 | Ga0495645_0001151 | 3300046543 | Bacteria | 17952 |
| 688 | Ga0495645_0010788 | 3300046543 | Bacteria | 6418 |
| 689 | Ga0495645_0198839 | 3300046543 | Bacteria | 1361 |
| 690 | Ga0495622_0033447 | 3300046557 | Bacteria | 2399 |
| 691 | Ga0495633_0006733 | 3300046558 | Bacteria | 6763 |
| 692 | Ga0495667_0000212 | 3300046559 | Bacteria | 38949 |
| 693 | Ga0495667_0030318 | 3300046559 | Bacteria | 3635 |
| 694 | Ga0495667_0059372 | 3300046559 | Bacteria | 2510 |
| 695 | Ga0495656_0004302 | 3300046615 | Bacteria | 4866 |
| 696 | Ga0495634_0036763 | 3300046642 | Bacteria | 3347 |
| 697 | Ga0495634_0126160 | 3300046642 | Unclassified | 1635 |
| 698 | Ga0495634_0240904 | 3300046642 | Bacteria | 1109 |
| 699 | Ga0495611_0005176 | 3300046648 | Bacteria | 5593 |
| 700 | Ga0495635_0057614 | 3300046663 | Bacteria | 2673 |
| 701 | Ga0495635_0067169 | 3300046663 | Bacteria | 2459 |
| 702 | Ga0495635_0243707 | 3300046663 | Unclassified | 1212 |
| 703 | Ga0495588_0041161 | 3300046674 | Bacteria | 2358 |
| 704 | Ga0495588_0067080 | 3300046674 | Unclassified | 1862 |
| 705 | Ga0495657_0003573 | 3300046675 | Bacteria | 12646 |
| 706 | Ga0495599_0006187 | 3300046678 | Bacteria | 7215 |
| 707 | Ga0495599_0093387 | 3300046678 | Bacteria | 1877 |
| 708 | Ga0495599_0153442 | 3300046678 | Bacteria | 1425 |
| 709 | Ga0495623_0000188 | 3300046679 | Bacteria | 39199 |
| 710 | Ga0495623_0007794 | 3300046679 | Bacteria | 6962 |
| 711 | Ga0495646_0002814 | 3300046680 | Bacteria | 10765 |
| 712 | Ga0495646_0028716 | 3300046680 | Bacteria | 3481 |
| 713 | Ga0495647_0008172 | 3300046681 | Bacteria | 3516 |
| 714 | Ga0495647_0037390 | 3300046681 | Unclassified | 1831 |
| 715 | Ga0495658_0001507 | 3300046683 | Bacteria | 12204 |
| 716 | Ga0495658_0012622 | 3300046683 | Bacteria | 4286 |
| 717 | Ga0495658_0034456 | 3300046683 | Bacteria | 2778 |
| 718 | Ga0495658_0052177 | 3300046683 | Unclassified | 2318 |
| 719 | Ga0495613_0013123 | 3300046689 | Bacteria | 6157 |
| 720 | Ga0495624_0008197 | 3300046690 | Bacteria | 7307 |
| 721 | Ga0495670_0000704 | 3300046691 | Bacteria | 15931 |
| 722 | Ga0495600_0004951 | 3300046809 | Bacteria | 8000 |
| 723 | Ga0495600_0005049 | 3300046809 | Bacteria | 7928 |
| 724 | Ga0495600_0075044 | 3300046809 | Bacteria | 2208 |
| 725 | Ga0495581_0032257 | 3300047315 | Bacteria | 3033 |
| 726 | Ga0495581_0195420 | 3300047315 | Bacteria | 1183 |
| 727 | Ga0495604_0008689 | 3300047317 | Bacteria | 8028 |
| 728 | Ga0495604_0016801 | 3300047317 | Bacteria | 5854 |
| 729 | Ga0495604_0066408 | 3300047317 | Bacteria | 2744 |
| 730 | Ga0495674_0024741 | 3300047319 | Bacteria | 5512 |
| 731 | Ga0495674_0030841 | 3300047319 | Bacteria | 4872 |
| 732 | Ga0495674_0120459 | 3300047319 | Bacteria | 2217 |
| 733 | Ga0495674_0303533 | 3300047319 | Unclassified | 1303 |
| 734 | Ga0495676_0008228 | 3300047321 | Bacteria | 9567 |
| 735 | Ga0495680_0005676 | 3300047322 | Bacteria | 11681 |
| 736 | Ga0495680_0006175 | 3300047322 | Bacteria | 11175 |
| 737 | Ga0495680_0010622 | 3300047322 | Bacteria | 8210 |
| 738 | Ga0495680_0011028 | 3300047322 | Bacteria | 8030 |
| 739 | Ga0495680_0012117 | 3300047322 | Bacteria | 7607 |
| 740 | Ga0495675_0008455 | 3300047444 | Bacteria | 6379 |
| 741 | Ga0495684_0003722 | 3300047471 | Bacteria | 11893 |
| 742 | Ga0495684_0044462 | 3300047471 | Bacteria | 3401 |
| 743 | Ga0495593_0040959 | 3300047673 | Bacteria | 2492 |
| 744 | Ga0495602_0002562 | 3300048088 | Bacteria | 18530 |
| 745 | Ga0495602_0008079 | 3300048088 | Bacteria | 10996 |
| 746 | Ga0495602_0164146 | 3300048088 | Bacteria | 1731 |
| 747 | Ga0495614_0100536 | 3300048089 | Bacteria | 1263 |
| 748 | Ga0496100_0001962 | 3300048903 | Bacteria | 10308 |
| 749 | Ga0496100_0058678 | 3300048903 | Bacteria | 2526 |
| 750 | Ga0496100_0125127 | 3300048903 | Bacteria | 1803 |
| 751 | Ga0496100_0165938 | 3300048903 | Bacteria | 1586 |
| 752 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 753 | Ga0496101_0000610 | 3300048904 | Bacteria | 21834 |
| 754 | Ga0496101_0081018 | 3300048904 | Bacteria | 2399 |
| 755 | Ga0496102_0004728 | 3300048905 | Bacteria | 11530 |
| 756 | Ga0496102_0009361 | 3300048905 | Bacteria | 8415 |
| 757 | Ga0496102_0020447 | 3300048905 | Bacteria | 5848 |
| 758 | Ga0496102_0040112 | 3300048905 | Bacteria | 4234 |
| 759 | Ga0496102_0187482 | 3300048905 | Bacteria | 1949 |
| 760 | Ga0496102_0187485 | 3300048905 | Bacteria | 1949 |
| 761 | Ga0496102_0223925 | 3300048905 | Bacteria | 1773 |
| 762 | Ga0496102_0373963 | 3300048905 | Bacteria | 1341 |
| 763 | Ga0496103_0001994 | 3300048906 | Bacteria | 13160 |
| 764 | Ga0496103_0010619 | 3300048906 | Bacteria | 5449 |
| 765 | Ga0496103_0065505 | 3300048906 | Bacteria | 2266 |
| 766 | Ga0496103_0091598 | 3300048906 | Bacteria | 1918 |
| 767 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 768 | Ga0496104_0023694 | 3300048907 | Bacteria | 5645 |
| 769 | Ga0496104_0025107 | 3300048907 | Bacteria | 5491 |
| 770 | Ga0496104_0050422 | 3300048907 | Bacteria | 3927 |
| 771 | Ga0496104_0080460 | 3300048907 | Bacteria | 3106 |
| 772 | Ga0496104_0124623 | 3300048907 | Bacteria | 2473 |
| 773 | Ga0496104_0157670 | 3300048907 | Bacteria | 2178 |
| 774 | Ga0496104_0189016 | 3300048907 | Bacteria | 1970 |
| 775 | Ga0496104_0252142 | 3300048907 | Bacteria | 1677 |
| 776 | Ga0496104_0330158 | 3300048907 | Bacteria | 1438 |
| 777 | Ga0496105_0000130 | 3300048908 | Bacteria | 50576 |
| 778 | Ga0496105_0003867 | 3300048908 | Bacteria | 11192 |
| 779 | Ga0496105_0028937 | 3300048908 | Bacteria | 4533 |
| 780 | Ga0496105_0077307 | 3300048908 | Bacteria | 2749 |
| 781 | Ga0496105_0099499 | 3300048908 | Bacteria | 2401 |
| 782 | Ga0496105_0176238 | 3300048908 | Bacteria | 1751 |
| 783 | Ga0496106_0000581 | 3300048909 | Bacteria | 26118 |
| 784 | Ga0496106_0011776 | 3300048909 | Bacteria | 6456 |
| 785 | Ga0496106_0102038 | 3300048909 | Bacteria | 2225 |
| 786 | Ga0496106_0213007 | 3300048909 | Bacteria | 1539 |
| 787 | Ga0496107_0000224 | 3300048910 | Bacteria | 29999 |
| 788 | Ga0496107_0016012 | 3300048910 | Bacteria | 5261 |
| 789 | Ga0496107_0018985 | 3300048910 | Bacteria | 4848 |
| 790 | Ga0496107_0116775 | 3300048910 | Bacteria | 1964 |
| 791 | Ga0496107_0133634 | 3300048910 | Bacteria | 1832 |
| 792 | Ga0496108_0000547 | 3300048911 | Bacteria | 29390 |
| 793 | Ga0496108_0008031 | 3300048911 | Bacteria | 8567 |
| 794 | Ga0496108_0244314 | 3300048911 | Bacteria | 1561 |
| 795 | Ga0496108_0403707 | 3300048911 | Bacteria | 1193 |
| 796 | Ga0496109_0000384 | 3300048912 | Bacteria | 40091 |
| 797 | Ga0496109_0002652 | 3300048912 | Bacteria | 15006 |
| 798 | Ga0496109_0165433 | 3300048912 | Bacteria | 2073 |
| 799 | Ga0496109_0190437 | 3300048912 | Bacteria | 1927 |
| 800 | Ga0496109_0232471 | 3300048912 | Bacteria | 1734 |
| 801 | Ga0496109_0265029 | 3300048912 | Bacteria | 1618 |
| 802 | Ga0496109_0270612 | 3300048912 | Bacteria | 1600 |
| 803 | Ga0496109_0428417 | 3300048912 | Bacteria | 1250 |
| 804 | Ga0496110_0018248 | 3300048913 | Bacteria | 5881 |
| 805 | Ga0496110_0047485 | 3300048913 | Bacteria | 3760 |
| 806 | Ga0496110_0060637 | 3300048913 | Unclassified | 3337 |
| 807 | Ga0496110_0115026 | 3300048913 | Bacteria | 2421 |
| 808 | Ga0496110_0128901 | 3300048913 | Bacteria | 2283 |
| 809 | Ga0496110_0174719 | 3300048913 | Bacteria | 1949 |
| 810 | Ga0496111_0101132 | 3300048914 | Bacteria | 2118 |
| 811 | Ga0496111_0102457 | 3300048914 | Bacteria | 2104 |
| 812 | Ga0496111_0119705 | 3300048914 | Bacteria | 1944 |
| 813 | Ga0496111_0124343 | 3300048914 | Bacteria | 1906 |
| 814 | Ga0496111_0435911 | 3300048914 | Bacteria | 967 |
| 815 | Ga0496112_0011430 | 3300048915 | Bacteria | 8106 |
| 816 | Ga0496112_0012719 | 3300048915 | Bacteria | 7738 |
| 817 | Ga0496112_0015964 | 3300048915 | Bacteria | 7021 |
| 818 | Ga0496112_0018912 | 3300048915 | Bacteria | 6490 |
| 819 | Ga0496112_0359706 | 3300048915 | Bacteria | 1397 |
| 820 | Ga0496113_0012292 | 3300048916 | Bacteria | 5749 |
| 821 | Ga0496113_0098405 | 3300048916 | Bacteria | 2264 |
| 822 | Ga0496113_0126156 | 3300048916 | Bacteria | 2004 |
| 823 | Ga0496114_0001624 | 3300048917 | Bacteria | 17060 |
| 824 | Ga0496114_0004538 | 3300048917 | Bacteria | 10780 |
| 825 | Ga0496114_0031245 | 3300048917 | Bacteria | 4381 |
| 826 | Ga0496115_0000826 | 3300048918 | Bacteria | 22686 |
| 827 | Ga0496115_0024651 | 3300048918 | Bacteria | 4679 |
| 828 | Ga0496115_0050063 | 3300048918 | Bacteria | 3345 |
| 829 | Ga0496115_0092412 | 3300048918 | Bacteria | 2473 |
| 830 | Ga0496115_0160495 | 3300048918 | Bacteria | 1857 |
| 831 | Ga0496115_0200485 | 3300048918 | Bacteria | 1649 |
| 832 | Ga0501034_0020703 | 3300049571 | Bacteria | 6716 |
| 833 | Ga0501034_0049745 | 3300049571 | Bacteria | 4229 |
| 834 | Ga0501039_0303957 | 3300049575 | Bacteria | 1254 |
| 835 | Ga0501047_0005174 | 3300049581 | Bacteria | 12241 |
| 836 | Ga0501047_0014095 | 3300049581 | Bacteria | 7597 |
| 837 | Ga0501047_0037523 | 3300049581 | Bacteria | 4685 |
| 838 | Ga0501068_0139429 | 3300049584 | Bacteria | 1520 |
| 839 | Ga0501069_0187776 | 3300049585 | Bacteria | 1195 |
| 840 | Ga0501070_0027936 | 3300049586 | Bacteria | 4733 |
| 841 | Ga0501070_0204203 | 3300049586 | Bacteria | 1623 |
| 842 | Ga0501071_0271679 | 3300049587 | Bacteria | 1282 |
| 843 | Ga0501071_0323032 | 3300049587 | Bacteria | 1172 |
| 844 | Ga0501072_0002307 | 3300049588 | Bacteria | 14289 |
| 845 | Ga0501073_0025235 | 3300049589 | Bacteria | 4265 |
| 846 | Ga0501074_0145785 | 3300049590 | Bacteria | 1693 |
| 847 | Ga0501079_0460666 | 3300049741 | Bacteria | 999 |
| 848 | Ga0501083_0025587 | 3300049744 | Bacteria | 4085 |
| 849 | Ga0501035_0000859 | 3300049822 | Bacteria | 32391 |
| 850 | Ga0501035_0140993 | 3300049822 | Bacteria | 2096 |
| 851 | Ga0501044_0011144 | 3300049823 | Bacteria | 9752 |
| 852 | Ga0501044_0109109 | 3300049823 | Bacteria | 2777 |
| 853 | Ga0501044_0408709 | 3300049823 | Bacteria | 1269 |
| 854 | nmdc:mga03n38_96127_c1 | 3300050490 | Bacteria | 1420 |
| 855 | nmdc:mga06z11_145509_c1 | 3300050494 | Bacteria | 1343 |
| 856 | nmdc:mga06z11_297221_c1 | 3300050494 | Bacteria | 959 |
| 857 | nmdc:mga05p37_19235_c1 | 3300050507 | Bacteria | 8261 |
| 858 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 859 | nmdc:mga0qj67_938_c1 | 3300050509 | Bacteria | 20072 |
| 860 | nmdc:mga06r32_661_c1 | 3300050510 | Bacteria | 30144 |
| 861 | nmdc:mga08y16_208_c1 | 3300050511 | Bacteria | 52742 |
| 862 | nmdc:mga08y16_29019_c1 | 3300050511 | Bacteria | 4590 |
| 863 | nmdc:mga08y16_60530_c1 | 3300050511 | Bacteria | 3955 |
| 864 | nmdc:mga0n895_12771_c1 | 3300050512 | Bacteria | 7543 |
| 865 | nmdc:mga0n895_169210_c1 | 3300050512 | Bacteria | 2217 |
| 866 | nmdc:mga0n895_3134_c1 | 3300050512 | Bacteria | 13188 |
| 867 | nmdc:mga0n895_331537_c1 | 3300050512 | Bacteria | 1542 |
| 868 | nmdc:mga0n895_797_c1 | 3300050512 | Bacteria | 22514 |
| 869 | nmdc:mga0rr50_4520_c1 | 3300050513 | Bacteria | 8192 |
| 870 | nmdc:mga0rr50_80327_c1 | 3300050513 | Bacteria | 2514 |
| 871 | nmdc:mga0rr50_91386_c1 | 3300050513 | Bacteria | 2371 |
| 872 | nmdc:mga08x19_274693_c1 | 3300050514 | Bacteria | 1167 |
| 873 | nmdc:mga0a205_11140_c1 | 3300050515 | Bacteria | 8275 |
| 874 | nmdc:mga0a205_13983_c1 | 3300050515 | Bacteria | 7486 |
| 875 | nmdc:mga0a205_2345_c1 | 3300050515 | Bacteria | 16707 |
| 876 | Ga0495601_0000237 | 3300053077 | Bacteria | 29469 |
| 877 | Ga0495601_0000293 | 3300053077 | Bacteria | 26739 |
| 878 | Ga0495601_0003203 | 3300053077 | Bacteria | 9363 |
| 879 | Ga0495601_0018736 | 3300053077 | Bacteria | 4213 |
| 880 | Ga0495612_0000275 | 3300053078 | Bacteria | 21187 |
| 881 | Ga0495612_0002577 | 3300053078 | Bacteria | 7477 |
| 882 | Ga0495612_0003858 | 3300053078 | Bacteria | 6224 |
| 883 | Ga0495612_0006876 | 3300053078 | Bacteria | 4654 |
| 884 | Ga0495595_0000701 | 3300053084 | Bacteria | 12760 |
| 885 | Ga0495595_0001594 | 3300053084 | Bacteria | 8856 |
| 886 | Ga0495595_0002027 | 3300053084 | Bacteria | 7865 |
| 887 | Ga0495595_0086064 | 3300053084 | Bacteria | 1503 |
| 888 | Ga0495595_0131768 | 3300053084 | Unclassified | 1222 |
| 889 | Ga0495619_0000343 | 3300053085 | Bacteria | 32522 |
| 890 | Ga0495619_0000660 | 3300053085 | Bacteria | 22604 |
| 891 | Ga0495619_0006775 | 3300053085 | Bacteria | 7246 |
| 892 | Ga0495619_0012952 | 3300053085 | Bacteria | 5253 |
| 893 | Ga0495619_0046394 | 3300053085 | Bacteria | 2856 |
| 894 | Ga0500644_0001523 | 3300053088 | Bacteria | 6093 |
| 895 | Ga0500641_0003967 | 3300053096 | Bacteria | 5232 |
| 896 | Ga0500652_042275 | 3300053131 | Bacteria | 1838 |
| 897 | Ga0500645_002132 | 3300053730 | Bacteria | 9107 |
| 898 | Ga0501084_0083226 | 3300054114 | Bacteria | 2685 |
| 899 | Ga0501082_0048199 | 3300060353 | Bacteria | 3672 |
| 900 | Ga0501082_0344076 | 3300060353 | Bacteria | 1299 |
| 901 | Ga0466962_0062558 | 3300061719 | Bacteria | 1777 |
| 902 | Ga0207681_10342389 | |||
| 903 | 2214736889 | |||
| 904 | ARSoilYngRDRAFT_c00112 | |||
| 905 | ARcpr5yngRDRAFT_c000099 | |||
| 906 | ARSoilOldRDRAFT_c000057 | |||
| 907 | ARCol0oldRDRAFT_c00030 | |||
| 908 | ARCol0yngRDRAFT_1000002 | |||
| 909 | JGI24746J21847_1001839 | |||
| 910 | JGI24747J21853_1003188 | |||
| 911 | JGI24739J22299_10001524 | |||
| 912 | JGI24737J22298_10002379 | |||
| 913 | JGI24737J22298_10008384 | |||
| 914 | JGI24750J21931_1000794 | |||
| 915 | JGI24745J21846_1000127 | |||
| 916 | JGI24738J21930_10000067 | |||
| 917 | JGI24749J21850_1000340 | |||
| 918 | JGI24744J21845_10006801 | |||
| 919 | JGI24742J22300_10002047 | |||
| 920 | JGI24751J29686_10005863 | |||
| 921 | Ga0065717_1002506 | |||
| 922 | Ga0065716_1001523 | |||
| 923 | Ga0065704_10073824 | |||
| 924 | Ga0065712_10000677 | |||
| 925 | Ga0065712_10001663 | |||
| 926 | Ga0065715_10004205 | |||
| 927 | Ga0065715_10089460 | |||
| 928 | Ga0070658_10001079 | |||
| 929 | Ga0070658_10014490 | |||
| 930 | Ga0070676_10000332 | |||
| 931 | Ga0070683_100004171 | |||
| 932 | Ga0070683_100059710 | |||
| 933 | Ga0070683_100172655 | |||
| 934 | Ga0070690_100002091 | |||
| 935 | Ga0070690_100004635 | |||
| 936 | Ga0070670_100072626 | |||
| 937 | Ga0070670_100081360 | |||
| 938 | Ga0070677_10000258 | |||
| 939 | Ga0068869_100000510 | |||
| 940 | Ga0068869_100148482 | |||
| 941 | Ga0070666_10004570 | |||
| 942 | Ga0070666_10327083 | |||
| 943 | Ga0070680_100001476 | |||
| 944 | Ga0070680_100012038 | |||
| 945 | Ga0070680_100018732 | |||
| 946 | Ga0070680_100052973 | |||
| 947 | Ga0070680_100059311 | |||
| 948 | Ga0070680_100237010 | |||
| 949 | Ga0070682_100003255 | |||
| 950 | Ga0070682_100208161 | |||
| 951 | Ga0070682_100343969 | |||
| 952 | Ga0070682_100344801 | |||
| 953 | Ga0068868_100000148 | |||
| 954 | Ga0068868_100233511 | |||
| 955 | Ga0070660_100001314 | |||
| 956 | Ga0070660_100052383 | |||
| 957 | Ga0070660_100118376 | |||
| 958 | Ga0070689_100003363 | |||
| 959 | Ga0070689_100009190 | |||
| 960 | Ga0070689_100027599 | |||
| 961 | Ga0070689_100207091 | |||
| 962 | Ga0070691_10001528 | |||
| 963 | Ga0070691_10018465 | |||
| 964 | Ga0070691_10061486 | |||
| 965 | Ga0070687_100000318 | |||
| 966 | Ga0070687_100146049 | |||
| 967 | Ga0070661_100000768 | |||
| 968 | Ga0070661_100127742 | |||
| 969 | Ga0070692_10000347 | |||
| 970 | Ga0070692_10012428 | |||
| 971 | Ga0070668_100004879 | |||
| 972 | Ga0070668_100013661 | |||
| 973 | Ga0070668_100052404 | |||
| 974 | Ga0070669_100003445 | |||
| 975 | Ga0070669_100016339 | |||
| 976 | Ga0070675_100001491 | |||
| 977 | Ga0070675_100065209 | |||
| 978 | Ga0070671_100003997 | |||
| 979 | Ga0070671_100084859 | |||
| 980 | Ga0070671_100154987 | |||
| 981 | Ga0070671_100292504 | |||
| 982 | Ga0070671_100415033 | |||
| 983 | Ga0070674_100001355 | |||
| 984 | Ga0070674_100197893 | |||
| 985 | Ga0070673_100000670 | |||
| 986 | Ga0070673_100024615 | |||
| 987 | Ga0070673_100031738 | |||
| 988 | Ga0070673_100036546 | |||
| 989 | Ga0070673_100322502 | |||
| 990 | Ga0070688_100001144 | |||
| 991 | Ga0070688_100065435 | |||
| 992 | Ga0070688_100210521 | |||
| 993 | Ga0070659_100001400 | |||
| 994 | Ga0070659_100164843 | |||
| 995 | Ga0070667_100002340 | |||
| 996 | Ga0070667_100009705 | |||
| 997 | Ga0070667_100120377 | |||
| 998 | Ga0070667_100157440 | |||
| 999 | Ga0070667_100320683 | |||
| 1000 | Ga0070703_10015511 | |||
| 1001 | Ga0070709_10034062 | |||
| 1002 | Ga0070714_100015272 | |||
| 1003 | Ga0070714_100116764 | |||
| 1004 | Ga0070713_100000838 | |||
| 1005 | Ga0070710_10021271 | |||
| 1006 | Ga0070710_10037732 | |||
| 1007 | Ga0070710_10060067 | |||
| 1008 | Ga0070701_10000066 | |||
| 1009 | Ga0070701_10031475 | |||
| 1010 | Ga0070711_100010309 | |||
| 1011 | Ga0070711_100120995 | |||
| 1012 | Ga0070711_100218055 | |||
| 1013 | Ga0070711_100343361 | |||
| 1014 | Ga0070705_100001500 | |||
| 1015 | Ga0070705_100076919 | |||
| 1016 | Ga0070700_100001568 | |||
| 1017 | Ga0070700_100174838 | |||
| 1018 | Ga0070700_100200606 | |||
| 1019 | Ga0070694_100002175 | |||
| 1020 | Ga0070694_100008394 | |||
| 1021 | Ga0070708_100021510 | |||
| 1022 | Ga0070708_100146688 | |||
| 1023 | Ga0070663_100001857 | |||
| 1024 | Ga0070663_100281834 | |||
| 1025 | Ga0070678_100000391 | |||
| 1026 | Ga0070678_100025652 | |||
| 1027 | Ga0070678_100069453 | |||
| 1028 | Ga0070662_100001285 | |||
| 1029 | Ga0070662_100073731 | |||
| 1030 | Ga0070681_10002720 | |||
| 1031 | Ga0070681_10016797 | |||
| 1032 | Ga0070681_10081723 | |||
| 1033 | Ga0070681_10207236 | |||
| 1034 | Ga0068867_100001688 | |||
| 1035 | Ga0068867_100032643 | |||
| 1036 | Ga0070685_10000496 | |||
| 1037 | Ga0070685_10010561 | |||
| 1038 | Ga0070679_100007687 | |||
| 1039 | Ga0070679_100048889 | |||
| 1040 | Ga0070679_100101875 | |||
| 1041 | Ga0070679_100254502 | |||
| 1042 | Ga0070684_100000101 | |||
| 1043 | Ga0070684_100020653 | |||
| 1044 | Ga0070684_100287676 | |||
| 1045 | Ga0068853_100005490 | |||
| 1046 | Ga0068853_100193278 | |||
| 1047 | Ga0070672_100000016 | |||
| 1048 | Ga0070672_100039509 | |||
| 1049 | Ga0070672_100042518 | |||
| 1050 | Ga0070686_100002195 | |||
| 1051 | Ga0070686_100026174 | |||
| 1052 | Ga0070686_100096472 | |||
| 1053 | Ga0070695_100000225 | |||
| 1054 | Ga0070695_100005011 | |||
| 1055 | Ga0070696_100002898 | |||
| 1056 | Ga0070696_100010256 | |||
| 1057 | Ga0070693_100000138 | |||
| 1058 | Ga0070693_100055005 | |||
| 1059 | Ga0070693_100116771 | |||
| 1060 | Ga0070665_100009456 | |||
| 1061 | Ga0070665_100044585 | |||
| 1062 | Ga0070665_100212479 | |||
| 1063 | Ga0070665_100789659 | |||
| 1064 | Ga0070704_100003148 | |||
| 1065 | Ga0070704_100027532 | |||
| 1066 | Ga0070704_100200936 | |||
| 1067 | Ga0068855_100008651 | |||
| 1068 | Ga0068855_100018870 | |||
| 1069 | Ga0068855_100032667 | |||
| 1070 | Ga0068855_100079966 | |||
| 1071 | Ga0068855_100197592 | |||
| 1072 | Ga0070664_100000067 | |||
| 1073 | Ga0070664_100022080 | |||
| 1074 | Ga0070664_100034890 | |||
| 1075 | Ga0070664_100038096 | |||
| 1076 | Ga0068857_100000275 | |||
| 1077 | Ga0068857_100060516 | |||
| 1078 | Ga0068854_100002271 | |||
| 1079 | Ga0068854_100395576 | |||
| 1080 | Ga0068856_100001016 | |||
| 1081 | Ga0068856_100103150 | |||
| 1082 | Ga0068856_100235161 | |||
| 1083 | Ga0068856_100460215 | |||
| 1084 | Ga0068856_100486022 | |||
| 1085 | Ga0068856_100575853 | |||
| 1086 | Ga0068856_100973681 | |||
| 1087 | Ga0070702_100000175 | |||
| 1088 | Ga0068852_100000611 | |||
| 1089 | Ga0068852_100139477 | |||
| 1090 | Ga0068852_100185344 | |||
| 1091 | Ga0068852_100233343 | |||
| 1092 | Ga0068852_100263402 | |||
| 1093 | Ga0068852_100279190 | |||
| 1094 | Ga0068859_100002948 | |||
| 1095 | Ga0068864_100000234 | |||
| 1096 | Ga0068864_100381709 | |||
| 1097 | Ga0068864_100726187 | |||
| 1098 | Ga0068866_10002176 | |||
| 1099 | Ga0068861_100000317 | |||
| 1100 | Ga0068861_100030808 | |||
| 1101 | Ga0068870_10000009 | |||
| 1102 | Ga0068863_100001729 | |||
| 1103 | Ga0068863_100296329 | |||
| 1104 | Ga0068858_100001059 | |||
| 1105 | Ga0068858_100046203 | |||
| 1106 | Ga0068858_100083371 | |||
| 1107 | Ga0068858_100128294 | |||
| 1108 | Ga0068858_100349923 | |||
| 1109 | Ga0068860_100003167 | |||
| 1110 | Ga0068860_100131881 | |||
| 1111 | Ga0068860_100147282 | |||
| 1112 | Ga0068862_100030207 | |||
| 1113 | Ga0081455_10008146 | |||
| 1114 | Ga0081540_1000374 | |||
| 1115 | Ga0070717_10025214 | |||
| 1116 | Ga0070717_10066122 | |||
| 1117 | Ga0070717_10096851 | |||
| 1118 | Ga0075432_10002492 | |||
| 1119 | Ga0070715_10055615 | |||
| 1120 | Ga0070715_10110172 | |||
| 1121 | Ga0070716_100040093 | |||
| 1122 | Ga0070712_100068122 | |||
| 1123 | Ga0070712_100201467 | |||
| 1124 | Ga0070712_100263293 | |||
| 1125 | Ga0075367_10104289 | |||
| 1126 | Ga0075367_10149404 | |||
| 1127 | Ga0097621_100010706 | |||
| 1128 | Ga0097621_100076109 | |||
| 1129 | Ga0097621_100468937 | |||
| 1130 | Ga0068871_100000012 | |||
| 1131 | Ga0075430_100008278 | |||
| 1132 | Ga0075433_10000072 | |||
| 1133 | Ga0075433_10057417 | |||
| 1134 | Ga0075434_100000756 | |||
| 1135 | Ga0075434_100001819 | |||
| 1136 | Ga0075434_100111340 | |||
| 1137 | Ga0075434_100148836 | |||
| 1138 | Ga0075434_100329671 | |||
| 1139 | Ga0075429_100001133 | |||
| 1140 | Ga0068865_100000355 | |||
| 1141 | Ga0075436_100072071 | |||
| 1142 | Ga0097620_100002948 | |||
| 1143 | Ga0075435_100167022 | |||
| 1144 | Ga0099794_10005086 | |||
| 1145 | Ga0105251_10036599 | |||
| 1146 | Ga0105240_10035122 | |||
| 1147 | Ga0111539_10001688 | |||
| 1148 | Ga0111539_10002781 | |||
| 1149 | Ga0111539_10005411 | |||
| 1150 | Ga0111539_10060689 | |||
| 1151 | Ga0111539_10182139 | |||
| 1152 | Ga0111539_10344488 | |||
| 1153 | Ga0105245_10000409 | |||
| 1154 | Ga0105245_10019441 | |||
| 1155 | Ga0105247_10004080 | |||
| 1156 | Ga0105247_10018620 | |||
| 1157 | Ga0105247_10045268 | |||
| 1158 | Ga0105247_10319810 | |||
| 1159 | Ga0114129_10003162 | |||
| 1160 | Ga0114129_10026034 | |||
| 1161 | Ga0105243_10004202 | |||
| 1162 | Ga0105243_10005740 | |||
| 1163 | Ga0105241_10000053 | |||
| 1164 | Ga0105241_10021735 | |||
| 1165 | Ga0105241_10101496 | |||
| 1166 | Ga0105241_10133544 | |||
| 1167 | Ga0105241_10190110 | |||
| 1168 | Ga0105242_10001586 | |||
| 1169 | Ga0105242_10104613 | |||
| 1170 | Ga0105242_10106125 | |||
| 1171 | Ga0105248_10000309 | |||
| 1172 | Ga0105248_10005691 | |||
| 1173 | Ga0105248_10009701 | |||
| 1174 | Ga0105248_10156233 | |||
| 1175 | Ga0105248_10363371 | |||
| 1176 | Ga0105248_10441280 | |||
| 1177 | Ga0105237_10005630 | |||
| 1178 | Ga0105237_10015365 | |||
| 1179 | Ga0105238_10162248 | |||
| 1180 | Ga0105238_10638600 | |||
| 1181 | Ga0105249_10003451 | |||
| 1182 | Ga0105249_10058537 | |||
| 1183 | Ga0105249_10151551 | |||
| 1184 | Ga0105239_10007939 | |||
| 1185 | Ga0105239_10029753 | |||
| 1186 | Ga0105239_10379007 | |||
| 1187 | Ga0105246_10002040 | |||
| 1188 | Ga0157329_1000662 | |||
| 1189 | Ga0157338_1005577 | |||
| 1190 | Ga0157373_10012578 | |||
| 1191 | Ga0157371_10006362 | |||
| 1192 | Ga0157371_10066724 | |||
| 1193 | Ga0157370_10054295 | |||
| 1194 | Ga0157369_10359452 | |||
| 1195 | Ga0157374_10000452 | |||
| 1196 | Ga0157374_10054238 | |||
| 1197 | Ga0157374_10185048 | |||
| 1198 | Ga0157378_10006920 | |||
| 1199 | Ga0163162_10000796 | |||
| 1200 | Ga0163162_10012138 | |||
| 1201 | Ga0163162_10055472 | |||
| 1202 | Ga0157372_10008710 | |||
| 1203 | Ga0157372_10175622 | |||
| 1204 | Ga0157372_10365119 | |||
| 1205 | Ga0157375_10004563 | |||
| 1206 | Ga0157375_10022988 | |||
| 1207 | Ga0157375_10143331 | |||
| 1208 | Ga0157375_10491475 | |||
| 1209 | Ga0163163_10001104 | |||
| 1210 | Ga0163163_10011726 | |||
| 1211 | Ga0163163_10144094 | |||
| 1212 | Ga0157380_10017908 | |||
| 1213 | Ga0157377_10000538 | |||
| 1214 | Ga0157379_10009254 | |||
| 1215 | Ga0157379_10094730 | |||
| 1216 | Ga0157379_10258962 | |||
| 1217 | Ga0157376_10002295 | |||
| 1218 | Ga0157376_10141931 | |||
| 1219 | Ga0157376_10276156 | |||
| 1220 | Ga0157376_10650290 | |||
| 1221 | Ga0163161_10000499 | |||
| 1222 | Ga0206353_10474572 | |||
| 1223 | Ga0207666_1000313 | |||
| 1224 | Ga0207666_1001193 | |||
| 1225 | Ga0207697_10000252 | |||
| 1226 | Ga0207653_10001924 | |||
| 1227 | Ga0207653_10027745 | |||
| 1228 | Ga0207682_10000029 | |||
| 1229 | Ga0207692_10002625 | |||
| 1230 | Ga0207692_10004448 | |||
| 1231 | Ga0207692_10062536 | |||
| 1232 | Ga0207692_10068998 | |||
| 1233 | Ga0207642_10000713 | |||
| 1234 | Ga0207710_10032756 | |||
| 1235 | Ga0207710_10060468 | |||
| 1236 | Ga0207710_10067238 | |||
| 1237 | Ga0207688_10000020 | |||
| 1238 | Ga0207680_10001555 | |||
| 1239 | Ga0207680_10303050 | |||
| 1240 | Ga0207647_10004457 | |||
| 1241 | Ga0207647_10004529 | |||
| 1242 | Ga0207685_10014773 | |||
| 1243 | Ga0207699_10019161 | |||
| 1244 | Ga0207699_10047171 | |||
| 1245 | Ga0207645_10000108 | |||
| 1246 | Ga0207645_10215252 | |||
| 1247 | Ga0207643_10000044 | |||
| 1248 | Ga0207705_10015497 | |||
| 1249 | Ga0207705_10019507 | |||
| 1250 | Ga0207654_10000143 | |||
| 1251 | Ga0207654_10123379 | |||
| 1252 | Ga0207654_10197266 | |||
| 1253 | Ga0207707_10002475 | |||
| 1254 | Ga0207707_10030589 | |||
| 1255 | Ga0207707_10054545 | |||
| 1256 | Ga0207707_10157482 | |||
| 1257 | Ga0207707_10204552 | |||
| 1258 | Ga0207707_10378188 | |||
| 1259 | Ga0207671_10009506 | |||
| 1260 | Ga0207693_10000831 | |||
| 1261 | Ga0207693_10005608 | |||
| 1262 | Ga0207693_10067898 | |||
| 1263 | Ga0207693_10153627 | |||
| 1264 | Ga0207693_10191504 | |||
| 1265 | Ga0207663_10027032 | |||
| 1266 | Ga0207663_10324202 | |||
| 1267 | Ga0207660_10000543 | |||
| 1268 | Ga0207660_10031238 | |||
| 1269 | Ga0207660_10034606 | |||
| 1270 | Ga0207660_10077574 | |||
| 1271 | Ga0207660_10397105 | |||
| 1272 | Ga0207660_10402371 | |||
| 1273 | Ga0207662_10000104 | |||
| 1274 | Ga0207662_10009837 | |||
| 1275 | Ga0207662_10158113 | |||
| 1276 | Ga0207657_10001453 | |||
| 1277 | Ga0207657_10004676 | |||
| 1278 | Ga0207657_10020064 | |||
| 1279 | Ga0207657_10068005 | |||
| 1280 | Ga0207649_10000057 | |||
| 1281 | Ga0207652_10000916 | |||
| 1282 | Ga0207652_10006960 | |||
| 1283 | Ga0207652_10087443 | |||
| 1284 | Ga0207652_10168332 | |||
| 1285 | Ga0207652_10312748 | |||
| 1286 | Ga0207681_10001187 | |||
| 1287 | Ga0207650_10001534 | |||
| 1288 | Ga0207650_10023478 | |||
| 1289 | Ga0207650_10140424 | |||
| 1290 | Ga0207659_10000028 | |||
| 1291 | Ga0207659_10019591 | |||
| 1292 | Ga0207659_10155742 | |||
| 1293 | Ga0207687_10000061 | |||
| 1294 | Ga0207687_10046599 | |||
| 1295 | Ga0207687_10143690 | |||
| 1296 | Ga0207700_10078743 | |||
| 1297 | Ga0207700_10192552 | |||
| 1298 | Ga0207664_10095859 | |||
| 1299 | Ga0207644_10000194 | |||
| 1300 | Ga0207644_10007311 | |||
| 1301 | Ga0207644_10029098 | |||
| 1302 | Ga0207644_10077254 | |||
| 1303 | Ga0207690_10000225 | |||
| 1304 | Ga0207706_10001293 | |||
| 1305 | Ga0207706_10010554 | |||
| 1306 | Ga0207706_10088706 | |||
| 1307 | Ga0207686_10000530 | |||
| 1308 | Ga0207686_10025146 | |||
| 1309 | Ga0207709_10000291 | |||
| 1310 | Ga0207709_10082888 | |||
| 1311 | Ga0207670_10000434 | |||
| 1312 | Ga0207670_10047843 | |||
| 1313 | Ga0207670_10204360 | |||
| 1314 | Ga0207669_10000019 | |||
| 1315 | Ga0207669_10154652 | |||
| 1316 | Ga0207669_10271354 | |||
| 1317 | Ga0207704_10000438 | |||
| 1318 | Ga0207665_10001157 | |||
| 1319 | Ga0207691_10001047 | |||
| 1320 | Ga0207691_10042370 | |||
| 1321 | Ga0207691_10043271 | |||
| 1322 | Ga0207691_10091890 | |||
| 1323 | Ga0207711_10007089 | |||
| 1324 | Ga0207711_10008817 | |||
| 1325 | Ga0207711_10491374 | |||
| 1326 | Ga0207689_10001160 | |||
| 1327 | Ga0207689_10096196 | |||
| 1328 | Ga0207661_10000126 | |||
| 1329 | Ga0207661_10312350 | |||
| 1330 | Ga0207679_10000026 | |||
| 1331 | Ga0207679_10030446 | |||
| 1332 | Ga0207679_10119600 | |||
| 1333 | Ga0207679_10555968 | |||
| 1334 | Ga0207667_10016786 | |||
| 1335 | Ga0207667_10022484 | |||
| 1336 | Ga0207667_10029280 | |||
| 1337 | Ga0207667_10299030 | |||
| 1338 | Ga0207651_10001232 | |||
| 1339 | Ga0207651_10085430 | |||
| 1340 | Ga0207651_10123202 | |||
| 1341 | Ga0207651_10130302 | |||
| 1342 | Ga0207712_10002654 | |||
| 1343 | Ga0207712_10018907 | |||
| 1344 | Ga0207668_10000049 | |||
| 1345 | Ga0207668_10163464 | |||
| 1346 | Ga0207640_10004275 | |||
| 1347 | Ga0207658_10001093 | |||
| 1348 | Ga0207658_10037209 | |||
| 1349 | Ga0207658_10130831 | |||
| 1350 | Ga0207658_10283800 | |||
| 1351 | Ga0207658_10340989 | |||
| 1352 | Ga0207658_10600720 | |||
| 1353 | Ga0207677_10000229 | |||
| 1354 | Ga0207677_10049748 | |||
| 1355 | Ga0207677_10083255 | |||
| 1356 | Ga0207703_10000780 | |||
| 1357 | Ga0207703_10016660 | |||
| 1358 | Ga0207703_10054060 | |||
| 1359 | Ga0207703_10069167 | |||
| 1360 | Ga0207703_10071010 | |||
| 1361 | Ga0207639_10002735 | |||
| 1362 | Ga0207639_10041347 | |||
| 1363 | Ga0207639_10067384 | |||
| 1364 | Ga0207678_10000403 | |||
| 1365 | Ga0207678_10040152 | |||
| 1366 | Ga0207708_10000669 | |||
| 1367 | Ga0207708_10005479 | |||
| 1368 | Ga0207708_10229896 | |||
| 1369 | Ga0207708_10244491 | |||
| 1370 | Ga0207702_10006536 | |||
| 1371 | Ga0207702_10143680 | |||
| 1372 | Ga0207702_10156396 | |||
| 1373 | Ga0207702_10181108 | |||
| 1374 | Ga0207702_10189336 | |||
| 1375 | Ga0207702_10195395 | |||
| 1376 | Ga0207702_10826128 | |||
| 1377 | Ga0207641_10000542 | |||
| 1378 | Ga0207641_10318386 | |||
| 1379 | Ga0207641_10629406 | |||
| 1380 | Ga0207648_10001244 | |||
| 1381 | Ga0207648_10017537 | |||
| 1382 | Ga0207676_10000672 | |||
| 1383 | Ga0207676_10035605 | |||
| 1384 | Ga0207676_10367384 | |||
| 1385 | Ga0207674_10001968 | |||
| 1386 | Ga0207675_100001274 | |||
| 1387 | Ga0207675_100056051 | |||
| 1388 | Ga0207683_10000034 | |||
| 1389 | Ga0207683_10000880 | |||
| 1390 | Ga0207683_10019963 | |||
| 1391 | Ga0207698_10001780 | |||
| 1392 | Ga0207698_10164946 | |||
| 1393 | Ga0207698_10190227 | |||
| 1394 | Ga0207698_10204016 | |||
| 1395 | Ga0209996_1003302 | |||
| 1396 | Ga0210002_1000151 | |||
| 1397 | Ga0209588_1034985 | |||
| 1398 | Ga0209971_1038720 | |||
| 1399 | Ga0209966_1001368 | |||
| 1400 | Ga0209966_1002416 | |||
| 1401 | Ga0209998_10000830 | |||
| 1402 | Ga0209998_10000899 | |||
| 1403 | Ga0207428_10000082 | |||
| 1404 | Ga0207428_10000130 | |||
| 1405 | Ga0207428_10000701 | |||
| 1406 | Ga0268266_10010845 | |||
| 1407 | Ga0268266_10066865 | |||
| 1408 | Ga0268266_10237921 | |||
| 1409 | Ga0268265_10000410 | |||
| 1410 | Ga0268265_10008133 | |||
| 1411 | Ga0268264_10001567 | |||
| 1412 | Ga0268264_10164771 | |||
| 1413 | Ga0265336_10029893 | |||
| 1414 | Ga0265338_10012066 | |||
| 1415 | Ga0265338_10219689 | |||
| 1416 | Ga0265325_10056250 | |||
| 1417 | Ga0265340_10096387 | |||
| 1418 | Ga0265339_10021871 | |||
| 1419 | Ga0265339_10059070 | |||
| 1420 | Ga0265339_10190761 | |||
| 1421 | Ga0265339_10198739 | |||
| 1422 | Ga0265316_10308415 | |||
| 1423 | Ga0265313_10007635 | |||
| 1424 | Ga0265313_10020128 | |||
| 1425 | Ga0265313_10021404 | |||
| 1426 | Ga0265313_10022693 | |||
| 1427 | Ga0265314_10005096 | |||
| 1428 | Ga0265314_10185576 | |||
| 1429 | Ga0265342_10000912 | |||
| 1430 | Ga0265342_10157545 | |||
| 1431 | Ga0316583_10000300 | |||
| 1432 | Ga0373930_0000948 | |||
| 1433 | Ga0373930_0009551 | |||
| 1434 | Ga0373930_0036029 | |||
| 1435 | Ga0373948_0000060 | |||
| 1436 | Ga0373950_0000151 | |||
| 1437 | Ga0373958_0000640 | |||
| 1438 | Ga0373958_0001109 | |||
| 1439 | Ga0373959_0003990 | |||
| 1440 | Ga0373938_0000265 | |||
| 1441 | Ga0373938_0000851 | |||
| 1442 | Ga0373928_0002719 | |||
| 1443 | Ga0373928_0047247 | |||
| 1444 | Ga0373929_0006649 | |||
| 1445 | Ga0373940_0001617 | |||
| 1446 | Ga0373940_0005020 | |||
| 1447 | Ga0373944_0040298 | |||
| 1448 | Ga0373949_0001017 | |||
| 1449 | Ga0373949_0001292 | |||
| 1450 | Ga0373951_0001079 | |||
| 1451 | Ga0373951_0006738 | |||
| 1452 | Ga0373952_0000144 | |||
| 1453 | Ga0373952_0003531 | |||
| 1454 | Ga0373952_0003549 | |||
| 1455 | Ga0373952_0030830 | |||
| 1456 | Ga0373932_0001474 | |||
| 1457 | Ga0373932_0002399 | |||
| 1458 | Ga0373932_0003771 | |||
| 1459 | Ga0373939_0000633 | |||
| 1460 | Ga0373939_0000683 | |||
| 1461 | Ga0373939_0001140 | |||
| 1462 | Ga0373941_0000506 | |||
| 1463 | Ga0373941_0000613 | |||
| 1464 | Ga0373941_0004805 | |||
| 1465 | Ga0373941_0011897 | |||
| 1466 | Ga0373941_0042292 | |||
| 1467 | Ga0373945_0002918 | |||
| 1468 | Ga0373953_0009947 | |||
| 1469 | Ga0373954_0002508 | |||
| 1470 | Ga0373954_0005440 | |||
| 1471 | Ga0373956_0024480 | |||
| 1472 | Ga0373957_0001422 | |||
| 1473 | Ga0373957_0002239 | |||
| 1474 | Ga0373957_0079124 | |||
| 1475 | Ga0373960_0000369 | |||
| 1476 | Ga0373960_0006235 | |||
| 1477 | Ga0373960_0007623 | |||
| 1478 | Ga0373943_0011614 | |||
| 1479 | Ga0373946_0004728 | |||
| 1480 | Ga0373946_0014660 | |||
| 1481 | Ga0373955_0000744 | |||
| 1482 | Ga0373955_0002809 | |||
| 1483 | Ga0373955_0045720 | |||
| 1484 | Ga0373942_0000425 | |||
| 1485 | Ga0373942_0001723 | |||
| 1486 | Ga0373942_0007645 | |||
| 1487 | Ga0373942_0029590 | |||
| 1488 | Ga0373961_0001150 | |||
| 1489 | Ga0373961_0001699 | |||
| 1490 | Ga0373961_0006662 | |||
| 1491 | Ga0373961_0026069 | |||
| 1492 | Ga0373962_0000209 | |||
| 1493 | Ga0373962_0000258 | |||
| 1494 | Ga0373962_0003978 | |||
| 1495 | Ga0373962_0022289 | |||
| 1496 | Ga0373924_0011954 | |||
| 1497 | Ga0373924_0025618 | |||
| 1498 | Ga0373931_0001019 | |||
| 1499 | Ga0373931_0020943 | |||
| 1500 | Ga0373931_0022983 | |||
| 1501 | Ga0373931_0169813 | |||
| 1502 | Ga0373927_0079590 | |||
| 1503 | Ga0373933_0000842 | |||
| 1504 | Ga0373933_0016370 | |||
| 1505 | Ga0373933_0037328 | |||
| 1506 | Ga0373933_0115928 | |||
| 1507 | Ga0373947_0001071 | |||
| 1508 | Ga0373947_0074885 | |||
| 1509 | Ga0373947_0322951 | |||
| 1510 | Ga0373937_0002444 | |||
| 1511 | Ga0373937_0004304 | |||
| 1512 | Ga0373937_0186711 | |||
| 1513 | Ga0316582_0070685 | |||
| 1514 | Ga0373925_0020933 | |||
| 1515 | Ga0373925_0058812 | |||
| 1516 | Ga0373925_0086417 | |||
| 1517 | Ga0373925_0190429 | |||
| 1518 | Ga0395900_0005590 | |||
| 1519 | Ga0395900_0582933 | |||
| 1520 | Ga0395898_0003040 | |||
| 1521 | Ga0439450_017390 | |||
| 1522 | Ga0439455_0014150 | |||
| 1523 | Ga0439463_019888 | |||
| 1524 | Ga0451577_0195565 | |||
| 1525 | Ga0439440_0064746 | |||
| 1526 | Ga0466963_0136357 | |||
| 1527 | Ga0453684_0219997 | |||
| 1528 | Ga0451576_0013835 | |||
| 1529 | Ga0466958_0041961 | |||
| 1530 | Ga0466967_0038326 | |||
| 1531 | Ga0466967_0272755 | |||
| 1532 | Ga0495592_0012089 | |||
| 1533 | Ga0495592_0024911 | |||
| 1534 | Ga0495592_0136335 | |||
| 1535 | Ga0495603_0003522 | |||
| 1536 | Ga0495603_0133959 | |||
| 1537 | Ga0495629_0000527 | |||
| 1538 | Ga0495629_0160533 | |||
| 1539 | Ga0495629_0254586 | |||
| 1540 | Ga0495641_0029112 | |||
| 1541 | Ga0495641_0033030 | |||
| 1542 | Ga0495641_0042184 | |||
| 1543 | Ga0495651_0000908 | |||
| 1544 | Ga0495651_0003856 | |||
| 1545 | Ga0495651_0013633 | |||
| 1546 | Ga0495653_0000912 | |||
| 1547 | Ga0495653_0052486 | |||
| 1548 | Ga0495653_0067885 | |||
| 1549 | Ga0495580_0052811 | |||
| 1550 | Ga0495580_0057151 | |||
| 1551 | Ga0495582_0012645 | |||
| 1552 | Ga0495582_0015881 | |||
| 1553 | Ga0495582_0203261 | |||
| 1554 | Ga0495639_0085854 | |||
| 1555 | Ga0495662_0018163 | |||
| 1556 | Ga0495662_0245232 | |||
| 1557 | Ga0495664_0016385 | |||
| 1558 | Ga0495664_0126183 | |||
| 1559 | Ga0495584_0066615 | |||
| 1560 | Ga0495594_0026475 | |||
| 1561 | Ga0495608_0008704 | |||
| 1562 | Ga0495608_0044974 | |||
| 1563 | Ga0495618_0003244 | |||
| 1564 | Ga0495618_0077276 | |||
| 1565 | Ga0495618_0124343 | |||
| 1566 | Ga0495628_0009709 | |||
| 1567 | Ga0495628_0011083 | |||
| 1568 | Ga0495628_0029193 | |||
| 1569 | Ga0495630_0101055 | |||
| 1570 | Ga0495630_0195665 | |||
| 1571 | Ga0495630_0244310 | |||
| 1572 | Ga0495637_0043852 | |||
| 1573 | Ga0495644_0003683 | |||
| 1574 | Ga0495663_0053003 | |||
| 1575 | Ga0495652_0011801 | |||
| 1576 | Ga0495652_0042003 | |||
| 1577 | Ga0495652_0059568 | |||
| 1578 | Ga0495652_0205523 | |||
| 1579 | Ga0495665_0032193 | |||
| 1580 | Ga0495640_0003572 | |||
| 1581 | Ga0495640_0150259 | |||
| 1582 | Ga0495586_0128107 | |||
| 1583 | Ga0495587_0002348 | |||
| 1584 | Ga0495587_0004743 | |||
| 1585 | Ga0495587_0111571 | |||
| 1586 | Ga0495587_0256213 | |||
| 1587 | Ga0495598_0009095 | |||
| 1588 | Ga0495645_0001151 | |||
| 1589 | Ga0495645_0010788 | |||
| 1590 | Ga0495645_0198839 | |||
| 1591 | Ga0495622_0033447 | |||
| 1592 | Ga0495633_0006733 | |||
| 1593 | Ga0495667_0000212 | |||
| 1594 | Ga0495667_0030318 | |||
| 1595 | Ga0495667_0059372 | |||
| 1596 | Ga0495656_0004302 | |||
| 1597 | Ga0495634_0036763 | |||
| 1598 | Ga0495634_0126160 | |||
| 1599 | Ga0495634_0240904 | |||
| 1600 | Ga0495611_0005176 | |||
| 1601 | Ga0495635_0057614 | |||
| 1602 | Ga0495635_0067169 | |||
| 1603 | Ga0495635_0243707 | |||
| 1604 | Ga0495588_0041161 | |||
| 1605 | Ga0495588_0067080 | |||
| 1606 | Ga0495657_0003573 | |||
| 1607 | Ga0495599_0006187 | |||
| 1608 | Ga0495599_0093387 | |||
| 1609 | Ga0495599_0153442 | |||
| 1610 | Ga0495623_0000188 | |||
| 1611 | Ga0495623_0007794 | |||
| 1612 | Ga0495646_0002814 | |||
| 1613 | Ga0495646_0028716 | |||
| 1614 | Ga0495647_0008172 | |||
| 1615 | Ga0495647_0037390 | |||
| 1616 | Ga0495658_0001507 | |||
| 1617 | Ga0495658_0012622 | |||
| 1618 | Ga0495658_0034456 | |||
| 1619 | Ga0495658_0052177 | |||
| 1620 | Ga0495613_0013123 | |||
| 1621 | Ga0495624_0008197 | |||
| 1622 | Ga0495670_0000704 | |||
| 1623 | Ga0495600_0004951 | |||
| 1624 | Ga0495600_0005049 | |||
| 1625 | Ga0495600_0075044 | |||
| 1626 | Ga0495581_0032257 | |||
| 1627 | Ga0495581_0195420 | |||
| 1628 | Ga0495604_0008689 | |||
| 1629 | Ga0495604_0016801 | |||
| 1630 | Ga0495604_0066408 | |||
| 1631 | Ga0495674_0024741 | |||
| 1632 | Ga0495674_0030841 | |||
| 1633 | Ga0495674_0120459 | |||
| 1634 | Ga0495674_0303533 | |||
| 1635 | Ga0495676_0008228 | |||
| 1636 | Ga0495680_0005676 | |||
| 1637 | Ga0495680_0006175 | |||
| 1638 | Ga0495680_0010622 | |||
| 1639 | Ga0495680_0011028 | |||
| 1640 | Ga0495680_0012117 | |||
| 1641 | Ga0495675_0008455 | |||
| 1642 | Ga0495684_0003722 | |||
| 1643 | Ga0495684_0044462 | |||
| 1644 | Ga0495593_0040959 | |||
| 1645 | Ga0495602_0002562 | |||
| 1646 | Ga0495602_0008079 | |||
| 1647 | Ga0495602_0164146 | |||
| 1648 | Ga0495614_0100536 | |||
| 1649 | Ga0496100_0001962 | |||
| 1650 | Ga0496100_0058678 | |||
| 1651 | Ga0496100_0125127 | |||
| 1652 | Ga0496100_0165938 | |||
| 1653 | Ga0496101_0000171 | |||
| 1654 | Ga0496101_0000610 | |||
| 1655 | Ga0496101_0081018 | |||
| 1656 | Ga0496102_0004728 | |||
| 1657 | Ga0496102_0009361 | |||
| 1658 | Ga0496102_0020447 | |||
| 1659 | Ga0496102_0040112 | |||
| 1660 | Ga0496102_0187482 | |||
| 1661 | Ga0496102_0187485 | |||
| 1662 | Ga0496102_0223925 | |||
| 1663 | Ga0496102_0373963 | |||
| 1664 | Ga0496103_0001994 | |||
| 1665 | Ga0496103_0010619 | |||
| 1666 | Ga0496103_0065505 | |||
| 1667 | Ga0496103_0091598 | |||
| 1668 | Ga0496104_0000067 | |||
| 1669 | Ga0496104_0023694 | |||
| 1670 | Ga0496104_0025107 | |||
| 1671 | Ga0496104_0050422 | |||
| 1672 | Ga0496104_0080460 | |||
| 1673 | Ga0496104_0124623 | |||
| 1674 | Ga0496104_0157670 | |||
| 1675 | Ga0496104_0189016 | |||
| 1676 | Ga0496104_0252142 | |||
| 1677 | Ga0496104_0330158 | |||
| 1678 | Ga0496105_0000130 | |||
| 1679 | Ga0496105_0003867 | |||
| 1680 | Ga0496105_0028937 | |||
| 1681 | Ga0496105_0077307 | |||
| 1682 | Ga0496105_0099499 | |||
| 1683 | Ga0496105_0176238 | |||
| 1684 | Ga0496106_0000581 | |||
| 1685 | Ga0496106_0011776 | |||
| 1686 | Ga0496106_0102038 | |||
| 1687 | Ga0496106_0213007 | |||
| 1688 | Ga0496107_0000224 | |||
| 1689 | Ga0496107_0016012 | |||
| 1690 | Ga0496107_0018985 | |||
| 1691 | Ga0496107_0116775 | |||
| 1692 | Ga0496107_0133634 | |||
| 1693 | Ga0496108_0000547 | |||
| 1694 | Ga0496108_0008031 | |||
| 1695 | Ga0496108_0244314 | |||
| 1696 | Ga0496108_0403707 | |||
| 1697 | Ga0496109_0000384 | |||
| 1698 | Ga0496109_0002652 | |||
| 1699 | Ga0496109_0165433 | |||
| 1700 | Ga0496109_0190437 | |||
| 1701 | Ga0496109_0232471 | |||
| 1702 | Ga0496109_0265029 | |||
| 1703 | Ga0496109_0270612 | |||
| 1704 | Ga0496109_0428417 | |||
| 1705 | Ga0496110_0018248 | |||
| 1706 | Ga0496110_0047485 | |||
| 1707 | Ga0496110_0060637 | |||
| 1708 | Ga0496110_0115026 | |||
| 1709 | Ga0496110_0128901 | |||
| 1710 | Ga0496110_0174719 | |||
| 1711 | Ga0496111_0101132 | |||
| 1712 | Ga0496111_0102457 | |||
| 1713 | Ga0496111_0119705 | |||
| 1714 | Ga0496111_0124343 | |||
| 1715 | Ga0496111_0435911 | |||
| 1716 | Ga0496112_0011430 | |||
| 1717 | Ga0496112_0012719 | |||
| 1718 | Ga0496112_0015964 | |||
| 1719 | Ga0496112_0018912 | |||
| 1720 | Ga0496112_0359706 | |||
| 1721 | Ga0496113_0012292 | |||
| 1722 | Ga0496113_0098405 | |||
| 1723 | Ga0496113_0126156 | |||
| 1724 | Ga0496114_0001624 | |||
| 1725 | Ga0496114_0004538 | |||
| 1726 | Ga0496114_0031245 | |||
| 1727 | Ga0496115_0000826 | |||
| 1728 | Ga0496115_0024651 | |||
| 1729 | Ga0496115_0050063 | |||
| 1730 | Ga0496115_0092412 | |||
| 1731 | Ga0496115_0160495 | |||
| 1732 | Ga0496115_0200485 | |||
| 1733 | Ga0501034_0020703 | |||
| 1734 | Ga0501034_0049745 | |||
| 1735 | Ga0501039_0303957 | |||
| 1736 | Ga0501047_0005174 | |||
| 1737 | Ga0501047_0014095 | |||
| 1738 | Ga0501047_0037523 | |||
| 1739 | Ga0501068_0139429 | |||
| 1740 | Ga0501069_0187776 | |||
| 1741 | Ga0501070_0027936 | |||
| 1742 | Ga0501070_0204203 | |||
| 1743 | Ga0501071_0271679 | |||
| 1744 | Ga0501071_0323032 | |||
| 1745 | Ga0501072_0002307 | |||
| 1746 | Ga0501073_0025235 | |||
| 1747 | Ga0501074_0145785 | |||
| 1748 | Ga0501079_0460666 | |||
| 1749 | Ga0501083_0025587 | |||
| 1750 | Ga0501035_0000859 | |||
| 1751 | Ga0501035_0140993 | |||
| 1752 | Ga0501044_0011144 | |||
| 1753 | Ga0501044_0109109 | |||
| 1754 | Ga0501044_0408709 | |||
| 1755 | nmdc:mga03n38_96127_c1 | |||
| 1756 | nmdc:mga06z11_145509_c1 | |||
| 1757 | nmdc:mga06z11_297221_c1 | |||
| 1758 | nmdc:mga05p37_19235_c1 | |||
| 1759 | nmdc:mga05p37_19_c2 | |||
| 1760 | nmdc:mga0qj67_938_c1 | |||
| 1761 | nmdc:mga06r32_661_c1 | |||
| 1762 | nmdc:mga08y16_208_c1 | |||
| 1763 | nmdc:mga08y16_29019_c1 | |||
| 1764 | nmdc:mga08y16_60530_c1 | |||
| 1765 | nmdc:mga0n895_12771_c1 | |||
| 1766 | nmdc:mga0n895_169210_c1 | |||
| 1767 | nmdc:mga0n895_3134_c1 | |||
| 1768 | nmdc:mga0n895_331537_c1 | |||
| 1769 | nmdc:mga0n895_797_c1 | |||
| 1770 | nmdc:mga0rr50_4520_c1 | |||
| 1771 | nmdc:mga0rr50_80327_c1 | |||
| 1772 | nmdc:mga0rr50_91386_c1 | |||
| 1773 | nmdc:mga08x19_274693_c1 | |||
| 1774 | nmdc:mga0a205_11140_c1 | |||
| 1775 | nmdc:mga0a205_13983_c1 | |||
| 1776 | nmdc:mga0a205_2345_c1 | |||
| 1777 | Ga0495601_0000237 | |||
| 1778 | Ga0495601_0000293 | |||
| 1779 | Ga0495601_0003203 | |||
| 1780 | Ga0495601_0018736 | |||
| 1781 | Ga0495612_0000275 | |||
| 1782 | Ga0495612_0002577 | |||
| 1783 | Ga0495612_0003858 | |||
| 1784 | Ga0495612_0006876 | |||
| 1785 | Ga0495595_0000701 | |||
| 1786 | Ga0495595_0001594 | |||
| 1787 | Ga0495595_0002027 | |||
| 1788 | Ga0495595_0086064 | |||
| 1789 | Ga0495595_0131768 | |||
| 1790 | Ga0495619_0000343 | |||
| 1791 | Ga0495619_0000660 | |||
| 1792 | Ga0495619_0006775 | |||
| 1793 | Ga0495619_0012952 | |||
| 1794 | Ga0495619_0046394 | |||
| 1795 | Ga0500644_0001523 | |||
| 1796 | Ga0500641_0003967 | |||
| 1797 | Ga0500652_042275 | |||
| 1798 | Ga0500645_002132 | |||
| 1799 | Ga0501084_0083226 | |||
| 1800 | Ga0501082_0048199 | |||
| 1801 | Ga0501082_0344076 | |||
| 1802 | Ga0466962_0062558 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bcj-assembly2.cif.gz_D | crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ | 0.9083 | 5 | 230 |
| 4y98-assembly1.cif.gz_A | crystal structure of ligd-apo form from sphingobium sp. strain syk-6 | 0.9073 | 5 | 242 |
| 4j2h-assembly1.cif.gz_A | crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) | 0.9052 | 3 | 189 |
| 2et6-assembly1.cif.gz_A | (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 | 0.9017 | 3 | 184 |
| 8g93-assembly1.cif.gz_B | crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 | 0.896 | 2 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HUJ2_8_65_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9621 | 9 | 52 | 3.40.50.720 |
| af_Q10782_3_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9351 | 4 | 248 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9243 | 5 | 194 | 3.40.50.720 |
| af_Q8SX47_51_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.92 | 8 | 228 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9157 | 91 | 186 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D7ED22-F1-model_v4 | Short-chain dehydrogenase | 0.9723 | 5 | 169 |
GO:0016491
|
| AF-A0A6N7GVM3-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9645 | 1 | 260 |
GO:0016020
GO:0016491 |
| AF-A0A1Q7B6N6-F1-model_v4 | Short-chain dehydrogenase | 0.9636 | 1 | 259 |
GO:0016020
GO:0016491 |
| AF-A0A2U1SFY3-F1-model_v4 | deleted | 0.9613 | 4 | 256 |
|
| AF-A0A3B8YUV5-F1-model_v4 | Short-chain dehydrogenase | 0.9579 | 5 | 256 |
GO:0016020
GO:0016491 |