F485176

General Info

Members Datasets Scaffolds Average Seq Length
901 381 1802 263

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10342389|Ga0207681_103423891
Length 299
Sequence MTSPRPITVITGASSGIGVALARVFAQHGHELALVARREDRLHALAEEIAGSGARRPIVIAADLFKTGAARVIGEALTAQGAEPQFVVNNAGFGLVGPAGALDRDEQLQMIDLNVRALTELSLAFVDSLARHRGGLLNVGSMAGFLPGPGMAVYYASKAYVLSFTEALHSELGPHGIRVAVLCPGPVPTEFAERAGVRDGLAPNILTQSADFVAEAGYRGLMAGHRTIVPGLINKLVTMLIRMTSVTPPPLWQVWLSIGIGVASAFAAIWFAAKVFRIGLLMYGKPPDFATLIRWARAA

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
128 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
236 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
243 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
244 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
267 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
268 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 9.32
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10342389 3300025923 Bacteria 1195
2 2214736889 2209111006 Bacteria 4052
3 ARSoilYngRDRAFT_c00112 3300000042 Bacteria 13838
4 ARcpr5yngRDRAFT_c000099 3300000043 Bacteria 13598
5 ARSoilOldRDRAFT_c000057 3300000044 Bacteria 23572
6 ARCol0oldRDRAFT_c00030 3300000045 Bacteria 10913
7 ARCol0yngRDRAFT_1000002 3300000652 Bacteria 55259
8 JGI24746J21847_1001839 3300001977 Bacteria 3391
9 JGI24747J21853_1003188 3300001978 Bacteria 1404
10 JGI24739J22299_10001524 3300001989 Bacteria 8748
11 JGI24737J22298_10002379 3300001990 Bacteria 6710
12 JGI24737J22298_10008384 3300001990 Bacteria 3462
13 JGI24750J21931_1000794 3300002070 Bacteria 4401
14 JGI24745J21846_1000127 3300002073 Bacteria 5827
15 JGI24738J21930_10000067 3300002075 Bacteria 21834
16 JGI24749J21850_1000340 3300002076 Bacteria 7024
17 JGI24744J21845_10006801 3300002077 Bacteria 2365
18 JGI24742J22300_10002047 3300002244 Bacteria 3215
19 JGI24751J29686_10005863 3300002459 Bacteria 2506
20 Ga0065717_1002506 3300005276 Bacteria 1886
21 Ga0065716_1001523 3300005277 Bacteria 10216
22 Ga0065704_10073824 3300005289 Bacteria 6761
23 Ga0065712_10000677 3300005290 Bacteria 11212
24 Ga0065712_10001663 3300005290 Bacteria 9900
25 Ga0065715_10004205 3300005293 Bacteria 11517
26 Ga0065715_10089460 3300005293 Bacteria 10071
27 Ga0070658_10001079 3300005327 Bacteria 23302
28 Ga0070658_10014490 3300005327 Bacteria 6327
29 Ga0070676_10000332 3300005328 Bacteria 21434
30 Ga0070683_100004171 3300005329 Bacteria 11837
31 Ga0070683_100059710 3300005329 Bacteria 3543
32 Ga0070683_100172655 3300005329 Bacteria 2052
33 Ga0070690_100002091 3300005330 Bacteria 10668
34 Ga0070690_100004635 3300005330 Bacteria 7653
35 Ga0070670_100072626 3300005331 Bacteria 2955
36 Ga0070670_100081360 3300005331 Bacteria 2783
37 Ga0070677_10000258 3300005333 Bacteria 18304
38 Ga0068869_100000510 3300005334 Bacteria 21648
39 Ga0068869_100148482 3300005334 Bacteria 1816
40 Ga0070666_10004570 3300005335 Bacteria 8438
41 Ga0070666_10327083 3300005335 Bacteria 1094
42 Ga0070680_100001476 3300005336 Bacteria 17088
43 Ga0070680_100012038 3300005336 Bacteria 6712
44 Ga0070680_100018732 3300005336 Bacteria 5477
45 Ga0070680_100052973 3300005336 Bacteria 3312
46 Ga0070680_100059311 3300005336 Bacteria 3130
47 Ga0070680_100237010 3300005336 Bacteria 1542
48 Ga0070682_100003255 3300005337 Bacteria 9005
49 Ga0070682_100208161 3300005337 Bacteria 1384
50 Ga0070682_100343969 3300005337 Bacteria 1110
51 Ga0070682_100344801 3300005337 Bacteria 1108
52 Ga0068868_100000148 3300005338 Bacteria 45833
53 Ga0068868_100233511 3300005338 Bacteria 1543
54 Ga0070660_100001314 3300005339 Bacteria 16922
55 Ga0070660_100052383 3300005339 Bacteria 3146
56 Ga0070660_100118376 3300005339 Bacteria 2112
57 Ga0070689_100003363 3300005340 Bacteria 10634
58 Ga0070689_100009190 3300005340 Bacteria 6996
59 Ga0070689_100027599 3300005340 Bacteria 4280
60 Ga0070689_100207091 3300005340 Bacteria 1604
61 Ga0070691_10001528 3300005341 Bacteria 9952
62 Ga0070691_10018465 3300005341 Bacteria 3216
63 Ga0070691_10061486 3300005341 Bacteria 1807
64 Ga0070687_100000318 3300005343 Bacteria 16315
65 Ga0070687_100146049 3300005343 Bacteria 1383
66 Ga0070661_100000768 3300005344 Bacteria 23141
67 Ga0070661_100127742 3300005344 Bacteria 1908
68 Ga0070692_10000347 3300005345 Bacteria 13504
69 Ga0070692_10012428 3300005345 Bacteria 3941
70 Ga0070668_100004879 3300005347 Bacteria 9938
71 Ga0070668_100013661 3300005347 Bacteria 6062
72 Ga0070668_100052404 3300005347 Bacteria 3145
73 Ga0070669_100003445 3300005353 Bacteria 11403
74 Ga0070669_100016339 3300005353 Bacteria 5294
75 Ga0070675_100001491 3300005354 Bacteria 17261
76 Ga0070675_100065209 3300005354 Unclassified 3011
77 Ga0070671_100003997 3300005355 Bacteria 11616
78 Ga0070671_100084859 3300005355 Bacteria 2648
79 Ga0070671_100154987 3300005355 Bacteria 1935
80 Ga0070671_100292504 3300005355 Bacteria 1386
81 Ga0070671_100415033 3300005355 Bacteria 1152
82 Ga0070674_100001355 3300005356 Bacteria 12909
83 Ga0070674_100197893 3300005356 Bacteria 1550
84 Ga0070673_100000670 3300005364 Bacteria 18859
85 Ga0070673_100024615 3300005364 Bacteria 4418
86 Ga0070673_100031738 3300005364 Bacteria 3968
87 Ga0070673_100036546 3300005364 Bacteria 3734
88 Ga0070673_100322502 3300005364 Bacteria 1365
89 Ga0070688_100001144 3300005365 Bacteria 13256
90 Ga0070688_100065435 3300005365 Bacteria 2310
91 Ga0070688_100210521 3300005365 Bacteria 1365
92 Ga0070659_100001400 3300005366 Bacteria 17383
93 Ga0070659_100164843 3300005366 Bacteria 1813
94 Ga0070667_100002340 3300005367 Bacteria 16596
95 Ga0070667_100009705 3300005367 Bacteria 7978
96 Ga0070667_100120377 3300005367 Unclassified 2283
97 Ga0070667_100157440 3300005367 Bacteria 1999
98 Ga0070667_100320683 3300005367 Bacteria 1398
99 Ga0070703_10015511 3300005406 Bacteria 2181
100 Ga0070709_10034062 3300005434 Bacteria 3085
101 Ga0070714_100015272 3300005435 Bacteria 6177
102 Ga0070714_100116764 3300005435 Bacteria 2369
103 Ga0070713_100000838 3300005436 Bacteria 19660
104 Ga0070710_10021271 3300005437 Bacteria 3378
105 Ga0070710_10037732 3300005437 Bacteria 2651
106 Ga0070710_10060067 3300005437 Bacteria 2161
107 Ga0070701_10000066 3300005438 Bacteria 28271
108 Ga0070701_10031475 3300005438 Bacteria 2632
109 Ga0070711_100010309 3300005439 Bacteria 5780
110 Ga0070711_100120995 3300005439 Bacteria 1936
111 Ga0070711_100218055 3300005439 Bacteria 1481
112 Ga0070711_100343361 3300005439 Bacteria 1198
113 Ga0070705_100001500 3300005440 Bacteria 12285
114 Ga0070705_100076919 3300005440 Bacteria 2037
115 Ga0070700_100001568 3300005441 Bacteria 11405
116 Ga0070700_100174838 3300005441 Bacteria 1489
117 Ga0070700_100200606 3300005441 Bacteria 1401
118 Ga0070694_100002175 3300005444 Bacteria 11621
119 Ga0070694_100008394 3300005444 Bacteria 6319
120 Ga0070708_100021510 3300005445 Bacteria 5454
121 Ga0070708_100146688 3300005445 Bacteria 2192
122 Ga0070663_100001857 3300005455 Bacteria 11779
123 Ga0070663_100281834 3300005455 Bacteria 1324
124 Ga0070678_100000391 3300005456 Bacteria 20585
125 Ga0070678_100025652 3300005456 Bacteria 3970
126 Ga0070678_100069453 3300005456 Bacteria 2630
127 Ga0070662_100001285 3300005457 Bacteria 15435
128 Ga0070662_100073731 3300005457 Bacteria 2523
129 Ga0070681_10002720 3300005458 Bacteria 16283
130 Ga0070681_10016797 3300005458 Bacteria 7308
131 Ga0070681_10081723 3300005458 Bacteria 3187
132 Ga0070681_10207236 3300005458 Bacteria 1877
133 Ga0068867_100001688 3300005459 Bacteria 15398
134 Ga0068867_100032643 3300005459 Unclassified 3766
135 Ga0070685_10000496 3300005466 Bacteria 22749
136 Ga0070685_10010561 3300005466 Bacteria 4802
137 Ga0070679_100007687 3300005530 Bacteria 10092
138 Ga0070679_100048889 3300005530 Unclassified 4213
139 Ga0070679_100101875 3300005530 Bacteria 2858
140 Ga0070679_100254502 3300005530 Bacteria 1712
141 Ga0070684_100000101 3300005535 Bacteria 55960
142 Ga0070684_100020653 3300005535 Bacteria 5462
143 Ga0070684_100287676 3300005535 Bacteria 1506
144 Ga0068853_100005490 3300005539 Bacteria 9938
145 Ga0068853_100193278 3300005539 Bacteria 1850
146 Ga0070672_100000016 3300005543 Bacteria 71848
147 Ga0070672_100039509 3300005543 Unclassified 3615
148 Ga0070672_100042518 3300005543 Bacteria 3499
149 Ga0070686_100002195 3300005544 Bacteria 10783
150 Ga0070686_100026174 3300005544 Bacteria 3518
151 Ga0070686_100096472 3300005544 Bacteria 1988
152 Ga0070695_100000225 3300005545 Bacteria 27760
153 Ga0070695_100005011 3300005545 Bacteria 7804
154 Ga0070696_100002898 3300005546 Bacteria 11405
155 Ga0070696_100010256 3300005546 Bacteria 6271
156 Ga0070693_100000138 3300005547 Bacteria 32988
157 Ga0070693_100055005 3300005547 Unclassified 2291
158 Ga0070693_100116771 3300005547 Bacteria 1650
159 Ga0070665_100009456 3300005548 Bacteria 9865
160 Ga0070665_100044585 3300005548 Bacteria 4453
161 Ga0070665_100212479 3300005548 Bacteria 1935
162 Ga0070665_100789659 3300005548 Bacteria 962
163 Ga0070704_100003148 3300005549 Bacteria 9414
164 Ga0070704_100027532 3300005549 Unclassified 3772
165 Ga0070704_100200936 3300005549 Bacteria 1609
166 Ga0068855_100008651 3300005563 Bacteria 12299
167 Ga0068855_100018870 3300005563 Bacteria 8290
168 Ga0068855_100032667 3300005563 Bacteria 6213
169 Ga0068855_100079966 3300005563 Bacteria 3791
170 Ga0068855_100197592 3300005563 Bacteria 2265
171 Ga0070664_100000067 3300005564 Bacteria 65201
172 Ga0070664_100022080 3300005564 Bacteria 5248
173 Ga0070664_100034890 3300005564 Bacteria 4222
174 Ga0070664_100038096 3300005564 Bacteria 4046
175 Ga0068857_100000275 3300005577 Bacteria 35176
176 Ga0068857_100060516 3300005577 Bacteria 3364
177 Ga0068854_100002271 3300005578 Bacteria 11828
178 Ga0068854_100395576 3300005578 Bacteria 1142
179 Ga0068856_100001016 3300005614 Bacteria 29871
180 Ga0068856_100103150 3300005614 Bacteria 2846
181 Ga0068856_100235161 3300005614 Bacteria 1848
182 Ga0068856_100460215 3300005614 Bacteria 1293
183 Ga0068856_100486022 3300005614 Bacteria 1256
184 Ga0068856_100575853 3300005614 Bacteria 1147
185 Ga0068856_100973681 3300005614 Bacteria 867
186 Ga0070702_100000175 3300005615 Bacteria 20470
187 Ga0068852_100000611 3300005616 Bacteria 23441
188 Ga0068852_100139477 3300005616 Bacteria 2242
189 Ga0068852_100185344 3300005616 Bacteria 1960
190 Ga0068852_100233343 3300005616 Bacteria 1755
191 Ga0068852_100263402 3300005616 Bacteria 1656
192 Ga0068852_100279190 3300005616 Bacteria 1610
193 Ga0068859_100002948 3300005617 Bacteria 17261
194 Ga0068864_100000234 3300005618 Bacteria 49663
195 Ga0068864_100381709 3300005618 Bacteria 1335
196 Ga0068864_100726187 3300005618 Bacteria 972
197 Ga0068866_10002176 3300005718 Bacteria 8161
198 Ga0068861_100000317 3300005719 Bacteria 27073
199 Ga0068861_100030808 3300005719 Bacteria 3935
200 Ga0068870_10000009 3300005840 Bacteria 70353
201 Ga0068863_100001729 3300005841 Bacteria 21634
202 Ga0068863_100296329 3300005841 Bacteria 1568
203 Ga0068858_100001059 3300005842 Bacteria 28468
204 Ga0068858_100046203 3300005842 Bacteria 4037
205 Ga0068858_100083371 3300005842 Bacteria 2973
206 Ga0068858_100128294 3300005842 Bacteria 2377
207 Ga0068858_100349923 3300005842 Bacteria 1415
208 Ga0068860_100003167 3300005843 Bacteria 16980
209 Ga0068860_100131881 3300005843 Bacteria 2398
210 Ga0068860_100147282 3300005843 Bacteria 2266
211 Ga0068862_100030207 3300005844 Bacteria 4566
212 Ga0081455_10008146 3300005937 Bacteria 10932
213 Ga0081540_1000374 3300005983 Bacteria 44794
214 Ga0070717_10025214 3300006028 Bacteria 4726
215 Ga0070717_10066122 3300006028 Bacteria 3006
216 Ga0070717_10096851 3300006028 Bacteria 2499
217 Ga0075432_10002492 3300006058 Bacteria 6119
218 Ga0070715_10055615 3300006163 Bacteria 1719
219 Ga0070715_10110172 3300006163 Bacteria 1298
220 Ga0070716_100040093 3300006173 Bacteria 2604
221 Ga0070712_100068122 3300006175 Bacteria 2535
222 Ga0070712_100201467 3300006175 Bacteria 1564
223 Ga0070712_100263293 3300006175 Bacteria 1382
224 Ga0075367_10104289 3300006178 Bacteria 1736
225 Ga0075367_10149404 3300006178 Bacteria 1449
226 Ga0097621_100010706 3300006237 Bacteria 6723
227 Ga0097621_100076109 3300006237 Bacteria 2783
228 Ga0097621_100468937 3300006237 Bacteria 1137
229 Ga0068871_100000012 3300006358 Bacteria 105267
230 Ga0075430_100008278 3300006846 Bacteria 8782
231 Ga0075433_10000072 3300006852 Bacteria 45390
232 Ga0075433_10057417 3300006852 Bacteria 3402
233 Ga0075434_100000756 3300006871 Bacteria 25483
234 Ga0075434_100001819 3300006871 Bacteria 18406
235 Ga0075434_100111340 3300006871 Bacteria 2748
236 Ga0075434_100148836 3300006871 Bacteria 2361
237 Ga0075434_100329671 3300006871 Bacteria 1547
238 Ga0075429_100001133 3300006880 Bacteria 21502
239 Ga0068865_100000355 3300006881 Bacteria 25325
240 Ga0075436_100072071 3300006914 Bacteria 2390
241 Ga0097620_100002948 3300006931 Bacteria 17261
242 Ga0075435_100167022 3300007076 Bacteria 1856
243 Ga0099794_10005086 3300007265 Bacteria 5243
244 Ga0105251_10036599 3300009011 Bacteria 2414
245 Ga0105240_10035122 3300009093 Bacteria 6464
246 Ga0111539_10001688 3300009094 Bacteria 29450
247 Ga0111539_10002781 3300009094 Bacteria 23232
248 Ga0111539_10005411 3300009094 Bacteria 16521
249 Ga0111539_10060689 3300009094 Unclassified 4481
250 Ga0111539_10182139 3300009094 Bacteria 2453
251 Ga0111539_10344488 3300009094 Bacteria 1735
252 Ga0105245_10000409 3300009098 Bacteria 39920
253 Ga0105245_10019441 3300009098 Bacteria 5951
254 Ga0105247_10004080 3300009101 Bacteria 9386
255 Ga0105247_10018620 3300009101 Bacteria 4167
256 Ga0105247_10045268 3300009101 Bacteria 2699
257 Ga0105247_10319810 3300009101 Bacteria 1082
258 Ga0114129_10003162 3300009147 Bacteria 23098
259 Ga0114129_10026034 3300009147 Bacteria 8283
260 Ga0105243_10004202 3300009148 Bacteria 11415
261 Ga0105243_10005740 3300009148 Bacteria 9637
262 Ga0105241_10000053 3300009174 Bacteria 94578
263 Ga0105241_10021735 3300009174 Bacteria 4746
264 Ga0105241_10101496 3300009174 Bacteria 2287
265 Ga0105241_10133544 3300009174 Bacteria 2012
266 Ga0105241_10190110 3300009174 Bacteria 1709
267 Ga0105242_10001586 3300009176 Bacteria 17880
268 Ga0105242_10104613 3300009176 Bacteria 2403
269 Ga0105242_10106125 3300009176 Bacteria 2387
270 Ga0105248_10000309 3300009177 Bacteria 58008
271 Ga0105248_10005691 3300009177 Bacteria 13695
272 Ga0105248_10009701 3300009177 Bacteria 10604
273 Ga0105248_10156233 3300009177 Bacteria 2574
274 Ga0105248_10363371 3300009177 Bacteria 1630
275 Ga0105248_10441280 3300009177 Bacteria 1466
276 Ga0105237_10005630 3300009545 Bacteria 14111
277 Ga0105237_10015365 3300009545 Bacteria 7971
278 Ga0105238_10162248 3300009551 Bacteria 2211
279 Ga0105238_10638600 3300009551 Bacteria 1074
280 Ga0105249_10003451 3300009553 Bacteria 13696
281 Ga0105249_10058537 3300009553 Bacteria 3531
282 Ga0105249_10151551 3300009553 Bacteria 2233
283 Ga0105239_10007939 3300010375 Bacteria 12129
284 Ga0105239_10029753 3300010375 Bacteria 6005
285 Ga0105239_10379007 3300010375 Bacteria 1599
286 Ga0105246_10002040 3300011119 Bacteria 12194
287 Ga0157329_1000662 3300012491 Bacteria 1463
288 Ga0157338_1005577 3300012515 Bacteria 1136
289 Ga0157373_10012578 3300013100 Bacteria 6221
290 Ga0157371_10006362 3300013102 Bacteria 9768
291 Ga0157371_10066724 3300013102 Bacteria 2548
292 Ga0157370_10054295 3300013104 Bacteria 3819
293 Ga0157369_10359452 3300013105 Bacteria 1512
294 Ga0157374_10000452 3300013296 Bacteria 37355
295 Ga0157374_10054238 3300013296 Bacteria 3739
296 Ga0157374_10185048 3300013296 Bacteria 2036
297 Ga0157378_10006920 3300013297 Bacteria 9903
298 Ga0163162_10000796 3300013306 Bacteria 29342
299 Ga0163162_10012138 3300013306 Bacteria 8407
300 Ga0163162_10055472 3300013306 Bacteria 3989
301 Ga0157372_10008710 3300013307 Bacteria 10774
302 Ga0157372_10175622 3300013307 Bacteria 2479
303 Ga0157372_10365119 3300013307 Bacteria 1682
304 Ga0157375_10004563 3300013308 Bacteria 12034
305 Ga0157375_10022988 3300013308 Bacteria 5747
306 Ga0157375_10143331 3300013308 Bacteria 2518
307 Ga0157375_10491475 3300013308 Bacteria 1392
308 Ga0163163_10001104 3300014325 Bacteria 22905
309 Ga0163163_10011726 3300014325 Bacteria 7963
310 Ga0163163_10144094 3300014325 Bacteria 2425
311 Ga0157380_10017908 3300014326 Bacteria 5252
312 Ga0157377_10000538 3300014745 Bacteria 16011
313 Ga0157379_10009254 3300014968 Bacteria 8576
314 Ga0157379_10094730 3300014968 Bacteria 2679
315 Ga0157379_10258962 3300014968 Bacteria 1580
316 Ga0157376_10002295 3300014969 Bacteria 12921
317 Ga0157376_10141931 3300014969 Bacteria 2156
318 Ga0157376_10276156 3300014969 Bacteria 1580
319 Ga0157376_10650290 3300014969 Bacteria 1054
320 Ga0163161_10000499 3300017792 Bacteria 32280
321 Ga0206353_10474572 3300020082 Bacteria 1741
322 Ga0207666_1000313 3300025271 Bacteria 6754
323 Ga0207666_1001193 3300025271 Bacteria 3064
324 Ga0207697_10000252 3300025315 Bacteria 29548
325 Ga0207653_10001924 3300025885 Bacteria 6639
326 Ga0207653_10027745 3300025885 Bacteria 1817
327 Ga0207682_10000029 3300025893 Bacteria 57930
328 Ga0207692_10002625 3300025898 Bacteria 6916
329 Ga0207692_10004448 3300025898 Bacteria 5550
330 Ga0207692_10062536 3300025898 Bacteria 1932
331 Ga0207692_10068998 3300025898 Bacteria 1856
332 Ga0207642_10000713 3300025899 Bacteria 10287
333 Ga0207710_10032756 3300025900 Bacteria 2277
334 Ga0207710_10060468 3300025900 Bacteria 1717
335 Ga0207710_10067238 3300025900 Bacteria 1636
336 Ga0207688_10000020 3300025901 Bacteria 51200
337 Ga0207680_10001555 3300025903 Bacteria 10815
338 Ga0207680_10303050 3300025903 Bacteria 1114
339 Ga0207647_10004457 3300025904 Bacteria 10378
340 Ga0207647_10004529 3300025904 Bacteria 10300
341 Ga0207685_10014773 3300025905 Bacteria 2453
342 Ga0207699_10019161 3300025906 Bacteria 3642
343 Ga0207699_10047171 3300025906 Bacteria 2525
344 Ga0207645_10000108 3300025907 Bacteria 61630
345 Ga0207645_10215252 3300025907 Bacteria 1266
346 Ga0207643_10000044 3300025908 Bacteria 82217
347 Ga0207705_10015497 3300025909 Bacteria 5470
348 Ga0207705_10019507 3300025909 Bacteria 4848
349 Ga0207654_10000143 3300025911 Bacteria 45654
350 Ga0207654_10123379 3300025911 Bacteria 1630
351 Ga0207654_10197266 3300025911 Bacteria 1323
352 Ga0207707_10002475 3300025912 Bacteria 16630
353 Ga0207707_10030589 3300025912 Bacteria 4710
354 Ga0207707_10054545 3300025912 Bacteria 3480
355 Ga0207707_10157482 3300025912 Bacteria 1986
356 Ga0207707_10204552 3300025912 Bacteria 1721
357 Ga0207707_10378188 3300025912 Bacteria 1218
358 Ga0207671_10009506 3300025914 Bacteria 8121
359 Ga0207693_10000831 3300025915 Bacteria 27450
360 Ga0207693_10005608 3300025915 Bacteria 10436
361 Ga0207693_10067898 3300025915 Bacteria 2791
362 Ga0207693_10153627 3300025915 Bacteria 1811
363 Ga0207693_10191504 3300025915 Bacteria 1609
364 Ga0207663_10027032 3300025916 Bacteria 3339
365 Ga0207663_10324202 3300025916 Bacteria 1158
366 Ga0207660_10000543 3300025917 Bacteria 25357
367 Ga0207660_10031238 3300025917 Bacteria 3665
368 Ga0207660_10034606 3300025917 Bacteria 3503
369 Ga0207660_10077574 3300025917 Bacteria 2432
370 Ga0207660_10397105 3300025917 Bacteria 1110
371 Ga0207660_10402371 3300025917 Bacteria 1103
372 Ga0207662_10000104 3300025918 Bacteria 40365
373 Ga0207662_10009837 3300025918 Bacteria 5276
374 Ga0207662_10158113 3300025918 Bacteria 1446
375 Ga0207657_10001453 3300025919 Bacteria 25334
376 Ga0207657_10004676 3300025919 Bacteria 14449
377 Ga0207657_10020064 3300025919 Bacteria 6330
378 Ga0207657_10068005 3300025919 Bacteria 3027
379 Ga0207649_10000057 3300025920 Bacteria 102314
380 Ga0207652_10000916 3300025921 Bacteria 27831
381 Ga0207652_10006960 3300025921 Bacteria 9111
382 Ga0207652_10087443 3300025921 Bacteria 2733
383 Ga0207652_10168332 3300025921 Bacteria 1966
384 Ga0207652_10312748 3300025921 Bacteria 1418
385 Ga0207681_10001187 3300025923 Bacteria 16757
386 Ga0207650_10001534 3300025925 Bacteria 16557
387 Ga0207650_10023478 3300025925 Bacteria 4374
388 Ga0207650_10140424 3300025925 Bacteria 1899
389 Ga0207659_10000028 3300025926 Bacteria 130804
390 Ga0207659_10019591 3300025926 Bacteria 4457
391 Ga0207659_10155742 3300025926 Bacteria 1788
392 Ga0207687_10000061 3300025927 Bacteria 84113
393 Ga0207687_10046599 3300025927 Bacteria 3002
394 Ga0207687_10143690 3300025927 Bacteria 1813
395 Ga0207700_10078743 3300025928 Bacteria 2565
396 Ga0207700_10192552 3300025928 Bacteria 1714
397 Ga0207664_10095859 3300025929 Bacteria 2441
398 Ga0207644_10000194 3300025931 Bacteria 43567
399 Ga0207644_10007311 3300025931 Bacteria 7188
400 Ga0207644_10029098 3300025931 Bacteria 3829
401 Ga0207644_10077254 3300025931 Bacteria 2451
402 Ga0207690_10000225 3300025932 Bacteria 42706
403 Ga0207706_10001293 3300025933 Bacteria 25199
404 Ga0207706_10010554 3300025933 Bacteria 8439
405 Ga0207706_10088706 3300025933 Bacteria 2719
406 Ga0207686_10000530 3300025934 Bacteria 24694
407 Ga0207686_10025146 3300025934 Bacteria 3459
408 Ga0207709_10000291 3300025935 Bacteria 56621
409 Ga0207709_10082888 3300025935 Bacteria 2072
410 Ga0207670_10000434 3300025936 Bacteria 23430
411 Ga0207670_10047843 3300025936 Bacteria 2851
412 Ga0207670_10204360 3300025936 Bacteria 1502
413 Ga0207669_10000019 3300025937 Bacteria 111630
414 Ga0207669_10154652 3300025937 Bacteria 1611
415 Ga0207669_10271354 3300025937 Bacteria 1274
416 Ga0207704_10000438 3300025938 Bacteria 18608
417 Ga0207665_10001157 3300025939 Bacteria 17725
418 Ga0207691_10001047 3300025940 Bacteria 27463
419 Ga0207691_10042370 3300025940 Bacteria 4197
420 Ga0207691_10043271 3300025940 Bacteria 4151
421 Ga0207691_10091890 3300025940 Bacteria 2718
422 Ga0207711_10007089 3300025941 Bacteria 9389
423 Ga0207711_10008817 3300025941 Bacteria 8433
424 Ga0207711_10491374 3300025941 Bacteria 1144
425 Ga0207689_10001160 3300025942 Bacteria 25357
426 Ga0207689_10096196 3300025942 Bacteria 2432
427 Ga0207661_10000126 3300025944 Bacteria 48665
428 Ga0207661_10312350 3300025944 Bacteria 1411
429 Ga0207679_10000026 3300025945 Bacteria 200073
430 Ga0207679_10030446 3300025945 Bacteria 3769
431 Ga0207679_10119600 3300025945 Bacteria 2094
432 Ga0207679_10555968 3300025945 Bacteria 1030
433 Ga0207667_10016786 3300025949 Bacteria 8259
434 Ga0207667_10022484 3300025949 Bacteria 6963
435 Ga0207667_10029280 3300025949 Bacteria 5973
436 Ga0207667_10299030 3300025949 Bacteria 1644
437 Ga0207651_10001232 3300025960 Bacteria 11489
438 Ga0207651_10085430 3300025960 Bacteria 2289
439 Ga0207651_10123202 3300025960 Bacteria 1970
440 Ga0207651_10130302 3300025960 Bacteria 1924
441 Ga0207712_10002654 3300025961 Bacteria 11451
442 Ga0207712_10018907 3300025961 Bacteria 4494
443 Ga0207668_10000049 3300025972 Bacteria 99391
444 Ga0207668_10163464 3300025972 Bacteria 1737
445 Ga0207640_10004275 3300025981 Bacteria 7729
446 Ga0207658_10001093 3300025986 Bacteria 21888
447 Ga0207658_10037209 3300025986 Bacteria 3495
448 Ga0207658_10130831 3300025986 Bacteria 2016
449 Ga0207658_10283800 3300025986 Bacteria 1420
450 Ga0207658_10340989 3300025986 Bacteria 1302
451 Ga0207658_10600720 3300025986 Bacteria 988
452 Ga0207677_10000229 3300026023 Bacteria 44154
453 Ga0207677_10049748 3300026023 Bacteria 2830
454 Ga0207677_10083255 3300026023 Bacteria 2302
455 Ga0207703_10000780 3300026035 Bacteria 31340
456 Ga0207703_10016660 3300026035 Bacteria 5732
457 Ga0207703_10054060 3300026035 Bacteria 3265
458 Ga0207703_10069167 3300026035 Bacteria 2911
459 Ga0207703_10071010 3300026035 Bacteria 2875
460 Ga0207639_10002735 3300026041 Bacteria 11838
461 Ga0207639_10041347 3300026041 Bacteria 3448
462 Ga0207639_10067384 3300026041 Bacteria 2785
463 Ga0207678_10000403 3300026067 Bacteria 39172
464 Ga0207678_10040152 3300026067 Bacteria 4059
465 Ga0207708_10000669 3300026075 Bacteria 26302
466 Ga0207708_10005479 3300026075 Bacteria 9367
467 Ga0207708_10229896 3300026075 Bacteria 1489
468 Ga0207708_10244491 3300026075 Bacteria 1444
469 Ga0207702_10006536 3300026078 Bacteria 10027
470 Ga0207702_10143680 3300026078 Bacteria 2162
471 Ga0207702_10156396 3300026078 Bacteria 2078
472 Ga0207702_10181108 3300026078 Bacteria 1941
473 Ga0207702_10189336 3300026078 Bacteria 1900
474 Ga0207702_10195395 3300026078 Bacteria 1872
475 Ga0207702_10826128 3300026078 Bacteria 917
476 Ga0207641_10000542 3300026088 Bacteria 42352
477 Ga0207641_10318386 3300026088 Bacteria 1474
478 Ga0207641_10629406 3300026088 Bacteria 1052
479 Ga0207648_10001244 3300026089 Bacteria 28553
480 Ga0207648_10017537 3300026089 Bacteria 6507
481 Ga0207676_10000672 3300026095 Bacteria 27349
482 Ga0207676_10035605 3300026095 Bacteria 3780
483 Ga0207676_10367384 3300026095 Bacteria 1335
484 Ga0207674_10001968 3300026116 Bacteria 26001
485 Ga0207675_100001274 3300026118 Bacteria 25219
486 Ga0207675_100056051 3300026118 Bacteria 3677
487 Ga0207683_10000034 3300026121 Bacteria 101817
488 Ga0207683_10000880 3300026121 Bacteria 27550
489 Ga0207683_10019963 3300026121 Bacteria 5725
490 Ga0207698_10001780 3300026142 Bacteria 12577
491 Ga0207698_10164946 3300026142 Bacteria 1943
492 Ga0207698_10190227 3300026142 Bacteria 1827
493 Ga0207698_10204016 3300026142 Bacteria 1773
494 Ga0209996_1003302 3300027395 Bacteria 2023
495 Ga0210002_1000151 3300027617 Bacteria 10314
496 Ga0209588_1034985 3300027671 Bacteria 1614
497 Ga0209971_1038720 3300027682 Bacteria 1148
498 Ga0209966_1001368 3300027695 Bacteria 4266
499 Ga0209966_1002416 3300027695 Bacteria 3117
500 Ga0209998_10000830 3300027717 Bacteria 7984
501 Ga0209998_10000899 3300027717 Bacteria 7635
502 Ga0207428_10000082 3300027907 Bacteria 133684
503 Ga0207428_10000130 3300027907 Bacteria 104457
504 Ga0207428_10000701 3300027907 Bacteria 38862
505 Ga0268266_10010845 3300028379 Bacteria 7938
506 Ga0268266_10066865 3300028379 Bacteria 3109
507 Ga0268266_10237921 3300028379 Bacteria 1679
508 Ga0268265_10000410 3300028380 Bacteria 45939
509 Ga0268265_10008133 3300028380 Bacteria 7089
510 Ga0268264_10001567 3300028381 Bacteria 21210
511 Ga0268264_10164771 3300028381 Bacteria 2000
512 Ga0265336_10029893 3300028666 Bacteria 1698
513 Ga0265338_10012066 3300028800 Bacteria 9882
514 Ga0265338_10219689 3300028800 Bacteria 1420
515 Ga0265325_10056250 3300031241 Bacteria 2010
516 Ga0265340_10096387 3300031247 Bacteria 1378
517 Ga0265339_10021871 3300031249 Bacteria 3712
518 Ga0265339_10059070 3300031249 Bacteria 2069
519 Ga0265339_10190761 3300031249 Bacteria 1016
520 Ga0265339_10198739 3300031249 Bacteria 990
521 Ga0265316_10308415 3300031344 Bacteria 1152
522 Ga0265313_10007635 3300031595 Bacteria 7334
523 Ga0265313_10020128 3300031595 Bacteria 3689
524 Ga0265313_10021404 3300031595 Bacteria 3536
525 Ga0265313_10022693 3300031595 Bacteria 3398
526 Ga0265314_10005096 3300031711 Bacteria 11967
527 Ga0265314_10185576 3300031711 Bacteria 1242
528 Ga0265342_10000912 3300031712 Bacteria 29335
529 Ga0265342_10157545 3300031712 Bacteria 1257
530 Ga0316583_10000300 3300032133 Bacteria 13878
531 Ga0373930_0000948 3300034816 Bacteria 4151
532 Ga0373930_0009551 3300034816 Bacteria 1718
533 Ga0373930_0036029 3300034816 Bacteria 1037
534 Ga0373948_0000060 3300034817 Bacteria 11545
535 Ga0373950_0000151 3300034818 Bacteria 10644
536 Ga0373958_0000640 3300034819 Bacteria 4376
537 Ga0373958_0001109 3300034819 Bacteria 3557
538 Ga0373959_0003990 3300034820 Unclassified 2364
539 Ga0373938_0000265 3300034957 Bacteria 8266
540 Ga0373938_0000851 3300034957 Bacteria 4927
541 Ga0373928_0002719 3300035084 Unclassified 3416
542 Ga0373928_0047247 3300035084 Bacteria 1006
543 Ga0373929_0006649 3300035085 Bacteria 2093
544 Ga0373940_0001617 3300035088 Bacteria 4136
545 Ga0373940_0005020 3300035088 Bacteria 2841
546 Ga0373944_0040298 3300035089 Bacteria 1441
547 Ga0373949_0001017 3300035090 Bacteria 8644
548 Ga0373949_0001292 3300035090 Bacteria 7292
549 Ga0373951_0001079 3300035091 Bacteria 7294
550 Ga0373951_0006738 3300035091 Bacteria 2623
551 Ga0373952_0000144 3300035092 Bacteria 10452
552 Ga0373952_0003531 3300035092 Bacteria 2819
553 Ga0373952_0003549 3300035092 Bacteria 2812
554 Ga0373952_0030830 3300035092 Bacteria 1189
555 Ga0373932_0001474 3300035112 Bacteria 6576
556 Ga0373932_0002399 3300035112 Bacteria 4751
557 Ga0373932_0003771 3300035112 Bacteria 3617
558 Ga0373939_0000633 3300035114 Bacteria 8744
559 Ga0373939_0000683 3300035114 Bacteria 8411
560 Ga0373939_0001140 3300035114 Bacteria 6532
561 Ga0373941_0000506 3300035115 Bacteria 7782
562 Ga0373941_0000613 3300035115 Bacteria 7197
563 Ga0373941_0004805 3300035115 Bacteria 3144
564 Ga0373941_0011897 3300035115 Bacteria 2261
565 Ga0373941_0042292 3300035115 Bacteria 1414
566 Ga0373945_0002918 3300035116 Bacteria 5373
567 Ga0373953_0009947 3300035117 Bacteria 3296
568 Ga0373954_0002508 3300035118 Bacteria 7701
569 Ga0373954_0005440 3300035118 Bacteria 5510
570 Ga0373956_0024480 3300035119 Bacteria 2602
571 Ga0373957_0001422 3300035120 Bacteria 6480
572 Ga0373957_0002239 3300035120 Bacteria 5477
573 Ga0373957_0079124 3300035120 Bacteria 1295
574 Ga0373960_0000369 3300035121 Bacteria 8691
575 Ga0373960_0006235 3300035121 Bacteria 2791
576 Ga0373960_0007623 3300035121 Bacteria 2570
577 Ga0373943_0011614 3300035170 Bacteria 3963
578 Ga0373946_0004728 3300035171 Bacteria 4893
579 Ga0373946_0014660 3300035171 Bacteria 2958
580 Ga0373955_0000744 3300035172 Bacteria 14004
581 Ga0373955_0002809 3300035172 Bacteria 7652
582 Ga0373955_0045720 3300035172 Bacteria 2363
583 Ga0373942_0000425 3300035207 Bacteria 11867
584 Ga0373942_0001723 3300035207 Bacteria 5561
585 Ga0373942_0007645 3300035207 Bacteria 2511
586 Ga0373942_0029590 3300035207 Bacteria 1438
587 Ga0373961_0001150 3300035241 Bacteria 8276
588 Ga0373961_0001699 3300035241 Bacteria 6134
589 Ga0373961_0006662 3300035241 Bacteria 2777
590 Ga0373961_0026069 3300035241 Bacteria 1594
591 Ga0373962_0000209 3300035242 Bacteria 12428
592 Ga0373962_0000258 3300035242 Bacteria 11309
593 Ga0373962_0003978 3300035242 Bacteria 3559
594 Ga0373962_0022289 3300035242 Bacteria 1678
595 Ga0373924_0011954 3300035410 Bacteria 3233
596 Ga0373924_0025618 3300035410 Bacteria 2332
597 Ga0373931_0001019 3300035691 Bacteria 11824
598 Ga0373931_0020943 3300035691 Bacteria 3275
599 Ga0373931_0022983 3300035691 Bacteria 3143
600 Ga0373931_0169813 3300035691 Bacteria 1284
601 Ga0373927_0079590 3300035695 Unclassified 2123
602 Ga0373933_0000842 3300035724 Bacteria 18781
603 Ga0373933_0016370 3300035724 Bacteria 4145
604 Ga0373933_0037328 3300035724 Bacteria 2849
605 Ga0373933_0115928 3300035724 Bacteria 1674
606 Ga0373947_0001071 3300035725 Bacteria 16758
607 Ga0373947_0074885 3300035725 Bacteria 2084
608 Ga0373947_0322951 3300035725 Unclassified 1032
609 Ga0373937_0002444 3300036401 Bacteria 15436
610 Ga0373937_0004304 3300036401 Bacteria 12068
611 Ga0373937_0186711 3300036401 Unclassified 1947
612 Ga0316582_0070685 3300036647 Bacteria 2259
613 Ga0373925_0020933 3300037068 Bacteria 4766
614 Ga0373925_0058812 3300037068 Bacteria 2883
615 Ga0373925_0086417 3300037068 Bacteria 2392
616 Ga0373925_0190429 3300037068 Unclassified 1627
617 Ga0395900_0005590 3300037418 Bacteria 13152
618 Ga0395900_0582933 3300037418 Bacteria 1060
619 Ga0395898_0003040 3300037466 Bacteria 19011
620 Ga0439450_017390 3300042008 Bacteria 1498
621 Ga0439455_0014150 3300042012 Bacteria 1818
622 Ga0439463_019888 3300042016 Bacteria 1673
623 Ga0451577_0195565 3300042876 Bacteria 1825
624 Ga0439440_0064746 3300042993 Bacteria 940
625 Ga0466963_0136357 3300044694 Bacteria 1698
626 Ga0453684_0219997 3300044712 Bacteria 2200
627 Ga0451576_0013835 3300045051 Bacteria 9014
628 Ga0466958_0041961 3300045836 Bacteria 2754
629 Ga0466967_0038326 3300045976 Bacteria 4109
630 Ga0466967_0272755 3300045976 Bacteria 1621
631 Ga0495592_0012089 3300046454 Bacteria 6546
632 Ga0495592_0024911 3300046454 Bacteria 4547
633 Ga0495592_0136335 3300046454 Bacteria 1711
634 Ga0495603_0003522 3300046455 Bacteria 9319
635 Ga0495603_0133959 3300046455 Unclassified 1442
636 Ga0495629_0000527 3300046459 Bacteria 31973
637 Ga0495629_0160533 3300046459 Bacteria 1561
638 Ga0495629_0254586 3300046459 Bacteria 1207
639 Ga0495641_0029112 3300046461 Bacteria 2664
640 Ga0495641_0033030 3300046461 Bacteria 2459
641 Ga0495641_0042184 3300046461 Unclassified 2116
642 Ga0495651_0000908 3300046462 Bacteria 22960
643 Ga0495651_0003856 3300046462 Bacteria 11462
644 Ga0495651_0013633 3300046462 Bacteria 6282
645 Ga0495653_0000912 3300046463 Bacteria 22874
646 Ga0495653_0052486 3300046463 Bacteria 3124
647 Ga0495653_0067885 3300046463 Bacteria 2676
648 Ga0495580_0052811 3300046472 Bacteria 2869
649 Ga0495580_0057151 3300046472 Bacteria 2746
650 Ga0495582_0012645 3300046473 Bacteria 4654
651 Ga0495582_0015881 3300046473 Bacteria 4128
652 Ga0495582_0203261 3300046473 Unclassified 1131
653 Ga0495639_0085854 3300046475 Bacteria 1471
654 Ga0495662_0018163 3300046476 Bacteria 3402
655 Ga0495662_0245232 3300046476 Bacteria 883
656 Ga0495664_0016385 3300046477 Bacteria 4220
657 Ga0495664_0126183 3300046477 Bacteria 1548
658 Ga0495584_0066615 3300046491 Bacteria 1811
659 Ga0495594_0026475 3300046499 Bacteria 3120
660 Ga0495608_0008704 3300046511 Bacteria 7100
661 Ga0495608_0044974 3300046511 Bacteria 2945
662 Ga0495618_0003244 3300046514 Bacteria 10188
663 Ga0495618_0077276 3300046514 Unclassified 2121
664 Ga0495618_0124343 3300046514 Bacteria 1652
665 Ga0495628_0009709 3300046516 Bacteria 8210
666 Ga0495628_0011083 3300046516 Bacteria 7628
667 Ga0495628_0029193 3300046516 Bacteria 4474
668 Ga0495630_0101055 3300046517 Bacteria 2182
669 Ga0495630_0195665 3300046517 Unclassified 1542
670 Ga0495630_0244310 3300046517 Bacteria 1371
671 Ga0495637_0043852 3300046520 Bacteria 1907
672 Ga0495644_0003683 3300046523 Bacteria 6033
673 Ga0495663_0053003 3300046525 Bacteria 1260
674 Ga0495652_0011801 3300046529 Bacteria 7893
675 Ga0495652_0042003 3300046529 Bacteria 3943
676 Ga0495652_0059568 3300046529 Bacteria 3230
677 Ga0495652_0205523 3300046529 Bacteria 1491
678 Ga0495665_0032193 3300046531 Bacteria 2804
679 Ga0495640_0003572 3300046533 Bacteria 12483
680 Ga0495640_0150259 3300046533 Bacteria 1497
681 Ga0495586_0128107 3300046535 Bacteria 1420
682 Ga0495587_0002348 3300046536 Bacteria 12651
683 Ga0495587_0004743 3300046536 Bacteria 8925
684 Ga0495587_0111571 3300046536 Bacteria 1570
685 Ga0495587_0256213 3300046536 Unclassified 983
686 Ga0495598_0009095 3300046537 Bacteria 2336
687 Ga0495645_0001151 3300046543 Bacteria 17952
688 Ga0495645_0010788 3300046543 Bacteria 6418
689 Ga0495645_0198839 3300046543 Bacteria 1361
690 Ga0495622_0033447 3300046557 Bacteria 2399
691 Ga0495633_0006733 3300046558 Bacteria 6763
692 Ga0495667_0000212 3300046559 Bacteria 38949
693 Ga0495667_0030318 3300046559 Bacteria 3635
694 Ga0495667_0059372 3300046559 Bacteria 2510
695 Ga0495656_0004302 3300046615 Bacteria 4866
696 Ga0495634_0036763 3300046642 Bacteria 3347
697 Ga0495634_0126160 3300046642 Unclassified 1635
698 Ga0495634_0240904 3300046642 Bacteria 1109
699 Ga0495611_0005176 3300046648 Bacteria 5593
700 Ga0495635_0057614 3300046663 Bacteria 2673
701 Ga0495635_0067169 3300046663 Bacteria 2459
702 Ga0495635_0243707 3300046663 Unclassified 1212
703 Ga0495588_0041161 3300046674 Bacteria 2358
704 Ga0495588_0067080 3300046674 Unclassified 1862
705 Ga0495657_0003573 3300046675 Bacteria 12646
706 Ga0495599_0006187 3300046678 Bacteria 7215
707 Ga0495599_0093387 3300046678 Bacteria 1877
708 Ga0495599_0153442 3300046678 Bacteria 1425
709 Ga0495623_0000188 3300046679 Bacteria 39199
710 Ga0495623_0007794 3300046679 Bacteria 6962
711 Ga0495646_0002814 3300046680 Bacteria 10765
712 Ga0495646_0028716 3300046680 Bacteria 3481
713 Ga0495647_0008172 3300046681 Bacteria 3516
714 Ga0495647_0037390 3300046681 Unclassified 1831
715 Ga0495658_0001507 3300046683 Bacteria 12204
716 Ga0495658_0012622 3300046683 Bacteria 4286
717 Ga0495658_0034456 3300046683 Bacteria 2778
718 Ga0495658_0052177 3300046683 Unclassified 2318
719 Ga0495613_0013123 3300046689 Bacteria 6157
720 Ga0495624_0008197 3300046690 Bacteria 7307
721 Ga0495670_0000704 3300046691 Bacteria 15931
722 Ga0495600_0004951 3300046809 Bacteria 8000
723 Ga0495600_0005049 3300046809 Bacteria 7928
724 Ga0495600_0075044 3300046809 Bacteria 2208
725 Ga0495581_0032257 3300047315 Bacteria 3033
726 Ga0495581_0195420 3300047315 Bacteria 1183
727 Ga0495604_0008689 3300047317 Bacteria 8028
728 Ga0495604_0016801 3300047317 Bacteria 5854
729 Ga0495604_0066408 3300047317 Bacteria 2744
730 Ga0495674_0024741 3300047319 Bacteria 5512
731 Ga0495674_0030841 3300047319 Bacteria 4872
732 Ga0495674_0120459 3300047319 Bacteria 2217
733 Ga0495674_0303533 3300047319 Unclassified 1303
734 Ga0495676_0008228 3300047321 Bacteria 9567
735 Ga0495680_0005676 3300047322 Bacteria 11681
736 Ga0495680_0006175 3300047322 Bacteria 11175
737 Ga0495680_0010622 3300047322 Bacteria 8210
738 Ga0495680_0011028 3300047322 Bacteria 8030
739 Ga0495680_0012117 3300047322 Bacteria 7607
740 Ga0495675_0008455 3300047444 Bacteria 6379
741 Ga0495684_0003722 3300047471 Bacteria 11893
742 Ga0495684_0044462 3300047471 Bacteria 3401
743 Ga0495593_0040959 3300047673 Bacteria 2492
744 Ga0495602_0002562 3300048088 Bacteria 18530
745 Ga0495602_0008079 3300048088 Bacteria 10996
746 Ga0495602_0164146 3300048088 Bacteria 1731
747 Ga0495614_0100536 3300048089 Bacteria 1263
748 Ga0496100_0001962 3300048903 Bacteria 10308
749 Ga0496100_0058678 3300048903 Bacteria 2526
750 Ga0496100_0125127 3300048903 Bacteria 1803
751 Ga0496100_0165938 3300048903 Bacteria 1586
752 Ga0496101_0000171 3300048904 Bacteria 53757
753 Ga0496101_0000610 3300048904 Bacteria 21834
754 Ga0496101_0081018 3300048904 Bacteria 2399
755 Ga0496102_0004728 3300048905 Bacteria 11530
756 Ga0496102_0009361 3300048905 Bacteria 8415
757 Ga0496102_0020447 3300048905 Bacteria 5848
758 Ga0496102_0040112 3300048905 Bacteria 4234
759 Ga0496102_0187482 3300048905 Bacteria 1949
760 Ga0496102_0187485 3300048905 Bacteria 1949
761 Ga0496102_0223925 3300048905 Bacteria 1773
762 Ga0496102_0373963 3300048905 Bacteria 1341
763 Ga0496103_0001994 3300048906 Bacteria 13160
764 Ga0496103_0010619 3300048906 Bacteria 5449
765 Ga0496103_0065505 3300048906 Bacteria 2266
766 Ga0496103_0091598 3300048906 Bacteria 1918
767 Ga0496104_0000067 3300048907 Bacteria 108556
768 Ga0496104_0023694 3300048907 Bacteria 5645
769 Ga0496104_0025107 3300048907 Bacteria 5491
770 Ga0496104_0050422 3300048907 Bacteria 3927
771 Ga0496104_0080460 3300048907 Bacteria 3106
772 Ga0496104_0124623 3300048907 Bacteria 2473
773 Ga0496104_0157670 3300048907 Bacteria 2178
774 Ga0496104_0189016 3300048907 Bacteria 1970
775 Ga0496104_0252142 3300048907 Bacteria 1677
776 Ga0496104_0330158 3300048907 Bacteria 1438
777 Ga0496105_0000130 3300048908 Bacteria 50576
778 Ga0496105_0003867 3300048908 Bacteria 11192
779 Ga0496105_0028937 3300048908 Bacteria 4533
780 Ga0496105_0077307 3300048908 Bacteria 2749
781 Ga0496105_0099499 3300048908 Bacteria 2401
782 Ga0496105_0176238 3300048908 Bacteria 1751
783 Ga0496106_0000581 3300048909 Bacteria 26118
784 Ga0496106_0011776 3300048909 Bacteria 6456
785 Ga0496106_0102038 3300048909 Bacteria 2225
786 Ga0496106_0213007 3300048909 Bacteria 1539
787 Ga0496107_0000224 3300048910 Bacteria 29999
788 Ga0496107_0016012 3300048910 Bacteria 5261
789 Ga0496107_0018985 3300048910 Bacteria 4848
790 Ga0496107_0116775 3300048910 Bacteria 1964
791 Ga0496107_0133634 3300048910 Bacteria 1832
792 Ga0496108_0000547 3300048911 Bacteria 29390
793 Ga0496108_0008031 3300048911 Bacteria 8567
794 Ga0496108_0244314 3300048911 Bacteria 1561
795 Ga0496108_0403707 3300048911 Bacteria 1193
796 Ga0496109_0000384 3300048912 Bacteria 40091
797 Ga0496109_0002652 3300048912 Bacteria 15006
798 Ga0496109_0165433 3300048912 Bacteria 2073
799 Ga0496109_0190437 3300048912 Bacteria 1927
800 Ga0496109_0232471 3300048912 Bacteria 1734
801 Ga0496109_0265029 3300048912 Bacteria 1618
802 Ga0496109_0270612 3300048912 Bacteria 1600
803 Ga0496109_0428417 3300048912 Bacteria 1250
804 Ga0496110_0018248 3300048913 Bacteria 5881
805 Ga0496110_0047485 3300048913 Bacteria 3760
806 Ga0496110_0060637 3300048913 Unclassified 3337
807 Ga0496110_0115026 3300048913 Bacteria 2421
808 Ga0496110_0128901 3300048913 Bacteria 2283
809 Ga0496110_0174719 3300048913 Bacteria 1949
810 Ga0496111_0101132 3300048914 Bacteria 2118
811 Ga0496111_0102457 3300048914 Bacteria 2104
812 Ga0496111_0119705 3300048914 Bacteria 1944
813 Ga0496111_0124343 3300048914 Bacteria 1906
814 Ga0496111_0435911 3300048914 Bacteria 967
815 Ga0496112_0011430 3300048915 Bacteria 8106
816 Ga0496112_0012719 3300048915 Bacteria 7738
817 Ga0496112_0015964 3300048915 Bacteria 7021
818 Ga0496112_0018912 3300048915 Bacteria 6490
819 Ga0496112_0359706 3300048915 Bacteria 1397
820 Ga0496113_0012292 3300048916 Bacteria 5749
821 Ga0496113_0098405 3300048916 Bacteria 2264
822 Ga0496113_0126156 3300048916 Bacteria 2004
823 Ga0496114_0001624 3300048917 Bacteria 17060
824 Ga0496114_0004538 3300048917 Bacteria 10780
825 Ga0496114_0031245 3300048917 Bacteria 4381
826 Ga0496115_0000826 3300048918 Bacteria 22686
827 Ga0496115_0024651 3300048918 Bacteria 4679
828 Ga0496115_0050063 3300048918 Bacteria 3345
829 Ga0496115_0092412 3300048918 Bacteria 2473
830 Ga0496115_0160495 3300048918 Bacteria 1857
831 Ga0496115_0200485 3300048918 Bacteria 1649
832 Ga0501034_0020703 3300049571 Bacteria 6716
833 Ga0501034_0049745 3300049571 Bacteria 4229
834 Ga0501039_0303957 3300049575 Bacteria 1254
835 Ga0501047_0005174 3300049581 Bacteria 12241
836 Ga0501047_0014095 3300049581 Bacteria 7597
837 Ga0501047_0037523 3300049581 Bacteria 4685
838 Ga0501068_0139429 3300049584 Bacteria 1520
839 Ga0501069_0187776 3300049585 Bacteria 1195
840 Ga0501070_0027936 3300049586 Bacteria 4733
841 Ga0501070_0204203 3300049586 Bacteria 1623
842 Ga0501071_0271679 3300049587 Bacteria 1282
843 Ga0501071_0323032 3300049587 Bacteria 1172
844 Ga0501072_0002307 3300049588 Bacteria 14289
845 Ga0501073_0025235 3300049589 Bacteria 4265
846 Ga0501074_0145785 3300049590 Bacteria 1693
847 Ga0501079_0460666 3300049741 Bacteria 999
848 Ga0501083_0025587 3300049744 Bacteria 4085
849 Ga0501035_0000859 3300049822 Bacteria 32391
850 Ga0501035_0140993 3300049822 Bacteria 2096
851 Ga0501044_0011144 3300049823 Bacteria 9752
852 Ga0501044_0109109 3300049823 Bacteria 2777
853 Ga0501044_0408709 3300049823 Bacteria 1269
854 nmdc:mga03n38_96127_c1 3300050490 Bacteria 1420
855 nmdc:mga06z11_145509_c1 3300050494 Bacteria 1343
856 nmdc:mga06z11_297221_c1 3300050494 Bacteria 959
857 nmdc:mga05p37_19235_c1 3300050507 Bacteria 8261
858 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
859 nmdc:mga0qj67_938_c1 3300050509 Bacteria 20072
860 nmdc:mga06r32_661_c1 3300050510 Bacteria 30144
861 nmdc:mga08y16_208_c1 3300050511 Bacteria 52742
862 nmdc:mga08y16_29019_c1 3300050511 Bacteria 4590
863 nmdc:mga08y16_60530_c1 3300050511 Bacteria 3955
864 nmdc:mga0n895_12771_c1 3300050512 Bacteria 7543
865 nmdc:mga0n895_169210_c1 3300050512 Bacteria 2217
866 nmdc:mga0n895_3134_c1 3300050512 Bacteria 13188
867 nmdc:mga0n895_331537_c1 3300050512 Bacteria 1542
868 nmdc:mga0n895_797_c1 3300050512 Bacteria 22514
869 nmdc:mga0rr50_4520_c1 3300050513 Bacteria 8192
870 nmdc:mga0rr50_80327_c1 3300050513 Bacteria 2514
871 nmdc:mga0rr50_91386_c1 3300050513 Bacteria 2371
872 nmdc:mga08x19_274693_c1 3300050514 Bacteria 1167
873 nmdc:mga0a205_11140_c1 3300050515 Bacteria 8275
874 nmdc:mga0a205_13983_c1 3300050515 Bacteria 7486
875 nmdc:mga0a205_2345_c1 3300050515 Bacteria 16707
876 Ga0495601_0000237 3300053077 Bacteria 29469
877 Ga0495601_0000293 3300053077 Bacteria 26739
878 Ga0495601_0003203 3300053077 Bacteria 9363
879 Ga0495601_0018736 3300053077 Bacteria 4213
880 Ga0495612_0000275 3300053078 Bacteria 21187
881 Ga0495612_0002577 3300053078 Bacteria 7477
882 Ga0495612_0003858 3300053078 Bacteria 6224
883 Ga0495612_0006876 3300053078 Bacteria 4654
884 Ga0495595_0000701 3300053084 Bacteria 12760
885 Ga0495595_0001594 3300053084 Bacteria 8856
886 Ga0495595_0002027 3300053084 Bacteria 7865
887 Ga0495595_0086064 3300053084 Bacteria 1503
888 Ga0495595_0131768 3300053084 Unclassified 1222
889 Ga0495619_0000343 3300053085 Bacteria 32522
890 Ga0495619_0000660 3300053085 Bacteria 22604
891 Ga0495619_0006775 3300053085 Bacteria 7246
892 Ga0495619_0012952 3300053085 Bacteria 5253
893 Ga0495619_0046394 3300053085 Bacteria 2856
894 Ga0500644_0001523 3300053088 Bacteria 6093
895 Ga0500641_0003967 3300053096 Bacteria 5232
896 Ga0500652_042275 3300053131 Bacteria 1838
897 Ga0500645_002132 3300053730 Bacteria 9107
898 Ga0501084_0083226 3300054114 Bacteria 2685
899 Ga0501082_0048199 3300060353 Bacteria 3672
900 Ga0501082_0344076 3300060353 Bacteria 1299
901 Ga0466962_0062558 3300061719 Bacteria 1777
902 Ga0207681_10342389
903 2214736889
904 ARSoilYngRDRAFT_c00112
905 ARcpr5yngRDRAFT_c000099
906 ARSoilOldRDRAFT_c000057
907 ARCol0oldRDRAFT_c00030
908 ARCol0yngRDRAFT_1000002
909 JGI24746J21847_1001839
910 JGI24747J21853_1003188
911 JGI24739J22299_10001524
912 JGI24737J22298_10002379
913 JGI24737J22298_10008384
914 JGI24750J21931_1000794
915 JGI24745J21846_1000127
916 JGI24738J21930_10000067
917 JGI24749J21850_1000340
918 JGI24744J21845_10006801
919 JGI24742J22300_10002047
920 JGI24751J29686_10005863
921 Ga0065717_1002506
922 Ga0065716_1001523
923 Ga0065704_10073824
924 Ga0065712_10000677
925 Ga0065712_10001663
926 Ga0065715_10004205
927 Ga0065715_10089460
928 Ga0070658_10001079
929 Ga0070658_10014490
930 Ga0070676_10000332
931 Ga0070683_100004171
932 Ga0070683_100059710
933 Ga0070683_100172655
934 Ga0070690_100002091
935 Ga0070690_100004635
936 Ga0070670_100072626
937 Ga0070670_100081360
938 Ga0070677_10000258
939 Ga0068869_100000510
940 Ga0068869_100148482
941 Ga0070666_10004570
942 Ga0070666_10327083
943 Ga0070680_100001476
944 Ga0070680_100012038
945 Ga0070680_100018732
946 Ga0070680_100052973
947 Ga0070680_100059311
948 Ga0070680_100237010
949 Ga0070682_100003255
950 Ga0070682_100208161
951 Ga0070682_100343969
952 Ga0070682_100344801
953 Ga0068868_100000148
954 Ga0068868_100233511
955 Ga0070660_100001314
956 Ga0070660_100052383
957 Ga0070660_100118376
958 Ga0070689_100003363
959 Ga0070689_100009190
960 Ga0070689_100027599
961 Ga0070689_100207091
962 Ga0070691_10001528
963 Ga0070691_10018465
964 Ga0070691_10061486
965 Ga0070687_100000318
966 Ga0070687_100146049
967 Ga0070661_100000768
968 Ga0070661_100127742
969 Ga0070692_10000347
970 Ga0070692_10012428
971 Ga0070668_100004879
972 Ga0070668_100013661
973 Ga0070668_100052404
974 Ga0070669_100003445
975 Ga0070669_100016339
976 Ga0070675_100001491
977 Ga0070675_100065209
978 Ga0070671_100003997
979 Ga0070671_100084859
980 Ga0070671_100154987
981 Ga0070671_100292504
982 Ga0070671_100415033
983 Ga0070674_100001355
984 Ga0070674_100197893
985 Ga0070673_100000670
986 Ga0070673_100024615
987 Ga0070673_100031738
988 Ga0070673_100036546
989 Ga0070673_100322502
990 Ga0070688_100001144
991 Ga0070688_100065435
992 Ga0070688_100210521
993 Ga0070659_100001400
994 Ga0070659_100164843
995 Ga0070667_100002340
996 Ga0070667_100009705
997 Ga0070667_100120377
998 Ga0070667_100157440
999 Ga0070667_100320683
1000 Ga0070703_10015511
1001 Ga0070709_10034062
1002 Ga0070714_100015272
1003 Ga0070714_100116764
1004 Ga0070713_100000838
1005 Ga0070710_10021271
1006 Ga0070710_10037732
1007 Ga0070710_10060067
1008 Ga0070701_10000066
1009 Ga0070701_10031475
1010 Ga0070711_100010309
1011 Ga0070711_100120995
1012 Ga0070711_100218055
1013 Ga0070711_100343361
1014 Ga0070705_100001500
1015 Ga0070705_100076919
1016 Ga0070700_100001568
1017 Ga0070700_100174838
1018 Ga0070700_100200606
1019 Ga0070694_100002175
1020 Ga0070694_100008394
1021 Ga0070708_100021510
1022 Ga0070708_100146688
1023 Ga0070663_100001857
1024 Ga0070663_100281834
1025 Ga0070678_100000391
1026 Ga0070678_100025652
1027 Ga0070678_100069453
1028 Ga0070662_100001285
1029 Ga0070662_100073731
1030 Ga0070681_10002720
1031 Ga0070681_10016797
1032 Ga0070681_10081723
1033 Ga0070681_10207236
1034 Ga0068867_100001688
1035 Ga0068867_100032643
1036 Ga0070685_10000496
1037 Ga0070685_10010561
1038 Ga0070679_100007687
1039 Ga0070679_100048889
1040 Ga0070679_100101875
1041 Ga0070679_100254502
1042 Ga0070684_100000101
1043 Ga0070684_100020653
1044 Ga0070684_100287676
1045 Ga0068853_100005490
1046 Ga0068853_100193278
1047 Ga0070672_100000016
1048 Ga0070672_100039509
1049 Ga0070672_100042518
1050 Ga0070686_100002195
1051 Ga0070686_100026174
1052 Ga0070686_100096472
1053 Ga0070695_100000225
1054 Ga0070695_100005011
1055 Ga0070696_100002898
1056 Ga0070696_100010256
1057 Ga0070693_100000138
1058 Ga0070693_100055005
1059 Ga0070693_100116771
1060 Ga0070665_100009456
1061 Ga0070665_100044585
1062 Ga0070665_100212479
1063 Ga0070665_100789659
1064 Ga0070704_100003148
1065 Ga0070704_100027532
1066 Ga0070704_100200936
1067 Ga0068855_100008651
1068 Ga0068855_100018870
1069 Ga0068855_100032667
1070 Ga0068855_100079966
1071 Ga0068855_100197592
1072 Ga0070664_100000067
1073 Ga0070664_100022080
1074 Ga0070664_100034890
1075 Ga0070664_100038096
1076 Ga0068857_100000275
1077 Ga0068857_100060516
1078 Ga0068854_100002271
1079 Ga0068854_100395576
1080 Ga0068856_100001016
1081 Ga0068856_100103150
1082 Ga0068856_100235161
1083 Ga0068856_100460215
1084 Ga0068856_100486022
1085 Ga0068856_100575853
1086 Ga0068856_100973681
1087 Ga0070702_100000175
1088 Ga0068852_100000611
1089 Ga0068852_100139477
1090 Ga0068852_100185344
1091 Ga0068852_100233343
1092 Ga0068852_100263402
1093 Ga0068852_100279190
1094 Ga0068859_100002948
1095 Ga0068864_100000234
1096 Ga0068864_100381709
1097 Ga0068864_100726187
1098 Ga0068866_10002176
1099 Ga0068861_100000317
1100 Ga0068861_100030808
1101 Ga0068870_10000009
1102 Ga0068863_100001729
1103 Ga0068863_100296329
1104 Ga0068858_100001059
1105 Ga0068858_100046203
1106 Ga0068858_100083371
1107 Ga0068858_100128294
1108 Ga0068858_100349923
1109 Ga0068860_100003167
1110 Ga0068860_100131881
1111 Ga0068860_100147282
1112 Ga0068862_100030207
1113 Ga0081455_10008146
1114 Ga0081540_1000374
1115 Ga0070717_10025214
1116 Ga0070717_10066122
1117 Ga0070717_10096851
1118 Ga0075432_10002492
1119 Ga0070715_10055615
1120 Ga0070715_10110172
1121 Ga0070716_100040093
1122 Ga0070712_100068122
1123 Ga0070712_100201467
1124 Ga0070712_100263293
1125 Ga0075367_10104289
1126 Ga0075367_10149404
1127 Ga0097621_100010706
1128 Ga0097621_100076109
1129 Ga0097621_100468937
1130 Ga0068871_100000012
1131 Ga0075430_100008278
1132 Ga0075433_10000072
1133 Ga0075433_10057417
1134 Ga0075434_100000756
1135 Ga0075434_100001819
1136 Ga0075434_100111340
1137 Ga0075434_100148836
1138 Ga0075434_100329671
1139 Ga0075429_100001133
1140 Ga0068865_100000355
1141 Ga0075436_100072071
1142 Ga0097620_100002948
1143 Ga0075435_100167022
1144 Ga0099794_10005086
1145 Ga0105251_10036599
1146 Ga0105240_10035122
1147 Ga0111539_10001688
1148 Ga0111539_10002781
1149 Ga0111539_10005411
1150 Ga0111539_10060689
1151 Ga0111539_10182139
1152 Ga0111539_10344488
1153 Ga0105245_10000409
1154 Ga0105245_10019441
1155 Ga0105247_10004080
1156 Ga0105247_10018620
1157 Ga0105247_10045268
1158 Ga0105247_10319810
1159 Ga0114129_10003162
1160 Ga0114129_10026034
1161 Ga0105243_10004202
1162 Ga0105243_10005740
1163 Ga0105241_10000053
1164 Ga0105241_10021735
1165 Ga0105241_10101496
1166 Ga0105241_10133544
1167 Ga0105241_10190110
1168 Ga0105242_10001586
1169 Ga0105242_10104613
1170 Ga0105242_10106125
1171 Ga0105248_10000309
1172 Ga0105248_10005691
1173 Ga0105248_10009701
1174 Ga0105248_10156233
1175 Ga0105248_10363371
1176 Ga0105248_10441280
1177 Ga0105237_10005630
1178 Ga0105237_10015365
1179 Ga0105238_10162248
1180 Ga0105238_10638600
1181 Ga0105249_10003451
1182 Ga0105249_10058537
1183 Ga0105249_10151551
1184 Ga0105239_10007939
1185 Ga0105239_10029753
1186 Ga0105239_10379007
1187 Ga0105246_10002040
1188 Ga0157329_1000662
1189 Ga0157338_1005577
1190 Ga0157373_10012578
1191 Ga0157371_10006362
1192 Ga0157371_10066724
1193 Ga0157370_10054295
1194 Ga0157369_10359452
1195 Ga0157374_10000452
1196 Ga0157374_10054238
1197 Ga0157374_10185048
1198 Ga0157378_10006920
1199 Ga0163162_10000796
1200 Ga0163162_10012138
1201 Ga0163162_10055472
1202 Ga0157372_10008710
1203 Ga0157372_10175622
1204 Ga0157372_10365119
1205 Ga0157375_10004563
1206 Ga0157375_10022988
1207 Ga0157375_10143331
1208 Ga0157375_10491475
1209 Ga0163163_10001104
1210 Ga0163163_10011726
1211 Ga0163163_10144094
1212 Ga0157380_10017908
1213 Ga0157377_10000538
1214 Ga0157379_10009254
1215 Ga0157379_10094730
1216 Ga0157379_10258962
1217 Ga0157376_10002295
1218 Ga0157376_10141931
1219 Ga0157376_10276156
1220 Ga0157376_10650290
1221 Ga0163161_10000499
1222 Ga0206353_10474572
1223 Ga0207666_1000313
1224 Ga0207666_1001193
1225 Ga0207697_10000252
1226 Ga0207653_10001924
1227 Ga0207653_10027745
1228 Ga0207682_10000029
1229 Ga0207692_10002625
1230 Ga0207692_10004448
1231 Ga0207692_10062536
1232 Ga0207692_10068998
1233 Ga0207642_10000713
1234 Ga0207710_10032756
1235 Ga0207710_10060468
1236 Ga0207710_10067238
1237 Ga0207688_10000020
1238 Ga0207680_10001555
1239 Ga0207680_10303050
1240 Ga0207647_10004457
1241 Ga0207647_10004529
1242 Ga0207685_10014773
1243 Ga0207699_10019161
1244 Ga0207699_10047171
1245 Ga0207645_10000108
1246 Ga0207645_10215252
1247 Ga0207643_10000044
1248 Ga0207705_10015497
1249 Ga0207705_10019507
1250 Ga0207654_10000143
1251 Ga0207654_10123379
1252 Ga0207654_10197266
1253 Ga0207707_10002475
1254 Ga0207707_10030589
1255 Ga0207707_10054545
1256 Ga0207707_10157482
1257 Ga0207707_10204552
1258 Ga0207707_10378188
1259 Ga0207671_10009506
1260 Ga0207693_10000831
1261 Ga0207693_10005608
1262 Ga0207693_10067898
1263 Ga0207693_10153627
1264 Ga0207693_10191504
1265 Ga0207663_10027032
1266 Ga0207663_10324202
1267 Ga0207660_10000543
1268 Ga0207660_10031238
1269 Ga0207660_10034606
1270 Ga0207660_10077574
1271 Ga0207660_10397105
1272 Ga0207660_10402371
1273 Ga0207662_10000104
1274 Ga0207662_10009837
1275 Ga0207662_10158113
1276 Ga0207657_10001453
1277 Ga0207657_10004676
1278 Ga0207657_10020064
1279 Ga0207657_10068005
1280 Ga0207649_10000057
1281 Ga0207652_10000916
1282 Ga0207652_10006960
1283 Ga0207652_10087443
1284 Ga0207652_10168332
1285 Ga0207652_10312748
1286 Ga0207681_10001187
1287 Ga0207650_10001534
1288 Ga0207650_10023478
1289 Ga0207650_10140424
1290 Ga0207659_10000028
1291 Ga0207659_10019591
1292 Ga0207659_10155742
1293 Ga0207687_10000061
1294 Ga0207687_10046599
1295 Ga0207687_10143690
1296 Ga0207700_10078743
1297 Ga0207700_10192552
1298 Ga0207664_10095859
1299 Ga0207644_10000194
1300 Ga0207644_10007311
1301 Ga0207644_10029098
1302 Ga0207644_10077254
1303 Ga0207690_10000225
1304 Ga0207706_10001293
1305 Ga0207706_10010554
1306 Ga0207706_10088706
1307 Ga0207686_10000530
1308 Ga0207686_10025146
1309 Ga0207709_10000291
1310 Ga0207709_10082888
1311 Ga0207670_10000434
1312 Ga0207670_10047843
1313 Ga0207670_10204360
1314 Ga0207669_10000019
1315 Ga0207669_10154652
1316 Ga0207669_10271354
1317 Ga0207704_10000438
1318 Ga0207665_10001157
1319 Ga0207691_10001047
1320 Ga0207691_10042370
1321 Ga0207691_10043271
1322 Ga0207691_10091890
1323 Ga0207711_10007089
1324 Ga0207711_10008817
1325 Ga0207711_10491374
1326 Ga0207689_10001160
1327 Ga0207689_10096196
1328 Ga0207661_10000126
1329 Ga0207661_10312350
1330 Ga0207679_10000026
1331 Ga0207679_10030446
1332 Ga0207679_10119600
1333 Ga0207679_10555968
1334 Ga0207667_10016786
1335 Ga0207667_10022484
1336 Ga0207667_10029280
1337 Ga0207667_10299030
1338 Ga0207651_10001232
1339 Ga0207651_10085430
1340 Ga0207651_10123202
1341 Ga0207651_10130302
1342 Ga0207712_10002654
1343 Ga0207712_10018907
1344 Ga0207668_10000049
1345 Ga0207668_10163464
1346 Ga0207640_10004275
1347 Ga0207658_10001093
1348 Ga0207658_10037209
1349 Ga0207658_10130831
1350 Ga0207658_10283800
1351 Ga0207658_10340989
1352 Ga0207658_10600720
1353 Ga0207677_10000229
1354 Ga0207677_10049748
1355 Ga0207677_10083255
1356 Ga0207703_10000780
1357 Ga0207703_10016660
1358 Ga0207703_10054060
1359 Ga0207703_10069167
1360 Ga0207703_10071010
1361 Ga0207639_10002735
1362 Ga0207639_10041347
1363 Ga0207639_10067384
1364 Ga0207678_10000403
1365 Ga0207678_10040152
1366 Ga0207708_10000669
1367 Ga0207708_10005479
1368 Ga0207708_10229896
1369 Ga0207708_10244491
1370 Ga0207702_10006536
1371 Ga0207702_10143680
1372 Ga0207702_10156396
1373 Ga0207702_10181108
1374 Ga0207702_10189336
1375 Ga0207702_10195395
1376 Ga0207702_10826128
1377 Ga0207641_10000542
1378 Ga0207641_10318386
1379 Ga0207641_10629406
1380 Ga0207648_10001244
1381 Ga0207648_10017537
1382 Ga0207676_10000672
1383 Ga0207676_10035605
1384 Ga0207676_10367384
1385 Ga0207674_10001968
1386 Ga0207675_100001274
1387 Ga0207675_100056051
1388 Ga0207683_10000034
1389 Ga0207683_10000880
1390 Ga0207683_10019963
1391 Ga0207698_10001780
1392 Ga0207698_10164946
1393 Ga0207698_10190227
1394 Ga0207698_10204016
1395 Ga0209996_1003302
1396 Ga0210002_1000151
1397 Ga0209588_1034985
1398 Ga0209971_1038720
1399 Ga0209966_1001368
1400 Ga0209966_1002416
1401 Ga0209998_10000830
1402 Ga0209998_10000899
1403 Ga0207428_10000082
1404 Ga0207428_10000130
1405 Ga0207428_10000701
1406 Ga0268266_10010845
1407 Ga0268266_10066865
1408 Ga0268266_10237921
1409 Ga0268265_10000410
1410 Ga0268265_10008133
1411 Ga0268264_10001567
1412 Ga0268264_10164771
1413 Ga0265336_10029893
1414 Ga0265338_10012066
1415 Ga0265338_10219689
1416 Ga0265325_10056250
1417 Ga0265340_10096387
1418 Ga0265339_10021871
1419 Ga0265339_10059070
1420 Ga0265339_10190761
1421 Ga0265339_10198739
1422 Ga0265316_10308415
1423 Ga0265313_10007635
1424 Ga0265313_10020128
1425 Ga0265313_10021404
1426 Ga0265313_10022693
1427 Ga0265314_10005096
1428 Ga0265314_10185576
1429 Ga0265342_10000912
1430 Ga0265342_10157545
1431 Ga0316583_10000300
1432 Ga0373930_0000948
1433 Ga0373930_0009551
1434 Ga0373930_0036029
1435 Ga0373948_0000060
1436 Ga0373950_0000151
1437 Ga0373958_0000640
1438 Ga0373958_0001109
1439 Ga0373959_0003990
1440 Ga0373938_0000265
1441 Ga0373938_0000851
1442 Ga0373928_0002719
1443 Ga0373928_0047247
1444 Ga0373929_0006649
1445 Ga0373940_0001617
1446 Ga0373940_0005020
1447 Ga0373944_0040298
1448 Ga0373949_0001017
1449 Ga0373949_0001292
1450 Ga0373951_0001079
1451 Ga0373951_0006738
1452 Ga0373952_0000144
1453 Ga0373952_0003531
1454 Ga0373952_0003549
1455 Ga0373952_0030830
1456 Ga0373932_0001474
1457 Ga0373932_0002399
1458 Ga0373932_0003771
1459 Ga0373939_0000633
1460 Ga0373939_0000683
1461 Ga0373939_0001140
1462 Ga0373941_0000506
1463 Ga0373941_0000613
1464 Ga0373941_0004805
1465 Ga0373941_0011897
1466 Ga0373941_0042292
1467 Ga0373945_0002918
1468 Ga0373953_0009947
1469 Ga0373954_0002508
1470 Ga0373954_0005440
1471 Ga0373956_0024480
1472 Ga0373957_0001422
1473 Ga0373957_0002239
1474 Ga0373957_0079124
1475 Ga0373960_0000369
1476 Ga0373960_0006235
1477 Ga0373960_0007623
1478 Ga0373943_0011614
1479 Ga0373946_0004728
1480 Ga0373946_0014660
1481 Ga0373955_0000744
1482 Ga0373955_0002809
1483 Ga0373955_0045720
1484 Ga0373942_0000425
1485 Ga0373942_0001723
1486 Ga0373942_0007645
1487 Ga0373942_0029590
1488 Ga0373961_0001150
1489 Ga0373961_0001699
1490 Ga0373961_0006662
1491 Ga0373961_0026069
1492 Ga0373962_0000209
1493 Ga0373962_0000258
1494 Ga0373962_0003978
1495 Ga0373962_0022289
1496 Ga0373924_0011954
1497 Ga0373924_0025618
1498 Ga0373931_0001019
1499 Ga0373931_0020943
1500 Ga0373931_0022983
1501 Ga0373931_0169813
1502 Ga0373927_0079590
1503 Ga0373933_0000842
1504 Ga0373933_0016370
1505 Ga0373933_0037328
1506 Ga0373933_0115928
1507 Ga0373947_0001071
1508 Ga0373947_0074885
1509 Ga0373947_0322951
1510 Ga0373937_0002444
1511 Ga0373937_0004304
1512 Ga0373937_0186711
1513 Ga0316582_0070685
1514 Ga0373925_0020933
1515 Ga0373925_0058812
1516 Ga0373925_0086417
1517 Ga0373925_0190429
1518 Ga0395900_0005590
1519 Ga0395900_0582933
1520 Ga0395898_0003040
1521 Ga0439450_017390
1522 Ga0439455_0014150
1523 Ga0439463_019888
1524 Ga0451577_0195565
1525 Ga0439440_0064746
1526 Ga0466963_0136357
1527 Ga0453684_0219997
1528 Ga0451576_0013835
1529 Ga0466958_0041961
1530 Ga0466967_0038326
1531 Ga0466967_0272755
1532 Ga0495592_0012089
1533 Ga0495592_0024911
1534 Ga0495592_0136335
1535 Ga0495603_0003522
1536 Ga0495603_0133959
1537 Ga0495629_0000527
1538 Ga0495629_0160533
1539 Ga0495629_0254586
1540 Ga0495641_0029112
1541 Ga0495641_0033030
1542 Ga0495641_0042184
1543 Ga0495651_0000908
1544 Ga0495651_0003856
1545 Ga0495651_0013633
1546 Ga0495653_0000912
1547 Ga0495653_0052486
1548 Ga0495653_0067885
1549 Ga0495580_0052811
1550 Ga0495580_0057151
1551 Ga0495582_0012645
1552 Ga0495582_0015881
1553 Ga0495582_0203261
1554 Ga0495639_0085854
1555 Ga0495662_0018163
1556 Ga0495662_0245232
1557 Ga0495664_0016385
1558 Ga0495664_0126183
1559 Ga0495584_0066615
1560 Ga0495594_0026475
1561 Ga0495608_0008704
1562 Ga0495608_0044974
1563 Ga0495618_0003244
1564 Ga0495618_0077276
1565 Ga0495618_0124343
1566 Ga0495628_0009709
1567 Ga0495628_0011083
1568 Ga0495628_0029193
1569 Ga0495630_0101055
1570 Ga0495630_0195665
1571 Ga0495630_0244310
1572 Ga0495637_0043852
1573 Ga0495644_0003683
1574 Ga0495663_0053003
1575 Ga0495652_0011801
1576 Ga0495652_0042003
1577 Ga0495652_0059568
1578 Ga0495652_0205523
1579 Ga0495665_0032193
1580 Ga0495640_0003572
1581 Ga0495640_0150259
1582 Ga0495586_0128107
1583 Ga0495587_0002348
1584 Ga0495587_0004743
1585 Ga0495587_0111571
1586 Ga0495587_0256213
1587 Ga0495598_0009095
1588 Ga0495645_0001151
1589 Ga0495645_0010788
1590 Ga0495645_0198839
1591 Ga0495622_0033447
1592 Ga0495633_0006733
1593 Ga0495667_0000212
1594 Ga0495667_0030318
1595 Ga0495667_0059372
1596 Ga0495656_0004302
1597 Ga0495634_0036763
1598 Ga0495634_0126160
1599 Ga0495634_0240904
1600 Ga0495611_0005176
1601 Ga0495635_0057614
1602 Ga0495635_0067169
1603 Ga0495635_0243707
1604 Ga0495588_0041161
1605 Ga0495588_0067080
1606 Ga0495657_0003573
1607 Ga0495599_0006187
1608 Ga0495599_0093387
1609 Ga0495599_0153442
1610 Ga0495623_0000188
1611 Ga0495623_0007794
1612 Ga0495646_0002814
1613 Ga0495646_0028716
1614 Ga0495647_0008172
1615 Ga0495647_0037390
1616 Ga0495658_0001507
1617 Ga0495658_0012622
1618 Ga0495658_0034456
1619 Ga0495658_0052177
1620 Ga0495613_0013123
1621 Ga0495624_0008197
1622 Ga0495670_0000704
1623 Ga0495600_0004951
1624 Ga0495600_0005049
1625 Ga0495600_0075044
1626 Ga0495581_0032257
1627 Ga0495581_0195420
1628 Ga0495604_0008689
1629 Ga0495604_0016801
1630 Ga0495604_0066408
1631 Ga0495674_0024741
1632 Ga0495674_0030841
1633 Ga0495674_0120459
1634 Ga0495674_0303533
1635 Ga0495676_0008228
1636 Ga0495680_0005676
1637 Ga0495680_0006175
1638 Ga0495680_0010622
1639 Ga0495680_0011028
1640 Ga0495680_0012117
1641 Ga0495675_0008455
1642 Ga0495684_0003722
1643 Ga0495684_0044462
1644 Ga0495593_0040959
1645 Ga0495602_0002562
1646 Ga0495602_0008079
1647 Ga0495602_0164146
1648 Ga0495614_0100536
1649 Ga0496100_0001962
1650 Ga0496100_0058678
1651 Ga0496100_0125127
1652 Ga0496100_0165938
1653 Ga0496101_0000171
1654 Ga0496101_0000610
1655 Ga0496101_0081018
1656 Ga0496102_0004728
1657 Ga0496102_0009361
1658 Ga0496102_0020447
1659 Ga0496102_0040112
1660 Ga0496102_0187482
1661 Ga0496102_0187485
1662 Ga0496102_0223925
1663 Ga0496102_0373963
1664 Ga0496103_0001994
1665 Ga0496103_0010619
1666 Ga0496103_0065505
1667 Ga0496103_0091598
1668 Ga0496104_0000067
1669 Ga0496104_0023694
1670 Ga0496104_0025107
1671 Ga0496104_0050422
1672 Ga0496104_0080460
1673 Ga0496104_0124623
1674 Ga0496104_0157670
1675 Ga0496104_0189016
1676 Ga0496104_0252142
1677 Ga0496104_0330158
1678 Ga0496105_0000130
1679 Ga0496105_0003867
1680 Ga0496105_0028937
1681 Ga0496105_0077307
1682 Ga0496105_0099499
1683 Ga0496105_0176238
1684 Ga0496106_0000581
1685 Ga0496106_0011776
1686 Ga0496106_0102038
1687 Ga0496106_0213007
1688 Ga0496107_0000224
1689 Ga0496107_0016012
1690 Ga0496107_0018985
1691 Ga0496107_0116775
1692 Ga0496107_0133634
1693 Ga0496108_0000547
1694 Ga0496108_0008031
1695 Ga0496108_0244314
1696 Ga0496108_0403707
1697 Ga0496109_0000384
1698 Ga0496109_0002652
1699 Ga0496109_0165433
1700 Ga0496109_0190437
1701 Ga0496109_0232471
1702 Ga0496109_0265029
1703 Ga0496109_0270612
1704 Ga0496109_0428417
1705 Ga0496110_0018248
1706 Ga0496110_0047485
1707 Ga0496110_0060637
1708 Ga0496110_0115026
1709 Ga0496110_0128901
1710 Ga0496110_0174719
1711 Ga0496111_0101132
1712 Ga0496111_0102457
1713 Ga0496111_0119705
1714 Ga0496111_0124343
1715 Ga0496111_0435911
1716 Ga0496112_0011430
1717 Ga0496112_0012719
1718 Ga0496112_0015964
1719 Ga0496112_0018912
1720 Ga0496112_0359706
1721 Ga0496113_0012292
1722 Ga0496113_0098405
1723 Ga0496113_0126156
1724 Ga0496114_0001624
1725 Ga0496114_0004538
1726 Ga0496114_0031245
1727 Ga0496115_0000826
1728 Ga0496115_0024651
1729 Ga0496115_0050063
1730 Ga0496115_0092412
1731 Ga0496115_0160495
1732 Ga0496115_0200485
1733 Ga0501034_0020703
1734 Ga0501034_0049745
1735 Ga0501039_0303957
1736 Ga0501047_0005174
1737 Ga0501047_0014095
1738 Ga0501047_0037523
1739 Ga0501068_0139429
1740 Ga0501069_0187776
1741 Ga0501070_0027936
1742 Ga0501070_0204203
1743 Ga0501071_0271679
1744 Ga0501071_0323032
1745 Ga0501072_0002307
1746 Ga0501073_0025235
1747 Ga0501074_0145785
1748 Ga0501079_0460666
1749 Ga0501083_0025587
1750 Ga0501035_0000859
1751 Ga0501035_0140993
1752 Ga0501044_0011144
1753 Ga0501044_0109109
1754 Ga0501044_0408709
1755 nmdc:mga03n38_96127_c1
1756 nmdc:mga06z11_145509_c1
1757 nmdc:mga06z11_297221_c1
1758 nmdc:mga05p37_19235_c1
1759 nmdc:mga05p37_19_c2
1760 nmdc:mga0qj67_938_c1
1761 nmdc:mga06r32_661_c1
1762 nmdc:mga08y16_208_c1
1763 nmdc:mga08y16_29019_c1
1764 nmdc:mga08y16_60530_c1
1765 nmdc:mga0n895_12771_c1
1766 nmdc:mga0n895_169210_c1
1767 nmdc:mga0n895_3134_c1
1768 nmdc:mga0n895_331537_c1
1769 nmdc:mga0n895_797_c1
1770 nmdc:mga0rr50_4520_c1
1771 nmdc:mga0rr50_80327_c1
1772 nmdc:mga0rr50_91386_c1
1773 nmdc:mga08x19_274693_c1
1774 nmdc:mga0a205_11140_c1
1775 nmdc:mga0a205_13983_c1
1776 nmdc:mga0a205_2345_c1
1777 Ga0495601_0000237
1778 Ga0495601_0000293
1779 Ga0495601_0003203
1780 Ga0495601_0018736
1781 Ga0495612_0000275
1782 Ga0495612_0002577
1783 Ga0495612_0003858
1784 Ga0495612_0006876
1785 Ga0495595_0000701
1786 Ga0495595_0001594
1787 Ga0495595_0002027
1788 Ga0495595_0086064
1789 Ga0495595_0131768
1790 Ga0495619_0000343
1791 Ga0495619_0000660
1792 Ga0495619_0006775
1793 Ga0495619_0012952
1794 Ga0495619_0046394
1795 Ga0500644_0001523
1796 Ga0500641_0003967
1797 Ga0500652_042275
1798 Ga0500645_002132
1799 Ga0501084_0083226
1800 Ga0501082_0048199
1801 Ga0501082_0344076
1802 Ga0466962_0062558

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

199

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

210

0.94

PF08659

KR

KR domain

7

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bcj-assembly2.cif.gz_D crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with nadp+ 0.9083 5 230
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9073 5 242
4j2h-assembly1.cif.gz_A crystal structure of a putative short-chain alcohol dehydrogenase from sinorhizobium meliloti 1021 (target nysgrc-011708) 0.9052 3 189
2et6-assembly1.cif.gz_A (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 0.9017 3 184
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.896 2 246
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 9 52 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9351 4 248 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9243 5 194 3.40.50.720
af_Q8SX47_51_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.92 8 228 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9157 91 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0D7ED22-F1-model_v4 Short-chain dehydrogenase 0.9723 5 169 GO:0016491
AF-A0A6N7GVM3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9645 1 260 GO:0016020
GO:0016491
AF-A0A1Q7B6N6-F1-model_v4 Short-chain dehydrogenase 0.9636 1 259 GO:0016020
GO:0016491
AF-A0A2U1SFY3-F1-model_v4 deleted 0.9613 4 256
AF-A0A3B8YUV5-F1-model_v4 Short-chain dehydrogenase 0.9579 5 256 GO:0016020
GO:0016491

Map