F485169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 376 | 881 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100283605|Ga0075436_1002836052 |
| Length | 266 |
| Sequence | VAITDPLAATSPASGESFSTVRAARFAEVLRGSRSPLSGSAGTIGGMEHTKLSRADASAAVTRLGWRYVLGEFRTEVLTGSLPLAADVAARAAAVPDVEGHLRMDIRADRLLLSLQTAEQSWVTTHDAELARQLSALTQEFRLTTQPGDRTVQVLELGIDALDIAKIRPFWKAALGYTDEPEGGHGLIDPLGQGPAVWFQQMDAPRPQRNRIHVDVSVPHDEAPLRIEATLAAGGTVQSDAEAPAFWVLADPEGNEACITTWQGRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 3 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 4 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 5 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 6 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 7 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 8 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 9 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 10 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 11 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 12 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 13 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 14 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 15 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 16 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 17 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 18 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 19 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 256 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 259 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 260 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 371 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 373 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.78 |
| Metatranscriptomes | 0 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.55 |
| Nodule | 0 |
| Rhizoplane | 9.77 |
| Rhizosphere | 84.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10039823 | 3300001979 | Bacteria | 1430 |
| 2 | JGI24744J21845_10000985 | 3300002077 | Bacteria | 5442 |
| 3 | JGI24744J21845_10024362 | 3300002077 | Bacteria | 1183 |
| 4 | rootL2_10144810 | 3300003322 | Bacteria | 1506 |
| 5 | JGI25404J52841_10003701 | 3300003659 | Bacteria | 3041 |
| 6 | Ga0070658_10153054 | 3300005327 | Bacteria | 1932 |
| 7 | Ga0070676_10104642 | 3300005328 | Bacteria | 1754 |
| 8 | Ga0070683_100338401 | 3300005329 | Bacteria | 1433 |
| 9 | Ga0070690_100026670 | 3300005330 | Bacteria | 3566 |
| 10 | Ga0070690_100292530 | 3300005330 | Bacteria | 1165 |
| 11 | Ga0068869_100037649 | 3300005334 | Bacteria | 3441 |
| 12 | Ga0070666_10047828 | 3300005335 | Bacteria | 2873 |
| 13 | Ga0070680_100079057 | 3300005336 | Bacteria | 2710 |
| 14 | Ga0070682_100031720 | 3300005337 | Bacteria | 3197 |
| 15 | Ga0070682_100092035 | 3300005337 | Bacteria | 1986 |
| 16 | Ga0070682_100122226 | 3300005337 | Bacteria | 1750 |
| 17 | Ga0068868_100000265 | 3300005338 | Bacteria | 35343 |
| 18 | Ga0068868_100088550 | 3300005338 | Bacteria | 2491 |
| 19 | Ga0070689_100030411 | 3300005340 | Bacteria | 4099 |
| 20 | Ga0070689_100164351 | 3300005340 | Bacteria | 1796 |
| 21 | Ga0070691_10005965 | 3300005341 | Bacteria | 5559 |
| 22 | Ga0070691_10050323 | 3300005341 | Bacteria | 1987 |
| 23 | Ga0070687_100054420 | 3300005343 | Bacteria | 2085 |
| 24 | Ga0070661_100008632 | 3300005344 | Bacteria | 7048 |
| 25 | Ga0070668_100000455 | 3300005347 | Bacteria | 27040 |
| 26 | Ga0070668_100023364 | 3300005347 | Bacteria | 4676 |
| 27 | Ga0070668_100146899 | 3300005347 | Bacteria | 1904 |
| 28 | Ga0070669_100020736 | 3300005353 | Bacteria | 4695 |
| 29 | Ga0070675_100390671 | 3300005354 | Bacteria | 1240 |
| 30 | Ga0070671_100115862 | 3300005355 | Bacteria | 2253 |
| 31 | Ga0070671_100396090 | 3300005355 | Bacteria | 1181 |
| 32 | Ga0070674_100000174 | 3300005356 | Bacteria | 30012 |
| 33 | Ga0070674_100006521 | 3300005356 | Bacteria | 6817 |
| 34 | Ga0070674_100125559 | 3300005356 | Bacteria | 1905 |
| 35 | Ga0070673_100196242 | 3300005364 | Bacteria | 1736 |
| 36 | Ga0070673_100230127 | 3300005364 | Bacteria | 1608 |
| 37 | Ga0070688_100016229 | 3300005365 | Bacteria | 4253 |
| 38 | Ga0070659_100032427 | 3300005366 | Bacteria | 4051 |
| 39 | Ga0070667_100000598 | 3300005367 | Bacteria | 35201 |
| 40 | Ga0070667_100166430 | 3300005367 | Bacteria | 1945 |
| 41 | Ga0070667_100202056 | 3300005367 | Bacteria | 1764 |
| 42 | Ga0070667_101046919 | 3300005367 | Bacteria | 762 |
| 43 | Ga0070709_10016737 | 3300005434 | Bacteria | 4192 |
| 44 | Ga0070709_10085613 | 3300005434 | Bacteria | 2067 |
| 45 | Ga0070709_10170988 | 3300005434 | Bacteria | 1518 |
| 46 | Ga0070714_100010112 | 3300005435 | Bacteria | 7447 |
| 47 | Ga0070714_100010407 | 3300005435 | Bacteria | 7351 |
| 48 | Ga0070714_100076583 | 3300005435 | Bacteria | 2904 |
| 49 | Ga0070714_100100783 | 3300005435 | Bacteria | 2544 |
| 50 | Ga0070714_100240558 | 3300005435 | Bacteria | 1670 |
| 51 | Ga0070714_100309929 | 3300005435 | Bacteria | 1473 |
| 52 | Ga0070714_100496691 | 3300005435 | Bacteria | 1163 |
| 53 | Ga0070714_101065675 | 3300005435 | Bacteria | 787 |
| 54 | Ga0070714_101136655 | 3300005435 | Bacteria | 761 |
| 55 | Ga0070713_100443351 | 3300005436 | Bacteria | 1218 |
| 56 | Ga0070710_10001110 | 3300005437 | Bacteria | 12721 |
| 57 | Ga0070710_10020610 | 3300005437 | Bacteria | 3423 |
| 58 | Ga0070710_10028063 | 3300005437 | Bacteria | 3007 |
| 59 | Ga0070701_10001050 | 3300005438 | Bacteria | 10078 |
| 60 | Ga0070701_10094086 | 3300005438 | Bacteria | 1648 |
| 61 | Ga0070711_100001452 | 3300005439 | Bacteria | 13023 |
| 62 | Ga0070711_100009619 | 3300005439 | Bacteria | 5956 |
| 63 | Ga0070711_100122108 | 3300005439 | Bacteria | 1928 |
| 64 | Ga0070711_100312704 | 3300005439 | Bacteria | 1252 |
| 65 | Ga0070705_100004745 | 3300005440 | Bacteria | 6618 |
| 66 | Ga0070694_100016452 | 3300005444 | Bacteria | 4655 |
| 67 | Ga0070708_100024554 | 3300005445 | Bacteria | 5144 |
| 68 | Ga0070663_100021659 | 3300005455 | Bacteria | 4279 |
| 69 | Ga0070663_100757039 | 3300005455 | Bacteria | 830 |
| 70 | Ga0070678_100000417 | 3300005456 | Bacteria | 20087 |
| 71 | Ga0070678_100056036 | 3300005456 | Bacteria | 2880 |
| 72 | Ga0070678_100144298 | 3300005456 | Bacteria | 1909 |
| 73 | Ga0070678_100767032 | 3300005456 | Bacteria | 873 |
| 74 | Ga0070662_100014635 | 3300005457 | Bacteria | 5245 |
| 75 | Ga0070662_100051034 | 3300005457 | Bacteria | 2985 |
| 76 | Ga0068867_100009482 | 3300005459 | Bacteria | 6865 |
| 77 | Ga0070685_10104060 | 3300005466 | Bacteria | 1738 |
| 78 | Ga0070706_100043551 | 3300005467 | Bacteria | 4148 |
| 79 | Ga0070706_100409818 | 3300005467 | Bacteria | 1262 |
| 80 | Ga0070707_100039805 | 3300005468 | Bacteria | 4494 |
| 81 | Ga0070707_100328171 | 3300005468 | Bacteria | 1487 |
| 82 | Ga0070707_100375784 | 3300005468 | Bacteria | 1381 |
| 83 | Ga0070698_100003317 | 3300005471 | Bacteria | 17707 |
| 84 | Ga0070698_100004212 | 3300005471 | Bacteria | 15807 |
| 85 | Ga0070698_100032776 | 3300005471 | Bacteria | 5380 |
| 86 | Ga0070699_100001238 | 3300005518 | Bacteria | 23538 |
| 87 | Ga0070699_100136854 | 3300005518 | Bacteria | 2161 |
| 88 | Ga0070684_100038614 | 3300005535 | Bacteria | 4102 |
| 89 | Ga0070684_101183786 | 3300005535 | Bacteria | 719 |
| 90 | Ga0070697_100411499 | 3300005536 | Bacteria | 1174 |
| 91 | Ga0068853_100038879 | 3300005539 | Bacteria | 4055 |
| 92 | Ga0068853_100061169 | 3300005539 | Bacteria | 3256 |
| 93 | Ga0070672_100052590 | 3300005543 | Bacteria | 3180 |
| 94 | Ga0070686_100271563 | 3300005544 | Bacteria | 1247 |
| 95 | Ga0070686_100521776 | 3300005544 | Bacteria | 925 |
| 96 | Ga0070695_100013381 | 3300005545 | Bacteria | 4930 |
| 97 | Ga0070695_100198376 | 3300005545 | Bacteria | 1432 |
| 98 | Ga0070696_100006966 | 3300005546 | Bacteria | 7544 |
| 99 | Ga0070693_100024477 | 3300005547 | Bacteria | 3238 |
| 100 | Ga0070665_100019640 | 3300005548 | Bacteria | 6781 |
| 101 | Ga0070665_100044922 | 3300005548 | Bacteria | 4435 |
| 102 | Ga0070665_100233181 | 3300005548 | Bacteria | 1841 |
| 103 | Ga0070665_100397741 | 3300005548 | Bacteria | 1385 |
| 104 | Ga0070665_100625293 | 3300005548 | Bacteria | 1090 |
| 105 | Ga0070704_100004004 | 3300005549 | Bacteria | 8502 |
| 106 | Ga0070704_100038335 | 3300005549 | Bacteria | 3282 |
| 107 | Ga0070704_100255624 | 3300005549 | Bacteria | 1441 |
| 108 | Ga0070704_100323199 | 3300005549 | Bacteria | 1293 |
| 109 | Ga0068855_100030921 | 3300005563 | Bacteria | 6398 |
| 110 | Ga0068855_100271881 | 3300005563 | Bacteria | 1884 |
| 111 | Ga0068855_100571828 | 3300005563 | Bacteria | 1221 |
| 112 | Ga0070664_100444366 | 3300005564 | Bacteria | 1190 |
| 113 | Ga0068857_100058147 | 3300005577 | Bacteria | 3432 |
| 114 | Ga0068857_100783345 | 3300005577 | Bacteria | 910 |
| 115 | Ga0068854_100000759 | 3300005578 | Bacteria | 19146 |
| 116 | Ga0068854_100406104 | 3300005578 | Bacteria | 1128 |
| 117 | Ga0068856_100055601 | 3300005614 | Bacteria | 3906 |
| 118 | Ga0068856_100115890 | 3300005614 | Bacteria | 2679 |
| 119 | Ga0068856_100134245 | 3300005614 | Bacteria | 2480 |
| 120 | Ga0068856_100241317 | 3300005614 | Bacteria | 1822 |
| 121 | Ga0070702_100003039 | 3300005615 | Bacteria | 7424 |
| 122 | Ga0068852_100027793 | 3300005616 | Bacteria | 4617 |
| 123 | Ga0068852_100062573 | 3300005616 | Bacteria | 3237 |
| 124 | Ga0068852_100926064 | 3300005616 | Bacteria | 889 |
| 125 | Ga0068859_100000995 | 3300005617 | Bacteria | 29017 |
| 126 | Ga0068864_100135672 | 3300005618 | Bacteria | 2216 |
| 127 | Ga0068864_100163786 | 3300005618 | Bacteria | 2023 |
| 128 | Ga0068864_100281321 | 3300005618 | Bacteria | 1553 |
| 129 | Ga0068866_10000103 | 3300005718 | Bacteria | 36199 |
| 130 | Ga0068866_10046459 | 3300005718 | Bacteria | 2184 |
| 131 | Ga0068866_10101580 | 3300005718 | Bacteria | 1587 |
| 132 | Ga0068861_100075444 | 3300005719 | Bacteria | 2625 |
| 133 | Ga0068861_100079890 | 3300005719 | Bacteria | 2557 |
| 134 | Ga0068851_10127321 | 3300005834 | Bacteria | 1374 |
| 135 | Ga0068870_10050765 | 3300005840 | Bacteria | 2193 |
| 136 | Ga0068863_100011989 | 3300005841 | Bacteria | 8377 |
| 137 | Ga0068863_100147341 | 3300005841 | Bacteria | 2252 |
| 138 | Ga0068863_100412844 | 3300005841 | Bacteria | 1322 |
| 139 | Ga0068858_100007072 | 3300005842 | Bacteria | 10894 |
| 140 | Ga0068860_100015253 | 3300005843 | Bacteria | 7504 |
| 141 | Ga0068860_100384477 | 3300005843 | Bacteria | 1386 |
| 142 | Ga0068862_100009073 | 3300005844 | Bacteria | 8233 |
| 143 | Ga0081455_10016117 | 3300005937 | Bacteria | 7226 |
| 144 | Ga0081455_10017921 | 3300005937 | Bacteria | 6768 |
| 145 | Ga0081455_10095551 | 3300005937 | Bacteria | 2398 |
| 146 | Ga0081538_10089137 | 3300005981 | Bacteria | 1603 |
| 147 | Ga0081540_1000151 | 3300005983 | Bacteria | 71183 |
| 148 | Ga0070717_10236287 | 3300006028 | Bacteria | 1610 |
| 149 | Ga0070717_10304231 | 3300006028 | Bacteria | 1418 |
| 150 | Ga0070717_10365386 | 3300006028 | Bacteria | 1292 |
| 151 | Ga0070717_10428317 | 3300006028 | Bacteria | 1190 |
| 152 | Ga0075365_10006636 | 3300006038 | Bacteria | 6388 |
| 153 | Ga0075364_10086242 | 3300006051 | Bacteria | 2080 |
| 154 | Ga0070715_10002094 | 3300006163 | Bacteria | 6032 |
| 155 | Ga0070715_10004368 | 3300006163 | Bacteria | 4629 |
| 156 | Ga0070715_10017521 | 3300006163 | Bacteria | 2713 |
| 157 | Ga0070715_10221742 | 3300006163 | Bacteria | 972 |
| 158 | Ga0070716_100001890 | 3300006173 | Bacteria | 9505 |
| 159 | Ga0070716_100015780 | 3300006173 | Bacteria | 3888 |
| 160 | Ga0070716_100024660 | 3300006173 | Bacteria | 3203 |
| 161 | Ga0070716_100119642 | 3300006173 | Bacteria | 1646 |
| 162 | Ga0070716_100177433 | 3300006173 | Bacteria | 1396 |
| 163 | Ga0070716_100509344 | 3300006173 | Bacteria | 889 |
| 164 | Ga0070712_100003551 | 3300006175 | Bacteria | 9600 |
| 165 | Ga0070712_100006518 | 3300006175 | Bacteria | 7245 |
| 166 | Ga0070712_100114877 | 3300006175 | Bacteria | 2016 |
| 167 | Ga0070712_100349330 | 3300006175 | Bacteria | 1210 |
| 168 | Ga0070712_100552352 | 3300006175 | Bacteria | 970 |
| 169 | Ga0075367_10173930 | 3300006178 | Bacteria | 1342 |
| 170 | Ga0075369_10006227 | 3300006186 | Bacteria | 4506 |
| 171 | Ga0097621_100040409 | 3300006237 | Bacteria | 3750 |
| 172 | Ga0097621_100138077 | 3300006237 | Bacteria | 2081 |
| 173 | Ga0097621_100156100 | 3300006237 | Bacteria | 1959 |
| 174 | Ga0068871_100078058 | 3300006358 | Bacteria | 2737 |
| 175 | Ga0068871_100083681 | 3300006358 | Bacteria | 2647 |
| 176 | Ga0075428_100000121 | 3300006844 | Bacteria | 67666 |
| 177 | Ga0075428_100001048 | 3300006844 | Bacteria | 29361 |
| 178 | Ga0075428_100209311 | 3300006844 | Bacteria | 2107 |
| 179 | Ga0075430_100012222 | 3300006846 | Bacteria | 7310 |
| 180 | Ga0075431_100002178 | 3300006847 | Bacteria | 18720 |
| 181 | Ga0075431_100014875 | 3300006847 | Bacteria | 7878 |
| 182 | Ga0075431_100204899 | 3300006847 | Bacteria | 2017 |
| 183 | Ga0075431_100364054 | 3300006847 | Bacteria | 1452 |
| 184 | Ga0075431_100774487 | 3300006847 | Bacteria | 934 |
| 185 | Ga0075434_100073124 | 3300006871 | Bacteria | 3421 |
| 186 | Ga0075434_100513031 | 3300006871 | Bacteria | 1219 |
| 187 | Ga0075429_100021365 | 3300006880 | Bacteria | 5611 |
| 188 | Ga0075429_100027164 | 3300006880 | Bacteria | 4968 |
| 189 | Ga0068865_100007291 | 3300006881 | Bacteria | 6795 |
| 190 | Ga0068865_100101723 | 3300006881 | Bacteria | 2105 |
| 191 | Ga0068865_100436798 | 3300006881 | Bacteria | 1079 |
| 192 | Ga0075436_100209484 | 3300006914 | Bacteria | 1381 |
| 193 | Ga0075436_100283605 | 3300006914 | Bacteria | 1185 |
| 194 | Ga0097620_100000995 | 3300006931 | Bacteria | 29017 |
| 195 | Ga0075435_100029558 | 3300007076 | Bacteria | 4301 |
| 196 | Ga0075435_100135673 | 3300007076 | Bacteria | 2061 |
| 197 | Ga0075435_100585034 | 3300007076 | Bacteria | 968 |
| 198 | Ga0099795_10087512 | 3300007788 | Bacteria | 1202 |
| 199 | Ga0105251_10130454 | 3300009011 | Bacteria | 1139 |
| 200 | Ga0105250_10079341 | 3300009092 | Bacteria | 1330 |
| 201 | Ga0105250_10162336 | 3300009092 | Bacteria | 933 |
| 202 | Ga0105240_10125005 | 3300009093 | Bacteria | 3093 |
| 203 | Ga0105245_10003044 | 3300009098 | Bacteria | 15023 |
| 204 | Ga0105245_10144351 | 3300009098 | Bacteria | 2245 |
| 205 | Ga0105245_10781862 | 3300009098 | Bacteria | 992 |
| 206 | Ga0105247_10000279 | 3300009101 | Bacteria | 46962 |
| 207 | Ga0105247_10015410 | 3300009101 | Bacteria | 4579 |
| 208 | Ga0105247_10065084 | 3300009101 | Bacteria | 2267 |
| 209 | Ga0114129_10005229 | 3300009147 | Bacteria | 18285 |
| 210 | Ga0114129_10025054 | 3300009147 | Bacteria | 8455 |
| 211 | Ga0114129_10258388 | 3300009147 | Bacteria | 2336 |
| 212 | Ga0105243_10001443 | 3300009148 | Bacteria | 20907 |
| 213 | Ga0105243_10063692 | 3300009148 | Bacteria | 2955 |
| 214 | Ga0105243_10106616 | 3300009148 | Bacteria | 2336 |
| 215 | Ga0105243_10922410 | 3300009148 | Bacteria | 870 |
| 216 | Ga0105241_10003063 | 3300009174 | Bacteria | 12464 |
| 217 | Ga0105242_10000551 | 3300009176 | Bacteria | 29661 |
| 218 | Ga0105242_10225864 | 3300009176 | Bacteria | 1675 |
| 219 | Ga0105242_10772909 | 3300009176 | Bacteria | 948 |
| 220 | Ga0105248_10004599 | 3300009177 | Bacteria | 15277 |
| 221 | Ga0105248_10136290 | 3300009177 | Bacteria | 2769 |
| 222 | Ga0105248_10190064 | 3300009177 | Bacteria | 2314 |
| 223 | Ga0105248_10217998 | 3300009177 | Bacteria | 2149 |
| 224 | Ga0105248_10261832 | 3300009177 | Bacteria | 1947 |
| 225 | Ga0105237_10041116 | 3300009545 | Bacteria | 4663 |
| 226 | Ga0105237_10366293 | 3300009545 | Bacteria | 1446 |
| 227 | Ga0105237_10529268 | 3300009545 | Bacteria | 1185 |
| 228 | Ga0105237_10619239 | 3300009545 | Bacteria | 1089 |
| 229 | Ga0105238_10031089 | 3300009551 | Bacteria | 5435 |
| 230 | Ga0105238_10089251 | 3300009551 | Bacteria | 3070 |
| 231 | Ga0105238_10120598 | 3300009551 | Bacteria | 2602 |
| 232 | Ga0105238_10755169 | 3300009551 | Bacteria | 987 |
| 233 | Ga0105249_10011764 | 3300009553 | Bacteria | 7693 |
| 234 | Ga0105249_10024827 | 3300009553 | Bacteria | 5390 |
| 235 | Ga0105249_10077184 | 3300009553 | Bacteria | 3089 |
| 236 | Ga0105249_10160180 | 3300009553 | Bacteria | 2174 |
| 237 | Ga0099796_10110426 | 3300010159 | Bacteria | 1046 |
| 238 | Ga0105239_10123756 | 3300010375 | Bacteria | 2873 |
| 239 | Ga0105246_10018664 | 3300011119 | Bacteria | 4422 |
| 240 | Ga0105246_10075433 | 3300011119 | Bacteria | 2387 |
| 241 | Ga0105246_10170648 | 3300011119 | Bacteria | 1666 |
| 242 | Ga0157373_10303934 | 3300013100 | Bacteria | 1133 |
| 243 | Ga0157370_10344684 | 3300013104 | Bacteria | 1373 |
| 244 | Ga0157369_10061904 | 3300013105 | Bacteria | 4033 |
| 245 | Ga0157369_10104777 | 3300013105 | Bacteria | 3011 |
| 246 | Ga0157374_10003857 | 3300013296 | Bacteria | 12596 |
| 247 | Ga0157374_10535313 | 3300013296 | Bacteria | 1178 |
| 248 | Ga0157378_10001937 | 3300013297 | Bacteria | 18571 |
| 249 | Ga0163162_10008789 | 3300013306 | Bacteria | 9820 |
| 250 | Ga0163162_10305651 | 3300013306 | Bacteria | 1723 |
| 251 | Ga0163162_10324934 | 3300013306 | Bacteria | 1671 |
| 252 | Ga0163162_10380728 | 3300013306 | Bacteria | 1544 |
| 253 | Ga0163162_10451695 | 3300013306 | Bacteria | 1417 |
| 254 | Ga0157372_10031255 | 3300013307 | Bacteria | 5830 |
| 255 | Ga0157372_10099026 | 3300013307 | Bacteria | 3325 |
| 256 | Ga0157375_10006369 | 3300013308 | Bacteria | 10290 |
| 257 | Ga0157375_10184412 | 3300013308 | Bacteria | 2239 |
| 258 | Ga0157375_10490605 | 3300013308 | Bacteria | 1393 |
| 259 | Ga0157375_10526053 | 3300013308 | Bacteria | 1345 |
| 260 | Ga0157375_10802315 | 3300013308 | Bacteria | 1090 |
| 261 | Ga0157375_11098204 | 3300013308 | Bacteria | 931 |
| 262 | Ga0163163_10075470 | 3300014325 | Bacteria | 3365 |
| 263 | Ga0163163_10238482 | 3300014325 | Bacteria | 1868 |
| 264 | Ga0163163_10347185 | 3300014325 | Bacteria | 1540 |
| 265 | Ga0163163_10567307 | 3300014325 | Bacteria | 1198 |
| 266 | Ga0157380_10000918 | 3300014326 | Bacteria | 18557 |
| 267 | Ga0157380_10149743 | 3300014326 | Bacteria | 2016 |
| 268 | Ga0157379_10000781 | 3300014968 | Bacteria | 25849 |
| 269 | Ga0157379_10212942 | 3300014968 | Bacteria | 1750 |
| 270 | Ga0157376_10909984 | 3300014969 | Bacteria | 898 |
| 271 | Ga0163161_10008981 | 3300017792 | Bacteria | 6914 |
| 272 | Ga0213875_10002166 | 3300021388 | Bacteria | 11985 |
| 273 | Ga0213875_10005062 | 3300021388 | Bacteria | 7139 |
| 274 | Ga0224572_1034206 | 3300024225 | Bacteria | 966 |
| 275 | Ga0224572_1036396 | 3300024225 | Bacteria | 932 |
| 276 | Ga0209051_1006886 | 3300025303 | Bacteria | 6314 |
| 277 | Ga0209051_1072020 | 3300025303 | Bacteria | 1036 |
| 278 | Ga0207653_10032963 | 3300025885 | Bacteria | 1678 |
| 279 | Ga0207692_10001518 | 3300025898 | Bacteria | 8723 |
| 280 | Ga0207692_10003051 | 3300025898 | Bacteria | 6499 |
| 281 | Ga0207692_10014716 | 3300025898 | Bacteria | 3424 |
| 282 | Ga0207692_10029842 | 3300025898 | Bacteria | 2596 |
| 283 | Ga0207692_10189020 | 3300025898 | Bacteria | 1204 |
| 284 | Ga0207642_10000651 | 3300025899 | Bacteria | 10659 |
| 285 | Ga0207710_10005916 | 3300025900 | Bacteria | 5246 |
| 286 | Ga0207710_10015088 | 3300025900 | Bacteria | 3263 |
| 287 | Ga0207710_10080859 | 3300025900 | Bacteria | 1507 |
| 288 | Ga0207688_10004249 | 3300025901 | Bacteria | 7807 |
| 289 | Ga0207688_10006764 | 3300025901 | Bacteria | 6241 |
| 290 | Ga0207688_10014643 | 3300025901 | Bacteria | 4260 |
| 291 | Ga0207680_10129293 | 3300025903 | Bacteria | 1662 |
| 292 | Ga0207647_10019580 | 3300025904 | Bacteria | 4550 |
| 293 | Ga0207647_10136243 | 3300025904 | Bacteria | 1441 |
| 294 | Ga0207685_10003273 | 3300025905 | Bacteria | 3913 |
| 295 | Ga0207685_10023198 | 3300025905 | Bacteria | 2109 |
| 296 | Ga0207699_10004754 | 3300025906 | Bacteria | 6487 |
| 297 | Ga0207699_10006080 | 3300025906 | Bacteria | 5815 |
| 298 | Ga0207699_10009375 | 3300025906 | Bacteria | 4872 |
| 299 | Ga0207699_10047745 | 3300025906 | Bacteria | 2512 |
| 300 | Ga0207699_10049900 | 3300025906 | Bacteria | 2465 |
| 301 | Ga0207699_10075340 | 3300025906 | Bacteria | 2075 |
| 302 | Ga0207699_10084096 | 3300025906 | Bacteria | 1981 |
| 303 | Ga0207699_10219549 | 3300025906 | Bacteria | 1297 |
| 304 | Ga0207645_10203818 | 3300025907 | Bacteria | 1302 |
| 305 | Ga0207645_10308318 | 3300025907 | Bacteria | 1054 |
| 306 | Ga0207684_10027555 | 3300025910 | Bacteria | 4839 |
| 307 | Ga0207684_10392680 | 3300025910 | Bacteria | 1193 |
| 308 | Ga0207654_10509293 | 3300025911 | Bacteria | 851 |
| 309 | Ga0207707_10216807 | 3300025912 | Bacteria | 1666 |
| 310 | Ga0207695_10001059 | 3300025913 | Bacteria | 48227 |
| 311 | Ga0207671_10001032 | 3300025914 | Bacteria | 33903 |
| 312 | Ga0207671_10187444 | 3300025914 | Bacteria | 1612 |
| 313 | Ga0207693_10000320 | 3300025915 | Bacteria | 44589 |
| 314 | Ga0207693_10017765 | 3300025915 | Bacteria | 5672 |
| 315 | Ga0207693_10052598 | 3300025915 | Bacteria | 3195 |
| 316 | Ga0207663_10003612 | 3300025916 | Bacteria | 7594 |
| 317 | Ga0207663_10004022 | 3300025916 | Bacteria | 7284 |
| 318 | Ga0207663_10059686 | 3300025916 | Bacteria | 2414 |
| 319 | Ga0207663_10196179 | 3300025916 | Bacteria | 1453 |
| 320 | Ga0207663_10774373 | 3300025916 | Bacteria | 763 |
| 321 | Ga0207660_10206965 | 3300025917 | Bacteria | 1535 |
| 322 | Ga0207662_10029765 | 3300025918 | Bacteria | 3166 |
| 323 | Ga0207657_10601486 | 3300025919 | Bacteria | 858 |
| 324 | Ga0207646_10045798 | 3300025922 | Bacteria | 3925 |
| 325 | Ga0207646_10170287 | 3300025922 | Bacteria | 1967 |
| 326 | Ga0207694_10446478 | 3300025924 | Bacteria | 1079 |
| 327 | Ga0207659_10117533 | 3300025926 | Bacteria | 2032 |
| 328 | Ga0207659_10513281 | 3300025926 | Bacteria | 1016 |
| 329 | Ga0207687_10005088 | 3300025927 | Bacteria | 8710 |
| 330 | Ga0207687_10025124 | 3300025927 | Bacteria | 3986 |
| 331 | Ga0207700_10014376 | 3300025928 | Bacteria | 5185 |
| 332 | Ga0207700_10016141 | 3300025928 | Bacteria | 4951 |
| 333 | Ga0207700_10040353 | 3300025928 | Bacteria | 3406 |
| 334 | Ga0207700_10492374 | 3300025928 | Bacteria | 1084 |
| 335 | Ga0207700_10524017 | 3300025928 | Bacteria | 1050 |
| 336 | Ga0207664_10000436 | 3300025929 | Bacteria | 29818 |
| 337 | Ga0207664_10018715 | 3300025929 | Bacteria | 5107 |
| 338 | Ga0207664_10121171 | 3300025929 | Bacteria | 2189 |
| 339 | Ga0207664_10155908 | 3300025929 | Bacteria | 1944 |
| 340 | Ga0207664_10202954 | 3300025929 | Bacteria | 1712 |
| 341 | Ga0207664_10279286 | 3300025929 | Bacteria | 1465 |
| 342 | Ga0207664_10316480 | 3300025929 | Bacteria | 1376 |
| 343 | Ga0207664_10449303 | 3300025929 | Bacteria | 1150 |
| 344 | Ga0207664_10600112 | 3300025929 | Bacteria | 989 |
| 345 | Ga0207644_10317424 | 3300025931 | Bacteria | 1259 |
| 346 | Ga0207644_10337154 | 3300025931 | Bacteria | 1222 |
| 347 | Ga0207644_10351524 | 3300025931 | Bacteria | 1197 |
| 348 | Ga0207706_10011104 | 3300025933 | Bacteria | 8209 |
| 349 | Ga0207706_10037870 | 3300025933 | Bacteria | 4280 |
| 350 | Ga0207686_10055958 | 3300025934 | Bacteria | 2477 |
| 351 | Ga0207709_10005487 | 3300025935 | Bacteria | 7200 |
| 352 | Ga0207709_10035131 | 3300025935 | Bacteria | 2961 |
| 353 | Ga0207670_10034471 | 3300025936 | Bacteria | 3272 |
| 354 | Ga0207670_10264605 | 3300025936 | Bacteria | 1334 |
| 355 | Ga0207669_10000415 | 3300025937 | Bacteria | 18644 |
| 356 | Ga0207669_10025046 | 3300025937 | Bacteria | 3217 |
| 357 | Ga0207669_10133823 | 3300025937 | Bacteria | 1709 |
| 358 | Ga0207704_10000497 | 3300025938 | Bacteria | 17484 |
| 359 | Ga0207704_10047128 | 3300025938 | Bacteria | 2574 |
| 360 | Ga0207704_10369790 | 3300025938 | Bacteria | 1122 |
| 361 | Ga0207665_10006186 | 3300025939 | Bacteria | 7948 |
| 362 | Ga0207665_10022481 | 3300025939 | Bacteria | 4149 |
| 363 | Ga0207665_10032442 | 3300025939 | Bacteria | 3458 |
| 364 | Ga0207665_10046112 | 3300025939 | Bacteria | 2920 |
| 365 | Ga0207665_10113752 | 3300025939 | Bacteria | 1904 |
| 366 | Ga0207665_10231340 | 3300025939 | Bacteria | 1358 |
| 367 | Ga0207691_10035502 | 3300025940 | Bacteria | 4626 |
| 368 | Ga0207711_10157217 | 3300025941 | Bacteria | 2055 |
| 369 | Ga0207711_10262403 | 3300025941 | Bacteria | 1588 |
| 370 | Ga0207689_10009038 | 3300025942 | Bacteria | 8628 |
| 371 | Ga0207689_10012026 | 3300025942 | Bacteria | 7417 |
| 372 | Ga0207689_10110200 | 3300025942 | Bacteria | 2262 |
| 373 | Ga0207679_10344818 | 3300025945 | Bacteria | 1296 |
| 374 | Ga0207679_10861915 | 3300025945 | Bacteria | 827 |
| 375 | Ga0207667_10686769 | 3300025949 | Bacteria | 1027 |
| 376 | Ga0207667_10839335 | 3300025949 | Bacteria | 913 |
| 377 | Ga0207651_10024297 | 3300025960 | Bacteria | 3746 |
| 378 | Ga0207651_10041183 | 3300025960 | Bacteria | 3064 |
| 379 | Ga0207712_10071413 | 3300025961 | Bacteria | 2497 |
| 380 | Ga0207712_10303777 | 3300025961 | Bacteria | 1311 |
| 381 | Ga0207712_10666013 | 3300025961 | Bacteria | 906 |
| 382 | Ga0207668_10002762 | 3300025972 | Bacteria | 10260 |
| 383 | Ga0207668_10168510 | 3300025972 | Bacteria | 1715 |
| 384 | Ga0207668_10306978 | 3300025972 | Bacteria | 1312 |
| 385 | Ga0207640_10252662 | 3300025981 | Bacteria | 1369 |
| 386 | Ga0207658_10026543 | 3300025986 | Bacteria | 4061 |
| 387 | Ga0207677_10000663 | 3300026023 | Bacteria | 20484 |
| 388 | Ga0207677_10076042 | 3300026023 | Bacteria | 2389 |
| 389 | Ga0207703_10002809 | 3300026035 | Bacteria | 14858 |
| 390 | Ga0207703_10228227 | 3300026035 | Bacteria | 1668 |
| 391 | Ga0207639_10086370 | 3300026041 | Bacteria | 2498 |
| 392 | Ga0207678_10013701 | 3300026067 | Bacteria | 7123 |
| 393 | Ga0207678_10048537 | 3300026067 | Bacteria | 3669 |
| 394 | Ga0207708_10006741 | 3300026075 | Bacteria | 8498 |
| 395 | Ga0207708_10022478 | 3300026075 | Bacteria | 4762 |
| 396 | Ga0207702_10089728 | 3300026078 | Bacteria | 2688 |
| 397 | Ga0207702_10098495 | 3300026078 | Bacteria | 2576 |
| 398 | Ga0207702_10376769 | 3300026078 | Bacteria | 1364 |
| 399 | Ga0207641_10093683 | 3300026088 | Bacteria | 2633 |
| 400 | Ga0207641_10223635 | 3300026088 | Bacteria | 1747 |
| 401 | Ga0207648_10000451 | 3300026089 | Bacteria | 45574 |
| 402 | Ga0207648_10085983 | 3300026089 | Bacteria | 2743 |
| 403 | Ga0207676_10037818 | 3300026095 | Bacteria | 3680 |
| 404 | Ga0207674_10005304 | 3300026116 | Bacteria | 15337 |
| 405 | Ga0207674_10400882 | 3300026116 | Bacteria | 1326 |
| 406 | Ga0207675_100023739 | 3300026118 | Bacteria | 5705 |
| 407 | Ga0207675_100028799 | 3300026118 | Bacteria | 5174 |
| 408 | Ga0207675_100053244 | 3300026118 | Bacteria | 3776 |
| 409 | Ga0207683_10000665 | 3300026121 | Bacteria | 31567 |
| 410 | Ga0207683_10057046 | 3300026121 | Bacteria | 3428 |
| 411 | Ga0207683_10077553 | 3300026121 | Bacteria | 2943 |
| 412 | Ga0207683_10210305 | 3300026121 | Bacteria | 1770 |
| 413 | Ga0207683_10574394 | 3300026121 | Bacteria | 1043 |
| 414 | Ga0207698_10015490 | 3300026142 | Bacteria | 5106 |
| 415 | Ga0207698_10842970 | 3300026142 | Bacteria | 921 |
| 416 | Ga0268266_10032412 | 3300028379 | Bacteria | 4440 |
| 417 | Ga0268266_10098723 | 3300028379 | Bacteria | 2570 |
| 418 | Ga0268266_10739900 | 3300028379 | Bacteria | 949 |
| 419 | Ga0268265_10783775 | 3300028380 | Bacteria | 928 |
| 420 | Ga0268264_10011372 | 3300028381 | Bacteria | 7352 |
| 421 | Ga0265334_10001329 | 3300028573 | Bacteria | 11921 |
| 422 | Ga0265336_10021017 | 3300028666 | Bacteria | 2089 |
| 423 | Ga0265338_10037230 | 3300028800 | Bacteria | 4637 |
| 424 | Ga0307512_10056095 | 3300030522 | Bacteria | 3098 |
| 425 | Ga0307408_100051849 | 3300031548 | Bacteria | 2958 |
| 426 | Ga0307408_100409656 | 3300031548 | Bacteria | 1166 |
| 427 | Ga0307405_10169629 | 3300031731 | Bacteria | 1555 |
| 428 | Ga0307410_10115094 | 3300031852 | Bacteria | 1952 |
| 429 | Ga0307410_10525727 | 3300031852 | Bacteria | 977 |
| 430 | Ga0307406_10032249 | 3300031901 | Bacteria | 3197 |
| 431 | Ga0307406_10567885 | 3300031901 | Bacteria | 931 |
| 432 | Ga0307407_10209102 | 3300031903 | Bacteria | 1312 |
| 433 | Ga0307412_10607221 | 3300031911 | Bacteria | 927 |
| 434 | Ga0307416_100000419 | 3300032002 | Bacteria | 21590 |
| 435 | Ga0307414_10779706 | 3300032004 | Bacteria | 871 |
| 436 | Ga0307415_100000096 | 3300032126 | Bacteria | 37053 |
| 437 | Ga0307415_100481297 | 3300032126 | Bacteria | 1081 |
| 438 | Ga0373930_0002391 | 3300034816 | Bacteria | 2900 |
| 439 | Ga0373958_0025723 | 3300034819 | Bacteria | 1123 |
| 440 | Ga0373959_0006639 | 3300034820 | Bacteria | 1927 |
| 441 | Ga0373938_0058961 | 3300034957 | Bacteria | 894 |
| 442 | Ga0373926_0001654 | 3300035083 | Bacteria | 6892 |
| 443 | Ga0373926_0002658 | 3300035083 | Bacteria | 5687 |
| 444 | Ga0373928_0064894 | 3300035084 | Bacteria | 890 |
| 445 | Ga0373929_0014121 | 3300035085 | Bacteria | 1539 |
| 446 | Ga0373934_0001925 | 3300035086 | Bacteria | 7614 |
| 447 | Ga0373934_0038478 | 3300035086 | Bacteria | 1884 |
| 448 | Ga0373934_0042906 | 3300035086 | Bacteria | 1787 |
| 449 | Ga0373944_0002847 | 3300035089 | Bacteria | 4426 |
| 450 | Ga0373944_0010853 | 3300035089 | Bacteria | 2489 |
| 451 | Ga0373951_0024489 | 3300035091 | Bacteria | 1398 |
| 452 | Ga0373952_0004919 | 3300035092 | Bacteria | 2430 |
| 453 | Ga0373923_0000236 | 3300035111 | Bacteria | 11706 |
| 454 | Ga0373923_0019823 | 3300035111 | Bacteria | 2608 |
| 455 | Ga0373923_0031760 | 3300035111 | Bacteria | 2130 |
| 456 | Ga0373932_0005708 | 3300035112 | Bacteria | 2928 |
| 457 | Ga0373932_0029274 | 3300035112 | Bacteria | 1519 |
| 458 | Ga0373936_0000515 | 3300035113 | Bacteria | 13169 |
| 459 | Ga0373936_0015433 | 3300035113 | Bacteria | 2927 |
| 460 | Ga0373936_0016786 | 3300035113 | Bacteria | 2817 |
| 461 | Ga0373936_0033364 | 3300035113 | Bacteria | 2040 |
| 462 | Ga0373939_0018023 | 3300035114 | Bacteria | 1884 |
| 463 | Ga0373939_0034308 | 3300035114 | Bacteria | 1488 |
| 464 | Ga0373941_0021457 | 3300035115 | Bacteria | 1823 |
| 465 | Ga0373945_0000850 | 3300035116 | Bacteria | 8989 |
| 466 | Ga0373945_0001512 | 3300035116 | Bacteria | 7100 |
| 467 | Ga0373953_0008839 | 3300035117 | Bacteria | 3437 |
| 468 | Ga0373953_0009151 | 3300035117 | Bacteria | 3390 |
| 469 | Ga0373954_0002512 | 3300035118 | Bacteria | 7698 |
| 470 | Ga0373954_0053090 | 3300035118 | Bacteria | 1905 |
| 471 | Ga0373954_0085055 | 3300035118 | Bacteria | 1514 |
| 472 | Ga0373956_0010504 | 3300035119 | Bacteria | 3796 |
| 473 | Ga0373956_0059799 | 3300035119 | Bacteria | 1724 |
| 474 | Ga0373957_0002668 | 3300035120 | Bacteria | 5122 |
| 475 | Ga0373957_0025601 | 3300035120 | Bacteria | 2127 |
| 476 | Ga0373957_0040059 | 3300035120 | Bacteria | 1760 |
| 477 | Ga0373960_0028843 | 3300035121 | Bacteria | 1534 |
| 478 | Ga0373960_0049693 | 3300035121 | Bacteria | 1241 |
| 479 | Ga0373960_0105314 | 3300035121 | Bacteria | 919 |
| 480 | Ga0373943_0000572 | 3300035170 | Bacteria | 15968 |
| 481 | Ga0373943_0002611 | 3300035170 | Bacteria | 8189 |
| 482 | Ga0373943_0099544 | 3300035170 | Bacteria | 1518 |
| 483 | Ga0373946_0000135 | 3300035171 | Bacteria | 22104 |
| 484 | Ga0373946_0003306 | 3300035171 | Bacteria | 5725 |
| 485 | Ga0373946_0070733 | 3300035171 | Bacteria | 1506 |
| 486 | Ga0373955_0019245 | 3300035172 | Bacteria | 3408 |
| 487 | Ga0373955_0032010 | 3300035172 | Bacteria | 2757 |
| 488 | Ga0373962_0004632 | 3300035242 | Bacteria | 3323 |
| 489 | Ga0373924_0002854 | 3300035410 | Bacteria | 5855 |
| 490 | Ga0373924_0013098 | 3300035410 | Bacteria | 3111 |
| 491 | Ga0373924_0028292 | 3300035410 | Bacteria | 2233 |
| 492 | Ga0373931_0012440 | 3300035691 | Bacteria | 4123 |
| 493 | Ga0373931_0039606 | 3300035691 | Bacteria | 2469 |
| 494 | Ga0373931_0118059 | 3300035691 | Bacteria | 1513 |
| 495 | Ga0373931_0268185 | 3300035691 | Bacteria | 1044 |
| 496 | Ga0373931_0346662 | 3300035691 | Bacteria | 929 |
| 497 | Ga0373935_0009215 | 3300035692 | Bacteria | 5908 |
| 498 | Ga0373935_0026712 | 3300035692 | Bacteria | 3566 |
| 499 | Ga0373935_0044398 | 3300035692 | Bacteria | 2800 |
| 500 | Ga0373935_0195541 | 3300035692 | Bacteria | 1395 |
| 501 | Ga0373927_0006681 | 3300035695 | Bacteria | 7851 |
| 502 | Ga0373927_0006733 | 3300035695 | Bacteria | 7821 |
| 503 | Ga0373933_0004568 | 3300035724 | Bacteria | 7585 |
| 504 | Ga0373933_0008682 | 3300035724 | Bacteria | 5541 |
| 505 | Ga0373933_0020937 | 3300035724 | Bacteria | 3709 |
| 506 | Ga0373933_0070825 | 3300035724 | Bacteria | 2121 |
| 507 | Ga0373947_0001636 | 3300035725 | Bacteria | 13742 |
| 508 | Ga0373947_0004702 | 3300035725 | Bacteria | 8000 |
| 509 | Ga0373947_0033283 | 3300035725 | Bacteria | 3042 |
| 510 | Ga0373947_0039900 | 3300035725 | Bacteria | 2795 |
| 511 | Ga0373937_0001745 | 3300036401 | Bacteria | 18295 |
| 512 | Ga0373937_0828406 | 3300036401 | Bacteria | 873 |
| 513 | Ga0373925_0001952 | 3300037068 | Bacteria | 17059 |
| 514 | Ga0373925_0015109 | 3300037068 | Bacteria | 5580 |
| 515 | Ga0373925_0053143 | 3300037068 | Bacteria | 3027 |
| 516 | Ga0373925_0420285 | 3300037068 | Bacteria | 1092 |
| 517 | Ga0373925_0429930 | 3300037068 | Bacteria | 1079 |
| 518 | Ga0436364_0246675 | 3300037853 | Bacteria | 22744 |
| 519 | Ga0436364_0252998 | 3300037853 | Bacteria | 5068 |
| 520 | Ga0436364_0922968 | 3300037853 | Bacteria | 2016 |
| 521 | Ga0436364_1157355 | 3300037853 | Bacteria | 1407 |
| 522 | Ga0436364_1206511 | 3300037853 | Bacteria | 41633 |
| 523 | Ga0439461_0000425 | 3300041410 | Bacteria | 6069 |
| 524 | Ga0439466_0020257 | 3300041411 | Bacteria | 2371 |
| 525 | Ga0439466_0090101 | 3300041411 | Bacteria | 962 |
| 526 | Ga0451791_1188155 | 3300041451 | Bacteria | 2742 |
| 527 | Ga0451802_0165858 | 3300041460 | Bacteria | 1228 |
| 528 | Ga0451839_1060590 | 3300041496 | Bacteria | 951 |
| 529 | Ga0439431_0015856 | 3300041997 | Bacteria | 1758 |
| 530 | Ga0439442_006464 | 3300042002 | Bacteria | 2354 |
| 531 | Ga0439448_0079217 | 3300042005 | Bacteria | 1102 |
| 532 | Ga0439434_0035218 | 3300042435 | Bacteria | 1530 |
| 533 | Ga0466969_0009562 | 3300044656 | Bacteria | 5139 |
| 534 | Ga0466972_0031636 | 3300044658 | Bacteria | 2601 |
| 535 | Ga0466972_0046925 | 3300044658 | Bacteria | 2090 |
| 536 | Ga0466972_0088869 | 3300044658 | Bacteria | 1466 |
| 537 | Ga0466965_0003556 | 3300044683 | Bacteria | 6847 |
| 538 | Ga0466965_0006957 | 3300044683 | Bacteria | 5175 |
| 539 | Ga0466966_0000541 | 3300044684 | Bacteria | 24070 |
| 540 | Ga0466961_0008206 | 3300044693 | Bacteria | 6653 |
| 541 | Ga0466961_0014126 | 3300044693 | Bacteria | 5122 |
| 542 | Ga0466963_0007395 | 3300044694 | Bacteria | 6544 |
| 543 | Ga0466963_0041713 | 3300044694 | Bacteria | 3011 |
| 544 | Ga0466963_0545640 | 3300044694 | Bacteria | 819 |
| 545 | Ga0466971_0001219 | 3300044719 | Bacteria | 10687 |
| 546 | Ga0466968_0022125 | 3300044735 | Bacteria | 2582 |
| 547 | Ga0466970_0033353 | 3300044765 | Bacteria | 2722 |
| 548 | Ga0466970_0127995 | 3300044765 | Bacteria | 1393 |
| 549 | Ga0466957_0001172 | 3300044842 | Bacteria | 13604 |
| 550 | Ga0466957_0087447 | 3300044842 | Bacteria | 1949 |
| 551 | Ga0466960_0009227 | 3300044901 | Bacteria | 4061 |
| 552 | Ga0466960_0148844 | 3300044901 | Bacteria | 1249 |
| 553 | Ga0466959_0001339 | 3300045049 | Bacteria | 15000 |
| 554 | Ga0466959_0132409 | 3300045049 | Bacteria | 1767 |
| 555 | Ga0466958_0000654 | 3300045836 | Bacteria | 14953 |
| 556 | Ga0466967_0004594 | 3300045976 | Bacteria | 9352 |
| 557 | Ga0466967_0020033 | 3300045976 | Bacteria | 5395 |
| 558 | Ga0466967_0021666 | 3300045976 | Bacteria | 5227 |
| 559 | Ga0466967_0104797 | 3300045976 | Bacteria | 2590 |
| 560 | Ga0466967_0166658 | 3300045976 | Bacteria | 2071 |
| 561 | Ga0466967_0331319 | 3300045976 | Bacteria | 1470 |
| 562 | Ga0495592_0013132 | 3300046454 | Bacteria | 6303 |
| 563 | Ga0495592_0109978 | 3300046454 | Bacteria | 1951 |
| 564 | Ga0495592_0110157 | 3300046454 | Bacteria | 1949 |
| 565 | Ga0495592_0238198 | 3300046454 | Bacteria | 1208 |
| 566 | Ga0495603_0001257 | 3300046455 | Bacteria | 14783 |
| 567 | Ga0495603_0078045 | 3300046455 | Bacteria | 1942 |
| 568 | Ga0495629_0007578 | 3300046459 | Bacteria | 7997 |
| 569 | Ga0495629_0051194 | 3300046459 | Bacteria | 2890 |
| 570 | Ga0495638_0179154 | 3300046460 | Bacteria | 1210 |
| 571 | Ga0495641_0004172 | 3300046461 | Bacteria | 10387 |
| 572 | Ga0495641_0011867 | 3300046461 | Bacteria | 4922 |
| 573 | Ga0495641_0235861 | 3300046461 | Bacteria | 821 |
| 574 | Ga0495651_0000394 | 3300046462 | Bacteria | 33759 |
| 575 | Ga0495651_0011996 | 3300046462 | Bacteria | 6669 |
| 576 | Ga0495651_0018767 | 3300046462 | Bacteria | 5358 |
| 577 | Ga0495651_0098856 | 3300046462 | Bacteria | 2176 |
| 578 | Ga0495651_0286210 | 3300046462 | Bacteria | 1111 |
| 579 | Ga0495653_0011805 | 3300046463 | Bacteria | 7132 |
| 580 | Ga0495653_0012589 | 3300046463 | Bacteria | 6908 |
| 581 | Ga0495653_0013966 | 3300046463 | Bacteria | 6548 |
| 582 | Ga0495653_0020199 | 3300046463 | Bacteria | 5400 |
| 583 | Ga0495653_0067083 | 3300046463 | Bacteria | 2696 |
| 584 | Ga0495580_0011843 | 3300046472 | Bacteria | 6729 |
| 585 | Ga0495580_0238742 | 3300046472 | Bacteria | 1246 |
| 586 | Ga0495582_0001366 | 3300046473 | Bacteria | 13732 |
| 587 | Ga0495582_0015813 | 3300046473 | Bacteria | 4138 |
| 588 | Ga0495582_0058915 | 3300046473 | Bacteria | 2118 |
| 589 | Ga0495639_0010831 | 3300046475 | Bacteria | 3927 |
| 590 | Ga0495662_0001342 | 3300046476 | Bacteria | 12161 |
| 591 | Ga0495662_0004654 | 3300046476 | Bacteria | 6887 |
| 592 | Ga0495662_0007662 | 3300046476 | Bacteria | 5324 |
| 593 | Ga0495662_0035913 | 3300046476 | Bacteria | 2392 |
| 594 | Ga0495664_0008837 | 3300046477 | Bacteria | 5628 |
| 595 | Ga0495664_0013226 | 3300046477 | Bacteria | 4680 |
| 596 | Ga0495664_0028493 | 3300046477 | Bacteria | 3261 |
| 597 | Ga0495664_0056565 | 3300046477 | Bacteria | 2333 |
| 598 | Ga0495664_0306910 | 3300046477 | Bacteria | 958 |
| 599 | Ga0495664_0307408 | 3300046477 | Bacteria | 957 |
| 600 | Ga0495594_0026316 | 3300046499 | Bacteria | 3129 |
| 601 | Ga0495594_0035556 | 3300046499 | Bacteria | 2714 |
| 602 | Ga0495608_0022211 | 3300046511 | Bacteria | 4348 |
| 603 | Ga0495608_0071116 | 3300046511 | Bacteria | 2270 |
| 604 | Ga0495608_0188614 | 3300046511 | Bacteria | 1302 |
| 605 | Ga0495618_0004698 | 3300046514 | Bacteria | 8353 |
| 606 | Ga0495618_0009672 | 3300046514 | Bacteria | 5821 |
| 607 | Ga0495618_0132519 | 3300046514 | Bacteria | 1594 |
| 608 | Ga0495618_0180762 | 3300046514 | Bacteria | 1340 |
| 609 | Ga0495628_0010263 | 3300046516 | Bacteria | 7965 |
| 610 | Ga0495628_0042394 | 3300046516 | Bacteria | 3630 |
| 611 | Ga0495628_0182720 | 3300046516 | Bacteria | 1585 |
| 612 | Ga0495630_0000896 | 3300046517 | Bacteria | 20817 |
| 613 | Ga0495630_0055174 | 3300046517 | Bacteria | 2977 |
| 614 | Ga0495630_0112760 | 3300046517 | Bacteria | 2059 |
| 615 | Ga0495666_0001610 | 3300046526 | Bacteria | 11119 |
| 616 | Ga0495666_0007318 | 3300046526 | Bacteria | 5535 |
| 617 | Ga0495666_0295064 | 3300046526 | Bacteria | 734 |
| 618 | Ga0495652_0027983 | 3300046529 | Bacteria | 4964 |
| 619 | Ga0495652_0033009 | 3300046529 | Bacteria | 4523 |
| 620 | Ga0495652_0102428 | 3300046529 | Bacteria | 2319 |
| 621 | Ga0495652_0141347 | 3300046529 | Bacteria | 1892 |
| 622 | Ga0495652_0214134 | 3300046529 | Bacteria | 1452 |
| 623 | Ga0495652_0229837 | 3300046529 | Bacteria | 1388 |
| 624 | Ga0495652_0281544 | 3300046529 | Bacteria | 1217 |
| 625 | Ga0495665_0000793 | 3300046531 | Bacteria | 16530 |
| 626 | Ga0495665_0044751 | 3300046531 | Bacteria | 2351 |
| 627 | Ga0495665_0105989 | 3300046531 | Bacteria | 1475 |
| 628 | Ga0495665_0195758 | 3300046531 | Bacteria | 1048 |
| 629 | Ga0495640_0003266 | 3300046533 | Bacteria | 13044 |
| 630 | Ga0495640_0005269 | 3300046533 | Bacteria | 10282 |
| 631 | Ga0495640_0028884 | 3300046533 | Bacteria | 3987 |
| 632 | Ga0495640_0058324 | 3300046533 | Bacteria | 2633 |
| 633 | Ga0495640_0147570 | 3300046533 | Bacteria | 1512 |
| 634 | Ga0495640_0379054 | 3300046533 | Bacteria | 870 |
| 635 | Ga0495586_0003013 | 3300046535 | Bacteria | 9086 |
| 636 | Ga0495587_0048194 | 3300046536 | Bacteria | 2523 |
| 637 | Ga0495587_0056836 | 3300046536 | Bacteria | 2301 |
| 638 | Ga0495598_0193629 | 3300046537 | Bacteria | 731 |
| 639 | Ga0495645_0030504 | 3300046543 | Bacteria | 3926 |
| 640 | Ga0495645_0033760 | 3300046543 | Bacteria | 3732 |
| 641 | Ga0495645_0050282 | 3300046543 | Bacteria | 3035 |
| 642 | Ga0495645_0095322 | 3300046543 | Bacteria | 2121 |
| 643 | Ga0495645_0110710 | 3300046543 | Bacteria | 1943 |
| 644 | Ga0495667_0004037 | 3300046559 | Bacteria | 9865 |
| 645 | Ga0495667_0006871 | 3300046559 | Bacteria | 7728 |
| 646 | Ga0495667_0017425 | 3300046559 | Bacteria | 4851 |
| 647 | Ga0495667_0026619 | 3300046559 | Bacteria | 3897 |
| 648 | Ga0495667_0073661 | 3300046559 | Bacteria | 2224 |
| 649 | Ga0495667_0084164 | 3300046559 | Bacteria | 2065 |
| 650 | Ga0495656_0067259 | 3300046615 | Bacteria | 1581 |
| 651 | Ga0495634_0002285 | 3300046642 | Bacteria | 16036 |
| 652 | Ga0495634_0014050 | 3300046642 | Bacteria | 5782 |
| 653 | Ga0495634_0053314 | 3300046642 | Bacteria | 2709 |
| 654 | Ga0495634_0204909 | 3300046642 | Bacteria | 1223 |
| 655 | Ga0495634_0410092 | 3300046642 | Bacteria | 804 |
| 656 | Ga0495635_0002970 | 3300046663 | Bacteria | 11637 |
| 657 | Ga0495635_0005150 | 3300046663 | Bacteria | 9103 |
| 658 | Ga0495635_0013555 | 3300046663 | Bacteria | 5704 |
| 659 | Ga0495635_0030701 | 3300046663 | Bacteria | 3733 |
| 660 | Ga0495635_0059348 | 3300046663 | Bacteria | 2630 |
| 661 | Ga0495635_0159151 | 3300046663 | Bacteria | 1537 |
| 662 | Ga0495635_0193183 | 3300046663 | Bacteria | 1381 |
| 663 | Ga0495588_0071613 | 3300046674 | Bacteria | 1803 |
| 664 | Ga0495657_0018029 | 3300046675 | Bacteria | 5117 |
| 665 | Ga0495657_0025619 | 3300046675 | Bacteria | 4186 |
| 666 | Ga0495657_0090532 | 3300046675 | Bacteria | 1963 |
| 667 | Ga0495657_0138095 | 3300046675 | Bacteria | 1521 |
| 668 | Ga0495657_0139129 | 3300046675 | Bacteria | 1514 |
| 669 | Ga0495599_0018642 | 3300046678 | Bacteria | 4323 |
| 670 | Ga0495599_0019985 | 3300046678 | Bacteria | 4171 |
| 671 | Ga0495599_0044277 | 3300046678 | Bacteria | 2791 |
| 672 | Ga0495599_0045652 | 3300046678 | Bacteria | 2747 |
| 673 | Ga0495599_0071120 | 3300046678 | Bacteria | 2171 |
| 674 | Ga0495599_0291326 | 3300046678 | Bacteria | 987 |
| 675 | Ga0495623_0018307 | 3300046679 | Bacteria | 4524 |
| 676 | Ga0495623_0111178 | 3300046679 | Bacteria | 1660 |
| 677 | Ga0495646_0036219 | 3300046680 | Bacteria | 3057 |
| 678 | Ga0495646_0096802 | 3300046680 | Bacteria | 1696 |
| 679 | Ga0495647_0001049 | 3300046681 | Bacteria | 8420 |
| 680 | Ga0495647_0086430 | 3300046681 | Bacteria | 1279 |
| 681 | Ga0495658_0069353 | 3300046683 | Bacteria | 2043 |
| 682 | Ga0495658_0267318 | 3300046683 | Bacteria | 1077 |
| 683 | Ga0495613_0001028 | 3300046689 | Bacteria | 21269 |
| 684 | Ga0495613_0019176 | 3300046689 | Bacteria | 5098 |
| 685 | Ga0495613_0095021 | 3300046689 | Bacteria | 2156 |
| 686 | Ga0495624_0033396 | 3300046690 | Bacteria | 3332 |
| 687 | Ga0495624_0115305 | 3300046690 | Bacteria | 1651 |
| 688 | Ga0495624_0144131 | 3300046690 | Bacteria | 1458 |
| 689 | Ga0495670_0092124 | 3300046691 | Bacteria | 1552 |
| 690 | Ga0495600_0002966 | 3300046809 | Bacteria | 9895 |
| 691 | Ga0495600_0020940 | 3300046809 | Bacteria | 4185 |
| 692 | Ga0495600_0089150 | 3300046809 | Bacteria | 2012 |
| 693 | Ga0495600_0093105 | 3300046809 | Bacteria | 1965 |
| 694 | Ga0495600_0095488 | 3300046809 | Bacteria | 1938 |
| 695 | Ga0495600_0160874 | 3300046809 | Bacteria | 1451 |
| 696 | Ga0495600_0670133 | 3300046809 | Bacteria | 626 |
| 697 | Ga0495581_0000259 | 3300047315 | Bacteria | 25347 |
| 698 | Ga0495581_0038840 | 3300047315 | Bacteria | 2756 |
| 699 | Ga0495581_0059789 | 3300047315 | Bacteria | 2202 |
| 700 | Ga0495581_0097316 | 3300047315 | Bacteria | 1709 |
| 701 | Ga0495604_0007271 | 3300047317 | Bacteria | 8765 |
| 702 | Ga0495604_0015233 | 3300047317 | Bacteria | 6138 |
| 703 | Ga0495604_0029324 | 3300047317 | Bacteria | 4377 |
| 704 | Ga0495604_0147402 | 3300047317 | Bacteria | 1676 |
| 705 | Ga0495636_0034047 | 3300047318 | Bacteria | 2095 |
| 706 | Ga0495674_0006519 | 3300047319 | Bacteria | 11198 |
| 707 | Ga0495674_0008874 | 3300047319 | Bacteria | 9564 |
| 708 | Ga0495674_0030731 | 3300047319 | Bacteria | 4881 |
| 709 | Ga0495674_0052132 | 3300047319 | Bacteria | 3602 |
| 710 | Ga0495674_0166509 | 3300047319 | Bacteria | 1841 |
| 711 | Ga0495674_0169556 | 3300047319 | Bacteria | 1822 |
| 712 | Ga0495674_0174272 | 3300047319 | Bacteria | 1793 |
| 713 | Ga0495672_0153980 | 3300047320 | Bacteria | 1189 |
| 714 | Ga0495676_0003192 | 3300047321 | Bacteria | 14819 |
| 715 | Ga0495676_0004285 | 3300047321 | Bacteria | 13022 |
| 716 | Ga0495676_0088227 | 3300047321 | Bacteria | 2327 |
| 717 | Ga0495680_0006306 | 3300047322 | Bacteria | 11039 |
| 718 | Ga0495680_0020055 | 3300047322 | Bacteria | 5633 |
| 719 | Ga0495680_0021072 | 3300047322 | Bacteria | 5462 |
| 720 | Ga0495680_0031039 | 3300047322 | Bacteria | 4353 |
| 721 | Ga0495680_0034422 | 3300047322 | Bacteria | 4090 |
| 722 | Ga0495680_0071615 | 3300047322 | Bacteria | 2638 |
| 723 | Ga0495680_0085849 | 3300047322 | Bacteria | 2369 |
| 724 | Ga0495675_0009336 | 3300047444 | Bacteria | 6100 |
| 725 | Ga0495675_0055318 | 3300047444 | Bacteria | 2517 |
| 726 | Ga0495675_0068642 | 3300047444 | Bacteria | 2239 |
| 727 | Ga0495675_0140669 | 3300047444 | Bacteria | 1496 |
| 728 | Ga0495685_035437 | 3300047447 | Bacteria | 1715 |
| 729 | Ga0495684_0003764 | 3300047471 | Bacteria | 11835 |
| 730 | Ga0495684_0006732 | 3300047471 | Bacteria | 8922 |
| 731 | Ga0495684_0015296 | 3300047471 | Bacteria | 5909 |
| 732 | Ga0495684_0027313 | 3300047471 | Bacteria | 4382 |
| 733 | Ga0495684_0030709 | 3300047471 | Bacteria | 4125 |
| 734 | Ga0495684_0103828 | 3300047471 | Bacteria | 2148 |
| 735 | Ga0495684_0121656 | 3300047471 | Bacteria | 1965 |
| 736 | Ga0495593_0000939 | 3300047673 | Bacteria | 16979 |
| 737 | Ga0495593_0023596 | 3300047673 | Bacteria | 3417 |
| 738 | Ga0495593_0058014 | 3300047673 | Bacteria | 2031 |
| 739 | Ga0495602_0041462 | 3300048088 | Bacteria | 4204 |
| 740 | Ga0495602_0073501 | 3300048088 | Bacteria | 2910 |
| 741 | Ga0495602_0099160 | 3300048088 | Bacteria | 2395 |
| 742 | Ga0495614_0010267 | 3300048089 | Bacteria | 4130 |
| 743 | Ga0496100_0000466 | 3300048903 | Bacteria | 19411 |
| 744 | Ga0496100_0004465 | 3300048903 | Bacteria | 7422 |
| 745 | Ga0496100_0007116 | 3300048903 | Bacteria | 6145 |
| 746 | Ga0496100_0017209 | 3300048903 | Bacteria | 4263 |
| 747 | Ga0496100_0063048 | 3300048903 | Bacteria | 2448 |
| 748 | Ga0496100_0069688 | 3300048903 | Bacteria | 2343 |
| 749 | Ga0496101_0001809 | 3300048904 | Bacteria | 12877 |
| 750 | Ga0496101_0005804 | 3300048904 | Bacteria | 7895 |
| 751 | Ga0496102_0001111 | 3300048905 | Bacteria | 24695 |
| 752 | Ga0496102_0007545 | 3300048905 | Bacteria | 9298 |
| 753 | Ga0496102_0038987 | 3300048905 | Bacteria | 4291 |
| 754 | Ga0496102_0043526 | 3300048905 | Bacteria | 4072 |
| 755 | Ga0496102_0081114 | 3300048905 | Bacteria | 2990 |
| 756 | Ga0496102_0085413 | 3300048905 | Bacteria | 2914 |
| 757 | Ga0496102_0113978 | 3300048905 | Bacteria | 2522 |
| 758 | Ga0496102_0156224 | 3300048905 | Bacteria | 2144 |
| 759 | Ga0496102_0565683 | 3300048905 | Bacteria | 1059 |
| 760 | Ga0496102_0583553 | 3300048905 | Bacteria | 1040 |
| 761 | Ga0496103_0000325 | 3300048906 | Bacteria | 43734 |
| 762 | Ga0496103_0009479 | 3300048906 | Bacteria | 5765 |
| 763 | Ga0496103_0048063 | 3300048906 | Bacteria | 2636 |
| 764 | Ga0496103_0232211 | 3300048906 | Bacteria | 1187 |
| 765 | Ga0496104_0004493 | 3300048907 | Bacteria | 12153 |
| 766 | Ga0496104_0006961 | 3300048907 | Bacteria | 9971 |
| 767 | Ga0496104_0025994 | 3300048907 | Bacteria | 5399 |
| 768 | Ga0496104_0034615 | 3300048907 | Bacteria | 4711 |
| 769 | Ga0496104_0105516 | 3300048907 | Bacteria | 2700 |
| 770 | Ga0496104_0209971 | 3300048907 | Bacteria | 1858 |
| 771 | Ga0496104_0279855 | 3300048907 | Bacteria | 1581 |
| 772 | Ga0496105_0002369 | 3300048908 | Bacteria | 13651 |
| 773 | Ga0496105_0005086 | 3300048908 | Bacteria | 9969 |
| 774 | Ga0496105_0047702 | 3300048908 | Bacteria | 3535 |
| 775 | Ga0496105_0056642 | 3300048908 | Bacteria | 3235 |
| 776 | Ga0496105_0070159 | 3300048908 | Bacteria | 2896 |
| 777 | Ga0496105_0131559 | 3300048908 | Bacteria | 2063 |
| 778 | Ga0496105_0529172 | 3300048908 | Bacteria | 922 |
| 779 | Ga0496106_0001362 | 3300048909 | Bacteria | 18293 |
| 780 | Ga0496106_0023852 | 3300048909 | Bacteria | 4547 |
| 781 | Ga0496106_0034564 | 3300048909 | Bacteria | 3776 |
| 782 | Ga0496106_0167222 | 3300048909 | Bacteria | 1741 |
| 783 | Ga0496106_0304006 | 3300048909 | Bacteria | 1279 |
| 784 | Ga0496107_0001156 | 3300048910 | Bacteria | 15994 |
| 785 | Ga0496107_0005433 | 3300048910 | Bacteria | 8722 |
| 786 | Ga0496107_0159698 | 3300048910 | Bacteria | 1670 |
| 787 | Ga0496108_0020456 | 3300048911 | Bacteria | 5441 |
| 788 | Ga0496108_0021343 | 3300048911 | Bacteria | 5322 |
| 789 | Ga0496108_0088326 | 3300048911 | Bacteria | 2634 |
| 790 | Ga0496108_0119745 | 3300048911 | Bacteria | 2257 |
| 791 | Ga0496108_0126083 | 3300048911 | Bacteria | 2198 |
| 792 | Ga0496108_0518554 | 3300048911 | Bacteria | 1040 |
| 793 | Ga0496108_0739406 | 3300048911 | Bacteria | 851 |
| 794 | Ga0496108_0765788 | 3300048911 | Bacteria | 834 |
| 795 | Ga0496109_0021430 | 3300048912 | Bacteria | 5713 |
| 796 | Ga0496109_0594084 | 3300048912 | Bacteria | 1043 |
| 797 | Ga0496109_0802475 | 3300048912 | Bacteria | 879 |
| 798 | Ga0496109_0996910 | 3300048912 | Bacteria | 775 |
| 799 | Ga0496110_0078676 | 3300048913 | Bacteria | 2935 |
| 800 | Ga0496110_0082731 | 3300048913 | Bacteria | 2863 |
| 801 | Ga0496110_0092549 | 3300048913 | Bacteria | 2706 |
| 802 | Ga0496110_0259122 | 3300048913 | Bacteria | 1583 |
| 803 | Ga0496110_0413473 | 3300048913 | Bacteria | 1230 |
| 804 | Ga0496111_0415161 | 3300048914 | Bacteria | 994 |
| 805 | Ga0496112_0016784 | 3300048915 | Bacteria | 6867 |
| 806 | Ga0496112_0029501 | 3300048915 | Bacteria | 5305 |
| 807 | Ga0496112_0065957 | 3300048915 | Bacteria | 3572 |
| 808 | Ga0496112_0541432 | 3300048915 | Bacteria | 1098 |
| 809 | Ga0496113_0030139 | 3300048916 | Bacteria | 3925 |
| 810 | Ga0496113_0038047 | 3300048916 | Bacteria | 3535 |
| 811 | Ga0496113_0163600 | 3300048916 | Bacteria | 1760 |
| 812 | Ga0496113_0215179 | 3300048916 | Bacteria | 1530 |
| 813 | Ga0496113_0408474 | 3300048916 | Bacteria | 1090 |
| 814 | Ga0496114_0001628 | 3300048917 | Bacteria | 17045 |
| 815 | Ga0496114_0012380 | 3300048917 | Bacteria | 6827 |
| 816 | Ga0496114_0019031 | 3300048917 | Bacteria | 5563 |
| 817 | Ga0496114_0029356 | 3300048917 | Bacteria | 4519 |
| 818 | Ga0496114_0030315 | 3300048917 | Bacteria | 4450 |
| 819 | Ga0496114_0155050 | 3300048917 | Bacteria | 1988 |
| 820 | Ga0496114_0183763 | 3300048917 | Bacteria | 1826 |
| 821 | Ga0496114_0200650 | 3300048917 | Bacteria | 1747 |
| 822 | Ga0496115_0006660 | 3300048918 | Bacteria | 8478 |
| 823 | Ga0496115_0021261 | 3300048918 | Bacteria | 5011 |
| 824 | Ga0496115_0034382 | 3300048918 | Bacteria | 4005 |
| 825 | Ga0496115_0070080 | 3300048918 | Bacteria | 2841 |
| 826 | Ga0496115_0150799 | 3300048918 | Bacteria | 1920 |
| 827 | Ga0496115_0199551 | 3300048918 | Bacteria | 1653 |
| 828 | Ga0496115_0965798 | 3300048918 | Bacteria | 653 |
| 829 | Ga0496117_0236648 | 3300048920 | Bacteria | 1005 |
| 830 | Ga0496125_0093747 | 3300048928 | Bacteria | 2240 |
| 831 | Ga0496126_0322404 | 3300048929 | Bacteria | 1269 |
| 832 | Ga0496126_0646897 | 3300048929 | Bacteria | 828 |
| 833 | nmdc:mga03683_68821_c1 | 3300050489 | Bacteria | 1509 |
| 834 | nmdc:mga00v17_264512_c1 | 3300050491 | Bacteria | 1116 |
| 835 | nmdc:mga00v17_82622_c1 | 3300050491 | Bacteria | 2008 |
| 836 | nmdc:mga0yw44_229616_c1 | 3300050492 | Bacteria | 1231 |
| 837 | nmdc:mga0yw44_30323_c1 | 3300050492 | Bacteria | 3132 |
| 838 | nmdc:mga06z11_167969_c1 | 3300050494 | Bacteria | 1258 |
| 839 | nmdc:mga05p37_172342_c1 | 3300050507 | Bacteria | 1979 |
| 840 | nmdc:mga05p37_199149_c1 | 3300050507 | Bacteria | 2427 |
| 841 | nmdc:mga05p37_66203_c1 | 3300050507 | Bacteria | 4444 |
| 842 | nmdc:mga09592_23781_c1 | 3300050508 | Bacteria | 5062 |
| 843 | nmdc:mga09592_270_c1 | 3300050508 | Bacteria | 37634 |
| 844 | nmdc:mga0qj67_43207_c1 | 3300050509 | Bacteria | 3549 |
| 845 | nmdc:mga0qj67_49989_c1 | 3300050509 | Bacteria | 3305 |
| 846 | nmdc:mga06r32_181563_c1 | 3300050510 | Bacteria | 1458 |
| 847 | nmdc:mga06r32_416243_c1 | 3300050510 | Bacteria | 1325 |
| 848 | nmdc:mga06r32_518749_c1 | 3300050510 | Bacteria | 1167 |
| 849 | nmdc:mga06r32_9538_c1 | 3300050510 | Bacteria | 8765 |
| 850 | nmdc:mga0n895_990672_c1 | 3300050512 | Bacteria | 822 |
| 851 | nmdc:mga0rr50_28392_c1 | 3300050513 | Bacteria | 3933 |
| 852 | nmdc:mga0rr50_319849_c1 | 3300050513 | Bacteria | 1301 |
| 853 | nmdc:mga0rr50_380489_c1 | 3300050513 | Bacteria | 1190 |
| 854 | nmdc:mga08x19_35523_c1 | 3300050514 | Bacteria | 3153 |
| 855 | nmdc:mga08x19_434490_c1 | 3300050514 | Bacteria | 923 |
| 856 | nmdc:mga0a205_69593_c1 | 3300050515 | Bacteria | 3397 |
| 857 | nmdc:mga0sz30_268407_c1 | 3300050516 | Bacteria | 760 |
| 858 | Ga0495601_0002161 | 3300053077 | Bacteria | 11063 |
| 859 | Ga0495601_0042702 | 3300053077 | Bacteria | 2845 |
| 860 | Ga0495601_0274815 | 3300053077 | Bacteria | 1099 |
| 861 | Ga0495612_0002534 | 3300053078 | Bacteria | 7539 |
| 862 | Ga0495612_0054902 | 3300053078 | Bacteria | 1641 |
| 863 | Ga0495612_0107099 | 3300053078 | Bacteria | 1194 |
| 864 | Ga0500635_0086312 | 3300053080 | Bacteria | 1135 |
| 865 | Ga0495595_0017708 | 3300053084 | Bacteria | 3068 |
| 866 | Ga0495595_0062076 | 3300053084 | Bacteria | 1751 |
| 867 | Ga0495595_0103448 | 3300053084 | Bacteria | 1376 |
| 868 | Ga0495595_0300924 | 3300053084 | Bacteria | 807 |
| 869 | Ga0495595_0404554 | 3300053084 | Bacteria | 692 |
| 870 | Ga0495619_0002498 | 3300053085 | Bacteria | 12040 |
| 871 | Ga0495619_0072445 | 3300053085 | Bacteria | 2307 |
| 872 | Ga0500643_016143 | 3300053087 | Bacteria | 2539 |
| 873 | Ga0500646_0000227 | 3300053090 | Bacteria | 16961 |
| 874 | Ga0500583_0089433 | 3300053092 | Bacteria | 1497 |
| 875 | Ga0500652_000650 | 3300053131 | Bacteria | 11826 |
| 876 | Ga0500652_103213 | 3300053131 | Bacteria | 1192 |
| 877 | Ga0500658_0103063 | 3300053134 | Bacteria | 1248 |
| 878 | Ga0500588_0002499 | 3300053146 | Bacteria | 3750 |
| 879 | Ga0500627_0000697 | 3300053158 | Bacteria | 8936 |
| 880 | Ga0500645_000063 | 3300053730 | Bacteria | 85018 |
| 881 | Ga0466962_0000491 | 3300061719 | Bacteria | 17164 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0996910 | Ga0496109_0996910_169_759 | 178 |
| 2 | 3300005347 | Ga0070668_100023364 | Ga0070668_1000233643 | 180 |
| 3 | 3300005719 | Ga0068861_100075444 | Ga0068861_1000754442 | 180 |
| 4 | 3300013306 | Ga0163162_10451695 | Ga0163162_104516951 | 180 |
| 5 | 3300026118 | Ga0207675_100028799 | Ga0207675_1000287993 | 180 |
| 6 | 3300042005 | Ga0439448_0079217 | Ga0439448_0079217_516_1079 | 181 |
| 7 | 3300005841 | Ga0068863_100147341 | Ga0068863_1001473412 | 184 |
| 8 | 3300026088 | Ga0207641_10093683 | Ga0207641_100936832 | 184 |
| 9 | 3300036401 | Ga0373937_0828406 | Ga0373937_0828406_33_620 | 188 |
| 10 | 3300002077 | JGI24744J21845_10000985 | JGI24744J21845_100009852 | 190 |
| 11 | 3300005328 | Ga0070676_10104642 | Ga0070676_101046422 | 190 |
| 12 | 3300005330 | Ga0070690_100026670 | Ga0070690_1000266702 | 190 |
| 13 | 3300005334 | Ga0068869_100037649 | Ga0068869_1000376493 | 190 |
| 14 | 3300005338 | Ga0068868_100000265 | Ga0068868_10000026512 | 190 |
| 15 | 3300005340 | Ga0070689_100030411 | Ga0070689_1000304113 | 190 |
| 16 | 3300005341 | Ga0070691_10005965 | Ga0070691_100059652 | 190 |
| 17 | 3300005347 | Ga0070668_100000455 | Ga0070668_1000004555 | 190 |
| 18 | 3300005353 | Ga0070669_100020736 | Ga0070669_1000207362 | 190 |
| 19 | 3300005356 | Ga0070674_100000174 | Ga0070674_10000017416 | 190 |
| 20 | 3300005365 | Ga0070688_100016229 | Ga0070688_1000162292 | 190 |
| 21 | 3300005366 | Ga0070659_100032427 | Ga0070659_1000324273 | 190 |
| 22 | 3300005367 | Ga0070667_100000598 | Ga0070667_10000059810 | 190 |
| 23 | 3300005437 | Ga0070710_10001110 | Ga0070710_100011108 | 190 |
| 24 | 3300005438 | Ga0070701_10001050 | Ga0070701_100010505 | 190 |
| 25 | 3300005439 | Ga0070711_100001452 | Ga0070711_1000014523 | 190 |
| 26 | 3300005440 | Ga0070705_100004745 | Ga0070705_1000047455 | 190 |
| 27 | 3300005444 | Ga0070694_100016452 | Ga0070694_1000164524 | 190 |
| 28 | 3300005456 | Ga0070678_100000417 | Ga0070678_1000004178 | 190 |
| 29 | 3300005457 | Ga0070662_100014635 | Ga0070662_1000146352 | 190 |
| 30 | 3300005459 | Ga0068867_100009482 | Ga0068867_1000094825 | 190 |
| 31 | 3300005466 | Ga0070685_10104060 | Ga0070685_101040602 | 190 |
| 32 | 3300005539 | Ga0068853_100038879 | Ga0068853_1000388793 | 190 |
| 33 | 3300005545 | Ga0070695_100013381 | Ga0070695_1000133813 | 190 |
| 34 | 3300005546 | Ga0070696_100006966 | Ga0070696_1000069663 | 190 |
| 35 | 3300005548 | Ga0070665_100044922 | Ga0070665_1000449222 | 190 |
| 36 | 3300005549 | Ga0070704_100004004 | Ga0070704_1000040042 | 190 |
| 37 | 3300005578 | Ga0068854_100000759 | Ga0068854_10000075915 | 190 |
| 38 | 3300005615 | Ga0070702_100003039 | Ga0070702_1000030395 | 190 |
| 39 | 3300005616 | Ga0068852_100027793 | Ga0068852_1000277932 | 190 |
| 40 | 3300005617 | Ga0068859_100000995 | Ga0068859_10000099516 | 190 |
| 41 | 3300005718 | Ga0068866_10000103 | Ga0068866_100001038 | 190 |
| 42 | 3300005842 | Ga0068858_100007072 | Ga0068858_1000070724 | 190 |
| 43 | 3300005843 | Ga0068860_100015253 | Ga0068860_1000152536 | 190 |
| 44 | 3300005844 | Ga0068862_100009073 | Ga0068862_1000090733 | 190 |
| 45 | 3300006163 | Ga0070715_10002094 | Ga0070715_100020943 | 190 |
| 46 | 3300006173 | Ga0070716_100001890 | Ga0070716_1000018904 | 190 |
| 47 | 3300006175 | Ga0070712_100006518 | Ga0070712_1000065182 | 190 |
| 48 | 3300006237 | Ga0097621_100138077 | Ga0097621_1001380772 | 190 |
| 49 | 3300006881 | Ga0068865_100007291 | Ga0068865_1000072912 | 190 |
| 50 | 3300006931 | Ga0097620_100000995 | Ga0097620_1000009959 | 190 |
| 51 | 3300009092 | Ga0105250_10162336 | Ga0105250_101623362 | 190 |
| 52 | 3300009098 | Ga0105245_10003044 | Ga0105245_1000304410 | 190 |
| 53 | 3300009101 | Ga0105247_10000279 | Ga0105247_100002797 | 190 |
| 54 | 3300009148 | Ga0105243_10001443 | Ga0105243_1000144313 | 190 |
| 55 | 3300009176 | Ga0105242_10000551 | Ga0105242_100005519 | 190 |
| 56 | 3300009177 | Ga0105248_10004599 | Ga0105248_1000459910 | 190 |
| 57 | 3300009545 | Ga0105237_10041116 | Ga0105237_100411163 | 190 |
| 58 | 3300009553 | Ga0105249_10011764 | Ga0105249_100117642 | 190 |
| 59 | 3300013306 | Ga0163162_10008789 | Ga0163162_100087894 | 190 |
| 60 | 3300013307 | Ga0157372_10099026 | Ga0157372_100990263 | 190 |
| 61 | 3300014326 | Ga0157380_10000918 | Ga0157380_1000091810 | 190 |
| 62 | 3300014968 | Ga0157379_10000781 | Ga0157379_100007815 | 190 |
| 63 | 3300017792 | Ga0163161_10008981 | Ga0163161_100089816 | 190 |
| 64 | 3300025898 | Ga0207692_10014716 | Ga0207692_100147162 | 190 |
| 65 | 3300025899 | Ga0207642_10000651 | Ga0207642_100006517 | 190 |
| 66 | 3300025900 | Ga0207710_10015088 | Ga0207710_100150882 | 190 |
| 67 | 3300025901 | Ga0207688_10004249 | Ga0207688_100042492 | 190 |
| 68 | 3300025905 | Ga0207685_10003273 | Ga0207685_100032733 | 190 |
| 69 | 3300025906 | Ga0207699_10049900 | Ga0207699_100499002 | 190 |
| 70 | 3300025907 | Ga0207645_10203818 | Ga0207645_102038181 | 190 |
| 71 | 3300025915 | Ga0207693_10000320 | Ga0207693_1000032037 | 190 |
| 72 | 3300025916 | Ga0207663_10004022 | Ga0207663_100040222 | 190 |
| 73 | 3300025926 | Ga0207659_10513281 | Ga0207659_105132812 | 190 |
| 74 | 3300025927 | Ga0207687_10005088 | Ga0207687_100050885 | 190 |
| 75 | 3300025933 | Ga0207706_10011104 | Ga0207706_1001110410 | 190 |
| 76 | 3300025934 | Ga0207686_10055958 | Ga0207686_100559583 | 190 |
| 77 | 3300025935 | Ga0207709_10005487 | Ga0207709_100054876 | 190 |
| 78 | 3300025936 | Ga0207670_10034471 | Ga0207670_100344713 | 190 |
| 79 | 3300025937 | Ga0207669_10000415 | Ga0207669_1000041514 | 190 |
| 80 | 3300025938 | Ga0207704_10000497 | Ga0207704_1000049713 | 190 |
| 81 | 3300025939 | Ga0207665_10006186 | Ga0207665_100061865 | 190 |
| 82 | 3300025942 | Ga0207689_10110200 | Ga0207689_101102003 | 190 |
| 83 | 3300025972 | Ga0207668_10002762 | Ga0207668_100027629 | 190 |
| 84 | 3300025986 | Ga0207658_10026543 | Ga0207658_100265433 | 190 |
| 85 | 3300026023 | Ga0207677_10000663 | Ga0207677_1000066313 | 190 |
| 86 | 3300026035 | Ga0207703_10002809 | Ga0207703_100028096 | 190 |
| 87 | 3300026041 | Ga0207639_10086370 | Ga0207639_100863702 | 190 |
| 88 | 3300026075 | Ga0207708_10022478 | Ga0207708_100224782 | 190 |
| 89 | 3300026078 | Ga0207702_10098495 | Ga0207702_100984951 | 190 |
| 90 | 3300026089 | Ga0207648_10000451 | Ga0207648_1000045139 | 190 |
| 91 | 3300026118 | Ga0207675_100023739 | Ga0207675_1000237393 | 190 |
| 92 | 3300026121 | Ga0207683_10000665 | Ga0207683_1000066526 | 190 |
| 93 | 3300026142 | Ga0207698_10015490 | Ga0207698_100154904 | 190 |
| 94 | 3300028379 | Ga0268266_10032412 | Ga0268266_100324122 | 190 |
| 95 | 3300028381 | Ga0268264_10011372 | Ga0268264_100113724 | 190 |
| 96 | 3300046809 | Ga0495600_0670133 | Ga0495600_0670133_30_602 | 190 |
| 97 | 3300048903 | Ga0496100_0004465 | Ga0496100_0004465_2871_3542 | 190 |
| 98 | 3300048905 | Ga0496102_0007545 | Ga0496102_0007545_3575_4246 | 190 |
| 99 | 3300048906 | Ga0496103_0000325 | Ga0496103_0000325_11040_11711 | 190 |
| 100 | 3300048909 | Ga0496106_0001362 | Ga0496106_0001362_11517_12188 | 190 |
| 101 | 3300048910 | Ga0496107_0001156 | Ga0496107_0001156_13108_13779 | 190 |
| 102 | 3300048917 | Ga0496114_0001628 | Ga0496114_0001628_10475_11146 | 190 |
| 103 | 3300048918 | Ga0496115_0006660 | Ga0496115_0006660_1584_2255 | 190 |
| 104 | 3300013297 | Ga0157378_10001937 | Ga0157378_1000193715 | 192 |
| 105 | 3300013308 | Ga0157375_10006369 | Ga0157375_100063699 | 192 |
| 106 | 3300035691 | Ga0373931_0118059 | Ga0373931_0118059_728_1399 | 192 |
| 107 | 3300048912 | Ga0496109_0802475 | Ga0496109_0802475_52_639 | 192 |
| 108 | 3300048918 | Ga0496115_0965798 | Ga0496115_0965798_25_615 | 192 |
| 109 | 3300053084 | Ga0495595_0404554 | Ga0495595_0404554_33_620 | 192 |
| 110 | 3300041411 | Ga0439466_0090101 | Ga0439466_0090101_153_818 | 193 |
| 111 | 3300005981 | Ga0081538_10089137 | Ga0081538_100891372 | 197 |
| 112 | 3300048903 | Ga0496100_0000466 | Ga0496100_0000466_5077_5745 | 197 |
| 113 | 3300048909 | Ga0496106_0034564 | Ga0496106_0034564_1937_2605 | 197 |
| 114 | 3300048917 | Ga0496114_0030315 | Ga0496114_0030315_2749_3417 | 197 |
| 115 | 3300005330 | Ga0070690_100292530 | Ga0070690_1002925302 | 202 |
| 116 | 3300005356 | Ga0070674_100125559 | Ga0070674_1001255592 | 202 |
| 117 | 3300005456 | Ga0070678_100144298 | Ga0070678_1001442982 | 202 |
| 118 | 3300005544 | Ga0070686_100271563 | Ga0070686_1002715632 | 202 |
| 119 | 3300005718 | Ga0068866_10046459 | Ga0068866_100464592 | 202 |
| 120 | 3300009176 | Ga0105242_10225864 | Ga0105242_102258642 | 202 |
| 121 | 3300009177 | Ga0105248_10190064 | Ga0105248_101900642 | 202 |
| 122 | 3300014968 | Ga0157379_10212942 | Ga0157379_102129422 | 202 |
| 123 | 3300025937 | Ga0207669_10025046 | Ga0207669_100250462 | 202 |
| 124 | 3300026121 | Ga0207683_10077553 | Ga0207683_100775532 | 202 |
| 125 | 3300048904 | Ga0496101_0005804 | Ga0496101_0005804_2180_2896 | 202 |
| 126 | 3300048905 | Ga0496102_0038987 | Ga0496102_0038987_346_1062 | 202 |
| 127 | 3300048907 | Ga0496104_0006961 | Ga0496104_0006961_1174_1890 | 202 |
| 128 | 3300048908 | Ga0496105_0005086 | Ga0496105_0005086_3681_4397 | 202 |
| 129 | 3300048910 | Ga0496107_0005433 | Ga0496107_0005433_2241_2957 | 202 |
| 130 | 3300048918 | Ga0496115_0034382 | Ga0496115_0034382_330_1046 | 202 |
| 131 | 3300005355 | Ga0070671_100115862 | Ga0070671_1001158622 | 204 |
| 132 | 3300005367 | Ga0070667_100202056 | Ga0070667_1002020562 | 204 |
| 133 | 3300005468 | Ga0070707_100328171 | Ga0070707_1003281712 | 204 |
| 134 | 3300005471 | Ga0070698_100004212 | Ga0070698_10000421213 | 204 |
| 135 | 3300005518 | Ga0070699_100136854 | Ga0070699_1001368542 | 204 |
| 136 | 3300005843 | Ga0068860_100384477 | Ga0068860_1003844772 | 204 |
| 137 | 3300009553 | Ga0105249_10024827 | Ga0105249_100248272 | 204 |
| 138 | 3300025922 | Ga0207646_10170287 | Ga0207646_101702872 | 204 |
| 139 | 3300025931 | Ga0207644_10337154 | Ga0207644_103371541 | 204 |
| 140 | 3300025961 | Ga0207712_10303777 | Ga0207712_103037772 | 204 |
| 141 | 3300028379 | Ga0268266_10739900 | Ga0268266_107399001 | 204 |
| 142 | 3300028380 | Ga0268265_10783775 | Ga0268265_107837751 | 204 |
| 143 | 3300046533 | Ga0495640_0379054 | Ga0495640_0379054_10_639 | 204 |
| 144 | 3300048911 | Ga0496108_0088326 | Ga0496108_0088326_14_628 | 204 |
| 145 | 3300048911 | Ga0496108_0126083 | Ga0496108_0126083_242_913 | 204 |
| 146 | 3300048913 | Ga0496110_0413473 | Ga0496110_0413473_29_700 | 204 |
| 147 | 3300048915 | Ga0496112_0065957 | Ga0496112_0065957_597_1268 | 204 |
| 148 | 3300048916 | Ga0496113_0163600 | Ga0496113_0163600_221_892 | 204 |
| 149 | 3300053078 | Ga0495612_0107099 | Ga0495612_0107099_28_774 | 204 |
| 150 | 3300005467 | Ga0070706_100409818 | Ga0070706_1004098182 | 205 |
| 151 | 3300046454 | Ga0495592_0109978 | Ga0495592_0109978_879_1580 | 205 |
| 152 | 3300046526 | Ga0495666_0295064 | Ga0495666_0295064_17_718 | 205 |
| 153 | 3300046543 | Ga0495645_0110710 | Ga0495645_0110710_529_1230 | 205 |
| 154 | 3300046559 | Ga0495667_0017425 | Ga0495667_0017425_3675_4376 | 205 |
| 155 | 3300046642 | Ga0495634_0204909 | Ga0495634_0204909_72_773 | 205 |
| 156 | 3300046675 | Ga0495657_0138095 | Ga0495657_0138095_530_1231 | 205 |
| 157 | 3300005434 | Ga0070709_10016737 | Ga0070709_100167373 | 206 |
| 158 | 3300005435 | Ga0070714_101136655 | Ga0070714_1011366551 | 206 |
| 159 | 3300005437 | Ga0070710_10028063 | Ga0070710_100280632 | 206 |
| 160 | 3300005439 | Ga0070711_100122108 | Ga0070711_1001221082 | 206 |
| 161 | 3300005841 | Ga0068863_100011989 | Ga0068863_1000119893 | 206 |
| 162 | 3300006163 | Ga0070715_10017521 | Ga0070715_100175212 | 206 |
| 163 | 3300006173 | Ga0070716_100024660 | Ga0070716_1000246603 | 206 |
| 164 | 3300006175 | Ga0070712_100552352 | Ga0070712_1005523522 | 206 |
| 165 | 3300025906 | Ga0207699_10006080 | Ga0207699_100060807 | 206 |
| 166 | 3300025916 | Ga0207663_10774373 | Ga0207663_107743731 | 206 |
| 167 | 3300025928 | Ga0207700_10016141 | Ga0207700_100161416 | 206 |
| 168 | 3300025928 | Ga0207700_10492374 | Ga0207700_104923742 | 206 |
| 169 | 3300046809 | Ga0495600_0160874 | Ga0495600_0160874_25_651 | 206 |
| 170 | 3300025972 | Ga0207668_10168510 | Ga0207668_101685102 | 207 |
| 171 | 3300053131 | Ga0500652_000650 | Ga0500652_000650_5419_6117 | 208 |
| 172 | 3300048907 | Ga0496104_0105516 | Ga0496104_0105516_996_1667 | 209 |
| 173 | 3300050510 | nmdc:mga06r32_518749_c1 | nmdc:mga06r32_518749_c1_383_1021 | 209 |
| 174 | 3300050510 | nmdc:mga06r32_9538_c1 | nmdc:mga06r32_9538_c1_4570_5208 | 209 |
| 175 | 3300013306 | Ga0163162_10305651 | Ga0163162_103056513 | 211 |
| 176 | 3300048917 | Ga0496114_0200650 | Ga0496114_0200650_275_916 | 211 |
| 177 | iso_pu_bacteria | 2643221711 | 2644610042 | 211 |
| 178 | iso_pu_bacteria | 2818991458 | 2819667795 | 211 |
| 179 | 3300005337 | Ga0070682_100122226 | Ga0070682_1001222262 | 212 |
| 180 | 3300005343 | Ga0070687_100054420 | Ga0070687_1000544202 | 212 |
| 181 | 3300005535 | Ga0070684_101183786 | Ga0070684_1011837861 | 212 |
| 182 | 3300005548 | Ga0070665_100233181 | Ga0070665_1002331811 | 212 |
| 183 | 3300005618 | Ga0068864_100281321 | Ga0068864_1002813211 | 212 |
| 184 | 3300006028 | Ga0070717_10304231 | Ga0070717_103042312 | 212 |
| 185 | 3300006847 | Ga0075431_100014875 | Ga0075431_1000148753 | 212 |
| 186 | 3300006847 | Ga0075431_100204899 | Ga0075431_1002048992 | 212 |
| 187 | 3300009148 | Ga0105243_10106616 | Ga0105243_101066164 | 212 |
| 188 | 3300009176 | Ga0105242_10772909 | Ga0105242_107729091 | 212 |
| 189 | 3300009551 | Ga0105238_10120598 | Ga0105238_101205983 | 212 |
| 190 | 3300009553 | Ga0105249_10077184 | Ga0105249_100771844 | 212 |
| 191 | 3300010375 | Ga0105239_10123756 | Ga0105239_101237565 | 212 |
| 192 | 3300011119 | Ga0105246_10170648 | Ga0105246_101706482 | 212 |
| 193 | 3300013308 | Ga0157375_10490605 | Ga0157375_104906052 | 212 |
| 194 | 3300014325 | Ga0163163_10347185 | Ga0163163_103471853 | 212 |
| 195 | 3300014326 | Ga0157380_10149743 | Ga0157380_101497432 | 212 |
| 196 | 3300025937 | Ga0207669_10133823 | Ga0207669_101338233 | 212 |
| 197 | 3300025945 | Ga0207679_10861915 | Ga0207679_108619151 | 212 |
| 198 | 3300025972 | Ga0207668_10306978 | Ga0207668_103069782 | 212 |
| 199 | 3300026089 | Ga0207648_10085983 | Ga0207648_100859832 | 212 |
| 200 | 3300026121 | Ga0207683_10057046 | Ga0207683_100570463 | 212 |
| 201 | 3300041410 | Ga0439461_0000425 | Ga0439461_0000425_3550_4215 | 212 |
| 202 | 3300041411 | Ga0439466_0020257 | Ga0439466_0020257_506_1171 | 212 |
| 203 | 3300041997 | Ga0439431_0015856 | Ga0439431_0015856_864_1529 | 212 |
| 204 | 3300042002 | Ga0439442_006464 | Ga0439442_006464_435_1100 | 212 |
| 205 | 3300042435 | Ga0439434_0035218 | Ga0439434_0035218_651_1316 | 212 |
| 206 | 3300044658 | Ga0466972_0046925 | Ga0466972_0046925_1215_1874 | 212 |
| 207 | 3300044735 | Ga0466968_0022125 | Ga0466968_0022125_589_1248 | 212 |
| 208 | 3300045049 | Ga0466959_0132409 | Ga0466959_0132409_659_1318 | 212 |
| 209 | 3300046463 | Ga0495653_0067083 | Ga0495653_0067083_420_1064 | 212 |
| 210 | 3300046477 | Ga0495664_0306910 | Ga0495664_0306910_155_799 | 212 |
| 211 | 3300046537 | Ga0495598_0193629 | Ga0495598_0193629_27_671 | 212 |
| 212 | 3300048908 | Ga0496105_0131559 | Ga0496105_0131559_553_1197 | 212 |
| 213 | 3300048911 | Ga0496108_0739406 | Ga0496108_0739406_126_770 | 212 |
| 214 | 3300048911 | Ga0496108_0765788 | Ga0496108_0765788_106_750 | 212 |
| 215 | 3300048913 | Ga0496110_0259122 | Ga0496110_0259122_889_1533 | 212 |
| 216 | iso_pu_bacteria | 2643221687 | 2644486368 | 212 |
| 217 | iso_pu_bacteria | 2902837492 | 2902840215 | 212 |
| 218 | 3300005471 | Ga0070698_100003317 | Ga0070698_1000033174 | 213 |
| 219 | 3300006051 | Ga0075364_10086242 | Ga0075364_100862422 | 213 |
| 220 | 3300006847 | Ga0075431_100774487 | Ga0075431_1007744872 | 213 |
| 221 | 3300026121 | Ga0207683_10574394 | Ga0207683_105743942 | 213 |
| 222 | 3300031852 | Ga0307410_10525727 | Ga0307410_105257272 | 213 |
| 223 | 3300048903 | Ga0496100_0007116 | Ga0496100_0007116_975_1631 | 213 |
| 224 | 3300048904 | Ga0496101_0001809 | Ga0496101_0001809_8866_9522 | 213 |
| 225 | 3300048905 | Ga0496102_0001111 | Ga0496102_0001111_10959_11615 | 213 |
| 226 | 3300048905 | Ga0496102_0081114 | Ga0496102_0081114_1951_2610 | 213 |
| 227 | 3300048906 | Ga0496103_0048063 | Ga0496103_0048063_1445_2101 | 213 |
| 228 | 3300048906 | Ga0496103_0232211 | Ga0496103_0232211_40_708 | 213 |
| 229 | 3300048907 | Ga0496104_0004493 | Ga0496104_0004493_4631_5287 | 213 |
| 230 | 3300048907 | Ga0496104_0025994 | Ga0496104_0025994_3116_3772 | 213 |
| 231 | 3300048908 | Ga0496105_0002369 | Ga0496105_0002369_8916_9572 | 213 |
| 232 | 3300048908 | Ga0496105_0070159 | Ga0496105_0070159_602_1258 | 213 |
| 233 | 3300048908 | Ga0496105_0529172 | Ga0496105_0529172_54_713 | 213 |
| 234 | 3300048913 | Ga0496110_0082731 | Ga0496110_0082731_179_835 | 213 |
| 235 | 3300048914 | Ga0496111_0415161 | Ga0496111_0415161_144_800 | 213 |
| 236 | 3300048916 | Ga0496113_0030139 | Ga0496113_0030139_2488_3147 | 213 |
| 237 | 3300048916 | Ga0496113_0408474 | Ga0496113_0408474_195_851 | 213 |
| 238 | 3300048917 | Ga0496114_0019031 | Ga0496114_0019031_4473_5129 | 213 |
| 239 | 3300048917 | Ga0496114_0183763 | Ga0496114_0183763_199_855 | 213 |
| 240 | 3300048918 | Ga0496115_0150799 | Ga0496115_0150799_491_1147 | 213 |
| 241 | 3300050491 | nmdc:mga00v17_264512_c1 | nmdc:mga00v17_264512_c1_49_711 | 213 |
| 242 | 3300050510 | nmdc:mga06r32_416243_c1 | nmdc:mga06r32_416243_c1_399_1055 | 213 |
| 243 | 3300025303 | Ga0209051_1006886 | Ga0209051_10068862 | 214 |
| 244 | 3300025939 | Ga0207665_10022481 | Ga0207665_100224813 | 214 |
| 245 | 3300035086 | Ga0373934_0038478 | Ga0373934_0038478_71_742 | 214 |
| 246 | 3300035118 | Ga0373954_0085055 | Ga0373954_0085055_825_1496 | 214 |
| 247 | 3300035119 | Ga0373956_0059799 | Ga0373956_0059799_961_1632 | 214 |
| 248 | 3300035120 | Ga0373957_0040059 | Ga0373957_0040059_971_1642 | 214 |
| 249 | 3300035691 | Ga0373931_0268185 | Ga0373931_0268185_107_808 | 214 |
| 250 | 3300035724 | Ga0373933_0020937 | Ga0373933_0020937_953_1624 | 214 |
| 251 | 3300037853 | Ga0436364_0922968 | Ga0436364_0922968_1036_1707 | 214 |
| 252 | 3300044765 | Ga0466970_0033353 | Ga0466970_0033353_715_1377 | 214 |
| 253 | 3300046663 | Ga0495635_0013555 | Ga0495635_0013555_591_1262 | 214 |
| 254 | 3300046809 | Ga0495600_0089150 | Ga0495600_0089150_1303_1974 | 214 |
| 255 | 3300047319 | Ga0495674_0174272 | Ga0495674_0174272_967_1638 | 214 |
| 256 | 3300047322 | Ga0495680_0085849 | Ga0495680_0085849_1345_2016 | 214 |
| 257 | 3300047444 | Ga0495675_0055318 | Ga0495675_0055318_1060_1731 | 214 |
| 258 | 3300047471 | Ga0495684_0121656 | Ga0495684_0121656_958_1629 | 214 |
| 259 | 3300050492 | nmdc:mga0yw44_229616_c1 | nmdc:mga0yw44_229616_c1_538_1215 | 214 |
| 260 | 3300053084 | Ga0495595_0300924 | Ga0495595_0300924_49_720 | 214 |
| 261 | iso_pu_bacteria | 2643221690 | 2644506735 | 214 |
| 262 | iso_pu_bacteria | 2643221694 | 2644527727 | 214 |
| 263 | iso_pu_bacteria | 2643221722 | 2644670652 | 214 |
| 264 | iso_pu_bacteria | 2675903059 | 2676483549 | 214 |
| 265 | iso_pu_bacteria | 2738541274 | 2738706200 | 214 |
| 266 | iso_pu_bacteria | 2738543028 | 2739332898 | 214 |
| 267 | 3300002077 | JGI24744J21845_10024362 | JGI24744J21845_100243621 | 215 |
| 268 | 3300005338 | Ga0068868_100088550 | Ga0068868_1000885502 | 215 |
| 269 | 3300005347 | Ga0070668_100146899 | Ga0070668_1001468992 | 215 |
| 270 | 3300005356 | Ga0070674_100006521 | Ga0070674_1000065215 | 215 |
| 271 | 3300005364 | Ga0070673_100230127 | Ga0070673_1002301272 | 215 |
| 272 | 3300005367 | Ga0070667_100166430 | Ga0070667_1001664302 | 215 |
| 273 | 3300005434 | Ga0070709_10085613 | Ga0070709_100856131 | 215 |
| 274 | 3300005435 | Ga0070714_100100783 | Ga0070714_1001007832 | 215 |
| 275 | 3300005437 | Ga0070710_10020610 | Ga0070710_100206102 | 215 |
| 276 | 3300005439 | Ga0070711_100009619 | Ga0070711_1000096194 | 215 |
| 277 | 3300005456 | Ga0070678_100056036 | Ga0070678_1000560362 | 215 |
| 278 | 3300005457 | Ga0070662_100051034 | Ga0070662_1000510342 | 215 |
| 279 | 3300005539 | Ga0068853_100061169 | Ga0068853_1000611693 | 215 |
| 280 | 3300005548 | Ga0070665_100019640 | Ga0070665_1000196404 | 215 |
| 281 | 3300005549 | Ga0070704_100038335 | Ga0070704_1000383352 | 215 |
| 282 | 3300005578 | Ga0068854_100406104 | Ga0068854_1004061041 | 215 |
| 283 | 3300005618 | Ga0068864_100135672 | Ga0068864_1001356721 | 215 |
| 284 | 3300005718 | Ga0068866_10101580 | Ga0068866_101015802 | 215 |
| 285 | 3300005719 | Ga0068861_100079890 | Ga0068861_1000798902 | 215 |
| 286 | 3300005834 | Ga0068851_10127321 | Ga0068851_101273212 | 215 |
| 287 | 3300005841 | Ga0068863_100412844 | Ga0068863_1004128442 | 215 |
| 288 | 3300005937 | Ga0081455_10017921 | Ga0081455_100179212 | 215 |
| 289 | 3300006038 | Ga0075365_10006636 | Ga0075365_100066364 | 215 |
| 290 | 3300006173 | Ga0070716_100119642 | Ga0070716_1001196422 | 215 |
| 291 | 3300006173 | Ga0070716_100177433 | Ga0070716_1001774332 | 215 |
| 292 | 3300006175 | Ga0070712_100349330 | Ga0070712_1003493302 | 215 |
| 293 | 3300006178 | Ga0075367_10173930 | Ga0075367_101739302 | 215 |
| 294 | 3300006186 | Ga0075369_10006227 | Ga0075369_100062274 | 215 |
| 295 | 3300006237 | Ga0097621_100156100 | Ga0097621_1001561002 | 215 |
| 296 | 3300006844 | Ga0075428_100001048 | Ga0075428_10000104828 | 215 |
| 297 | 3300006846 | Ga0075430_100012222 | Ga0075430_1000122228 | 215 |
| 298 | 3300006847 | Ga0075431_100364054 | Ga0075431_1003640542 | 215 |
| 299 | 3300006881 | Ga0068865_100436798 | Ga0068865_1004367982 | 215 |
| 300 | 3300009098 | Ga0105245_10144351 | Ga0105245_101443512 | 215 |
| 301 | 3300009098 | Ga0105245_10781862 | Ga0105245_107818622 | 215 |
| 302 | 3300009101 | Ga0105247_10015410 | Ga0105247_100154103 | 215 |
| 303 | 3300009147 | Ga0114129_10025054 | Ga0114129_100250546 | 215 |
| 304 | 3300009148 | Ga0105243_10063692 | Ga0105243_100636922 | 215 |
| 305 | 3300009177 | Ga0105248_10136290 | Ga0105248_101362902 | 215 |
| 306 | 3300009545 | Ga0105237_10529268 | Ga0105237_105292682 | 215 |
| 307 | 3300009553 | Ga0105249_10160180 | Ga0105249_101601802 | 215 |
| 308 | 3300011119 | Ga0105246_10018664 | Ga0105246_100186642 | 215 |
| 309 | 3300013306 | Ga0163162_10380728 | Ga0163162_103807281 | 215 |
| 310 | 3300013308 | Ga0157375_10802315 | Ga0157375_108023152 | 215 |
| 311 | 3300014969 | Ga0157376_10909984 | Ga0157376_109099841 | 215 |
| 312 | 3300025885 | Ga0207653_10032963 | Ga0207653_100329632 | 215 |
| 313 | 3300025898 | Ga0207692_10029842 | Ga0207692_100298422 | 215 |
| 314 | 3300025900 | Ga0207710_10080859 | Ga0207710_100808592 | 215 |
| 315 | 3300025901 | Ga0207688_10014643 | Ga0207688_100146432 | 215 |
| 316 | 3300025904 | Ga0207647_10019580 | Ga0207647_100195802 | 215 |
| 317 | 3300025905 | Ga0207685_10023198 | Ga0207685_100231982 | 215 |
| 318 | 3300025906 | Ga0207699_10075340 | Ga0207699_100753402 | 215 |
| 319 | 3300025907 | Ga0207645_10308318 | Ga0207645_103083182 | 215 |
| 320 | 3300025915 | Ga0207693_10017765 | Ga0207693_100177653 | 215 |
| 321 | 3300025916 | Ga0207663_10003612 | Ga0207663_100036125 | 215 |
| 322 | 3300025919 | Ga0207657_10601486 | Ga0207657_106014861 | 215 |
| 323 | 3300025924 | Ga0207694_10446478 | Ga0207694_104464782 | 215 |
| 324 | 3300025927 | Ga0207687_10025124 | Ga0207687_100251243 | 215 |
| 325 | 3300025929 | Ga0207664_10121171 | Ga0207664_101211712 | 215 |
| 326 | 3300025933 | Ga0207706_10037870 | Ga0207706_100378702 | 215 |
| 327 | 3300025935 | Ga0207709_10035131 | Ga0207709_100351313 | 215 |
| 328 | 3300025936 | Ga0207670_10264605 | Ga0207670_102646052 | 215 |
| 329 | 3300025938 | Ga0207704_10047128 | Ga0207704_100471282 | 215 |
| 330 | 3300025938 | Ga0207704_10369790 | Ga0207704_103697901 | 215 |
| 331 | 3300025939 | Ga0207665_10032442 | Ga0207665_100324423 | 215 |
| 332 | 3300025940 | Ga0207691_10035502 | Ga0207691_100355023 | 215 |
| 333 | 3300025942 | Ga0207689_10012026 | Ga0207689_100120264 | 215 |
| 334 | 3300025960 | Ga0207651_10024297 | Ga0207651_100242972 | 215 |
| 335 | 3300025961 | Ga0207712_10071413 | Ga0207712_100714132 | 215 |
| 336 | 3300025981 | Ga0207640_10252662 | Ga0207640_102526622 | 215 |
| 337 | 3300026023 | Ga0207677_10076042 | Ga0207677_100760421 | 215 |
| 338 | 3300026067 | Ga0207678_10048537 | Ga0207678_100485373 | 215 |
| 339 | 3300026075 | Ga0207708_10006741 | Ga0207708_100067417 | 215 |
| 340 | 3300026088 | Ga0207641_10223635 | Ga0207641_102236352 | 215 |
| 341 | 3300026121 | Ga0207683_10210305 | Ga0207683_102103052 | 215 |
| 342 | 3300035112 | Ga0373932_0029274 | Ga0373932_0029274_221_892 | 215 |
| 343 | 3300035114 | Ga0373939_0034308 | Ga0373939_0034308_445_1116 | 215 |
| 344 | 3300035691 | Ga0373931_0039606 | Ga0373931_0039606_522_1193 | 215 |
| 345 | 3300044901 | Ga0466960_0148844 | Ga0466960_0148844_138_809 | 215 |
| 346 | 3300045976 | Ga0466967_0104797 | Ga0466967_0104797_1139_1813 | 215 |
| 347 | 3300045976 | Ga0466967_0331319 | Ga0466967_0331319_763_1434 | 215 |
| 348 | 3300046615 | Ga0495656_0067259 | Ga0495656_0067259_30_686 | 215 |
| 349 | 3300048903 | Ga0496100_0069688 | Ga0496100_0069688_291_962 | 215 |
| 350 | 3300048905 | Ga0496102_0043526 | Ga0496102_0043526_1714_2385 | 215 |
| 351 | 3300048905 | Ga0496102_0113978 | Ga0496102_0113978_529_1200 | 215 |
| 352 | 3300048905 | Ga0496102_0565683 | Ga0496102_0565683_268_939 | 215 |
| 353 | 3300048906 | Ga0496103_0009479 | Ga0496103_0009479_1264_1935 | 215 |
| 354 | 3300048907 | Ga0496104_0279855 | Ga0496104_0279855_239_910 | 215 |
| 355 | 3300048909 | Ga0496106_0167222 | Ga0496106_0167222_799_1470 | 215 |
| 356 | 3300048911 | Ga0496108_0021343 | Ga0496108_0021343_3064_3735 | 215 |
| 357 | 3300048912 | Ga0496109_0021430 | Ga0496109_0021430_1887_2558 | 215 |
| 358 | 3300048913 | Ga0496110_0092549 | Ga0496110_0092549_1157_1828 | 215 |
| 359 | 3300048915 | Ga0496112_0016784 | Ga0496112_0016784_2869_3540 | 215 |
| 360 | 3300048916 | Ga0496113_0038047 | Ga0496113_0038047_106_777 | 215 |
| 361 | 3300048917 | Ga0496114_0012380 | Ga0496114_0012380_619_1290 | 215 |
| 362 | 3300048918 | Ga0496115_0199551 | Ga0496115_0199551_99_770 | 215 |
| 363 | 3300050489 | nmdc:mga03683_68821_c1 | nmdc:mga03683_68821_c1_695_1366 | 215 |
| 364 | 3300050491 | nmdc:mga00v17_82622_c1 | nmdc:mga00v17_82622_c1_142_813 | 215 |
| 365 | 3300050494 | nmdc:mga06z11_167969_c1 | nmdc:mga06z11_167969_c1_367_1038 | 215 |
| 366 | 3300050507 | nmdc:mga05p37_66203_c1 | nmdc:mga05p37_66203_c1_503_1174 | 215 |
| 367 | 3300050509 | nmdc:mga0qj67_43207_c1 | nmdc:mga0qj67_43207_c1_1003_1674 | 215 |
| 368 | 3300050510 | nmdc:mga06r32_181563_c1 | nmdc:mga06r32_181563_c1_108_779 | 215 |
| 369 | 3300053080 | Ga0500635_0086312 | Ga0500635_0086312_271_948 | 215 |
| 370 | 3300005435 | Ga0070714_100076583 | Ga0070714_1000765833 | 216 |
| 371 | 3300006173 | Ga0070716_100015780 | Ga0070716_1000157803 | 216 |
| 372 | 3300013308 | Ga0157375_11098204 | Ga0157375_110982042 | 216 |
| 373 | 3300025303 | Ga0209051_1072020 | Ga0209051_10720202 | 216 |
| 374 | 3300025898 | Ga0207692_10003051 | Ga0207692_100030514 | 216 |
| 375 | 3300025906 | Ga0207699_10009375 | Ga0207699_100093753 | 216 |
| 376 | 3300025929 | Ga0207664_10279286 | Ga0207664_102792861 | 216 |
| 377 | 3300025939 | Ga0207665_10046112 | Ga0207665_100461124 | 216 |
| 378 | 3300032004 | Ga0307414_10779706 | Ga0307414_107797061 | 216 |
| 379 | 3300032126 | Ga0307415_100481297 | Ga0307415_1004812971 | 216 |
| 380 | 3300041451 | Ga0451791_1188155 | Ga0451791_1188155_785_1447 | 216 |
| 381 | 3300041460 | Ga0451802_0165858 | Ga0451802_0165858_150_812 | 216 |
| 382 | 3300041496 | Ga0451839_1060590 | Ga0451839_1060590_159_821 | 216 |
| 383 | 3300046460 | Ga0495638_0179154 | Ga0495638_0179154_130_804 | 216 |
| 384 | 3300047320 | Ga0495672_0153980 | Ga0495672_0153980_15_689 | 216 |
| 385 | 3300048928 | Ga0496125_0093747 | Ga0496125_0093747_1479_2159 | 216 |
| 386 | 3300048929 | Ga0496126_0322404 | Ga0496126_0322404_562_1242 | 216 |
| 387 | 3300050492 | nmdc:mga0yw44_30323_c1 | nmdc:mga0yw44_30323_c1_958_1635 | 216 |
| 388 | 3300050516 | nmdc:mga0sz30_268407_c1 | nmdc:mga0sz30_268407_c1_29_703 | 216 |
| 389 | 3300053087 | Ga0500643_016143 | Ga0500643_016143_632_1306 | 216 |
| 390 | 3300053131 | Ga0500652_103213 | Ga0500652_103213_384_1058 | 216 |
| 391 | 3300053134 | Ga0500658_0103063 | Ga0500658_0103063_401_1075 | 216 |
| 392 | 3300053158 | Ga0500627_0000697 | Ga0500627_0000697_7094_7768 | 216 |
| 393 | 3300053730 | Ga0500645_000063 | Ga0500645_000063_9549_10229 | 216 |
| 394 | iso_pu_bacteria | 2939582691 | 2939587394 | 216 |
| 395 | 3300005335 | Ga0070666_10047828 | Ga0070666_100478283 | 217 |
| 396 | 3300005336 | Ga0070680_100079057 | Ga0070680_1000790573 | 217 |
| 397 | 3300005337 | Ga0070682_100031720 | Ga0070682_1000317203 | 217 |
| 398 | 3300005340 | Ga0070689_100164351 | Ga0070689_1001643511 | 217 |
| 399 | 3300005341 | Ga0070691_10050323 | Ga0070691_100503231 | 217 |
| 400 | 3300005344 | Ga0070661_100008632 | Ga0070661_1000086329 | 217 |
| 401 | 3300005354 | Ga0070675_100390671 | Ga0070675_1003906711 | 217 |
| 402 | 3300005364 | Ga0070673_100196242 | Ga0070673_1001962422 | 217 |
| 403 | 3300005367 | Ga0070667_101046919 | Ga0070667_1010469191 | 217 |
| 404 | 3300005438 | Ga0070701_10094086 | Ga0070701_100940862 | 217 |
| 405 | 3300005455 | Ga0070663_100021659 | Ga0070663_1000216592 | 217 |
| 406 | 3300005456 | Ga0070678_100767032 | Ga0070678_1007670321 | 217 |
| 407 | 3300005535 | Ga0070684_100038614 | Ga0070684_1000386142 | 217 |
| 408 | 3300005543 | Ga0070672_100052590 | Ga0070672_1000525903 | 217 |
| 409 | 3300005544 | Ga0070686_100521776 | Ga0070686_1005217762 | 217 |
| 410 | 3300005545 | Ga0070695_100198376 | Ga0070695_1001983762 | 217 |
| 411 | 3300005547 | Ga0070693_100024477 | Ga0070693_1000244773 | 217 |
| 412 | 3300005549 | Ga0070704_100323199 | Ga0070704_1003231992 | 217 |
| 413 | 3300005563 | Ga0068855_100271881 | Ga0068855_1002718813 | 217 |
| 414 | 3300005563 | Ga0068855_100571828 | Ga0068855_1005718282 | 217 |
| 415 | 3300005577 | Ga0068857_100058147 | Ga0068857_1000581472 | 217 |
| 416 | 3300005616 | Ga0068852_100062573 | Ga0068852_1000625732 | 217 |
| 417 | 3300005840 | Ga0068870_10050765 | Ga0068870_100507652 | 217 |
| 418 | 3300006028 | Ga0070717_10236287 | Ga0070717_102362874 | 217 |
| 419 | 3300006163 | Ga0070715_10004368 | Ga0070715_100043683 | 217 |
| 420 | 3300006173 | Ga0070716_100509344 | Ga0070716_1005093441 | 217 |
| 421 | 3300006237 | Ga0097621_100040409 | Ga0097621_1000404092 | 217 |
| 422 | 3300006358 | Ga0068871_100078058 | Ga0068871_1000780583 | 217 |
| 423 | 3300006844 | Ga0075428_100000121 | Ga0075428_10000012159 | 217 |
| 424 | 3300006871 | Ga0075434_100513031 | Ga0075434_1005130312 | 217 |
| 425 | 3300006881 | Ga0068865_100101723 | Ga0068865_1001017233 | 217 |
| 426 | 3300006914 | Ga0075436_100209484 | Ga0075436_1002094842 | 217 |
| 427 | 3300007076 | Ga0075435_100135673 | Ga0075435_1001356732 | 217 |
| 428 | 3300007076 | Ga0075435_100585034 | Ga0075435_1005850341 | 217 |
| 429 | 3300009011 | Ga0105251_10130454 | Ga0105251_101304542 | 217 |
| 430 | 3300009093 | Ga0105240_10125005 | Ga0105240_101250053 | 217 |
| 431 | 3300009101 | Ga0105247_10065084 | Ga0105247_100650842 | 217 |
| 432 | 3300009148 | Ga0105243_10922410 | Ga0105243_109224101 | 217 |
| 433 | 3300009545 | Ga0105237_10619239 | Ga0105237_106192392 | 217 |
| 434 | 3300009551 | Ga0105238_10089251 | Ga0105238_100892513 | 217 |
| 435 | 3300009551 | Ga0105238_10755169 | Ga0105238_107551692 | 217 |
| 436 | 3300011119 | Ga0105246_10075433 | Ga0105246_100754332 | 217 |
| 437 | 3300013100 | Ga0157373_10303934 | Ga0157373_103039342 | 217 |
| 438 | 3300013104 | Ga0157370_10344684 | Ga0157370_103446842 | 217 |
| 439 | 3300013105 | Ga0157369_10104777 | Ga0157369_101047771 | 217 |
| 440 | 3300013296 | Ga0157374_10535313 | Ga0157374_105353132 | 217 |
| 441 | 3300013306 | Ga0163162_10324934 | Ga0163162_103249341 | 217 |
| 442 | 3300013308 | Ga0157375_10184412 | Ga0157375_101844123 | 217 |
| 443 | 3300014325 | Ga0163163_10075470 | Ga0163163_100754703 | 217 |
| 444 | 3300025900 | Ga0207710_10005916 | Ga0207710_100059163 | 217 |
| 445 | 3300025901 | Ga0207688_10006764 | Ga0207688_100067644 | 217 |
| 446 | 3300025903 | Ga0207680_10129293 | Ga0207680_101292932 | 217 |
| 447 | 3300025906 | Ga0207699_10004754 | Ga0207699_100047542 | 217 |
| 448 | 3300025912 | Ga0207707_10216807 | Ga0207707_102168072 | 217 |
| 449 | 3300025917 | Ga0207660_10206965 | Ga0207660_102069652 | 217 |
| 450 | 3300025918 | Ga0207662_10029765 | Ga0207662_100297652 | 217 |
| 451 | 3300025926 | Ga0207659_10117533 | Ga0207659_101175332 | 217 |
| 452 | 3300025928 | Ga0207700_10014376 | Ga0207700_100143764 | 217 |
| 453 | 3300025931 | Ga0207644_10317424 | Ga0207644_103174242 | 217 |
| 454 | 3300025939 | Ga0207665_10231340 | Ga0207665_102313402 | 217 |
| 455 | 3300025941 | Ga0207711_10157217 | Ga0207711_101572172 | 217 |
| 456 | 3300025942 | Ga0207689_10009038 | Ga0207689_100090382 | 217 |
| 457 | 3300025949 | Ga0207667_10686769 | Ga0207667_106867692 | 217 |
| 458 | 3300025949 | Ga0207667_10839335 | Ga0207667_108393352 | 217 |
| 459 | 3300025960 | Ga0207651_10041183 | Ga0207651_100411832 | 217 |
| 460 | 3300025961 | Ga0207712_10666013 | Ga0207712_106660131 | 217 |
| 461 | 3300026035 | Ga0207703_10228227 | Ga0207703_102282271 | 217 |
| 462 | 3300026067 | Ga0207678_10013701 | Ga0207678_100137014 | 217 |
| 463 | 3300026095 | Ga0207676_10037818 | Ga0207676_100378183 | 217 |
| 464 | 3300026116 | Ga0207674_10005304 | Ga0207674_100053042 | 217 |
| 465 | 3300026118 | Ga0207675_100053244 | Ga0207675_1000532442 | 217 |
| 466 | 3300034816 | Ga0373930_0002391 | Ga0373930_0002391_1002_1664 | 217 |
| 467 | 3300035084 | Ga0373928_0064894 | Ga0373928_0064894_201_863 | 217 |
| 468 | 3300035085 | Ga0373929_0014121 | Ga0373929_0014121_222_884 | 217 |
| 469 | 3300035092 | Ga0373952_0004919 | Ga0373952_0004919_106_768 | 217 |
| 470 | 3300035115 | Ga0373941_0021457 | Ga0373941_0021457_519_1181 | 217 |
| 471 | 3300035121 | Ga0373960_0105314 | Ga0373960_0105314_91_753 | 217 |
| 472 | 3300048903 | Ga0496100_0017209 | Ga0496100_0017209_1107_1769 | 217 |
| 473 | 3300048905 | Ga0496102_0583553 | Ga0496102_0583553_20_682 | 217 |
| 474 | 3300048909 | Ga0496106_0023852 | Ga0496106_0023852_3041_3703 | 217 |
| 475 | 3300048911 | Ga0496108_0518554 | Ga0496108_0518554_359_1021 | 217 |
| 476 | 3300048913 | Ga0496110_0078676 | Ga0496110_0078676_306_968 | 217 |
| 477 | 3300048915 | Ga0496112_0029501 | Ga0496112_0029501_3317_3979 | 217 |
| 478 | 3300048917 | Ga0496114_0029356 | Ga0496114_0029356_3316_3978 | 217 |
| 479 | 3300048920 | Ga0496117_0236648 | Ga0496117_0236648_203_880 | 217 |
| 480 | 3300048929 | Ga0496126_0646897 | Ga0496126_0646897_32_694 | 217 |
| 481 | 3300050513 | nmdc:mga0rr50_319849_c1 | nmdc:mga0rr50_319849_c1_529_1191 | 217 |
| 482 | 3300050513 | nmdc:mga0rr50_380489_c1 | nmdc:mga0rr50_380489_c1_270_932 | 217 |
| 483 | 3300050514 | nmdc:mga08x19_434490_c1 | nmdc:mga08x19_434490_c1_72_734 | 217 |
| 484 | 3300003659 | JGI25404J52841_10003701 | JGI25404J52841_100037012 | 218 |
| 485 | 3300005548 | Ga0070665_100625293 | Ga0070665_1006252931 | 218 |
| 486 | 3300005983 | Ga0081540_1000151 | Ga0081540_100015113 | 218 |
| 487 | 3300006880 | Ga0075429_100021365 | Ga0075429_1000213652 | 218 |
| 488 | 3300006914 | Ga0075436_100283605 | Ga0075436_1002836052 | 218 |
| 489 | 3300009147 | Ga0114129_10005229 | Ga0114129_100052294 | 218 |
| 490 | 3300044658 | Ga0466972_0031636 | Ga0466972_0031636_1737_2444 | 218 |
| 491 | 3300044683 | Ga0466965_0003556 | Ga0466965_0003556_4137_4844 | 218 |
| 492 | 3300044901 | Ga0466960_0009227 | Ga0466960_0009227_2522_3229 | 218 |
| 493 | 3300050507 | nmdc:mga05p37_199149_c1 | nmdc:mga05p37_199149_c1_1504_2160 | 218 |
| 494 | 3300050508 | nmdc:mga09592_23781_c1 | nmdc:mga09592_23781_c1_4195_4851 | 218 |
| 495 | iso_pu_bacteria | 2902792274 | 2902798516 | 218 |
| 496 | 3300005445 | Ga0070708_100024554 | Ga0070708_1000245543 | 219 |
| 497 | 3300005468 | Ga0070707_100039805 | Ga0070707_1000398052 | 219 |
| 498 | 3300005518 | Ga0070699_100001238 | Ga0070699_1000012388 | 219 |
| 499 | 3300005536 | Ga0070697_100411499 | Ga0070697_1004114992 | 219 |
| 500 | 3300025910 | Ga0207684_10392680 | Ga0207684_103926802 | 219 |
| 501 | 3300025922 | Ga0207646_10045798 | Ga0207646_100457982 | 219 |
| 502 | 3300050507 | nmdc:mga05p37_172342_c1 | nmdc:mga05p37_172342_c1_380_1039 | 219 |
| 503 | 3300003322 | rootL2_10144810 | rootL2_101448102 | 220 |
| 504 | 3300005434 | Ga0070709_10170988 | Ga0070709_101709883 | 220 |
| 505 | 3300005435 | Ga0070714_100496691 | Ga0070714_1004966912 | 220 |
| 506 | 3300005436 | Ga0070713_100443351 | Ga0070713_1004433512 | 220 |
| 507 | 3300005471 | Ga0070698_100032776 | Ga0070698_1000327762 | 220 |
| 508 | 3300025906 | Ga0207699_10219549 | Ga0207699_102195492 | 220 |
| 509 | 3300025928 | Ga0207700_10524017 | Ga0207700_105240172 | 220 |
| 510 | 3300025929 | Ga0207664_10449303 | Ga0207664_104493033 | 220 |
| 511 | 3300028573 | Ga0265334_10001329 | Ga0265334_1000132910 | 220 |
| 512 | 3300035083 | Ga0373926_0002658 | Ga0373926_0002658_338_1009 | 220 |
| 513 | 3300035086 | Ga0373934_0001925 | Ga0373934_0001925_3205_3876 | 220 |
| 514 | 3300035089 | Ga0373944_0010853 | Ga0373944_0010853_543_1214 | 220 |
| 515 | 3300035111 | Ga0373923_0000236 | Ga0373923_0000236_5344_6015 | 220 |
| 516 | 3300035113 | Ga0373936_0000515 | Ga0373936_0000515_7927_8598 | 220 |
| 517 | 3300035116 | Ga0373945_0000850 | Ga0373945_0000850_2975_3646 | 220 |
| 518 | 3300035117 | Ga0373953_0009151 | Ga0373953_0009151_707_1378 | 220 |
| 519 | 3300035119 | Ga0373956_0010504 | Ga0373956_0010504_90_761 | 220 |
| 520 | 3300035120 | Ga0373957_0002668 | Ga0373957_0002668_2553_3224 | 220 |
| 521 | 3300035170 | Ga0373943_0000572 | Ga0373943_0000572_9197_9868 | 220 |
| 522 | 3300035171 | Ga0373946_0000135 | Ga0373946_0000135_14404_15075 | 220 |
| 523 | 3300035172 | Ga0373955_0019245 | Ga0373955_0019245_956_1627 | 220 |
| 524 | 3300035410 | Ga0373924_0002854 | Ga0373924_0002854_1254_1925 | 220 |
| 525 | 3300035692 | Ga0373935_0044398 | Ga0373935_0044398_300_971 | 220 |
| 526 | 3300035695 | Ga0373927_0006681 | Ga0373927_0006681_1385_2056 | 220 |
| 527 | 3300035725 | Ga0373947_0001636 | Ga0373947_0001636_6052_6723 | 220 |
| 528 | 3300037068 | Ga0373925_0015109 | Ga0373925_0015109_2858_3529 | 220 |
| 529 | 3300046454 | Ga0495592_0238198 | Ga0495592_0238198_28_699 | 220 |
| 530 | 3300046455 | Ga0495603_0001257 | Ga0495603_0001257_7030_7701 | 220 |
| 531 | 3300046461 | Ga0495641_0004172 | Ga0495641_0004172_2515_3186 | 220 |
| 532 | 3300046462 | Ga0495651_0018767 | Ga0495651_0018767_3086_3757 | 220 |
| 533 | 3300046463 | Ga0495653_0012589 | Ga0495653_0012589_495_1166 | 220 |
| 534 | 3300046472 | Ga0495580_0011843 | Ga0495580_0011843_4958_5629 | 220 |
| 535 | 3300046473 | Ga0495582_0001366 | Ga0495582_0001366_3595_4266 | 220 |
| 536 | 3300046475 | Ga0495639_0010831 | Ga0495639_0010831_236_907 | 220 |
| 537 | 3300046476 | Ga0495662_0004654 | Ga0495662_0004654_5917_6588 | 220 |
| 538 | 3300046477 | Ga0495664_0008837 | Ga0495664_0008837_3000_3671 | 220 |
| 539 | 3300046499 | Ga0495594_0026316 | Ga0495594_0026316_1837_2508 | 220 |
| 540 | 3300046511 | Ga0495608_0022211 | Ga0495608_0022211_3143_3814 | 220 |
| 541 | 3300046514 | Ga0495618_0004698 | Ga0495618_0004698_5180_5851 | 220 |
| 542 | 3300046516 | Ga0495628_0010263 | Ga0495628_0010263_4238_4909 | 220 |
| 543 | 3300046517 | Ga0495630_0000896 | Ga0495630_0000896_20119_20790 | 220 |
| 544 | 3300046526 | Ga0495666_0007318 | Ga0495666_0007318_125_796 | 220 |
| 545 | 3300046531 | Ga0495665_0000793 | Ga0495665_0000793_14030_14701 | 220 |
| 546 | 3300046533 | Ga0495640_0003266 | Ga0495640_0003266_5344_6015 | 220 |
| 547 | 3300046535 | Ga0495586_0003013 | Ga0495586_0003013_1486_2157 | 220 |
| 548 | 3300046536 | Ga0495587_0048194 | Ga0495587_0048194_1602_2273 | 220 |
| 549 | 3300046543 | Ga0495645_0030504 | Ga0495645_0030504_2956_3627 | 220 |
| 550 | 3300046559 | Ga0495667_0006871 | Ga0495667_0006871_7030_7701 | 220 |
| 551 | 3300046642 | Ga0495634_0002285 | Ga0495634_0002285_5678_6349 | 220 |
| 552 | 3300046663 | Ga0495635_0002970 | Ga0495635_0002970_4474_5145 | 220 |
| 553 | 3300046663 | Ga0495635_0159151 | Ga0495635_0159151_705_1433 | 220 |
| 554 | 3300046678 | Ga0495599_0045652 | Ga0495599_0045652_300_971 | 220 |
| 555 | 3300046679 | Ga0495623_0018307 | Ga0495623_0018307_1987_2658 | 220 |
| 556 | 3300046681 | Ga0495647_0001049 | Ga0495647_0001049_3344_4015 | 220 |
| 557 | 3300046689 | Ga0495613_0001028 | Ga0495613_0001028_9294_9965 | 220 |
| 558 | 3300046690 | Ga0495624_0033396 | Ga0495624_0033396_2235_2906 | 220 |
| 559 | 3300046809 | Ga0495600_0002966 | Ga0495600_0002966_5715_6386 | 220 |
| 560 | 3300047315 | Ga0495581_0000259 | Ga0495581_0000259_7030_7701 | 220 |
| 561 | 3300047317 | Ga0495604_0007271 | Ga0495604_0007271_6493_7164 | 220 |
| 562 | 3300047319 | Ga0495674_0006519 | Ga0495674_0006519_9317_9988 | 220 |
| 563 | 3300047321 | Ga0495676_0004285 | Ga0495676_0004285_7468_8139 | 220 |
| 564 | 3300047322 | Ga0495680_0020055 | Ga0495680_0020055_1830_2501 | 220 |
| 565 | 3300047444 | Ga0495675_0009336 | Ga0495675_0009336_1976_2647 | 220 |
| 566 | 3300047471 | Ga0495684_0003764 | Ga0495684_0003764_7463_8134 | 220 |
| 567 | 3300047673 | Ga0495593_0000939 | Ga0495593_0000939_4557_5228 | 220 |
| 568 | 3300048088 | Ga0495602_0041462 | Ga0495602_0041462_1777_2448 | 220 |
| 569 | 3300048089 | Ga0495614_0010267 | Ga0495614_0010267_2763_3434 | 220 |
| 570 | 3300053077 | Ga0495601_0002161 | Ga0495601_0002161_6484_7155 | 220 |
| 571 | 3300053078 | Ga0495612_0002534 | Ga0495612_0002534_689_1360 | 220 |
| 572 | 3300053084 | Ga0495595_0017708 | Ga0495595_0017708_2130_2801 | 220 |
| 573 | 3300053085 | Ga0495619_0002498 | Ga0495619_0002498_9294_9965 | 220 |
| 574 | 3300005329 | Ga0070683_100338401 | Ga0070683_1003384011 | 221 |
| 575 | 3300005435 | Ga0070714_100240558 | Ga0070714_1002405582 | 221 |
| 576 | 3300005435 | Ga0070714_101065675 | Ga0070714_1010656751 | 221 |
| 577 | 3300005439 | Ga0070711_100312704 | Ga0070711_1003127042 | 221 |
| 578 | 3300005614 | Ga0068856_100134245 | Ga0068856_1001342453 | 221 |
| 579 | 3300006163 | Ga0070715_10221742 | Ga0070715_102217422 | 221 |
| 580 | 3300007788 | Ga0099795_10087512 | Ga0099795_100875122 | 221 |
| 581 | 3300009545 | Ga0105237_10366293 | Ga0105237_103662932 | 221 |
| 582 | 3300010159 | Ga0099796_10110426 | Ga0099796_101104261 | 221 |
| 583 | 3300025906 | Ga0207699_10047745 | Ga0207699_100477452 | 221 |
| 584 | 3300025914 | Ga0207671_10187444 | Ga0207671_101874442 | 221 |
| 585 | 3300025915 | Ga0207693_10052598 | Ga0207693_100525984 | 221 |
| 586 | 3300025929 | Ga0207664_10316480 | Ga0207664_103164801 | 221 |
| 587 | 3300025939 | Ga0207665_10113752 | Ga0207665_101137522 | 221 |
| 588 | 3300035118 | Ga0373954_0002512 | Ga0373954_0002512_2556_3236 | 221 |
| 589 | 3300035121 | Ga0373960_0049693 | Ga0373960_0049693_211_882 | 221 |
| 590 | 3300035724 | Ga0373933_0004568 | Ga0373933_0004568_1329_2009 | 221 |
| 591 | 3300046462 | Ga0495651_0011996 | Ga0495651_0011996_5976_6647 | 221 |
| 592 | 3300046511 | Ga0495608_0188614 | Ga0495608_0188614_572_1243 | 221 |
| 593 | 3300046529 | Ga0495652_0102428 | Ga0495652_0102428_1089_1760 | 221 |
| 594 | 3300046543 | Ga0495645_0050282 | Ga0495645_0050282_1593_2264 | 221 |
| 595 | 3300046559 | Ga0495667_0084164 | Ga0495667_0084164_1265_1936 | 221 |
| 596 | 3300046642 | Ga0495634_0410092 | Ga0495634_0410092_87_758 | 221 |
| 597 | 3300046675 | Ga0495657_0139129 | Ga0495657_0139129_265_936 | 221 |
| 598 | 3300046678 | Ga0495599_0044277 | Ga0495599_0044277_33_704 | 221 |
| 599 | 3300046809 | Ga0495600_0093105 | Ga0495600_0093105_695_1366 | 221 |
| 600 | 3300047317 | Ga0495604_0147402 | Ga0495604_0147402_14_685 | 221 |
| 601 | 3300047319 | Ga0495674_0169556 | Ga0495674_0169556_292_963 | 221 |
| 602 | 3300047322 | Ga0495680_0006306 | Ga0495680_0006306_4259_4930 | 221 |
| 603 | 3300047444 | Ga0495675_0140669 | Ga0495675_0140669_622_1293 | 221 |
| 604 | 3300047471 | Ga0495684_0103828 | Ga0495684_0103828_550_1221 | 221 |
| 605 | 3300048088 | Ga0495602_0073501 | Ga0495602_0073501_448_1119 | 221 |
| 606 | 3300053077 | Ga0495601_0274815 | Ga0495601_0274815_24_695 | 221 |
| 607 | 3300053084 | Ga0495595_0103448 | Ga0495595_0103448_575_1246 | 221 |
| 608 | 3300013105 | Ga0157369_10061904 | Ga0157369_100619043 | 222 |
| 609 | 3300013307 | Ga0157372_10031255 | Ga0157372_100312554 | 222 |
| 610 | 3300021388 | Ga0213875_10005062 | Ga0213875_100050623 | 222 |
| 611 | 3300037853 | Ga0436364_1206511 | Ga0436364_1206511_8902_9627 | 222 |
| 612 | 3300006175 | Ga0070712_100003551 | Ga0070712_1000035517 | 223 |
| 613 | 3300031548 | Ga0307408_100409656 | Ga0307408_1004096562 | 223 |
| 614 | 3300031731 | Ga0307405_10169629 | Ga0307405_101696292 | 223 |
| 615 | 3300031852 | Ga0307410_10115094 | Ga0307410_101150941 | 223 |
| 616 | 3300031901 | Ga0307406_10032249 | Ga0307406_100322492 | 223 |
| 617 | 3300031903 | Ga0307407_10209102 | Ga0307407_102091021 | 223 |
| 618 | 3300031911 | Ga0307412_10607221 | Ga0307412_106072211 | 223 |
| 619 | 3300032002 | Ga0307416_100000419 | Ga0307416_1000004197 | 223 |
| 620 | 3300032126 | Ga0307415_100000096 | Ga0307415_1000000967 | 223 |
| 621 | 3300035691 | Ga0373931_0346662 | Ga0373931_0346662_144_821 | 223 |
| 622 | 3300037068 | Ga0373925_0420285 | Ga0373925_0420285_147_824 | 223 |
| 623 | 3300014325 | Ga0163163_10567307 | Ga0163163_105673072 | 224 |
| 624 | 3300025898 | Ga0207692_10001518 | Ga0207692_100015187 | 224 |
| 625 | 3300025906 | Ga0207699_10084096 | Ga0207699_100840964 | 224 |
| 626 | 3300025929 | Ga0207664_10202954 | Ga0207664_102029542 | 224 |
| 627 | 3300025929 | Ga0207664_10600112 | Ga0207664_106001121 | 224 |
| 628 | 3300035083 | Ga0373926_0001654 | Ga0373926_0001654_2457_3155 | 224 |
| 629 | 3300035089 | Ga0373944_0002847 | Ga0373944_0002847_27_725 | 224 |
| 630 | 3300035111 | Ga0373923_0019823 | Ga0373923_0019823_1054_1752 | 224 |
| 631 | 3300035113 | Ga0373936_0016786 | Ga0373936_0016786_1774_2472 | 224 |
| 632 | 3300035116 | Ga0373945_0001512 | Ga0373945_0001512_3945_4643 | 224 |
| 633 | 3300035170 | Ga0373943_0002611 | Ga0373943_0002611_4616_5314 | 224 |
| 634 | 3300035170 | Ga0373943_0099544 | Ga0373943_0099544_773_1471 | 224 |
| 635 | 3300035171 | Ga0373946_0003306 | Ga0373946_0003306_2515_3213 | 224 |
| 636 | 3300035692 | Ga0373935_0009215 | Ga0373935_0009215_2458_3156 | 224 |
| 637 | 3300035692 | Ga0373935_0195541 | Ga0373935_0195541_120_821 | 224 |
| 638 | 3300035695 | Ga0373927_0006733 | Ga0373927_0006733_2430_3128 | 224 |
| 639 | 3300035725 | Ga0373947_0004702 | Ga0373947_0004702_4845_5543 | 224 |
| 640 | 3300035725 | Ga0373947_0033283 | Ga0373947_0033283_1466_2164 | 224 |
| 641 | 3300037068 | Ga0373925_0001952 | Ga0373925_0001952_32_730 | 224 |
| 642 | 3300037068 | Ga0373925_0053143 | Ga0373925_0053143_293_991 | 224 |
| 643 | 3300044694 | Ga0466963_0545640 | Ga0466963_0545640_70_750 | 224 |
| 644 | 3300045976 | Ga0466967_0166658 | Ga0466967_0166658_984_1664 | 224 |
| 645 | 3300046454 | Ga0495592_0110157 | Ga0495592_0110157_27_704 | 224 |
| 646 | 3300046461 | Ga0495641_0011867 | Ga0495641_0011867_981_1679 | 224 |
| 647 | 3300046462 | Ga0495651_0286210 | Ga0495651_0286210_164_862 | 224 |
| 648 | 3300046463 | Ga0495653_0013966 | Ga0495653_0013966_3410_4108 | 224 |
| 649 | 3300046473 | Ga0495582_0058915 | Ga0495582_0058915_262_960 | 224 |
| 650 | 3300046476 | Ga0495662_0001342 | Ga0495662_0001342_10623_11363 | 224 |
| 651 | 3300046476 | Ga0495662_0007662 | Ga0495662_0007662_3285_3983 | 224 |
| 652 | 3300046477 | Ga0495664_0013226 | Ga0495664_0013226_1644_2384 | 224 |
| 653 | 3300046477 | Ga0495664_0028493 | Ga0495664_0028493_2513_3211 | 224 |
| 654 | 3300046514 | Ga0495618_0009672 | Ga0495618_0009672_2427_3125 | 224 |
| 655 | 3300046517 | Ga0495630_0055174 | Ga0495630_0055174_823_1521 | 224 |
| 656 | 3300046526 | Ga0495666_0001610 | Ga0495666_0001610_10009_10749 | 224 |
| 657 | 3300046529 | Ga0495652_0027983 | Ga0495652_0027983_2338_3036 | 224 |
| 658 | 3300046529 | Ga0495652_0281544 | Ga0495652_0281544_395_1096 | 224 |
| 659 | 3300046531 | Ga0495665_0105989 | Ga0495665_0105989_480_1220 | 224 |
| 660 | 3300046533 | Ga0495640_0058324 | Ga0495640_0058324_730_1428 | 224 |
| 661 | 3300046543 | Ga0495645_0033760 | Ga0495645_0033760_2535_3275 | 224 |
| 662 | 3300046559 | Ga0495667_0073661 | Ga0495667_0073661_755_1453 | 224 |
| 663 | 3300046642 | Ga0495634_0014050 | Ga0495634_0014050_3501_4199 | 224 |
| 664 | 3300046663 | Ga0495635_0030701 | Ga0495635_0030701_1380_2078 | 224 |
| 665 | 3300046678 | Ga0495599_0018642 | Ga0495599_0018642_393_1133 | 224 |
| 666 | 3300046678 | Ga0495599_0019985 | Ga0495599_0019985_960_1658 | 224 |
| 667 | 3300046678 | Ga0495599_0291326 | Ga0495599_0291326_202_903 | 224 |
| 668 | 3300046683 | Ga0495658_0267318 | Ga0495658_0267318_305_1003 | 224 |
| 669 | 3300046690 | Ga0495624_0115305 | Ga0495624_0115305_164_862 | 224 |
| 670 | 3300047315 | Ga0495581_0097316 | Ga0495581_0097316_329_1027 | 224 |
| 671 | 3300047319 | Ga0495674_0008874 | Ga0495674_0008874_2458_3156 | 224 |
| 672 | 3300047319 | Ga0495674_0030731 | Ga0495674_0030731_1387_2088 | 224 |
| 673 | 3300047321 | Ga0495676_0003192 | Ga0495676_0003192_11692_12390 | 224 |
| 674 | 3300047322 | Ga0495680_0021072 | Ga0495680_0021072_3366_4064 | 224 |
| 675 | 3300047471 | Ga0495684_0015296 | Ga0495684_0015296_2754_3452 | 224 |
| 676 | 3300005435 | Ga0070714_100309929 | Ga0070714_1003099292 | 225 |
| 677 | 3300005564 | Ga0070664_100444366 | Ga0070664_1004443661 | 225 |
| 678 | 3300005577 | Ga0068857_100783345 | Ga0068857_1007833452 | 225 |
| 679 | 3300005614 | Ga0068856_100241317 | Ga0068856_1002413173 | 225 |
| 680 | 3300005618 | Ga0068864_100163786 | Ga0068864_1001637862 | 225 |
| 681 | 3300006175 | Ga0070712_100114877 | Ga0070712_1001148772 | 225 |
| 682 | 3300021388 | Ga0213875_10002166 | Ga0213875_100021669 | 225 |
| 683 | 3300025929 | Ga0207664_10155908 | Ga0207664_101559082 | 225 |
| 684 | 3300025945 | Ga0207679_10344818 | Ga0207679_103448182 | 225 |
| 685 | 3300026116 | Ga0207674_10400882 | Ga0207674_104008822 | 225 |
| 686 | 3300035410 | Ga0373924_0028292 | Ga0373924_0028292_1346_2053 | 225 |
| 687 | 3300037853 | Ga0436364_0246675 | Ga0436364_0246675_11859_12566 | 225 |
| 688 | 3300037853 | Ga0436364_1157355 | Ga0436364_1157355_405_1085 | 225 |
| 689 | 3300045976 | Ga0466967_0020033 | Ga0466967_0020033_3391_4092 | 225 |
| 690 | 3300046529 | Ga0495652_0229837 | Ga0495652_0229837_638_1339 | 225 |
| 691 | 3300048912 | Ga0496109_0594084 | Ga0496109_0594084_315_1016 | 225 |
| 692 | 3300050512 | nmdc:mga0n895_990672_c1 | nmdc:mga0n895_990672_c1_42_743 | 225 |
| 693 | 3300005435 | Ga0070714_100010407 | Ga0070714_1000104071 | 226 |
| 694 | 3300005467 | Ga0070706_100043551 | Ga0070706_1000435512 | 226 |
| 695 | 3300006028 | Ga0070717_10428317 | Ga0070717_104283172 | 226 |
| 696 | 3300025910 | Ga0207684_10027555 | Ga0207684_100275552 | 226 |
| 697 | 3300025929 | Ga0207664_10000436 | Ga0207664_100004367 | 226 |
| 698 | iso_pu_bacteria | 2772190715 | 2772641931 | 226 |
| 699 | iso_pu_bacteria | 2858888857 | 2858891578 | 226 |
| 700 | iso_pu_bacteria | 2858895516 | 2858895858 | 226 |
| 701 | iso_pu_bacteria | 2869048445 | 2869048996 | 226 |
| 702 | iso_pu_bacteria | 2880495981 | 2880500907 | 226 |
| 703 | iso_pu_bacteria | 2954691527 | 2954700901 | 226 |
| 704 | iso_pu_bacteria | 2954701450 | 2954706438 | 226 |
| 705 | iso_pu_bacteria | 8003870546 | 8003871759 | 226 |
| 706 | 3300005937 | Ga0081455_10016117 | Ga0081455_100161172 | 227 |
| 707 | 3300006844 | Ga0075428_100209311 | Ga0075428_1002093111 | 227 |
| 708 | 3300006847 | Ga0075431_100002178 | Ga0075431_1000021787 | 227 |
| 709 | 3300006880 | Ga0075429_100027164 | Ga0075429_1000271642 | 227 |
| 710 | 3300014325 | Ga0163163_10238482 | Ga0163163_102384823 | 227 |
| 711 | 3300024225 | Ga0224572_1036396 | Ga0224572_10363961 | 227 |
| 712 | 3300031901 | Ga0307406_10567885 | Ga0307406_105678851 | 227 |
| 713 | 3300035113 | Ga0373936_0015433 | Ga0373936_0015433_2003_2716 | 227 |
| 714 | 3300035724 | Ga0373933_0008682 | Ga0373933_0008682_3450_4163 | 227 |
| 715 | 3300037853 | Ga0436364_0252998 | Ga0436364_0252998_4351_5040 | 227 |
| 716 | 3300046463 | Ga0495653_0020199 | Ga0495653_0020199_2852_3565 | 227 |
| 717 | 3300046477 | Ga0495664_0307408 | Ga0495664_0307408_186_899 | 227 |
| 718 | 3300046511 | Ga0495608_0071116 | Ga0495608_0071116_365_1078 | 227 |
| 719 | 3300046529 | Ga0495652_0214134 | Ga0495652_0214134_629_1342 | 227 |
| 720 | 3300046533 | Ga0495640_0005269 | Ga0495640_0005269_4697_5455 | 227 |
| 721 | 3300046559 | Ga0495667_0004037 | Ga0495667_0004037_8290_9003 | 227 |
| 722 | 3300046663 | Ga0495635_0005150 | Ga0495635_0005150_7222_7935 | 227 |
| 723 | 3300046675 | Ga0495657_0025619 | Ga0495657_0025619_14_727 | 227 |
| 724 | 3300047322 | Ga0495680_0031039 | Ga0495680_0031039_241_954 | 227 |
| 725 | 3300047471 | Ga0495684_0006732 | Ga0495684_0006732_3654_4367 | 227 |
| 726 | 3300048915 | Ga0496112_0541432 | Ga0496112_0541432_209_901 | 227 |
| 727 | 3300050508 | nmdc:mga09592_270_c1 | nmdc:mga09592_270_c1_12706_13398 | 227 |
| 728 | 3300050509 | nmdc:mga0qj67_49989_c1 | nmdc:mga0qj67_49989_c1_2297_2989 | 227 |
| 729 | 3300005435 | Ga0070714_100010112 | Ga0070714_1000101122 | 228 |
| 730 | 3300005937 | Ga0081455_10095551 | Ga0081455_100955512 | 228 |
| 731 | 3300009177 | Ga0105248_10217998 | Ga0105248_102179982 | 228 |
| 732 | 3300024225 | Ga0224572_1034206 | Ga0224572_10342062 | 228 |
| 733 | 3300025929 | Ga0207664_10018715 | Ga0207664_100187155 | 228 |
| 734 | 3300025941 | Ga0207711_10262403 | Ga0207711_102624032 | 228 |
| 735 | 3300053090 | Ga0500646_0000227 | Ga0500646_0000227_453_1160 | 228 |
| 736 | 3300053092 | Ga0500583_0089433 | Ga0500583_0089433_380_1087 | 228 |
| 737 | 3300053146 | Ga0500588_0002499 | Ga0500588_0002499_1492_2199 | 228 |
| 738 | 3300009177 | Ga0105248_10261832 | Ga0105248_102618321 | 229 |
| 739 | 3300031548 | Ga0307408_100051849 | Ga0307408_1000518493 | 229 |
| 740 | 3300034819 | Ga0373958_0025723 | Ga0373958_0025723_354_1058 | 229 |
| 741 | 3300046680 | Ga0495646_0096802 | Ga0495646_0096802_181_921 | 229 |
| 742 | 3300001979 | JGI24740J21852_10039823 | JGI24740J21852_100398233 | 230 |
| 743 | 3300005327 | Ga0070658_10153054 | Ga0070658_101530543 | 230 |
| 744 | 3300005337 | Ga0070682_100092035 | Ga0070682_1000920352 | 230 |
| 745 | 3300005355 | Ga0070671_100396090 | Ga0070671_1003960901 | 230 |
| 746 | 3300005455 | Ga0070663_100757039 | Ga0070663_1007570391 | 230 |
| 747 | 3300005468 | Ga0070707_100375784 | Ga0070707_1003757841 | 230 |
| 748 | 3300005548 | Ga0070665_100397741 | Ga0070665_1003977412 | 230 |
| 749 | 3300005549 | Ga0070704_100255624 | Ga0070704_1002556242 | 230 |
| 750 | 3300005563 | Ga0068855_100030921 | Ga0068855_1000309212 | 230 |
| 751 | 3300005614 | Ga0068856_100055601 | Ga0068856_1000556015 | 230 |
| 752 | 3300005614 | Ga0068856_100115890 | Ga0068856_1001158903 | 230 |
| 753 | 3300005616 | Ga0068852_100926064 | Ga0068852_1009260641 | 230 |
| 754 | 3300006028 | Ga0070717_10365386 | Ga0070717_103653862 | 230 |
| 755 | 3300006358 | Ga0068871_100083681 | Ga0068871_1000836811 | 230 |
| 756 | 3300006871 | Ga0075434_100073124 | Ga0075434_1000731243 | 230 |
| 757 | 3300007076 | Ga0075435_100029558 | Ga0075435_1000295584 | 230 |
| 758 | 3300009092 | Ga0105250_10079341 | Ga0105250_100793411 | 230 |
| 759 | 3300009147 | Ga0114129_10258388 | Ga0114129_102583882 | 230 |
| 760 | 3300009174 | Ga0105241_10003063 | Ga0105241_100030632 | 230 |
| 761 | 3300009551 | Ga0105238_10031089 | Ga0105238_100310895 | 230 |
| 762 | 3300013296 | Ga0157374_10003857 | Ga0157374_1000385715 | 230 |
| 763 | 3300013308 | Ga0157375_10526053 | Ga0157375_105260531 | 230 |
| 764 | 3300025898 | Ga0207692_10189020 | Ga0207692_101890202 | 230 |
| 765 | 3300025904 | Ga0207647_10136243 | Ga0207647_101362432 | 230 |
| 766 | 3300025911 | Ga0207654_10509293 | Ga0207654_105092931 | 230 |
| 767 | 3300025913 | Ga0207695_10001059 | Ga0207695_100010598 | 230 |
| 768 | 3300025914 | Ga0207671_10001032 | Ga0207671_100010322 | 230 |
| 769 | 3300025916 | Ga0207663_10059686 | Ga0207663_100596863 | 230 |
| 770 | 3300025916 | Ga0207663_10196179 | Ga0207663_101961791 | 230 |
| 771 | 3300025928 | Ga0207700_10040353 | Ga0207700_100403532 | 230 |
| 772 | 3300025931 | Ga0207644_10351524 | Ga0207644_103515242 | 230 |
| 773 | 3300026078 | Ga0207702_10089728 | Ga0207702_100897282 | 230 |
| 774 | 3300026078 | Ga0207702_10376769 | Ga0207702_103767692 | 230 |
| 775 | 3300026142 | Ga0207698_10842970 | Ga0207698_108429701 | 230 |
| 776 | 3300028379 | Ga0268266_10098723 | Ga0268266_100987232 | 230 |
| 777 | 3300028666 | Ga0265336_10021017 | Ga0265336_100210174 | 230 |
| 778 | 3300028800 | Ga0265338_10037230 | Ga0265338_100372301 | 230 |
| 779 | 3300030522 | Ga0307512_10056095 | Ga0307512_100560955 | 230 |
| 780 | 3300034820 | Ga0373959_0006639 | Ga0373959_0006639_843_1568 | 230 |
| 781 | 3300034957 | Ga0373938_0058961 | Ga0373938_0058961_67_804 | 230 |
| 782 | 3300035086 | Ga0373934_0042906 | Ga0373934_0042906_193_918 | 230 |
| 783 | 3300035091 | Ga0373951_0024489 | Ga0373951_0024489_76_801 | 230 |
| 784 | 3300035111 | Ga0373923_0031760 | Ga0373923_0031760_518_1243 | 230 |
| 785 | 3300035112 | Ga0373932_0005708 | Ga0373932_0005708_2012_2737 | 230 |
| 786 | 3300035113 | Ga0373936_0033364 | Ga0373936_0033364_419_1144 | 230 |
| 787 | 3300035114 | Ga0373939_0018023 | Ga0373939_0018023_1133_1858 | 230 |
| 788 | 3300035117 | Ga0373953_0008839 | Ga0373953_0008839_825_1550 | 230 |
| 789 | 3300035118 | Ga0373954_0053090 | Ga0373954_0053090_241_966 | 230 |
| 790 | 3300035120 | Ga0373957_0025601 | Ga0373957_0025601_211_948 | 230 |
| 791 | 3300035121 | Ga0373960_0028843 | Ga0373960_0028843_38_763 | 230 |
| 792 | 3300035171 | Ga0373946_0070733 | Ga0373946_0070733_575_1309 | 230 |
| 793 | 3300035172 | Ga0373955_0032010 | Ga0373955_0032010_1783_2508 | 230 |
| 794 | 3300035242 | Ga0373962_0004632 | Ga0373962_0004632_2223_2948 | 230 |
| 795 | 3300035410 | Ga0373924_0013098 | Ga0373924_0013098_720_1445 | 230 |
| 796 | 3300035691 | Ga0373931_0012440 | Ga0373931_0012440_3200_3925 | 230 |
| 797 | 3300035692 | Ga0373935_0026712 | Ga0373935_0026712_1211_1936 | 230 |
| 798 | 3300035724 | Ga0373933_0070825 | Ga0373933_0070825_1153_1878 | 230 |
| 799 | 3300035725 | Ga0373947_0039900 | Ga0373947_0039900_1667_2383 | 230 |
| 800 | 3300036401 | Ga0373937_0001745 | Ga0373937_0001745_10046_10771 | 230 |
| 801 | 3300037068 | Ga0373925_0429930 | Ga0373925_0429930_120_845 | 230 |
| 802 | 3300044656 | Ga0466969_0009562 | Ga0466969_0009562_639_1331 | 230 |
| 803 | 3300044658 | Ga0466972_0088869 | Ga0466972_0088869_271_963 | 230 |
| 804 | 3300044683 | Ga0466965_0006957 | Ga0466965_0006957_2739_3431 | 230 |
| 805 | 3300044684 | Ga0466966_0000541 | Ga0466966_0000541_13075_13767 | 230 |
| 806 | 3300044693 | Ga0466961_0008206 | Ga0466961_0008206_825_1529 | 230 |
| 807 | 3300044693 | Ga0466961_0014126 | Ga0466961_0014126_4072_4764 | 230 |
| 808 | 3300044694 | Ga0466963_0007395 | Ga0466963_0007395_603_1295 | 230 |
| 809 | 3300044694 | Ga0466963_0041713 | Ga0466963_0041713_1607_2299 | 230 |
| 810 | 3300044719 | Ga0466971_0001219 | Ga0466971_0001219_5255_5947 | 230 |
| 811 | 3300044765 | Ga0466970_0127995 | Ga0466970_0127995_139_831 | 230 |
| 812 | 3300044842 | Ga0466957_0001172 | Ga0466957_0001172_7735_8427 | 230 |
| 813 | 3300044842 | Ga0466957_0087447 | Ga0466957_0087447_390_1106 | 230 |
| 814 | 3300045049 | Ga0466959_0001339 | Ga0466959_0001339_8715_9407 | 230 |
| 815 | 3300045836 | Ga0466958_0000654 | Ga0466958_0000654_6357_7049 | 230 |
| 816 | 3300045976 | Ga0466967_0004594 | Ga0466967_0004594_4627_5319 | 230 |
| 817 | 3300045976 | Ga0466967_0021666 | Ga0466967_0021666_2065_2757 | 230 |
| 818 | 3300046454 | Ga0495592_0013132 | Ga0495592_0013132_5469_6194 | 230 |
| 819 | 3300046455 | Ga0495603_0078045 | Ga0495603_0078045_622_1314 | 230 |
| 820 | 3300046459 | Ga0495629_0007578 | Ga0495629_0007578_5475_6191 | 230 |
| 821 | 3300046459 | Ga0495629_0051194 | Ga0495629_0051194_764_1489 | 230 |
| 822 | 3300046461 | Ga0495641_0235861 | Ga0495641_0235861_30_758 | 230 |
| 823 | 3300046462 | Ga0495651_0000394 | Ga0495651_0000394_18009_18716 | 230 |
| 824 | 3300046462 | Ga0495651_0098856 | Ga0495651_0098856_685_1410 | 230 |
| 825 | 3300046463 | Ga0495653_0011805 | Ga0495653_0011805_4614_5339 | 230 |
| 826 | 3300046472 | Ga0495580_0238742 | Ga0495580_0238742_243_968 | 230 |
| 827 | 3300046473 | Ga0495582_0015813 | Ga0495582_0015813_1183_1908 | 230 |
| 828 | 3300046476 | Ga0495662_0035913 | Ga0495662_0035913_995_1720 | 230 |
| 829 | 3300046477 | Ga0495664_0056565 | Ga0495664_0056565_1354_2079 | 230 |
| 830 | 3300046499 | Ga0495594_0035556 | Ga0495594_0035556_1750_2442 | 230 |
| 831 | 3300046514 | Ga0495618_0132519 | Ga0495618_0132519_282_1007 | 230 |
| 832 | 3300046514 | Ga0495618_0180762 | Ga0495618_0180762_600_1316 | 230 |
| 833 | 3300046516 | Ga0495628_0042394 | Ga0495628_0042394_2748_3440 | 230 |
| 834 | 3300046516 | Ga0495628_0182720 | Ga0495628_0182720_746_1483 | 230 |
| 835 | 3300046517 | Ga0495630_0112760 | Ga0495630_0112760_447_1172 | 230 |
| 836 | 3300046529 | Ga0495652_0033009 | Ga0495652_0033009_1717_2424 | 230 |
| 837 | 3300046529 | Ga0495652_0141347 | Ga0495652_0141347_947_1684 | 230 |
| 838 | 3300046531 | Ga0495665_0044751 | Ga0495665_0044751_1364_2089 | 230 |
| 839 | 3300046531 | Ga0495665_0195758 | Ga0495665_0195758_122_850 | 230 |
| 840 | 3300046533 | Ga0495640_0028884 | Ga0495640_0028884_3133_3825 | 230 |
| 841 | 3300046533 | Ga0495640_0147570 | Ga0495640_0147570_209_946 | 230 |
| 842 | 3300046536 | Ga0495587_0056836 | Ga0495587_0056836_917_1642 | 230 |
| 843 | 3300046543 | Ga0495645_0095322 | Ga0495645_0095322_43_768 | 230 |
| 844 | 3300046559 | Ga0495667_0026619 | Ga0495667_0026619_2640_3365 | 230 |
| 845 | 3300046642 | Ga0495634_0053314 | Ga0495634_0053314_614_1339 | 230 |
| 846 | 3300046663 | Ga0495635_0059348 | Ga0495635_0059348_1227_1943 | 230 |
| 847 | 3300046663 | Ga0495635_0193183 | Ga0495635_0193183_349_1074 | 230 |
| 848 | 3300046674 | Ga0495588_0071613 | Ga0495588_0071613_615_1331 | 230 |
| 849 | 3300046675 | Ga0495657_0018029 | Ga0495657_0018029_163_855 | 230 |
| 850 | 3300046675 | Ga0495657_0090532 | Ga0495657_0090532_426_1151 | 230 |
| 851 | 3300046678 | Ga0495599_0071120 | Ga0495599_0071120_682_1407 | 230 |
| 852 | 3300046679 | Ga0495623_0111178 | Ga0495623_0111178_684_1409 | 230 |
| 853 | 3300046680 | Ga0495646_0036219 | Ga0495646_0036219_962_1687 | 230 |
| 854 | 3300046681 | Ga0495647_0086430 | Ga0495647_0086430_280_1005 | 230 |
| 855 | 3300046683 | Ga0495658_0069353 | Ga0495658_0069353_516_1241 | 230 |
| 856 | 3300046689 | Ga0495613_0019176 | Ga0495613_0019176_187_879 | 230 |
| 857 | 3300046689 | Ga0495613_0095021 | Ga0495613_0095021_828_1553 | 230 |
| 858 | 3300046690 | Ga0495624_0144131 | Ga0495624_0144131_582_1319 | 230 |
| 859 | 3300046691 | Ga0495670_0092124 | Ga0495670_0092124_768_1460 | 230 |
| 860 | 3300046809 | Ga0495600_0020940 | Ga0495600_0020940_1866_2573 | 230 |
| 861 | 3300046809 | Ga0495600_0095488 | Ga0495600_0095488_870_1595 | 230 |
| 862 | 3300047315 | Ga0495581_0038840 | Ga0495581_0038840_1468_2160 | 230 |
| 863 | 3300047315 | Ga0495581_0059789 | Ga0495581_0059789_930_1655 | 230 |
| 864 | 3300047317 | Ga0495604_0015233 | Ga0495604_0015233_4635_5360 | 230 |
| 865 | 3300047317 | Ga0495604_0029324 | Ga0495604_0029324_2504_3196 | 230 |
| 866 | 3300047318 | Ga0495636_0034047 | Ga0495636_0034047_368_1060 | 230 |
| 867 | 3300047319 | Ga0495674_0052132 | Ga0495674_0052132_2095_2811 | 230 |
| 868 | 3300047319 | Ga0495674_0166509 | Ga0495674_0166509_275_1000 | 230 |
| 869 | 3300047321 | Ga0495676_0088227 | Ga0495676_0088227_1569_2306 | 230 |
| 870 | 3300047322 | Ga0495680_0034422 | Ga0495680_0034422_792_1508 | 230 |
| 871 | 3300047322 | Ga0495680_0071615 | Ga0495680_0071615_995_1717 | 230 |
| 872 | 3300047444 | Ga0495675_0068642 | Ga0495675_0068642_567_1292 | 230 |
| 873 | 3300047447 | Ga0495685_035437 | Ga0495685_035437_465_1157 | 230 |
| 874 | 3300047471 | Ga0495684_0027313 | Ga0495684_0027313_3447_4163 | 230 |
| 875 | 3300047471 | Ga0495684_0030709 | Ga0495684_0030709_1226_1951 | 230 |
| 876 | 3300047673 | Ga0495593_0023596 | Ga0495593_0023596_1987_2712 | 230 |
| 877 | 3300047673 | Ga0495593_0058014 | Ga0495593_0058014_1292_1984 | 230 |
| 878 | 3300048088 | Ga0495602_0099160 | Ga0495602_0099160_1354_2079 | 230 |
| 879 | 3300048903 | Ga0496100_0063048 | Ga0496100_0063048_340_1065 | 230 |
| 880 | 3300048905 | Ga0496102_0085413 | Ga0496102_0085413_378_1106 | 230 |
| 881 | 3300048905 | Ga0496102_0156224 | Ga0496102_0156224_911_1636 | 230 |
| 882 | 3300048907 | Ga0496104_0034615 | Ga0496104_0034615_3901_4629 | 230 |
| 883 | 3300048907 | Ga0496104_0209971 | Ga0496104_0209971_625_1350 | 230 |
| 884 | 3300048908 | Ga0496105_0047702 | Ga0496105_0047702_534_1259 | 230 |
| 885 | 3300048908 | Ga0496105_0056642 | Ga0496105_0056642_565_1293 | 230 |
| 886 | 3300048909 | Ga0496106_0304006 | Ga0496106_0304006_27_752 | 230 |
| 887 | 3300048910 | Ga0496107_0159698 | Ga0496107_0159698_721_1446 | 230 |
| 888 | 3300048911 | Ga0496108_0020456 | Ga0496108_0020456_2411_3139 | 230 |
| 889 | 3300048911 | Ga0496108_0119745 | Ga0496108_0119745_993_1718 | 230 |
| 890 | 3300048916 | Ga0496113_0215179 | Ga0496113_0215179_473_1201 | 230 |
| 891 | 3300048917 | Ga0496114_0155050 | Ga0496114_0155050_178_903 | 230 |
| 892 | 3300048918 | Ga0496115_0021261 | Ga0496115_0021261_819_1547 | 230 |
| 893 | 3300048918 | Ga0496115_0070080 | Ga0496115_0070080_1131_1856 | 230 |
| 894 | 3300050513 | nmdc:mga0rr50_28392_c1 | nmdc:mga0rr50_28392_c1_2489_3214 | 230 |
| 895 | 3300050514 | nmdc:mga08x19_35523_c1 | nmdc:mga08x19_35523_c1_1905_2630 | 230 |
| 896 | 3300050515 | nmdc:mga0a205_69593_c1 | nmdc:mga0a205_69593_c1_94_819 | 230 |
| 897 | 3300053077 | Ga0495601_0042702 | Ga0495601_0042702_1226_1951 | 230 |
| 898 | 3300053078 | Ga0495612_0054902 | Ga0495612_0054902_859_1596 | 230 |
| 899 | 3300053084 | Ga0495595_0062076 | Ga0495595_0062076_973_1710 | 230 |
| 900 | 3300053085 | Ga0495619_0072445 | Ga0495619_0072445_212_949 | 230 |
| 901 | 3300061719 | Ga0466962_0000491 | Ga0466962_0000491_11192_11884 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uso-assembly1.cif.gz_A | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9236 | 25 | 92 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9043 | 19 | 94 |
| 2ebb-assembly1.cif.gz_A-2 | crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 | 0.8763 | 3 | 95 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.8605 | 19 | 94 |
| 3jst-assembly2.cif.gz_B | crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis | 0.8483 | 3 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1usoB00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9002 | 18 | 92 | 3.30.1360.20 |
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.8923 | 3 | 91 | 3.30.1360.20 |
| af_Q6MX13_31_126_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.8852 | 5 | 95 | 3.30.1360.20 |
| 2ebbA00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.8763 | 3 | 95 | 3.30.1360.20 |
| af_Q54XF6_87_182_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.8584 | 12 | 92 | 3.30.1360.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841BNV3-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9821 | 114 | 229 |
|
| AF-A0A6B2UD65-F1-model_v4 | deleted | 0.9764 | 1 | 230 |
|
| AF-A0A841BNV3-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9738 | 114 | 229 |
|
| AF-A0A7W7SJU9-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) | 0.9729 | 1 | 230 |
GO:0006729
GO:0008124 |
| AF-A0A4V2FE73-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase | 0.9709 | 1 | 230 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar