F485169

General Info

Members Datasets Scaffolds Average Seq Length
901 376 881 223

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100283605|Ga0075436_1002836052
Length 266
Sequence VAITDPLAATSPASGESFSTVRAARFAEVLRGSRSPLSGSAGTIGGMEHTKLSRADASAAVTRLGWRYVLGEFRTEVLTGSLPLAADVAARAAAVPDVEGHLRMDIRADRLLLSLQTAEQSWVTTHDAELARQLSALTQEFRLTTQPGDRTVQVLELGIDALDIAKIRPFWKAALGYTDEPEGGHGLIDPLGQGPAVWFQQMDAPRPQRNRIHVDVSVPHDEAPLRIEATLAAGGTVQSDAEAPAFWVLADPEGNEACITTWQGRD

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
4 2643221711 Terrabacter sp. Root85 Isolate Unclassified
5 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
6 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
10 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
11 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
12 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
13 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
14 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
15 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
16 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
17 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
18 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
19 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
207 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
259 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
260 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
372 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
373 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
374 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 0
Rhizoplane 9.77
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10039823 3300001979 Bacteria 1430
2 JGI24744J21845_10000985 3300002077 Bacteria 5442
3 JGI24744J21845_10024362 3300002077 Bacteria 1183
4 rootL2_10144810 3300003322 Bacteria 1506
5 JGI25404J52841_10003701 3300003659 Bacteria 3041
6 Ga0070658_10153054 3300005327 Bacteria 1932
7 Ga0070676_10104642 3300005328 Bacteria 1754
8 Ga0070683_100338401 3300005329 Bacteria 1433
9 Ga0070690_100026670 3300005330 Bacteria 3566
10 Ga0070690_100292530 3300005330 Bacteria 1165
11 Ga0068869_100037649 3300005334 Bacteria 3441
12 Ga0070666_10047828 3300005335 Bacteria 2873
13 Ga0070680_100079057 3300005336 Bacteria 2710
14 Ga0070682_100031720 3300005337 Bacteria 3197
15 Ga0070682_100092035 3300005337 Bacteria 1986
16 Ga0070682_100122226 3300005337 Bacteria 1750
17 Ga0068868_100000265 3300005338 Bacteria 35343
18 Ga0068868_100088550 3300005338 Bacteria 2491
19 Ga0070689_100030411 3300005340 Bacteria 4099
20 Ga0070689_100164351 3300005340 Bacteria 1796
21 Ga0070691_10005965 3300005341 Bacteria 5559
22 Ga0070691_10050323 3300005341 Bacteria 1987
23 Ga0070687_100054420 3300005343 Bacteria 2085
24 Ga0070661_100008632 3300005344 Bacteria 7048
25 Ga0070668_100000455 3300005347 Bacteria 27040
26 Ga0070668_100023364 3300005347 Bacteria 4676
27 Ga0070668_100146899 3300005347 Bacteria 1904
28 Ga0070669_100020736 3300005353 Bacteria 4695
29 Ga0070675_100390671 3300005354 Bacteria 1240
30 Ga0070671_100115862 3300005355 Bacteria 2253
31 Ga0070671_100396090 3300005355 Bacteria 1181
32 Ga0070674_100000174 3300005356 Bacteria 30012
33 Ga0070674_100006521 3300005356 Bacteria 6817
34 Ga0070674_100125559 3300005356 Bacteria 1905
35 Ga0070673_100196242 3300005364 Bacteria 1736
36 Ga0070673_100230127 3300005364 Bacteria 1608
37 Ga0070688_100016229 3300005365 Bacteria 4253
38 Ga0070659_100032427 3300005366 Bacteria 4051
39 Ga0070667_100000598 3300005367 Bacteria 35201
40 Ga0070667_100166430 3300005367 Bacteria 1945
41 Ga0070667_100202056 3300005367 Bacteria 1764
42 Ga0070667_101046919 3300005367 Bacteria 762
43 Ga0070709_10016737 3300005434 Bacteria 4192
44 Ga0070709_10085613 3300005434 Bacteria 2067
45 Ga0070709_10170988 3300005434 Bacteria 1518
46 Ga0070714_100010112 3300005435 Bacteria 7447
47 Ga0070714_100010407 3300005435 Bacteria 7351
48 Ga0070714_100076583 3300005435 Bacteria 2904
49 Ga0070714_100100783 3300005435 Bacteria 2544
50 Ga0070714_100240558 3300005435 Bacteria 1670
51 Ga0070714_100309929 3300005435 Bacteria 1473
52 Ga0070714_100496691 3300005435 Bacteria 1163
53 Ga0070714_101065675 3300005435 Bacteria 787
54 Ga0070714_101136655 3300005435 Bacteria 761
55 Ga0070713_100443351 3300005436 Bacteria 1218
56 Ga0070710_10001110 3300005437 Bacteria 12721
57 Ga0070710_10020610 3300005437 Bacteria 3423
58 Ga0070710_10028063 3300005437 Bacteria 3007
59 Ga0070701_10001050 3300005438 Bacteria 10078
60 Ga0070701_10094086 3300005438 Bacteria 1648
61 Ga0070711_100001452 3300005439 Bacteria 13023
62 Ga0070711_100009619 3300005439 Bacteria 5956
63 Ga0070711_100122108 3300005439 Bacteria 1928
64 Ga0070711_100312704 3300005439 Bacteria 1252
65 Ga0070705_100004745 3300005440 Bacteria 6618
66 Ga0070694_100016452 3300005444 Bacteria 4655
67 Ga0070708_100024554 3300005445 Bacteria 5144
68 Ga0070663_100021659 3300005455 Bacteria 4279
69 Ga0070663_100757039 3300005455 Bacteria 830
70 Ga0070678_100000417 3300005456 Bacteria 20087
71 Ga0070678_100056036 3300005456 Bacteria 2880
72 Ga0070678_100144298 3300005456 Bacteria 1909
73 Ga0070678_100767032 3300005456 Bacteria 873
74 Ga0070662_100014635 3300005457 Bacteria 5245
75 Ga0070662_100051034 3300005457 Bacteria 2985
76 Ga0068867_100009482 3300005459 Bacteria 6865
77 Ga0070685_10104060 3300005466 Bacteria 1738
78 Ga0070706_100043551 3300005467 Bacteria 4148
79 Ga0070706_100409818 3300005467 Bacteria 1262
80 Ga0070707_100039805 3300005468 Bacteria 4494
81 Ga0070707_100328171 3300005468 Bacteria 1487
82 Ga0070707_100375784 3300005468 Bacteria 1381
83 Ga0070698_100003317 3300005471 Bacteria 17707
84 Ga0070698_100004212 3300005471 Bacteria 15807
85 Ga0070698_100032776 3300005471 Bacteria 5380
86 Ga0070699_100001238 3300005518 Bacteria 23538
87 Ga0070699_100136854 3300005518 Bacteria 2161
88 Ga0070684_100038614 3300005535 Bacteria 4102
89 Ga0070684_101183786 3300005535 Bacteria 719
90 Ga0070697_100411499 3300005536 Bacteria 1174
91 Ga0068853_100038879 3300005539 Bacteria 4055
92 Ga0068853_100061169 3300005539 Bacteria 3256
93 Ga0070672_100052590 3300005543 Bacteria 3180
94 Ga0070686_100271563 3300005544 Bacteria 1247
95 Ga0070686_100521776 3300005544 Bacteria 925
96 Ga0070695_100013381 3300005545 Bacteria 4930
97 Ga0070695_100198376 3300005545 Bacteria 1432
98 Ga0070696_100006966 3300005546 Bacteria 7544
99 Ga0070693_100024477 3300005547 Bacteria 3238
100 Ga0070665_100019640 3300005548 Bacteria 6781
101 Ga0070665_100044922 3300005548 Bacteria 4435
102 Ga0070665_100233181 3300005548 Bacteria 1841
103 Ga0070665_100397741 3300005548 Bacteria 1385
104 Ga0070665_100625293 3300005548 Bacteria 1090
105 Ga0070704_100004004 3300005549 Bacteria 8502
106 Ga0070704_100038335 3300005549 Bacteria 3282
107 Ga0070704_100255624 3300005549 Bacteria 1441
108 Ga0070704_100323199 3300005549 Bacteria 1293
109 Ga0068855_100030921 3300005563 Bacteria 6398
110 Ga0068855_100271881 3300005563 Bacteria 1884
111 Ga0068855_100571828 3300005563 Bacteria 1221
112 Ga0070664_100444366 3300005564 Bacteria 1190
113 Ga0068857_100058147 3300005577 Bacteria 3432
114 Ga0068857_100783345 3300005577 Bacteria 910
115 Ga0068854_100000759 3300005578 Bacteria 19146
116 Ga0068854_100406104 3300005578 Bacteria 1128
117 Ga0068856_100055601 3300005614 Bacteria 3906
118 Ga0068856_100115890 3300005614 Bacteria 2679
119 Ga0068856_100134245 3300005614 Bacteria 2480
120 Ga0068856_100241317 3300005614 Bacteria 1822
121 Ga0070702_100003039 3300005615 Bacteria 7424
122 Ga0068852_100027793 3300005616 Bacteria 4617
123 Ga0068852_100062573 3300005616 Bacteria 3237
124 Ga0068852_100926064 3300005616 Bacteria 889
125 Ga0068859_100000995 3300005617 Bacteria 29017
126 Ga0068864_100135672 3300005618 Bacteria 2216
127 Ga0068864_100163786 3300005618 Bacteria 2023
128 Ga0068864_100281321 3300005618 Bacteria 1553
129 Ga0068866_10000103 3300005718 Bacteria 36199
130 Ga0068866_10046459 3300005718 Bacteria 2184
131 Ga0068866_10101580 3300005718 Bacteria 1587
132 Ga0068861_100075444 3300005719 Bacteria 2625
133 Ga0068861_100079890 3300005719 Bacteria 2557
134 Ga0068851_10127321 3300005834 Bacteria 1374
135 Ga0068870_10050765 3300005840 Bacteria 2193
136 Ga0068863_100011989 3300005841 Bacteria 8377
137 Ga0068863_100147341 3300005841 Bacteria 2252
138 Ga0068863_100412844 3300005841 Bacteria 1322
139 Ga0068858_100007072 3300005842 Bacteria 10894
140 Ga0068860_100015253 3300005843 Bacteria 7504
141 Ga0068860_100384477 3300005843 Bacteria 1386
142 Ga0068862_100009073 3300005844 Bacteria 8233
143 Ga0081455_10016117 3300005937 Bacteria 7226
144 Ga0081455_10017921 3300005937 Bacteria 6768
145 Ga0081455_10095551 3300005937 Bacteria 2398
146 Ga0081538_10089137 3300005981 Bacteria 1603
147 Ga0081540_1000151 3300005983 Bacteria 71183
148 Ga0070717_10236287 3300006028 Bacteria 1610
149 Ga0070717_10304231 3300006028 Bacteria 1418
150 Ga0070717_10365386 3300006028 Bacteria 1292
151 Ga0070717_10428317 3300006028 Bacteria 1190
152 Ga0075365_10006636 3300006038 Bacteria 6388
153 Ga0075364_10086242 3300006051 Bacteria 2080
154 Ga0070715_10002094 3300006163 Bacteria 6032
155 Ga0070715_10004368 3300006163 Bacteria 4629
156 Ga0070715_10017521 3300006163 Bacteria 2713
157 Ga0070715_10221742 3300006163 Bacteria 972
158 Ga0070716_100001890 3300006173 Bacteria 9505
159 Ga0070716_100015780 3300006173 Bacteria 3888
160 Ga0070716_100024660 3300006173 Bacteria 3203
161 Ga0070716_100119642 3300006173 Bacteria 1646
162 Ga0070716_100177433 3300006173 Bacteria 1396
163 Ga0070716_100509344 3300006173 Bacteria 889
164 Ga0070712_100003551 3300006175 Bacteria 9600
165 Ga0070712_100006518 3300006175 Bacteria 7245
166 Ga0070712_100114877 3300006175 Bacteria 2016
167 Ga0070712_100349330 3300006175 Bacteria 1210
168 Ga0070712_100552352 3300006175 Bacteria 970
169 Ga0075367_10173930 3300006178 Bacteria 1342
170 Ga0075369_10006227 3300006186 Bacteria 4506
171 Ga0097621_100040409 3300006237 Bacteria 3750
172 Ga0097621_100138077 3300006237 Bacteria 2081
173 Ga0097621_100156100 3300006237 Bacteria 1959
174 Ga0068871_100078058 3300006358 Bacteria 2737
175 Ga0068871_100083681 3300006358 Bacteria 2647
176 Ga0075428_100000121 3300006844 Bacteria 67666
177 Ga0075428_100001048 3300006844 Bacteria 29361
178 Ga0075428_100209311 3300006844 Bacteria 2107
179 Ga0075430_100012222 3300006846 Bacteria 7310
180 Ga0075431_100002178 3300006847 Bacteria 18720
181 Ga0075431_100014875 3300006847 Bacteria 7878
182 Ga0075431_100204899 3300006847 Bacteria 2017
183 Ga0075431_100364054 3300006847 Bacteria 1452
184 Ga0075431_100774487 3300006847 Bacteria 934
185 Ga0075434_100073124 3300006871 Bacteria 3421
186 Ga0075434_100513031 3300006871 Bacteria 1219
187 Ga0075429_100021365 3300006880 Bacteria 5611
188 Ga0075429_100027164 3300006880 Bacteria 4968
189 Ga0068865_100007291 3300006881 Bacteria 6795
190 Ga0068865_100101723 3300006881 Bacteria 2105
191 Ga0068865_100436798 3300006881 Bacteria 1079
192 Ga0075436_100209484 3300006914 Bacteria 1381
193 Ga0075436_100283605 3300006914 Bacteria 1185
194 Ga0097620_100000995 3300006931 Bacteria 29017
195 Ga0075435_100029558 3300007076 Bacteria 4301
196 Ga0075435_100135673 3300007076 Bacteria 2061
197 Ga0075435_100585034 3300007076 Bacteria 968
198 Ga0099795_10087512 3300007788 Bacteria 1202
199 Ga0105251_10130454 3300009011 Bacteria 1139
200 Ga0105250_10079341 3300009092 Bacteria 1330
201 Ga0105250_10162336 3300009092 Bacteria 933
202 Ga0105240_10125005 3300009093 Bacteria 3093
203 Ga0105245_10003044 3300009098 Bacteria 15023
204 Ga0105245_10144351 3300009098 Bacteria 2245
205 Ga0105245_10781862 3300009098 Bacteria 992
206 Ga0105247_10000279 3300009101 Bacteria 46962
207 Ga0105247_10015410 3300009101 Bacteria 4579
208 Ga0105247_10065084 3300009101 Bacteria 2267
209 Ga0114129_10005229 3300009147 Bacteria 18285
210 Ga0114129_10025054 3300009147 Bacteria 8455
211 Ga0114129_10258388 3300009147 Bacteria 2336
212 Ga0105243_10001443 3300009148 Bacteria 20907
213 Ga0105243_10063692 3300009148 Bacteria 2955
214 Ga0105243_10106616 3300009148 Bacteria 2336
215 Ga0105243_10922410 3300009148 Bacteria 870
216 Ga0105241_10003063 3300009174 Bacteria 12464
217 Ga0105242_10000551 3300009176 Bacteria 29661
218 Ga0105242_10225864 3300009176 Bacteria 1675
219 Ga0105242_10772909 3300009176 Bacteria 948
220 Ga0105248_10004599 3300009177 Bacteria 15277
221 Ga0105248_10136290 3300009177 Bacteria 2769
222 Ga0105248_10190064 3300009177 Bacteria 2314
223 Ga0105248_10217998 3300009177 Bacteria 2149
224 Ga0105248_10261832 3300009177 Bacteria 1947
225 Ga0105237_10041116 3300009545 Bacteria 4663
226 Ga0105237_10366293 3300009545 Bacteria 1446
227 Ga0105237_10529268 3300009545 Bacteria 1185
228 Ga0105237_10619239 3300009545 Bacteria 1089
229 Ga0105238_10031089 3300009551 Bacteria 5435
230 Ga0105238_10089251 3300009551 Bacteria 3070
231 Ga0105238_10120598 3300009551 Bacteria 2602
232 Ga0105238_10755169 3300009551 Bacteria 987
233 Ga0105249_10011764 3300009553 Bacteria 7693
234 Ga0105249_10024827 3300009553 Bacteria 5390
235 Ga0105249_10077184 3300009553 Bacteria 3089
236 Ga0105249_10160180 3300009553 Bacteria 2174
237 Ga0099796_10110426 3300010159 Bacteria 1046
238 Ga0105239_10123756 3300010375 Bacteria 2873
239 Ga0105246_10018664 3300011119 Bacteria 4422
240 Ga0105246_10075433 3300011119 Bacteria 2387
241 Ga0105246_10170648 3300011119 Bacteria 1666
242 Ga0157373_10303934 3300013100 Bacteria 1133
243 Ga0157370_10344684 3300013104 Bacteria 1373
244 Ga0157369_10061904 3300013105 Bacteria 4033
245 Ga0157369_10104777 3300013105 Bacteria 3011
246 Ga0157374_10003857 3300013296 Bacteria 12596
247 Ga0157374_10535313 3300013296 Bacteria 1178
248 Ga0157378_10001937 3300013297 Bacteria 18571
249 Ga0163162_10008789 3300013306 Bacteria 9820
250 Ga0163162_10305651 3300013306 Bacteria 1723
251 Ga0163162_10324934 3300013306 Bacteria 1671
252 Ga0163162_10380728 3300013306 Bacteria 1544
253 Ga0163162_10451695 3300013306 Bacteria 1417
254 Ga0157372_10031255 3300013307 Bacteria 5830
255 Ga0157372_10099026 3300013307 Bacteria 3325
256 Ga0157375_10006369 3300013308 Bacteria 10290
257 Ga0157375_10184412 3300013308 Bacteria 2239
258 Ga0157375_10490605 3300013308 Bacteria 1393
259 Ga0157375_10526053 3300013308 Bacteria 1345
260 Ga0157375_10802315 3300013308 Bacteria 1090
261 Ga0157375_11098204 3300013308 Bacteria 931
262 Ga0163163_10075470 3300014325 Bacteria 3365
263 Ga0163163_10238482 3300014325 Bacteria 1868
264 Ga0163163_10347185 3300014325 Bacteria 1540
265 Ga0163163_10567307 3300014325 Bacteria 1198
266 Ga0157380_10000918 3300014326 Bacteria 18557
267 Ga0157380_10149743 3300014326 Bacteria 2016
268 Ga0157379_10000781 3300014968 Bacteria 25849
269 Ga0157379_10212942 3300014968 Bacteria 1750
270 Ga0157376_10909984 3300014969 Bacteria 898
271 Ga0163161_10008981 3300017792 Bacteria 6914
272 Ga0213875_10002166 3300021388 Bacteria 11985
273 Ga0213875_10005062 3300021388 Bacteria 7139
274 Ga0224572_1034206 3300024225 Bacteria 966
275 Ga0224572_1036396 3300024225 Bacteria 932
276 Ga0209051_1006886 3300025303 Bacteria 6314
277 Ga0209051_1072020 3300025303 Bacteria 1036
278 Ga0207653_10032963 3300025885 Bacteria 1678
279 Ga0207692_10001518 3300025898 Bacteria 8723
280 Ga0207692_10003051 3300025898 Bacteria 6499
281 Ga0207692_10014716 3300025898 Bacteria 3424
282 Ga0207692_10029842 3300025898 Bacteria 2596
283 Ga0207692_10189020 3300025898 Bacteria 1204
284 Ga0207642_10000651 3300025899 Bacteria 10659
285 Ga0207710_10005916 3300025900 Bacteria 5246
286 Ga0207710_10015088 3300025900 Bacteria 3263
287 Ga0207710_10080859 3300025900 Bacteria 1507
288 Ga0207688_10004249 3300025901 Bacteria 7807
289 Ga0207688_10006764 3300025901 Bacteria 6241
290 Ga0207688_10014643 3300025901 Bacteria 4260
291 Ga0207680_10129293 3300025903 Bacteria 1662
292 Ga0207647_10019580 3300025904 Bacteria 4550
293 Ga0207647_10136243 3300025904 Bacteria 1441
294 Ga0207685_10003273 3300025905 Bacteria 3913
295 Ga0207685_10023198 3300025905 Bacteria 2109
296 Ga0207699_10004754 3300025906 Bacteria 6487
297 Ga0207699_10006080 3300025906 Bacteria 5815
298 Ga0207699_10009375 3300025906 Bacteria 4872
299 Ga0207699_10047745 3300025906 Bacteria 2512
300 Ga0207699_10049900 3300025906 Bacteria 2465
301 Ga0207699_10075340 3300025906 Bacteria 2075
302 Ga0207699_10084096 3300025906 Bacteria 1981
303 Ga0207699_10219549 3300025906 Bacteria 1297
304 Ga0207645_10203818 3300025907 Bacteria 1302
305 Ga0207645_10308318 3300025907 Bacteria 1054
306 Ga0207684_10027555 3300025910 Bacteria 4839
307 Ga0207684_10392680 3300025910 Bacteria 1193
308 Ga0207654_10509293 3300025911 Bacteria 851
309 Ga0207707_10216807 3300025912 Bacteria 1666
310 Ga0207695_10001059 3300025913 Bacteria 48227
311 Ga0207671_10001032 3300025914 Bacteria 33903
312 Ga0207671_10187444 3300025914 Bacteria 1612
313 Ga0207693_10000320 3300025915 Bacteria 44589
314 Ga0207693_10017765 3300025915 Bacteria 5672
315 Ga0207693_10052598 3300025915 Bacteria 3195
316 Ga0207663_10003612 3300025916 Bacteria 7594
317 Ga0207663_10004022 3300025916 Bacteria 7284
318 Ga0207663_10059686 3300025916 Bacteria 2414
319 Ga0207663_10196179 3300025916 Bacteria 1453
320 Ga0207663_10774373 3300025916 Bacteria 763
321 Ga0207660_10206965 3300025917 Bacteria 1535
322 Ga0207662_10029765 3300025918 Bacteria 3166
323 Ga0207657_10601486 3300025919 Bacteria 858
324 Ga0207646_10045798 3300025922 Bacteria 3925
325 Ga0207646_10170287 3300025922 Bacteria 1967
326 Ga0207694_10446478 3300025924 Bacteria 1079
327 Ga0207659_10117533 3300025926 Bacteria 2032
328 Ga0207659_10513281 3300025926 Bacteria 1016
329 Ga0207687_10005088 3300025927 Bacteria 8710
330 Ga0207687_10025124 3300025927 Bacteria 3986
331 Ga0207700_10014376 3300025928 Bacteria 5185
332 Ga0207700_10016141 3300025928 Bacteria 4951
333 Ga0207700_10040353 3300025928 Bacteria 3406
334 Ga0207700_10492374 3300025928 Bacteria 1084
335 Ga0207700_10524017 3300025928 Bacteria 1050
336 Ga0207664_10000436 3300025929 Bacteria 29818
337 Ga0207664_10018715 3300025929 Bacteria 5107
338 Ga0207664_10121171 3300025929 Bacteria 2189
339 Ga0207664_10155908 3300025929 Bacteria 1944
340 Ga0207664_10202954 3300025929 Bacteria 1712
341 Ga0207664_10279286 3300025929 Bacteria 1465
342 Ga0207664_10316480 3300025929 Bacteria 1376
343 Ga0207664_10449303 3300025929 Bacteria 1150
344 Ga0207664_10600112 3300025929 Bacteria 989
345 Ga0207644_10317424 3300025931 Bacteria 1259
346 Ga0207644_10337154 3300025931 Bacteria 1222
347 Ga0207644_10351524 3300025931 Bacteria 1197
348 Ga0207706_10011104 3300025933 Bacteria 8209
349 Ga0207706_10037870 3300025933 Bacteria 4280
350 Ga0207686_10055958 3300025934 Bacteria 2477
351 Ga0207709_10005487 3300025935 Bacteria 7200
352 Ga0207709_10035131 3300025935 Bacteria 2961
353 Ga0207670_10034471 3300025936 Bacteria 3272
354 Ga0207670_10264605 3300025936 Bacteria 1334
355 Ga0207669_10000415 3300025937 Bacteria 18644
356 Ga0207669_10025046 3300025937 Bacteria 3217
357 Ga0207669_10133823 3300025937 Bacteria 1709
358 Ga0207704_10000497 3300025938 Bacteria 17484
359 Ga0207704_10047128 3300025938 Bacteria 2574
360 Ga0207704_10369790 3300025938 Bacteria 1122
361 Ga0207665_10006186 3300025939 Bacteria 7948
362 Ga0207665_10022481 3300025939 Bacteria 4149
363 Ga0207665_10032442 3300025939 Bacteria 3458
364 Ga0207665_10046112 3300025939 Bacteria 2920
365 Ga0207665_10113752 3300025939 Bacteria 1904
366 Ga0207665_10231340 3300025939 Bacteria 1358
367 Ga0207691_10035502 3300025940 Bacteria 4626
368 Ga0207711_10157217 3300025941 Bacteria 2055
369 Ga0207711_10262403 3300025941 Bacteria 1588
370 Ga0207689_10009038 3300025942 Bacteria 8628
371 Ga0207689_10012026 3300025942 Bacteria 7417
372 Ga0207689_10110200 3300025942 Bacteria 2262
373 Ga0207679_10344818 3300025945 Bacteria 1296
374 Ga0207679_10861915 3300025945 Bacteria 827
375 Ga0207667_10686769 3300025949 Bacteria 1027
376 Ga0207667_10839335 3300025949 Bacteria 913
377 Ga0207651_10024297 3300025960 Bacteria 3746
378 Ga0207651_10041183 3300025960 Bacteria 3064
379 Ga0207712_10071413 3300025961 Bacteria 2497
380 Ga0207712_10303777 3300025961 Bacteria 1311
381 Ga0207712_10666013 3300025961 Bacteria 906
382 Ga0207668_10002762 3300025972 Bacteria 10260
383 Ga0207668_10168510 3300025972 Bacteria 1715
384 Ga0207668_10306978 3300025972 Bacteria 1312
385 Ga0207640_10252662 3300025981 Bacteria 1369
386 Ga0207658_10026543 3300025986 Bacteria 4061
387 Ga0207677_10000663 3300026023 Bacteria 20484
388 Ga0207677_10076042 3300026023 Bacteria 2389
389 Ga0207703_10002809 3300026035 Bacteria 14858
390 Ga0207703_10228227 3300026035 Bacteria 1668
391 Ga0207639_10086370 3300026041 Bacteria 2498
392 Ga0207678_10013701 3300026067 Bacteria 7123
393 Ga0207678_10048537 3300026067 Bacteria 3669
394 Ga0207708_10006741 3300026075 Bacteria 8498
395 Ga0207708_10022478 3300026075 Bacteria 4762
396 Ga0207702_10089728 3300026078 Bacteria 2688
397 Ga0207702_10098495 3300026078 Bacteria 2576
398 Ga0207702_10376769 3300026078 Bacteria 1364
399 Ga0207641_10093683 3300026088 Bacteria 2633
400 Ga0207641_10223635 3300026088 Bacteria 1747
401 Ga0207648_10000451 3300026089 Bacteria 45574
402 Ga0207648_10085983 3300026089 Bacteria 2743
403 Ga0207676_10037818 3300026095 Bacteria 3680
404 Ga0207674_10005304 3300026116 Bacteria 15337
405 Ga0207674_10400882 3300026116 Bacteria 1326
406 Ga0207675_100023739 3300026118 Bacteria 5705
407 Ga0207675_100028799 3300026118 Bacteria 5174
408 Ga0207675_100053244 3300026118 Bacteria 3776
409 Ga0207683_10000665 3300026121 Bacteria 31567
410 Ga0207683_10057046 3300026121 Bacteria 3428
411 Ga0207683_10077553 3300026121 Bacteria 2943
412 Ga0207683_10210305 3300026121 Bacteria 1770
413 Ga0207683_10574394 3300026121 Bacteria 1043
414 Ga0207698_10015490 3300026142 Bacteria 5106
415 Ga0207698_10842970 3300026142 Bacteria 921
416 Ga0268266_10032412 3300028379 Bacteria 4440
417 Ga0268266_10098723 3300028379 Bacteria 2570
418 Ga0268266_10739900 3300028379 Bacteria 949
419 Ga0268265_10783775 3300028380 Bacteria 928
420 Ga0268264_10011372 3300028381 Bacteria 7352
421 Ga0265334_10001329 3300028573 Bacteria 11921
422 Ga0265336_10021017 3300028666 Bacteria 2089
423 Ga0265338_10037230 3300028800 Bacteria 4637
424 Ga0307512_10056095 3300030522 Bacteria 3098
425 Ga0307408_100051849 3300031548 Bacteria 2958
426 Ga0307408_100409656 3300031548 Bacteria 1166
427 Ga0307405_10169629 3300031731 Bacteria 1555
428 Ga0307410_10115094 3300031852 Bacteria 1952
429 Ga0307410_10525727 3300031852 Bacteria 977
430 Ga0307406_10032249 3300031901 Bacteria 3197
431 Ga0307406_10567885 3300031901 Bacteria 931
432 Ga0307407_10209102 3300031903 Bacteria 1312
433 Ga0307412_10607221 3300031911 Bacteria 927
434 Ga0307416_100000419 3300032002 Bacteria 21590
435 Ga0307414_10779706 3300032004 Bacteria 871
436 Ga0307415_100000096 3300032126 Bacteria 37053
437 Ga0307415_100481297 3300032126 Bacteria 1081
438 Ga0373930_0002391 3300034816 Bacteria 2900
439 Ga0373958_0025723 3300034819 Bacteria 1123
440 Ga0373959_0006639 3300034820 Bacteria 1927
441 Ga0373938_0058961 3300034957 Bacteria 894
442 Ga0373926_0001654 3300035083 Bacteria 6892
443 Ga0373926_0002658 3300035083 Bacteria 5687
444 Ga0373928_0064894 3300035084 Bacteria 890
445 Ga0373929_0014121 3300035085 Bacteria 1539
446 Ga0373934_0001925 3300035086 Bacteria 7614
447 Ga0373934_0038478 3300035086 Bacteria 1884
448 Ga0373934_0042906 3300035086 Bacteria 1787
449 Ga0373944_0002847 3300035089 Bacteria 4426
450 Ga0373944_0010853 3300035089 Bacteria 2489
451 Ga0373951_0024489 3300035091 Bacteria 1398
452 Ga0373952_0004919 3300035092 Bacteria 2430
453 Ga0373923_0000236 3300035111 Bacteria 11706
454 Ga0373923_0019823 3300035111 Bacteria 2608
455 Ga0373923_0031760 3300035111 Bacteria 2130
456 Ga0373932_0005708 3300035112 Bacteria 2928
457 Ga0373932_0029274 3300035112 Bacteria 1519
458 Ga0373936_0000515 3300035113 Bacteria 13169
459 Ga0373936_0015433 3300035113 Bacteria 2927
460 Ga0373936_0016786 3300035113 Bacteria 2817
461 Ga0373936_0033364 3300035113 Bacteria 2040
462 Ga0373939_0018023 3300035114 Bacteria 1884
463 Ga0373939_0034308 3300035114 Bacteria 1488
464 Ga0373941_0021457 3300035115 Bacteria 1823
465 Ga0373945_0000850 3300035116 Bacteria 8989
466 Ga0373945_0001512 3300035116 Bacteria 7100
467 Ga0373953_0008839 3300035117 Bacteria 3437
468 Ga0373953_0009151 3300035117 Bacteria 3390
469 Ga0373954_0002512 3300035118 Bacteria 7698
470 Ga0373954_0053090 3300035118 Bacteria 1905
471 Ga0373954_0085055 3300035118 Bacteria 1514
472 Ga0373956_0010504 3300035119 Bacteria 3796
473 Ga0373956_0059799 3300035119 Bacteria 1724
474 Ga0373957_0002668 3300035120 Bacteria 5122
475 Ga0373957_0025601 3300035120 Bacteria 2127
476 Ga0373957_0040059 3300035120 Bacteria 1760
477 Ga0373960_0028843 3300035121 Bacteria 1534
478 Ga0373960_0049693 3300035121 Bacteria 1241
479 Ga0373960_0105314 3300035121 Bacteria 919
480 Ga0373943_0000572 3300035170 Bacteria 15968
481 Ga0373943_0002611 3300035170 Bacteria 8189
482 Ga0373943_0099544 3300035170 Bacteria 1518
483 Ga0373946_0000135 3300035171 Bacteria 22104
484 Ga0373946_0003306 3300035171 Bacteria 5725
485 Ga0373946_0070733 3300035171 Bacteria 1506
486 Ga0373955_0019245 3300035172 Bacteria 3408
487 Ga0373955_0032010 3300035172 Bacteria 2757
488 Ga0373962_0004632 3300035242 Bacteria 3323
489 Ga0373924_0002854 3300035410 Bacteria 5855
490 Ga0373924_0013098 3300035410 Bacteria 3111
491 Ga0373924_0028292 3300035410 Bacteria 2233
492 Ga0373931_0012440 3300035691 Bacteria 4123
493 Ga0373931_0039606 3300035691 Bacteria 2469
494 Ga0373931_0118059 3300035691 Bacteria 1513
495 Ga0373931_0268185 3300035691 Bacteria 1044
496 Ga0373931_0346662 3300035691 Bacteria 929
497 Ga0373935_0009215 3300035692 Bacteria 5908
498 Ga0373935_0026712 3300035692 Bacteria 3566
499 Ga0373935_0044398 3300035692 Bacteria 2800
500 Ga0373935_0195541 3300035692 Bacteria 1395
501 Ga0373927_0006681 3300035695 Bacteria 7851
502 Ga0373927_0006733 3300035695 Bacteria 7821
503 Ga0373933_0004568 3300035724 Bacteria 7585
504 Ga0373933_0008682 3300035724 Bacteria 5541
505 Ga0373933_0020937 3300035724 Bacteria 3709
506 Ga0373933_0070825 3300035724 Bacteria 2121
507 Ga0373947_0001636 3300035725 Bacteria 13742
508 Ga0373947_0004702 3300035725 Bacteria 8000
509 Ga0373947_0033283 3300035725 Bacteria 3042
510 Ga0373947_0039900 3300035725 Bacteria 2795
511 Ga0373937_0001745 3300036401 Bacteria 18295
512 Ga0373937_0828406 3300036401 Bacteria 873
513 Ga0373925_0001952 3300037068 Bacteria 17059
514 Ga0373925_0015109 3300037068 Bacteria 5580
515 Ga0373925_0053143 3300037068 Bacteria 3027
516 Ga0373925_0420285 3300037068 Bacteria 1092
517 Ga0373925_0429930 3300037068 Bacteria 1079
518 Ga0436364_0246675 3300037853 Bacteria 22744
519 Ga0436364_0252998 3300037853 Bacteria 5068
520 Ga0436364_0922968 3300037853 Bacteria 2016
521 Ga0436364_1157355 3300037853 Bacteria 1407
522 Ga0436364_1206511 3300037853 Bacteria 41633
523 Ga0439461_0000425 3300041410 Bacteria 6069
524 Ga0439466_0020257 3300041411 Bacteria 2371
525 Ga0439466_0090101 3300041411 Bacteria 962
526 Ga0451791_1188155 3300041451 Bacteria 2742
527 Ga0451802_0165858 3300041460 Bacteria 1228
528 Ga0451839_1060590 3300041496 Bacteria 951
529 Ga0439431_0015856 3300041997 Bacteria 1758
530 Ga0439442_006464 3300042002 Bacteria 2354
531 Ga0439448_0079217 3300042005 Bacteria 1102
532 Ga0439434_0035218 3300042435 Bacteria 1530
533 Ga0466969_0009562 3300044656 Bacteria 5139
534 Ga0466972_0031636 3300044658 Bacteria 2601
535 Ga0466972_0046925 3300044658 Bacteria 2090
536 Ga0466972_0088869 3300044658 Bacteria 1466
537 Ga0466965_0003556 3300044683 Bacteria 6847
538 Ga0466965_0006957 3300044683 Bacteria 5175
539 Ga0466966_0000541 3300044684 Bacteria 24070
540 Ga0466961_0008206 3300044693 Bacteria 6653
541 Ga0466961_0014126 3300044693 Bacteria 5122
542 Ga0466963_0007395 3300044694 Bacteria 6544
543 Ga0466963_0041713 3300044694 Bacteria 3011
544 Ga0466963_0545640 3300044694 Bacteria 819
545 Ga0466971_0001219 3300044719 Bacteria 10687
546 Ga0466968_0022125 3300044735 Bacteria 2582
547 Ga0466970_0033353 3300044765 Bacteria 2722
548 Ga0466970_0127995 3300044765 Bacteria 1393
549 Ga0466957_0001172 3300044842 Bacteria 13604
550 Ga0466957_0087447 3300044842 Bacteria 1949
551 Ga0466960_0009227 3300044901 Bacteria 4061
552 Ga0466960_0148844 3300044901 Bacteria 1249
553 Ga0466959_0001339 3300045049 Bacteria 15000
554 Ga0466959_0132409 3300045049 Bacteria 1767
555 Ga0466958_0000654 3300045836 Bacteria 14953
556 Ga0466967_0004594 3300045976 Bacteria 9352
557 Ga0466967_0020033 3300045976 Bacteria 5395
558 Ga0466967_0021666 3300045976 Bacteria 5227
559 Ga0466967_0104797 3300045976 Bacteria 2590
560 Ga0466967_0166658 3300045976 Bacteria 2071
561 Ga0466967_0331319 3300045976 Bacteria 1470
562 Ga0495592_0013132 3300046454 Bacteria 6303
563 Ga0495592_0109978 3300046454 Bacteria 1951
564 Ga0495592_0110157 3300046454 Bacteria 1949
565 Ga0495592_0238198 3300046454 Bacteria 1208
566 Ga0495603_0001257 3300046455 Bacteria 14783
567 Ga0495603_0078045 3300046455 Bacteria 1942
568 Ga0495629_0007578 3300046459 Bacteria 7997
569 Ga0495629_0051194 3300046459 Bacteria 2890
570 Ga0495638_0179154 3300046460 Bacteria 1210
571 Ga0495641_0004172 3300046461 Bacteria 10387
572 Ga0495641_0011867 3300046461 Bacteria 4922
573 Ga0495641_0235861 3300046461 Bacteria 821
574 Ga0495651_0000394 3300046462 Bacteria 33759
575 Ga0495651_0011996 3300046462 Bacteria 6669
576 Ga0495651_0018767 3300046462 Bacteria 5358
577 Ga0495651_0098856 3300046462 Bacteria 2176
578 Ga0495651_0286210 3300046462 Bacteria 1111
579 Ga0495653_0011805 3300046463 Bacteria 7132
580 Ga0495653_0012589 3300046463 Bacteria 6908
581 Ga0495653_0013966 3300046463 Bacteria 6548
582 Ga0495653_0020199 3300046463 Bacteria 5400
583 Ga0495653_0067083 3300046463 Bacteria 2696
584 Ga0495580_0011843 3300046472 Bacteria 6729
585 Ga0495580_0238742 3300046472 Bacteria 1246
586 Ga0495582_0001366 3300046473 Bacteria 13732
587 Ga0495582_0015813 3300046473 Bacteria 4138
588 Ga0495582_0058915 3300046473 Bacteria 2118
589 Ga0495639_0010831 3300046475 Bacteria 3927
590 Ga0495662_0001342 3300046476 Bacteria 12161
591 Ga0495662_0004654 3300046476 Bacteria 6887
592 Ga0495662_0007662 3300046476 Bacteria 5324
593 Ga0495662_0035913 3300046476 Bacteria 2392
594 Ga0495664_0008837 3300046477 Bacteria 5628
595 Ga0495664_0013226 3300046477 Bacteria 4680
596 Ga0495664_0028493 3300046477 Bacteria 3261
597 Ga0495664_0056565 3300046477 Bacteria 2333
598 Ga0495664_0306910 3300046477 Bacteria 958
599 Ga0495664_0307408 3300046477 Bacteria 957
600 Ga0495594_0026316 3300046499 Bacteria 3129
601 Ga0495594_0035556 3300046499 Bacteria 2714
602 Ga0495608_0022211 3300046511 Bacteria 4348
603 Ga0495608_0071116 3300046511 Bacteria 2270
604 Ga0495608_0188614 3300046511 Bacteria 1302
605 Ga0495618_0004698 3300046514 Bacteria 8353
606 Ga0495618_0009672 3300046514 Bacteria 5821
607 Ga0495618_0132519 3300046514 Bacteria 1594
608 Ga0495618_0180762 3300046514 Bacteria 1340
609 Ga0495628_0010263 3300046516 Bacteria 7965
610 Ga0495628_0042394 3300046516 Bacteria 3630
611 Ga0495628_0182720 3300046516 Bacteria 1585
612 Ga0495630_0000896 3300046517 Bacteria 20817
613 Ga0495630_0055174 3300046517 Bacteria 2977
614 Ga0495630_0112760 3300046517 Bacteria 2059
615 Ga0495666_0001610 3300046526 Bacteria 11119
616 Ga0495666_0007318 3300046526 Bacteria 5535
617 Ga0495666_0295064 3300046526 Bacteria 734
618 Ga0495652_0027983 3300046529 Bacteria 4964
619 Ga0495652_0033009 3300046529 Bacteria 4523
620 Ga0495652_0102428 3300046529 Bacteria 2319
621 Ga0495652_0141347 3300046529 Bacteria 1892
622 Ga0495652_0214134 3300046529 Bacteria 1452
623 Ga0495652_0229837 3300046529 Bacteria 1388
624 Ga0495652_0281544 3300046529 Bacteria 1217
625 Ga0495665_0000793 3300046531 Bacteria 16530
626 Ga0495665_0044751 3300046531 Bacteria 2351
627 Ga0495665_0105989 3300046531 Bacteria 1475
628 Ga0495665_0195758 3300046531 Bacteria 1048
629 Ga0495640_0003266 3300046533 Bacteria 13044
630 Ga0495640_0005269 3300046533 Bacteria 10282
631 Ga0495640_0028884 3300046533 Bacteria 3987
632 Ga0495640_0058324 3300046533 Bacteria 2633
633 Ga0495640_0147570 3300046533 Bacteria 1512
634 Ga0495640_0379054 3300046533 Bacteria 870
635 Ga0495586_0003013 3300046535 Bacteria 9086
636 Ga0495587_0048194 3300046536 Bacteria 2523
637 Ga0495587_0056836 3300046536 Bacteria 2301
638 Ga0495598_0193629 3300046537 Bacteria 731
639 Ga0495645_0030504 3300046543 Bacteria 3926
640 Ga0495645_0033760 3300046543 Bacteria 3732
641 Ga0495645_0050282 3300046543 Bacteria 3035
642 Ga0495645_0095322 3300046543 Bacteria 2121
643 Ga0495645_0110710 3300046543 Bacteria 1943
644 Ga0495667_0004037 3300046559 Bacteria 9865
645 Ga0495667_0006871 3300046559 Bacteria 7728
646 Ga0495667_0017425 3300046559 Bacteria 4851
647 Ga0495667_0026619 3300046559 Bacteria 3897
648 Ga0495667_0073661 3300046559 Bacteria 2224
649 Ga0495667_0084164 3300046559 Bacteria 2065
650 Ga0495656_0067259 3300046615 Bacteria 1581
651 Ga0495634_0002285 3300046642 Bacteria 16036
652 Ga0495634_0014050 3300046642 Bacteria 5782
653 Ga0495634_0053314 3300046642 Bacteria 2709
654 Ga0495634_0204909 3300046642 Bacteria 1223
655 Ga0495634_0410092 3300046642 Bacteria 804
656 Ga0495635_0002970 3300046663 Bacteria 11637
657 Ga0495635_0005150 3300046663 Bacteria 9103
658 Ga0495635_0013555 3300046663 Bacteria 5704
659 Ga0495635_0030701 3300046663 Bacteria 3733
660 Ga0495635_0059348 3300046663 Bacteria 2630
661 Ga0495635_0159151 3300046663 Bacteria 1537
662 Ga0495635_0193183 3300046663 Bacteria 1381
663 Ga0495588_0071613 3300046674 Bacteria 1803
664 Ga0495657_0018029 3300046675 Bacteria 5117
665 Ga0495657_0025619 3300046675 Bacteria 4186
666 Ga0495657_0090532 3300046675 Bacteria 1963
667 Ga0495657_0138095 3300046675 Bacteria 1521
668 Ga0495657_0139129 3300046675 Bacteria 1514
669 Ga0495599_0018642 3300046678 Bacteria 4323
670 Ga0495599_0019985 3300046678 Bacteria 4171
671 Ga0495599_0044277 3300046678 Bacteria 2791
672 Ga0495599_0045652 3300046678 Bacteria 2747
673 Ga0495599_0071120 3300046678 Bacteria 2171
674 Ga0495599_0291326 3300046678 Bacteria 987
675 Ga0495623_0018307 3300046679 Bacteria 4524
676 Ga0495623_0111178 3300046679 Bacteria 1660
677 Ga0495646_0036219 3300046680 Bacteria 3057
678 Ga0495646_0096802 3300046680 Bacteria 1696
679 Ga0495647_0001049 3300046681 Bacteria 8420
680 Ga0495647_0086430 3300046681 Bacteria 1279
681 Ga0495658_0069353 3300046683 Bacteria 2043
682 Ga0495658_0267318 3300046683 Bacteria 1077
683 Ga0495613_0001028 3300046689 Bacteria 21269
684 Ga0495613_0019176 3300046689 Bacteria 5098
685 Ga0495613_0095021 3300046689 Bacteria 2156
686 Ga0495624_0033396 3300046690 Bacteria 3332
687 Ga0495624_0115305 3300046690 Bacteria 1651
688 Ga0495624_0144131 3300046690 Bacteria 1458
689 Ga0495670_0092124 3300046691 Bacteria 1552
690 Ga0495600_0002966 3300046809 Bacteria 9895
691 Ga0495600_0020940 3300046809 Bacteria 4185
692 Ga0495600_0089150 3300046809 Bacteria 2012
693 Ga0495600_0093105 3300046809 Bacteria 1965
694 Ga0495600_0095488 3300046809 Bacteria 1938
695 Ga0495600_0160874 3300046809 Bacteria 1451
696 Ga0495600_0670133 3300046809 Bacteria 626
697 Ga0495581_0000259 3300047315 Bacteria 25347
698 Ga0495581_0038840 3300047315 Bacteria 2756
699 Ga0495581_0059789 3300047315 Bacteria 2202
700 Ga0495581_0097316 3300047315 Bacteria 1709
701 Ga0495604_0007271 3300047317 Bacteria 8765
702 Ga0495604_0015233 3300047317 Bacteria 6138
703 Ga0495604_0029324 3300047317 Bacteria 4377
704 Ga0495604_0147402 3300047317 Bacteria 1676
705 Ga0495636_0034047 3300047318 Bacteria 2095
706 Ga0495674_0006519 3300047319 Bacteria 11198
707 Ga0495674_0008874 3300047319 Bacteria 9564
708 Ga0495674_0030731 3300047319 Bacteria 4881
709 Ga0495674_0052132 3300047319 Bacteria 3602
710 Ga0495674_0166509 3300047319 Bacteria 1841
711 Ga0495674_0169556 3300047319 Bacteria 1822
712 Ga0495674_0174272 3300047319 Bacteria 1793
713 Ga0495672_0153980 3300047320 Bacteria 1189
714 Ga0495676_0003192 3300047321 Bacteria 14819
715 Ga0495676_0004285 3300047321 Bacteria 13022
716 Ga0495676_0088227 3300047321 Bacteria 2327
717 Ga0495680_0006306 3300047322 Bacteria 11039
718 Ga0495680_0020055 3300047322 Bacteria 5633
719 Ga0495680_0021072 3300047322 Bacteria 5462
720 Ga0495680_0031039 3300047322 Bacteria 4353
721 Ga0495680_0034422 3300047322 Bacteria 4090
722 Ga0495680_0071615 3300047322 Bacteria 2638
723 Ga0495680_0085849 3300047322 Bacteria 2369
724 Ga0495675_0009336 3300047444 Bacteria 6100
725 Ga0495675_0055318 3300047444 Bacteria 2517
726 Ga0495675_0068642 3300047444 Bacteria 2239
727 Ga0495675_0140669 3300047444 Bacteria 1496
728 Ga0495685_035437 3300047447 Bacteria 1715
729 Ga0495684_0003764 3300047471 Bacteria 11835
730 Ga0495684_0006732 3300047471 Bacteria 8922
731 Ga0495684_0015296 3300047471 Bacteria 5909
732 Ga0495684_0027313 3300047471 Bacteria 4382
733 Ga0495684_0030709 3300047471 Bacteria 4125
734 Ga0495684_0103828 3300047471 Bacteria 2148
735 Ga0495684_0121656 3300047471 Bacteria 1965
736 Ga0495593_0000939 3300047673 Bacteria 16979
737 Ga0495593_0023596 3300047673 Bacteria 3417
738 Ga0495593_0058014 3300047673 Bacteria 2031
739 Ga0495602_0041462 3300048088 Bacteria 4204
740 Ga0495602_0073501 3300048088 Bacteria 2910
741 Ga0495602_0099160 3300048088 Bacteria 2395
742 Ga0495614_0010267 3300048089 Bacteria 4130
743 Ga0496100_0000466 3300048903 Bacteria 19411
744 Ga0496100_0004465 3300048903 Bacteria 7422
745 Ga0496100_0007116 3300048903 Bacteria 6145
746 Ga0496100_0017209 3300048903 Bacteria 4263
747 Ga0496100_0063048 3300048903 Bacteria 2448
748 Ga0496100_0069688 3300048903 Bacteria 2343
749 Ga0496101_0001809 3300048904 Bacteria 12877
750 Ga0496101_0005804 3300048904 Bacteria 7895
751 Ga0496102_0001111 3300048905 Bacteria 24695
752 Ga0496102_0007545 3300048905 Bacteria 9298
753 Ga0496102_0038987 3300048905 Bacteria 4291
754 Ga0496102_0043526 3300048905 Bacteria 4072
755 Ga0496102_0081114 3300048905 Bacteria 2990
756 Ga0496102_0085413 3300048905 Bacteria 2914
757 Ga0496102_0113978 3300048905 Bacteria 2522
758 Ga0496102_0156224 3300048905 Bacteria 2144
759 Ga0496102_0565683 3300048905 Bacteria 1059
760 Ga0496102_0583553 3300048905 Bacteria 1040
761 Ga0496103_0000325 3300048906 Bacteria 43734
762 Ga0496103_0009479 3300048906 Bacteria 5765
763 Ga0496103_0048063 3300048906 Bacteria 2636
764 Ga0496103_0232211 3300048906 Bacteria 1187
765 Ga0496104_0004493 3300048907 Bacteria 12153
766 Ga0496104_0006961 3300048907 Bacteria 9971
767 Ga0496104_0025994 3300048907 Bacteria 5399
768 Ga0496104_0034615 3300048907 Bacteria 4711
769 Ga0496104_0105516 3300048907 Bacteria 2700
770 Ga0496104_0209971 3300048907 Bacteria 1858
771 Ga0496104_0279855 3300048907 Bacteria 1581
772 Ga0496105_0002369 3300048908 Bacteria 13651
773 Ga0496105_0005086 3300048908 Bacteria 9969
774 Ga0496105_0047702 3300048908 Bacteria 3535
775 Ga0496105_0056642 3300048908 Bacteria 3235
776 Ga0496105_0070159 3300048908 Bacteria 2896
777 Ga0496105_0131559 3300048908 Bacteria 2063
778 Ga0496105_0529172 3300048908 Bacteria 922
779 Ga0496106_0001362 3300048909 Bacteria 18293
780 Ga0496106_0023852 3300048909 Bacteria 4547
781 Ga0496106_0034564 3300048909 Bacteria 3776
782 Ga0496106_0167222 3300048909 Bacteria 1741
783 Ga0496106_0304006 3300048909 Bacteria 1279
784 Ga0496107_0001156 3300048910 Bacteria 15994
785 Ga0496107_0005433 3300048910 Bacteria 8722
786 Ga0496107_0159698 3300048910 Bacteria 1670
787 Ga0496108_0020456 3300048911 Bacteria 5441
788 Ga0496108_0021343 3300048911 Bacteria 5322
789 Ga0496108_0088326 3300048911 Bacteria 2634
790 Ga0496108_0119745 3300048911 Bacteria 2257
791 Ga0496108_0126083 3300048911 Bacteria 2198
792 Ga0496108_0518554 3300048911 Bacteria 1040
793 Ga0496108_0739406 3300048911 Bacteria 851
794 Ga0496108_0765788 3300048911 Bacteria 834
795 Ga0496109_0021430 3300048912 Bacteria 5713
796 Ga0496109_0594084 3300048912 Bacteria 1043
797 Ga0496109_0802475 3300048912 Bacteria 879
798 Ga0496109_0996910 3300048912 Bacteria 775
799 Ga0496110_0078676 3300048913 Bacteria 2935
800 Ga0496110_0082731 3300048913 Bacteria 2863
801 Ga0496110_0092549 3300048913 Bacteria 2706
802 Ga0496110_0259122 3300048913 Bacteria 1583
803 Ga0496110_0413473 3300048913 Bacteria 1230
804 Ga0496111_0415161 3300048914 Bacteria 994
805 Ga0496112_0016784 3300048915 Bacteria 6867
806 Ga0496112_0029501 3300048915 Bacteria 5305
807 Ga0496112_0065957 3300048915 Bacteria 3572
808 Ga0496112_0541432 3300048915 Bacteria 1098
809 Ga0496113_0030139 3300048916 Bacteria 3925
810 Ga0496113_0038047 3300048916 Bacteria 3535
811 Ga0496113_0163600 3300048916 Bacteria 1760
812 Ga0496113_0215179 3300048916 Bacteria 1530
813 Ga0496113_0408474 3300048916 Bacteria 1090
814 Ga0496114_0001628 3300048917 Bacteria 17045
815 Ga0496114_0012380 3300048917 Bacteria 6827
816 Ga0496114_0019031 3300048917 Bacteria 5563
817 Ga0496114_0029356 3300048917 Bacteria 4519
818 Ga0496114_0030315 3300048917 Bacteria 4450
819 Ga0496114_0155050 3300048917 Bacteria 1988
820 Ga0496114_0183763 3300048917 Bacteria 1826
821 Ga0496114_0200650 3300048917 Bacteria 1747
822 Ga0496115_0006660 3300048918 Bacteria 8478
823 Ga0496115_0021261 3300048918 Bacteria 5011
824 Ga0496115_0034382 3300048918 Bacteria 4005
825 Ga0496115_0070080 3300048918 Bacteria 2841
826 Ga0496115_0150799 3300048918 Bacteria 1920
827 Ga0496115_0199551 3300048918 Bacteria 1653
828 Ga0496115_0965798 3300048918 Bacteria 653
829 Ga0496117_0236648 3300048920 Bacteria 1005
830 Ga0496125_0093747 3300048928 Bacteria 2240
831 Ga0496126_0322404 3300048929 Bacteria 1269
832 Ga0496126_0646897 3300048929 Bacteria 828
833 nmdc:mga03683_68821_c1 3300050489 Bacteria 1509
834 nmdc:mga00v17_264512_c1 3300050491 Bacteria 1116
835 nmdc:mga00v17_82622_c1 3300050491 Bacteria 2008
836 nmdc:mga0yw44_229616_c1 3300050492 Bacteria 1231
837 nmdc:mga0yw44_30323_c1 3300050492 Bacteria 3132
838 nmdc:mga06z11_167969_c1 3300050494 Bacteria 1258
839 nmdc:mga05p37_172342_c1 3300050507 Bacteria 1979
840 nmdc:mga05p37_199149_c1 3300050507 Bacteria 2427
841 nmdc:mga05p37_66203_c1 3300050507 Bacteria 4444
842 nmdc:mga09592_23781_c1 3300050508 Bacteria 5062
843 nmdc:mga09592_270_c1 3300050508 Bacteria 37634
844 nmdc:mga0qj67_43207_c1 3300050509 Bacteria 3549
845 nmdc:mga0qj67_49989_c1 3300050509 Bacteria 3305
846 nmdc:mga06r32_181563_c1 3300050510 Bacteria 1458
847 nmdc:mga06r32_416243_c1 3300050510 Bacteria 1325
848 nmdc:mga06r32_518749_c1 3300050510 Bacteria 1167
849 nmdc:mga06r32_9538_c1 3300050510 Bacteria 8765
850 nmdc:mga0n895_990672_c1 3300050512 Bacteria 822
851 nmdc:mga0rr50_28392_c1 3300050513 Bacteria 3933
852 nmdc:mga0rr50_319849_c1 3300050513 Bacteria 1301
853 nmdc:mga0rr50_380489_c1 3300050513 Bacteria 1190
854 nmdc:mga08x19_35523_c1 3300050514 Bacteria 3153
855 nmdc:mga08x19_434490_c1 3300050514 Bacteria 923
856 nmdc:mga0a205_69593_c1 3300050515 Bacteria 3397
857 nmdc:mga0sz30_268407_c1 3300050516 Bacteria 760
858 Ga0495601_0002161 3300053077 Bacteria 11063
859 Ga0495601_0042702 3300053077 Bacteria 2845
860 Ga0495601_0274815 3300053077 Bacteria 1099
861 Ga0495612_0002534 3300053078 Bacteria 7539
862 Ga0495612_0054902 3300053078 Bacteria 1641
863 Ga0495612_0107099 3300053078 Bacteria 1194
864 Ga0500635_0086312 3300053080 Bacteria 1135
865 Ga0495595_0017708 3300053084 Bacteria 3068
866 Ga0495595_0062076 3300053084 Bacteria 1751
867 Ga0495595_0103448 3300053084 Bacteria 1376
868 Ga0495595_0300924 3300053084 Bacteria 807
869 Ga0495595_0404554 3300053084 Bacteria 692
870 Ga0495619_0002498 3300053085 Bacteria 12040
871 Ga0495619_0072445 3300053085 Bacteria 2307
872 Ga0500643_016143 3300053087 Bacteria 2539
873 Ga0500646_0000227 3300053090 Bacteria 16961
874 Ga0500583_0089433 3300053092 Bacteria 1497
875 Ga0500652_000650 3300053131 Bacteria 11826
876 Ga0500652_103213 3300053131 Bacteria 1192
877 Ga0500658_0103063 3300053134 Bacteria 1248
878 Ga0500588_0002499 3300053146 Bacteria 3750
879 Ga0500627_0000697 3300053158 Bacteria 8936
880 Ga0500645_000063 3300053730 Bacteria 85018
881 Ga0466962_0000491 3300061719 Bacteria 17164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0996910 Ga0496109_0996910_169_759 178
2 3300005347 Ga0070668_100023364 Ga0070668_1000233643 180
3 3300005719 Ga0068861_100075444 Ga0068861_1000754442 180
4 3300013306 Ga0163162_10451695 Ga0163162_104516951 180
5 3300026118 Ga0207675_100028799 Ga0207675_1000287993 180
6 3300042005 Ga0439448_0079217 Ga0439448_0079217_516_1079 181
7 3300005841 Ga0068863_100147341 Ga0068863_1001473412 184
8 3300026088 Ga0207641_10093683 Ga0207641_100936832 184
9 3300036401 Ga0373937_0828406 Ga0373937_0828406_33_620 188
10 3300002077 JGI24744J21845_10000985 JGI24744J21845_100009852 190
11 3300005328 Ga0070676_10104642 Ga0070676_101046422 190
12 3300005330 Ga0070690_100026670 Ga0070690_1000266702 190
13 3300005334 Ga0068869_100037649 Ga0068869_1000376493 190
14 3300005338 Ga0068868_100000265 Ga0068868_10000026512 190
15 3300005340 Ga0070689_100030411 Ga0070689_1000304113 190
16 3300005341 Ga0070691_10005965 Ga0070691_100059652 190
17 3300005347 Ga0070668_100000455 Ga0070668_1000004555 190
18 3300005353 Ga0070669_100020736 Ga0070669_1000207362 190
19 3300005356 Ga0070674_100000174 Ga0070674_10000017416 190
20 3300005365 Ga0070688_100016229 Ga0070688_1000162292 190
21 3300005366 Ga0070659_100032427 Ga0070659_1000324273 190
22 3300005367 Ga0070667_100000598 Ga0070667_10000059810 190
23 3300005437 Ga0070710_10001110 Ga0070710_100011108 190
24 3300005438 Ga0070701_10001050 Ga0070701_100010505 190
25 3300005439 Ga0070711_100001452 Ga0070711_1000014523 190
26 3300005440 Ga0070705_100004745 Ga0070705_1000047455 190
27 3300005444 Ga0070694_100016452 Ga0070694_1000164524 190
28 3300005456 Ga0070678_100000417 Ga0070678_1000004178 190
29 3300005457 Ga0070662_100014635 Ga0070662_1000146352 190
30 3300005459 Ga0068867_100009482 Ga0068867_1000094825 190
31 3300005466 Ga0070685_10104060 Ga0070685_101040602 190
32 3300005539 Ga0068853_100038879 Ga0068853_1000388793 190
33 3300005545 Ga0070695_100013381 Ga0070695_1000133813 190
34 3300005546 Ga0070696_100006966 Ga0070696_1000069663 190
35 3300005548 Ga0070665_100044922 Ga0070665_1000449222 190
36 3300005549 Ga0070704_100004004 Ga0070704_1000040042 190
37 3300005578 Ga0068854_100000759 Ga0068854_10000075915 190
38 3300005615 Ga0070702_100003039 Ga0070702_1000030395 190
39 3300005616 Ga0068852_100027793 Ga0068852_1000277932 190
40 3300005617 Ga0068859_100000995 Ga0068859_10000099516 190
41 3300005718 Ga0068866_10000103 Ga0068866_100001038 190
42 3300005842 Ga0068858_100007072 Ga0068858_1000070724 190
43 3300005843 Ga0068860_100015253 Ga0068860_1000152536 190
44 3300005844 Ga0068862_100009073 Ga0068862_1000090733 190
45 3300006163 Ga0070715_10002094 Ga0070715_100020943 190
46 3300006173 Ga0070716_100001890 Ga0070716_1000018904 190
47 3300006175 Ga0070712_100006518 Ga0070712_1000065182 190
48 3300006237 Ga0097621_100138077 Ga0097621_1001380772 190
49 3300006881 Ga0068865_100007291 Ga0068865_1000072912 190
50 3300006931 Ga0097620_100000995 Ga0097620_1000009959 190
51 3300009092 Ga0105250_10162336 Ga0105250_101623362 190
52 3300009098 Ga0105245_10003044 Ga0105245_1000304410 190
53 3300009101 Ga0105247_10000279 Ga0105247_100002797 190
54 3300009148 Ga0105243_10001443 Ga0105243_1000144313 190
55 3300009176 Ga0105242_10000551 Ga0105242_100005519 190
56 3300009177 Ga0105248_10004599 Ga0105248_1000459910 190
57 3300009545 Ga0105237_10041116 Ga0105237_100411163 190
58 3300009553 Ga0105249_10011764 Ga0105249_100117642 190
59 3300013306 Ga0163162_10008789 Ga0163162_100087894 190
60 3300013307 Ga0157372_10099026 Ga0157372_100990263 190
61 3300014326 Ga0157380_10000918 Ga0157380_1000091810 190
62 3300014968 Ga0157379_10000781 Ga0157379_100007815 190
63 3300017792 Ga0163161_10008981 Ga0163161_100089816 190
64 3300025898 Ga0207692_10014716 Ga0207692_100147162 190
65 3300025899 Ga0207642_10000651 Ga0207642_100006517 190
66 3300025900 Ga0207710_10015088 Ga0207710_100150882 190
67 3300025901 Ga0207688_10004249 Ga0207688_100042492 190
68 3300025905 Ga0207685_10003273 Ga0207685_100032733 190
69 3300025906 Ga0207699_10049900 Ga0207699_100499002 190
70 3300025907 Ga0207645_10203818 Ga0207645_102038181 190
71 3300025915 Ga0207693_10000320 Ga0207693_1000032037 190
72 3300025916 Ga0207663_10004022 Ga0207663_100040222 190
73 3300025926 Ga0207659_10513281 Ga0207659_105132812 190
74 3300025927 Ga0207687_10005088 Ga0207687_100050885 190
75 3300025933 Ga0207706_10011104 Ga0207706_1001110410 190
76 3300025934 Ga0207686_10055958 Ga0207686_100559583 190
77 3300025935 Ga0207709_10005487 Ga0207709_100054876 190
78 3300025936 Ga0207670_10034471 Ga0207670_100344713 190
79 3300025937 Ga0207669_10000415 Ga0207669_1000041514 190
80 3300025938 Ga0207704_10000497 Ga0207704_1000049713 190
81 3300025939 Ga0207665_10006186 Ga0207665_100061865 190
82 3300025942 Ga0207689_10110200 Ga0207689_101102003 190
83 3300025972 Ga0207668_10002762 Ga0207668_100027629 190
84 3300025986 Ga0207658_10026543 Ga0207658_100265433 190
85 3300026023 Ga0207677_10000663 Ga0207677_1000066313 190
86 3300026035 Ga0207703_10002809 Ga0207703_100028096 190
87 3300026041 Ga0207639_10086370 Ga0207639_100863702 190
88 3300026075 Ga0207708_10022478 Ga0207708_100224782 190
89 3300026078 Ga0207702_10098495 Ga0207702_100984951 190
90 3300026089 Ga0207648_10000451 Ga0207648_1000045139 190
91 3300026118 Ga0207675_100023739 Ga0207675_1000237393 190
92 3300026121 Ga0207683_10000665 Ga0207683_1000066526 190
93 3300026142 Ga0207698_10015490 Ga0207698_100154904 190
94 3300028379 Ga0268266_10032412 Ga0268266_100324122 190
95 3300028381 Ga0268264_10011372 Ga0268264_100113724 190
96 3300046809 Ga0495600_0670133 Ga0495600_0670133_30_602 190
97 3300048903 Ga0496100_0004465 Ga0496100_0004465_2871_3542 190
98 3300048905 Ga0496102_0007545 Ga0496102_0007545_3575_4246 190
99 3300048906 Ga0496103_0000325 Ga0496103_0000325_11040_11711 190
100 3300048909 Ga0496106_0001362 Ga0496106_0001362_11517_12188 190
101 3300048910 Ga0496107_0001156 Ga0496107_0001156_13108_13779 190
102 3300048917 Ga0496114_0001628 Ga0496114_0001628_10475_11146 190
103 3300048918 Ga0496115_0006660 Ga0496115_0006660_1584_2255 190
104 3300013297 Ga0157378_10001937 Ga0157378_1000193715 192
105 3300013308 Ga0157375_10006369 Ga0157375_100063699 192
106 3300035691 Ga0373931_0118059 Ga0373931_0118059_728_1399 192
107 3300048912 Ga0496109_0802475 Ga0496109_0802475_52_639 192
108 3300048918 Ga0496115_0965798 Ga0496115_0965798_25_615 192
109 3300053084 Ga0495595_0404554 Ga0495595_0404554_33_620 192
110 3300041411 Ga0439466_0090101 Ga0439466_0090101_153_818 193
111 3300005981 Ga0081538_10089137 Ga0081538_100891372 197
112 3300048903 Ga0496100_0000466 Ga0496100_0000466_5077_5745 197
113 3300048909 Ga0496106_0034564 Ga0496106_0034564_1937_2605 197
114 3300048917 Ga0496114_0030315 Ga0496114_0030315_2749_3417 197
115 3300005330 Ga0070690_100292530 Ga0070690_1002925302 202
116 3300005356 Ga0070674_100125559 Ga0070674_1001255592 202
117 3300005456 Ga0070678_100144298 Ga0070678_1001442982 202
118 3300005544 Ga0070686_100271563 Ga0070686_1002715632 202
119 3300005718 Ga0068866_10046459 Ga0068866_100464592 202
120 3300009176 Ga0105242_10225864 Ga0105242_102258642 202
121 3300009177 Ga0105248_10190064 Ga0105248_101900642 202
122 3300014968 Ga0157379_10212942 Ga0157379_102129422 202
123 3300025937 Ga0207669_10025046 Ga0207669_100250462 202
124 3300026121 Ga0207683_10077553 Ga0207683_100775532 202
125 3300048904 Ga0496101_0005804 Ga0496101_0005804_2180_2896 202
126 3300048905 Ga0496102_0038987 Ga0496102_0038987_346_1062 202
127 3300048907 Ga0496104_0006961 Ga0496104_0006961_1174_1890 202
128 3300048908 Ga0496105_0005086 Ga0496105_0005086_3681_4397 202
129 3300048910 Ga0496107_0005433 Ga0496107_0005433_2241_2957 202
130 3300048918 Ga0496115_0034382 Ga0496115_0034382_330_1046 202
131 3300005355 Ga0070671_100115862 Ga0070671_1001158622 204
132 3300005367 Ga0070667_100202056 Ga0070667_1002020562 204
133 3300005468 Ga0070707_100328171 Ga0070707_1003281712 204
134 3300005471 Ga0070698_100004212 Ga0070698_10000421213 204
135 3300005518 Ga0070699_100136854 Ga0070699_1001368542 204
136 3300005843 Ga0068860_100384477 Ga0068860_1003844772 204
137 3300009553 Ga0105249_10024827 Ga0105249_100248272 204
138 3300025922 Ga0207646_10170287 Ga0207646_101702872 204
139 3300025931 Ga0207644_10337154 Ga0207644_103371541 204
140 3300025961 Ga0207712_10303777 Ga0207712_103037772 204
141 3300028379 Ga0268266_10739900 Ga0268266_107399001 204
142 3300028380 Ga0268265_10783775 Ga0268265_107837751 204
143 3300046533 Ga0495640_0379054 Ga0495640_0379054_10_639 204
144 3300048911 Ga0496108_0088326 Ga0496108_0088326_14_628 204
145 3300048911 Ga0496108_0126083 Ga0496108_0126083_242_913 204
146 3300048913 Ga0496110_0413473 Ga0496110_0413473_29_700 204
147 3300048915 Ga0496112_0065957 Ga0496112_0065957_597_1268 204
148 3300048916 Ga0496113_0163600 Ga0496113_0163600_221_892 204
149 3300053078 Ga0495612_0107099 Ga0495612_0107099_28_774 204
150 3300005467 Ga0070706_100409818 Ga0070706_1004098182 205
151 3300046454 Ga0495592_0109978 Ga0495592_0109978_879_1580 205
152 3300046526 Ga0495666_0295064 Ga0495666_0295064_17_718 205
153 3300046543 Ga0495645_0110710 Ga0495645_0110710_529_1230 205
154 3300046559 Ga0495667_0017425 Ga0495667_0017425_3675_4376 205
155 3300046642 Ga0495634_0204909 Ga0495634_0204909_72_773 205
156 3300046675 Ga0495657_0138095 Ga0495657_0138095_530_1231 205
157 3300005434 Ga0070709_10016737 Ga0070709_100167373 206
158 3300005435 Ga0070714_101136655 Ga0070714_1011366551 206
159 3300005437 Ga0070710_10028063 Ga0070710_100280632 206
160 3300005439 Ga0070711_100122108 Ga0070711_1001221082 206
161 3300005841 Ga0068863_100011989 Ga0068863_1000119893 206
162 3300006163 Ga0070715_10017521 Ga0070715_100175212 206
163 3300006173 Ga0070716_100024660 Ga0070716_1000246603 206
164 3300006175 Ga0070712_100552352 Ga0070712_1005523522 206
165 3300025906 Ga0207699_10006080 Ga0207699_100060807 206
166 3300025916 Ga0207663_10774373 Ga0207663_107743731 206
167 3300025928 Ga0207700_10016141 Ga0207700_100161416 206
168 3300025928 Ga0207700_10492374 Ga0207700_104923742 206
169 3300046809 Ga0495600_0160874 Ga0495600_0160874_25_651 206
170 3300025972 Ga0207668_10168510 Ga0207668_101685102 207
171 3300053131 Ga0500652_000650 Ga0500652_000650_5419_6117 208
172 3300048907 Ga0496104_0105516 Ga0496104_0105516_996_1667 209
173 3300050510 nmdc:mga06r32_518749_c1 nmdc:mga06r32_518749_c1_383_1021 209
174 3300050510 nmdc:mga06r32_9538_c1 nmdc:mga06r32_9538_c1_4570_5208 209
175 3300013306 Ga0163162_10305651 Ga0163162_103056513 211
176 3300048917 Ga0496114_0200650 Ga0496114_0200650_275_916 211
177 iso_pu_bacteria 2643221711 2644610042 211
178 iso_pu_bacteria 2818991458 2819667795 211
179 3300005337 Ga0070682_100122226 Ga0070682_1001222262 212
180 3300005343 Ga0070687_100054420 Ga0070687_1000544202 212
181 3300005535 Ga0070684_101183786 Ga0070684_1011837861 212
182 3300005548 Ga0070665_100233181 Ga0070665_1002331811 212
183 3300005618 Ga0068864_100281321 Ga0068864_1002813211 212
184 3300006028 Ga0070717_10304231 Ga0070717_103042312 212
185 3300006847 Ga0075431_100014875 Ga0075431_1000148753 212
186 3300006847 Ga0075431_100204899 Ga0075431_1002048992 212
187 3300009148 Ga0105243_10106616 Ga0105243_101066164 212
188 3300009176 Ga0105242_10772909 Ga0105242_107729091 212
189 3300009551 Ga0105238_10120598 Ga0105238_101205983 212
190 3300009553 Ga0105249_10077184 Ga0105249_100771844 212
191 3300010375 Ga0105239_10123756 Ga0105239_101237565 212
192 3300011119 Ga0105246_10170648 Ga0105246_101706482 212
193 3300013308 Ga0157375_10490605 Ga0157375_104906052 212
194 3300014325 Ga0163163_10347185 Ga0163163_103471853 212
195 3300014326 Ga0157380_10149743 Ga0157380_101497432 212
196 3300025937 Ga0207669_10133823 Ga0207669_101338233 212
197 3300025945 Ga0207679_10861915 Ga0207679_108619151 212
198 3300025972 Ga0207668_10306978 Ga0207668_103069782 212
199 3300026089 Ga0207648_10085983 Ga0207648_100859832 212
200 3300026121 Ga0207683_10057046 Ga0207683_100570463 212
201 3300041410 Ga0439461_0000425 Ga0439461_0000425_3550_4215 212
202 3300041411 Ga0439466_0020257 Ga0439466_0020257_506_1171 212
203 3300041997 Ga0439431_0015856 Ga0439431_0015856_864_1529 212
204 3300042002 Ga0439442_006464 Ga0439442_006464_435_1100 212
205 3300042435 Ga0439434_0035218 Ga0439434_0035218_651_1316 212
206 3300044658 Ga0466972_0046925 Ga0466972_0046925_1215_1874 212
207 3300044735 Ga0466968_0022125 Ga0466968_0022125_589_1248 212
208 3300045049 Ga0466959_0132409 Ga0466959_0132409_659_1318 212
209 3300046463 Ga0495653_0067083 Ga0495653_0067083_420_1064 212
210 3300046477 Ga0495664_0306910 Ga0495664_0306910_155_799 212
211 3300046537 Ga0495598_0193629 Ga0495598_0193629_27_671 212
212 3300048908 Ga0496105_0131559 Ga0496105_0131559_553_1197 212
213 3300048911 Ga0496108_0739406 Ga0496108_0739406_126_770 212
214 3300048911 Ga0496108_0765788 Ga0496108_0765788_106_750 212
215 3300048913 Ga0496110_0259122 Ga0496110_0259122_889_1533 212
216 iso_pu_bacteria 2643221687 2644486368 212
217 iso_pu_bacteria 2902837492 2902840215 212
218 3300005471 Ga0070698_100003317 Ga0070698_1000033174 213
219 3300006051 Ga0075364_10086242 Ga0075364_100862422 213
220 3300006847 Ga0075431_100774487 Ga0075431_1007744872 213
221 3300026121 Ga0207683_10574394 Ga0207683_105743942 213
222 3300031852 Ga0307410_10525727 Ga0307410_105257272 213
223 3300048903 Ga0496100_0007116 Ga0496100_0007116_975_1631 213
224 3300048904 Ga0496101_0001809 Ga0496101_0001809_8866_9522 213
225 3300048905 Ga0496102_0001111 Ga0496102_0001111_10959_11615 213
226 3300048905 Ga0496102_0081114 Ga0496102_0081114_1951_2610 213
227 3300048906 Ga0496103_0048063 Ga0496103_0048063_1445_2101 213
228 3300048906 Ga0496103_0232211 Ga0496103_0232211_40_708 213
229 3300048907 Ga0496104_0004493 Ga0496104_0004493_4631_5287 213
230 3300048907 Ga0496104_0025994 Ga0496104_0025994_3116_3772 213
231 3300048908 Ga0496105_0002369 Ga0496105_0002369_8916_9572 213
232 3300048908 Ga0496105_0070159 Ga0496105_0070159_602_1258 213
233 3300048908 Ga0496105_0529172 Ga0496105_0529172_54_713 213
234 3300048913 Ga0496110_0082731 Ga0496110_0082731_179_835 213
235 3300048914 Ga0496111_0415161 Ga0496111_0415161_144_800 213
236 3300048916 Ga0496113_0030139 Ga0496113_0030139_2488_3147 213
237 3300048916 Ga0496113_0408474 Ga0496113_0408474_195_851 213
238 3300048917 Ga0496114_0019031 Ga0496114_0019031_4473_5129 213
239 3300048917 Ga0496114_0183763 Ga0496114_0183763_199_855 213
240 3300048918 Ga0496115_0150799 Ga0496115_0150799_491_1147 213
241 3300050491 nmdc:mga00v17_264512_c1 nmdc:mga00v17_264512_c1_49_711 213
242 3300050510 nmdc:mga06r32_416243_c1 nmdc:mga06r32_416243_c1_399_1055 213
243 3300025303 Ga0209051_1006886 Ga0209051_10068862 214
244 3300025939 Ga0207665_10022481 Ga0207665_100224813 214
245 3300035086 Ga0373934_0038478 Ga0373934_0038478_71_742 214
246 3300035118 Ga0373954_0085055 Ga0373954_0085055_825_1496 214
247 3300035119 Ga0373956_0059799 Ga0373956_0059799_961_1632 214
248 3300035120 Ga0373957_0040059 Ga0373957_0040059_971_1642 214
249 3300035691 Ga0373931_0268185 Ga0373931_0268185_107_808 214
250 3300035724 Ga0373933_0020937 Ga0373933_0020937_953_1624 214
251 3300037853 Ga0436364_0922968 Ga0436364_0922968_1036_1707 214
252 3300044765 Ga0466970_0033353 Ga0466970_0033353_715_1377 214
253 3300046663 Ga0495635_0013555 Ga0495635_0013555_591_1262 214
254 3300046809 Ga0495600_0089150 Ga0495600_0089150_1303_1974 214
255 3300047319 Ga0495674_0174272 Ga0495674_0174272_967_1638 214
256 3300047322 Ga0495680_0085849 Ga0495680_0085849_1345_2016 214
257 3300047444 Ga0495675_0055318 Ga0495675_0055318_1060_1731 214
258 3300047471 Ga0495684_0121656 Ga0495684_0121656_958_1629 214
259 3300050492 nmdc:mga0yw44_229616_c1 nmdc:mga0yw44_229616_c1_538_1215 214
260 3300053084 Ga0495595_0300924 Ga0495595_0300924_49_720 214
261 iso_pu_bacteria 2643221690 2644506735 214
262 iso_pu_bacteria 2643221694 2644527727 214
263 iso_pu_bacteria 2643221722 2644670652 214
264 iso_pu_bacteria 2675903059 2676483549 214
265 iso_pu_bacteria 2738541274 2738706200 214
266 iso_pu_bacteria 2738543028 2739332898 214
267 3300002077 JGI24744J21845_10024362 JGI24744J21845_100243621 215
268 3300005338 Ga0068868_100088550 Ga0068868_1000885502 215
269 3300005347 Ga0070668_100146899 Ga0070668_1001468992 215
270 3300005356 Ga0070674_100006521 Ga0070674_1000065215 215
271 3300005364 Ga0070673_100230127 Ga0070673_1002301272 215
272 3300005367 Ga0070667_100166430 Ga0070667_1001664302 215
273 3300005434 Ga0070709_10085613 Ga0070709_100856131 215
274 3300005435 Ga0070714_100100783 Ga0070714_1001007832 215
275 3300005437 Ga0070710_10020610 Ga0070710_100206102 215
276 3300005439 Ga0070711_100009619 Ga0070711_1000096194 215
277 3300005456 Ga0070678_100056036 Ga0070678_1000560362 215
278 3300005457 Ga0070662_100051034 Ga0070662_1000510342 215
279 3300005539 Ga0068853_100061169 Ga0068853_1000611693 215
280 3300005548 Ga0070665_100019640 Ga0070665_1000196404 215
281 3300005549 Ga0070704_100038335 Ga0070704_1000383352 215
282 3300005578 Ga0068854_100406104 Ga0068854_1004061041 215
283 3300005618 Ga0068864_100135672 Ga0068864_1001356721 215
284 3300005718 Ga0068866_10101580 Ga0068866_101015802 215
285 3300005719 Ga0068861_100079890 Ga0068861_1000798902 215
286 3300005834 Ga0068851_10127321 Ga0068851_101273212 215
287 3300005841 Ga0068863_100412844 Ga0068863_1004128442 215
288 3300005937 Ga0081455_10017921 Ga0081455_100179212 215
289 3300006038 Ga0075365_10006636 Ga0075365_100066364 215
290 3300006173 Ga0070716_100119642 Ga0070716_1001196422 215
291 3300006173 Ga0070716_100177433 Ga0070716_1001774332 215
292 3300006175 Ga0070712_100349330 Ga0070712_1003493302 215
293 3300006178 Ga0075367_10173930 Ga0075367_101739302 215
294 3300006186 Ga0075369_10006227 Ga0075369_100062274 215
295 3300006237 Ga0097621_100156100 Ga0097621_1001561002 215
296 3300006844 Ga0075428_100001048 Ga0075428_10000104828 215
297 3300006846 Ga0075430_100012222 Ga0075430_1000122228 215
298 3300006847 Ga0075431_100364054 Ga0075431_1003640542 215
299 3300006881 Ga0068865_100436798 Ga0068865_1004367982 215
300 3300009098 Ga0105245_10144351 Ga0105245_101443512 215
301 3300009098 Ga0105245_10781862 Ga0105245_107818622 215
302 3300009101 Ga0105247_10015410 Ga0105247_100154103 215
303 3300009147 Ga0114129_10025054 Ga0114129_100250546 215
304 3300009148 Ga0105243_10063692 Ga0105243_100636922 215
305 3300009177 Ga0105248_10136290 Ga0105248_101362902 215
306 3300009545 Ga0105237_10529268 Ga0105237_105292682 215
307 3300009553 Ga0105249_10160180 Ga0105249_101601802 215
308 3300011119 Ga0105246_10018664 Ga0105246_100186642 215
309 3300013306 Ga0163162_10380728 Ga0163162_103807281 215
310 3300013308 Ga0157375_10802315 Ga0157375_108023152 215
311 3300014969 Ga0157376_10909984 Ga0157376_109099841 215
312 3300025885 Ga0207653_10032963 Ga0207653_100329632 215
313 3300025898 Ga0207692_10029842 Ga0207692_100298422 215
314 3300025900 Ga0207710_10080859 Ga0207710_100808592 215
315 3300025901 Ga0207688_10014643 Ga0207688_100146432 215
316 3300025904 Ga0207647_10019580 Ga0207647_100195802 215
317 3300025905 Ga0207685_10023198 Ga0207685_100231982 215
318 3300025906 Ga0207699_10075340 Ga0207699_100753402 215
319 3300025907 Ga0207645_10308318 Ga0207645_103083182 215
320 3300025915 Ga0207693_10017765 Ga0207693_100177653 215
321 3300025916 Ga0207663_10003612 Ga0207663_100036125 215
322 3300025919 Ga0207657_10601486 Ga0207657_106014861 215
323 3300025924 Ga0207694_10446478 Ga0207694_104464782 215
324 3300025927 Ga0207687_10025124 Ga0207687_100251243 215
325 3300025929 Ga0207664_10121171 Ga0207664_101211712 215
326 3300025933 Ga0207706_10037870 Ga0207706_100378702 215
327 3300025935 Ga0207709_10035131 Ga0207709_100351313 215
328 3300025936 Ga0207670_10264605 Ga0207670_102646052 215
329 3300025938 Ga0207704_10047128 Ga0207704_100471282 215
330 3300025938 Ga0207704_10369790 Ga0207704_103697901 215
331 3300025939 Ga0207665_10032442 Ga0207665_100324423 215
332 3300025940 Ga0207691_10035502 Ga0207691_100355023 215
333 3300025942 Ga0207689_10012026 Ga0207689_100120264 215
334 3300025960 Ga0207651_10024297 Ga0207651_100242972 215
335 3300025961 Ga0207712_10071413 Ga0207712_100714132 215
336 3300025981 Ga0207640_10252662 Ga0207640_102526622 215
337 3300026023 Ga0207677_10076042 Ga0207677_100760421 215
338 3300026067 Ga0207678_10048537 Ga0207678_100485373 215
339 3300026075 Ga0207708_10006741 Ga0207708_100067417 215
340 3300026088 Ga0207641_10223635 Ga0207641_102236352 215
341 3300026121 Ga0207683_10210305 Ga0207683_102103052 215
342 3300035112 Ga0373932_0029274 Ga0373932_0029274_221_892 215
343 3300035114 Ga0373939_0034308 Ga0373939_0034308_445_1116 215
344 3300035691 Ga0373931_0039606 Ga0373931_0039606_522_1193 215
345 3300044901 Ga0466960_0148844 Ga0466960_0148844_138_809 215
346 3300045976 Ga0466967_0104797 Ga0466967_0104797_1139_1813 215
347 3300045976 Ga0466967_0331319 Ga0466967_0331319_763_1434 215
348 3300046615 Ga0495656_0067259 Ga0495656_0067259_30_686 215
349 3300048903 Ga0496100_0069688 Ga0496100_0069688_291_962 215
350 3300048905 Ga0496102_0043526 Ga0496102_0043526_1714_2385 215
351 3300048905 Ga0496102_0113978 Ga0496102_0113978_529_1200 215
352 3300048905 Ga0496102_0565683 Ga0496102_0565683_268_939 215
353 3300048906 Ga0496103_0009479 Ga0496103_0009479_1264_1935 215
354 3300048907 Ga0496104_0279855 Ga0496104_0279855_239_910 215
355 3300048909 Ga0496106_0167222 Ga0496106_0167222_799_1470 215
356 3300048911 Ga0496108_0021343 Ga0496108_0021343_3064_3735 215
357 3300048912 Ga0496109_0021430 Ga0496109_0021430_1887_2558 215
358 3300048913 Ga0496110_0092549 Ga0496110_0092549_1157_1828 215
359 3300048915 Ga0496112_0016784 Ga0496112_0016784_2869_3540 215
360 3300048916 Ga0496113_0038047 Ga0496113_0038047_106_777 215
361 3300048917 Ga0496114_0012380 Ga0496114_0012380_619_1290 215
362 3300048918 Ga0496115_0199551 Ga0496115_0199551_99_770 215
363 3300050489 nmdc:mga03683_68821_c1 nmdc:mga03683_68821_c1_695_1366 215
364 3300050491 nmdc:mga00v17_82622_c1 nmdc:mga00v17_82622_c1_142_813 215
365 3300050494 nmdc:mga06z11_167969_c1 nmdc:mga06z11_167969_c1_367_1038 215
366 3300050507 nmdc:mga05p37_66203_c1 nmdc:mga05p37_66203_c1_503_1174 215
367 3300050509 nmdc:mga0qj67_43207_c1 nmdc:mga0qj67_43207_c1_1003_1674 215
368 3300050510 nmdc:mga06r32_181563_c1 nmdc:mga06r32_181563_c1_108_779 215
369 3300053080 Ga0500635_0086312 Ga0500635_0086312_271_948 215
370 3300005435 Ga0070714_100076583 Ga0070714_1000765833 216
371 3300006173 Ga0070716_100015780 Ga0070716_1000157803 216
372 3300013308 Ga0157375_11098204 Ga0157375_110982042 216
373 3300025303 Ga0209051_1072020 Ga0209051_10720202 216
374 3300025898 Ga0207692_10003051 Ga0207692_100030514 216
375 3300025906 Ga0207699_10009375 Ga0207699_100093753 216
376 3300025929 Ga0207664_10279286 Ga0207664_102792861 216
377 3300025939 Ga0207665_10046112 Ga0207665_100461124 216
378 3300032004 Ga0307414_10779706 Ga0307414_107797061 216
379 3300032126 Ga0307415_100481297 Ga0307415_1004812971 216
380 3300041451 Ga0451791_1188155 Ga0451791_1188155_785_1447 216
381 3300041460 Ga0451802_0165858 Ga0451802_0165858_150_812 216
382 3300041496 Ga0451839_1060590 Ga0451839_1060590_159_821 216
383 3300046460 Ga0495638_0179154 Ga0495638_0179154_130_804 216
384 3300047320 Ga0495672_0153980 Ga0495672_0153980_15_689 216
385 3300048928 Ga0496125_0093747 Ga0496125_0093747_1479_2159 216
386 3300048929 Ga0496126_0322404 Ga0496126_0322404_562_1242 216
387 3300050492 nmdc:mga0yw44_30323_c1 nmdc:mga0yw44_30323_c1_958_1635 216
388 3300050516 nmdc:mga0sz30_268407_c1 nmdc:mga0sz30_268407_c1_29_703 216
389 3300053087 Ga0500643_016143 Ga0500643_016143_632_1306 216
390 3300053131 Ga0500652_103213 Ga0500652_103213_384_1058 216
391 3300053134 Ga0500658_0103063 Ga0500658_0103063_401_1075 216
392 3300053158 Ga0500627_0000697 Ga0500627_0000697_7094_7768 216
393 3300053730 Ga0500645_000063 Ga0500645_000063_9549_10229 216
394 iso_pu_bacteria 2939582691 2939587394 216
395 3300005335 Ga0070666_10047828 Ga0070666_100478283 217
396 3300005336 Ga0070680_100079057 Ga0070680_1000790573 217
397 3300005337 Ga0070682_100031720 Ga0070682_1000317203 217
398 3300005340 Ga0070689_100164351 Ga0070689_1001643511 217
399 3300005341 Ga0070691_10050323 Ga0070691_100503231 217
400 3300005344 Ga0070661_100008632 Ga0070661_1000086329 217
401 3300005354 Ga0070675_100390671 Ga0070675_1003906711 217
402 3300005364 Ga0070673_100196242 Ga0070673_1001962422 217
403 3300005367 Ga0070667_101046919 Ga0070667_1010469191 217
404 3300005438 Ga0070701_10094086 Ga0070701_100940862 217
405 3300005455 Ga0070663_100021659 Ga0070663_1000216592 217
406 3300005456 Ga0070678_100767032 Ga0070678_1007670321 217
407 3300005535 Ga0070684_100038614 Ga0070684_1000386142 217
408 3300005543 Ga0070672_100052590 Ga0070672_1000525903 217
409 3300005544 Ga0070686_100521776 Ga0070686_1005217762 217
410 3300005545 Ga0070695_100198376 Ga0070695_1001983762 217
411 3300005547 Ga0070693_100024477 Ga0070693_1000244773 217
412 3300005549 Ga0070704_100323199 Ga0070704_1003231992 217
413 3300005563 Ga0068855_100271881 Ga0068855_1002718813 217
414 3300005563 Ga0068855_100571828 Ga0068855_1005718282 217
415 3300005577 Ga0068857_100058147 Ga0068857_1000581472 217
416 3300005616 Ga0068852_100062573 Ga0068852_1000625732 217
417 3300005840 Ga0068870_10050765 Ga0068870_100507652 217
418 3300006028 Ga0070717_10236287 Ga0070717_102362874 217
419 3300006163 Ga0070715_10004368 Ga0070715_100043683 217
420 3300006173 Ga0070716_100509344 Ga0070716_1005093441 217
421 3300006237 Ga0097621_100040409 Ga0097621_1000404092 217
422 3300006358 Ga0068871_100078058 Ga0068871_1000780583 217
423 3300006844 Ga0075428_100000121 Ga0075428_10000012159 217
424 3300006871 Ga0075434_100513031 Ga0075434_1005130312 217
425 3300006881 Ga0068865_100101723 Ga0068865_1001017233 217
426 3300006914 Ga0075436_100209484 Ga0075436_1002094842 217
427 3300007076 Ga0075435_100135673 Ga0075435_1001356732 217
428 3300007076 Ga0075435_100585034 Ga0075435_1005850341 217
429 3300009011 Ga0105251_10130454 Ga0105251_101304542 217
430 3300009093 Ga0105240_10125005 Ga0105240_101250053 217
431 3300009101 Ga0105247_10065084 Ga0105247_100650842 217
432 3300009148 Ga0105243_10922410 Ga0105243_109224101 217
433 3300009545 Ga0105237_10619239 Ga0105237_106192392 217
434 3300009551 Ga0105238_10089251 Ga0105238_100892513 217
435 3300009551 Ga0105238_10755169 Ga0105238_107551692 217
436 3300011119 Ga0105246_10075433 Ga0105246_100754332 217
437 3300013100 Ga0157373_10303934 Ga0157373_103039342 217
438 3300013104 Ga0157370_10344684 Ga0157370_103446842 217
439 3300013105 Ga0157369_10104777 Ga0157369_101047771 217
440 3300013296 Ga0157374_10535313 Ga0157374_105353132 217
441 3300013306 Ga0163162_10324934 Ga0163162_103249341 217
442 3300013308 Ga0157375_10184412 Ga0157375_101844123 217
443 3300014325 Ga0163163_10075470 Ga0163163_100754703 217
444 3300025900 Ga0207710_10005916 Ga0207710_100059163 217
445 3300025901 Ga0207688_10006764 Ga0207688_100067644 217
446 3300025903 Ga0207680_10129293 Ga0207680_101292932 217
447 3300025906 Ga0207699_10004754 Ga0207699_100047542 217
448 3300025912 Ga0207707_10216807 Ga0207707_102168072 217
449 3300025917 Ga0207660_10206965 Ga0207660_102069652 217
450 3300025918 Ga0207662_10029765 Ga0207662_100297652 217
451 3300025926 Ga0207659_10117533 Ga0207659_101175332 217
452 3300025928 Ga0207700_10014376 Ga0207700_100143764 217
453 3300025931 Ga0207644_10317424 Ga0207644_103174242 217
454 3300025939 Ga0207665_10231340 Ga0207665_102313402 217
455 3300025941 Ga0207711_10157217 Ga0207711_101572172 217
456 3300025942 Ga0207689_10009038 Ga0207689_100090382 217
457 3300025949 Ga0207667_10686769 Ga0207667_106867692 217
458 3300025949 Ga0207667_10839335 Ga0207667_108393352 217
459 3300025960 Ga0207651_10041183 Ga0207651_100411832 217
460 3300025961 Ga0207712_10666013 Ga0207712_106660131 217
461 3300026035 Ga0207703_10228227 Ga0207703_102282271 217
462 3300026067 Ga0207678_10013701 Ga0207678_100137014 217
463 3300026095 Ga0207676_10037818 Ga0207676_100378183 217
464 3300026116 Ga0207674_10005304 Ga0207674_100053042 217
465 3300026118 Ga0207675_100053244 Ga0207675_1000532442 217
466 3300034816 Ga0373930_0002391 Ga0373930_0002391_1002_1664 217
467 3300035084 Ga0373928_0064894 Ga0373928_0064894_201_863 217
468 3300035085 Ga0373929_0014121 Ga0373929_0014121_222_884 217
469 3300035092 Ga0373952_0004919 Ga0373952_0004919_106_768 217
470 3300035115 Ga0373941_0021457 Ga0373941_0021457_519_1181 217
471 3300035121 Ga0373960_0105314 Ga0373960_0105314_91_753 217
472 3300048903 Ga0496100_0017209 Ga0496100_0017209_1107_1769 217
473 3300048905 Ga0496102_0583553 Ga0496102_0583553_20_682 217
474 3300048909 Ga0496106_0023852 Ga0496106_0023852_3041_3703 217
475 3300048911 Ga0496108_0518554 Ga0496108_0518554_359_1021 217
476 3300048913 Ga0496110_0078676 Ga0496110_0078676_306_968 217
477 3300048915 Ga0496112_0029501 Ga0496112_0029501_3317_3979 217
478 3300048917 Ga0496114_0029356 Ga0496114_0029356_3316_3978 217
479 3300048920 Ga0496117_0236648 Ga0496117_0236648_203_880 217
480 3300048929 Ga0496126_0646897 Ga0496126_0646897_32_694 217
481 3300050513 nmdc:mga0rr50_319849_c1 nmdc:mga0rr50_319849_c1_529_1191 217
482 3300050513 nmdc:mga0rr50_380489_c1 nmdc:mga0rr50_380489_c1_270_932 217
483 3300050514 nmdc:mga08x19_434490_c1 nmdc:mga08x19_434490_c1_72_734 217
484 3300003659 JGI25404J52841_10003701 JGI25404J52841_100037012 218
485 3300005548 Ga0070665_100625293 Ga0070665_1006252931 218
486 3300005983 Ga0081540_1000151 Ga0081540_100015113 218
487 3300006880 Ga0075429_100021365 Ga0075429_1000213652 218
488 3300006914 Ga0075436_100283605 Ga0075436_1002836052 218
489 3300009147 Ga0114129_10005229 Ga0114129_100052294 218
490 3300044658 Ga0466972_0031636 Ga0466972_0031636_1737_2444 218
491 3300044683 Ga0466965_0003556 Ga0466965_0003556_4137_4844 218
492 3300044901 Ga0466960_0009227 Ga0466960_0009227_2522_3229 218
493 3300050507 nmdc:mga05p37_199149_c1 nmdc:mga05p37_199149_c1_1504_2160 218
494 3300050508 nmdc:mga09592_23781_c1 nmdc:mga09592_23781_c1_4195_4851 218
495 iso_pu_bacteria 2902792274 2902798516 218
496 3300005445 Ga0070708_100024554 Ga0070708_1000245543 219
497 3300005468 Ga0070707_100039805 Ga0070707_1000398052 219
498 3300005518 Ga0070699_100001238 Ga0070699_1000012388 219
499 3300005536 Ga0070697_100411499 Ga0070697_1004114992 219
500 3300025910 Ga0207684_10392680 Ga0207684_103926802 219
501 3300025922 Ga0207646_10045798 Ga0207646_100457982 219
502 3300050507 nmdc:mga05p37_172342_c1 nmdc:mga05p37_172342_c1_380_1039 219
503 3300003322 rootL2_10144810 rootL2_101448102 220
504 3300005434 Ga0070709_10170988 Ga0070709_101709883 220
505 3300005435 Ga0070714_100496691 Ga0070714_1004966912 220
506 3300005436 Ga0070713_100443351 Ga0070713_1004433512 220
507 3300005471 Ga0070698_100032776 Ga0070698_1000327762 220
508 3300025906 Ga0207699_10219549 Ga0207699_102195492 220
509 3300025928 Ga0207700_10524017 Ga0207700_105240172 220
510 3300025929 Ga0207664_10449303 Ga0207664_104493033 220
511 3300028573 Ga0265334_10001329 Ga0265334_1000132910 220
512 3300035083 Ga0373926_0002658 Ga0373926_0002658_338_1009 220
513 3300035086 Ga0373934_0001925 Ga0373934_0001925_3205_3876 220
514 3300035089 Ga0373944_0010853 Ga0373944_0010853_543_1214 220
515 3300035111 Ga0373923_0000236 Ga0373923_0000236_5344_6015 220
516 3300035113 Ga0373936_0000515 Ga0373936_0000515_7927_8598 220
517 3300035116 Ga0373945_0000850 Ga0373945_0000850_2975_3646 220
518 3300035117 Ga0373953_0009151 Ga0373953_0009151_707_1378 220
519 3300035119 Ga0373956_0010504 Ga0373956_0010504_90_761 220
520 3300035120 Ga0373957_0002668 Ga0373957_0002668_2553_3224 220
521 3300035170 Ga0373943_0000572 Ga0373943_0000572_9197_9868 220
522 3300035171 Ga0373946_0000135 Ga0373946_0000135_14404_15075 220
523 3300035172 Ga0373955_0019245 Ga0373955_0019245_956_1627 220
524 3300035410 Ga0373924_0002854 Ga0373924_0002854_1254_1925 220
525 3300035692 Ga0373935_0044398 Ga0373935_0044398_300_971 220
526 3300035695 Ga0373927_0006681 Ga0373927_0006681_1385_2056 220
527 3300035725 Ga0373947_0001636 Ga0373947_0001636_6052_6723 220
528 3300037068 Ga0373925_0015109 Ga0373925_0015109_2858_3529 220
529 3300046454 Ga0495592_0238198 Ga0495592_0238198_28_699 220
530 3300046455 Ga0495603_0001257 Ga0495603_0001257_7030_7701 220
531 3300046461 Ga0495641_0004172 Ga0495641_0004172_2515_3186 220
532 3300046462 Ga0495651_0018767 Ga0495651_0018767_3086_3757 220
533 3300046463 Ga0495653_0012589 Ga0495653_0012589_495_1166 220
534 3300046472 Ga0495580_0011843 Ga0495580_0011843_4958_5629 220
535 3300046473 Ga0495582_0001366 Ga0495582_0001366_3595_4266 220
536 3300046475 Ga0495639_0010831 Ga0495639_0010831_236_907 220
537 3300046476 Ga0495662_0004654 Ga0495662_0004654_5917_6588 220
538 3300046477 Ga0495664_0008837 Ga0495664_0008837_3000_3671 220
539 3300046499 Ga0495594_0026316 Ga0495594_0026316_1837_2508 220
540 3300046511 Ga0495608_0022211 Ga0495608_0022211_3143_3814 220
541 3300046514 Ga0495618_0004698 Ga0495618_0004698_5180_5851 220
542 3300046516 Ga0495628_0010263 Ga0495628_0010263_4238_4909 220
543 3300046517 Ga0495630_0000896 Ga0495630_0000896_20119_20790 220
544 3300046526 Ga0495666_0007318 Ga0495666_0007318_125_796 220
545 3300046531 Ga0495665_0000793 Ga0495665_0000793_14030_14701 220
546 3300046533 Ga0495640_0003266 Ga0495640_0003266_5344_6015 220
547 3300046535 Ga0495586_0003013 Ga0495586_0003013_1486_2157 220
548 3300046536 Ga0495587_0048194 Ga0495587_0048194_1602_2273 220
549 3300046543 Ga0495645_0030504 Ga0495645_0030504_2956_3627 220
550 3300046559 Ga0495667_0006871 Ga0495667_0006871_7030_7701 220
551 3300046642 Ga0495634_0002285 Ga0495634_0002285_5678_6349 220
552 3300046663 Ga0495635_0002970 Ga0495635_0002970_4474_5145 220
553 3300046663 Ga0495635_0159151 Ga0495635_0159151_705_1433 220
554 3300046678 Ga0495599_0045652 Ga0495599_0045652_300_971 220
555 3300046679 Ga0495623_0018307 Ga0495623_0018307_1987_2658 220
556 3300046681 Ga0495647_0001049 Ga0495647_0001049_3344_4015 220
557 3300046689 Ga0495613_0001028 Ga0495613_0001028_9294_9965 220
558 3300046690 Ga0495624_0033396 Ga0495624_0033396_2235_2906 220
559 3300046809 Ga0495600_0002966 Ga0495600_0002966_5715_6386 220
560 3300047315 Ga0495581_0000259 Ga0495581_0000259_7030_7701 220
561 3300047317 Ga0495604_0007271 Ga0495604_0007271_6493_7164 220
562 3300047319 Ga0495674_0006519 Ga0495674_0006519_9317_9988 220
563 3300047321 Ga0495676_0004285 Ga0495676_0004285_7468_8139 220
564 3300047322 Ga0495680_0020055 Ga0495680_0020055_1830_2501 220
565 3300047444 Ga0495675_0009336 Ga0495675_0009336_1976_2647 220
566 3300047471 Ga0495684_0003764 Ga0495684_0003764_7463_8134 220
567 3300047673 Ga0495593_0000939 Ga0495593_0000939_4557_5228 220
568 3300048088 Ga0495602_0041462 Ga0495602_0041462_1777_2448 220
569 3300048089 Ga0495614_0010267 Ga0495614_0010267_2763_3434 220
570 3300053077 Ga0495601_0002161 Ga0495601_0002161_6484_7155 220
571 3300053078 Ga0495612_0002534 Ga0495612_0002534_689_1360 220
572 3300053084 Ga0495595_0017708 Ga0495595_0017708_2130_2801 220
573 3300053085 Ga0495619_0002498 Ga0495619_0002498_9294_9965 220
574 3300005329 Ga0070683_100338401 Ga0070683_1003384011 221
575 3300005435 Ga0070714_100240558 Ga0070714_1002405582 221
576 3300005435 Ga0070714_101065675 Ga0070714_1010656751 221
577 3300005439 Ga0070711_100312704 Ga0070711_1003127042 221
578 3300005614 Ga0068856_100134245 Ga0068856_1001342453 221
579 3300006163 Ga0070715_10221742 Ga0070715_102217422 221
580 3300007788 Ga0099795_10087512 Ga0099795_100875122 221
581 3300009545 Ga0105237_10366293 Ga0105237_103662932 221
582 3300010159 Ga0099796_10110426 Ga0099796_101104261 221
583 3300025906 Ga0207699_10047745 Ga0207699_100477452 221
584 3300025914 Ga0207671_10187444 Ga0207671_101874442 221
585 3300025915 Ga0207693_10052598 Ga0207693_100525984 221
586 3300025929 Ga0207664_10316480 Ga0207664_103164801 221
587 3300025939 Ga0207665_10113752 Ga0207665_101137522 221
588 3300035118 Ga0373954_0002512 Ga0373954_0002512_2556_3236 221
589 3300035121 Ga0373960_0049693 Ga0373960_0049693_211_882 221
590 3300035724 Ga0373933_0004568 Ga0373933_0004568_1329_2009 221
591 3300046462 Ga0495651_0011996 Ga0495651_0011996_5976_6647 221
592 3300046511 Ga0495608_0188614 Ga0495608_0188614_572_1243 221
593 3300046529 Ga0495652_0102428 Ga0495652_0102428_1089_1760 221
594 3300046543 Ga0495645_0050282 Ga0495645_0050282_1593_2264 221
595 3300046559 Ga0495667_0084164 Ga0495667_0084164_1265_1936 221
596 3300046642 Ga0495634_0410092 Ga0495634_0410092_87_758 221
597 3300046675 Ga0495657_0139129 Ga0495657_0139129_265_936 221
598 3300046678 Ga0495599_0044277 Ga0495599_0044277_33_704 221
599 3300046809 Ga0495600_0093105 Ga0495600_0093105_695_1366 221
600 3300047317 Ga0495604_0147402 Ga0495604_0147402_14_685 221
601 3300047319 Ga0495674_0169556 Ga0495674_0169556_292_963 221
602 3300047322 Ga0495680_0006306 Ga0495680_0006306_4259_4930 221
603 3300047444 Ga0495675_0140669 Ga0495675_0140669_622_1293 221
604 3300047471 Ga0495684_0103828 Ga0495684_0103828_550_1221 221
605 3300048088 Ga0495602_0073501 Ga0495602_0073501_448_1119 221
606 3300053077 Ga0495601_0274815 Ga0495601_0274815_24_695 221
607 3300053084 Ga0495595_0103448 Ga0495595_0103448_575_1246 221
608 3300013105 Ga0157369_10061904 Ga0157369_100619043 222
609 3300013307 Ga0157372_10031255 Ga0157372_100312554 222
610 3300021388 Ga0213875_10005062 Ga0213875_100050623 222
611 3300037853 Ga0436364_1206511 Ga0436364_1206511_8902_9627 222
612 3300006175 Ga0070712_100003551 Ga0070712_1000035517 223
613 3300031548 Ga0307408_100409656 Ga0307408_1004096562 223
614 3300031731 Ga0307405_10169629 Ga0307405_101696292 223
615 3300031852 Ga0307410_10115094 Ga0307410_101150941 223
616 3300031901 Ga0307406_10032249 Ga0307406_100322492 223
617 3300031903 Ga0307407_10209102 Ga0307407_102091021 223
618 3300031911 Ga0307412_10607221 Ga0307412_106072211 223
619 3300032002 Ga0307416_100000419 Ga0307416_1000004197 223
620 3300032126 Ga0307415_100000096 Ga0307415_1000000967 223
621 3300035691 Ga0373931_0346662 Ga0373931_0346662_144_821 223
622 3300037068 Ga0373925_0420285 Ga0373925_0420285_147_824 223
623 3300014325 Ga0163163_10567307 Ga0163163_105673072 224
624 3300025898 Ga0207692_10001518 Ga0207692_100015187 224
625 3300025906 Ga0207699_10084096 Ga0207699_100840964 224
626 3300025929 Ga0207664_10202954 Ga0207664_102029542 224
627 3300025929 Ga0207664_10600112 Ga0207664_106001121 224
628 3300035083 Ga0373926_0001654 Ga0373926_0001654_2457_3155 224
629 3300035089 Ga0373944_0002847 Ga0373944_0002847_27_725 224
630 3300035111 Ga0373923_0019823 Ga0373923_0019823_1054_1752 224
631 3300035113 Ga0373936_0016786 Ga0373936_0016786_1774_2472 224
632 3300035116 Ga0373945_0001512 Ga0373945_0001512_3945_4643 224
633 3300035170 Ga0373943_0002611 Ga0373943_0002611_4616_5314 224
634 3300035170 Ga0373943_0099544 Ga0373943_0099544_773_1471 224
635 3300035171 Ga0373946_0003306 Ga0373946_0003306_2515_3213 224
636 3300035692 Ga0373935_0009215 Ga0373935_0009215_2458_3156 224
637 3300035692 Ga0373935_0195541 Ga0373935_0195541_120_821 224
638 3300035695 Ga0373927_0006733 Ga0373927_0006733_2430_3128 224
639 3300035725 Ga0373947_0004702 Ga0373947_0004702_4845_5543 224
640 3300035725 Ga0373947_0033283 Ga0373947_0033283_1466_2164 224
641 3300037068 Ga0373925_0001952 Ga0373925_0001952_32_730 224
642 3300037068 Ga0373925_0053143 Ga0373925_0053143_293_991 224
643 3300044694 Ga0466963_0545640 Ga0466963_0545640_70_750 224
644 3300045976 Ga0466967_0166658 Ga0466967_0166658_984_1664 224
645 3300046454 Ga0495592_0110157 Ga0495592_0110157_27_704 224
646 3300046461 Ga0495641_0011867 Ga0495641_0011867_981_1679 224
647 3300046462 Ga0495651_0286210 Ga0495651_0286210_164_862 224
648 3300046463 Ga0495653_0013966 Ga0495653_0013966_3410_4108 224
649 3300046473 Ga0495582_0058915 Ga0495582_0058915_262_960 224
650 3300046476 Ga0495662_0001342 Ga0495662_0001342_10623_11363 224
651 3300046476 Ga0495662_0007662 Ga0495662_0007662_3285_3983 224
652 3300046477 Ga0495664_0013226 Ga0495664_0013226_1644_2384 224
653 3300046477 Ga0495664_0028493 Ga0495664_0028493_2513_3211 224
654 3300046514 Ga0495618_0009672 Ga0495618_0009672_2427_3125 224
655 3300046517 Ga0495630_0055174 Ga0495630_0055174_823_1521 224
656 3300046526 Ga0495666_0001610 Ga0495666_0001610_10009_10749 224
657 3300046529 Ga0495652_0027983 Ga0495652_0027983_2338_3036 224
658 3300046529 Ga0495652_0281544 Ga0495652_0281544_395_1096 224
659 3300046531 Ga0495665_0105989 Ga0495665_0105989_480_1220 224
660 3300046533 Ga0495640_0058324 Ga0495640_0058324_730_1428 224
661 3300046543 Ga0495645_0033760 Ga0495645_0033760_2535_3275 224
662 3300046559 Ga0495667_0073661 Ga0495667_0073661_755_1453 224
663 3300046642 Ga0495634_0014050 Ga0495634_0014050_3501_4199 224
664 3300046663 Ga0495635_0030701 Ga0495635_0030701_1380_2078 224
665 3300046678 Ga0495599_0018642 Ga0495599_0018642_393_1133 224
666 3300046678 Ga0495599_0019985 Ga0495599_0019985_960_1658 224
667 3300046678 Ga0495599_0291326 Ga0495599_0291326_202_903 224
668 3300046683 Ga0495658_0267318 Ga0495658_0267318_305_1003 224
669 3300046690 Ga0495624_0115305 Ga0495624_0115305_164_862 224
670 3300047315 Ga0495581_0097316 Ga0495581_0097316_329_1027 224
671 3300047319 Ga0495674_0008874 Ga0495674_0008874_2458_3156 224
672 3300047319 Ga0495674_0030731 Ga0495674_0030731_1387_2088 224
673 3300047321 Ga0495676_0003192 Ga0495676_0003192_11692_12390 224
674 3300047322 Ga0495680_0021072 Ga0495680_0021072_3366_4064 224
675 3300047471 Ga0495684_0015296 Ga0495684_0015296_2754_3452 224
676 3300005435 Ga0070714_100309929 Ga0070714_1003099292 225
677 3300005564 Ga0070664_100444366 Ga0070664_1004443661 225
678 3300005577 Ga0068857_100783345 Ga0068857_1007833452 225
679 3300005614 Ga0068856_100241317 Ga0068856_1002413173 225
680 3300005618 Ga0068864_100163786 Ga0068864_1001637862 225
681 3300006175 Ga0070712_100114877 Ga0070712_1001148772 225
682 3300021388 Ga0213875_10002166 Ga0213875_100021669 225
683 3300025929 Ga0207664_10155908 Ga0207664_101559082 225
684 3300025945 Ga0207679_10344818 Ga0207679_103448182 225
685 3300026116 Ga0207674_10400882 Ga0207674_104008822 225
686 3300035410 Ga0373924_0028292 Ga0373924_0028292_1346_2053 225
687 3300037853 Ga0436364_0246675 Ga0436364_0246675_11859_12566 225
688 3300037853 Ga0436364_1157355 Ga0436364_1157355_405_1085 225
689 3300045976 Ga0466967_0020033 Ga0466967_0020033_3391_4092 225
690 3300046529 Ga0495652_0229837 Ga0495652_0229837_638_1339 225
691 3300048912 Ga0496109_0594084 Ga0496109_0594084_315_1016 225
692 3300050512 nmdc:mga0n895_990672_c1 nmdc:mga0n895_990672_c1_42_743 225
693 3300005435 Ga0070714_100010407 Ga0070714_1000104071 226
694 3300005467 Ga0070706_100043551 Ga0070706_1000435512 226
695 3300006028 Ga0070717_10428317 Ga0070717_104283172 226
696 3300025910 Ga0207684_10027555 Ga0207684_100275552 226
697 3300025929 Ga0207664_10000436 Ga0207664_100004367 226
698 iso_pu_bacteria 2772190715 2772641931 226
699 iso_pu_bacteria 2858888857 2858891578 226
700 iso_pu_bacteria 2858895516 2858895858 226
701 iso_pu_bacteria 2869048445 2869048996 226
702 iso_pu_bacteria 2880495981 2880500907 226
703 iso_pu_bacteria 2954691527 2954700901 226
704 iso_pu_bacteria 2954701450 2954706438 226
705 iso_pu_bacteria 8003870546 8003871759 226
706 3300005937 Ga0081455_10016117 Ga0081455_100161172 227
707 3300006844 Ga0075428_100209311 Ga0075428_1002093111 227
708 3300006847 Ga0075431_100002178 Ga0075431_1000021787 227
709 3300006880 Ga0075429_100027164 Ga0075429_1000271642 227
710 3300014325 Ga0163163_10238482 Ga0163163_102384823 227
711 3300024225 Ga0224572_1036396 Ga0224572_10363961 227
712 3300031901 Ga0307406_10567885 Ga0307406_105678851 227
713 3300035113 Ga0373936_0015433 Ga0373936_0015433_2003_2716 227
714 3300035724 Ga0373933_0008682 Ga0373933_0008682_3450_4163 227
715 3300037853 Ga0436364_0252998 Ga0436364_0252998_4351_5040 227
716 3300046463 Ga0495653_0020199 Ga0495653_0020199_2852_3565 227
717 3300046477 Ga0495664_0307408 Ga0495664_0307408_186_899 227
718 3300046511 Ga0495608_0071116 Ga0495608_0071116_365_1078 227
719 3300046529 Ga0495652_0214134 Ga0495652_0214134_629_1342 227
720 3300046533 Ga0495640_0005269 Ga0495640_0005269_4697_5455 227
721 3300046559 Ga0495667_0004037 Ga0495667_0004037_8290_9003 227
722 3300046663 Ga0495635_0005150 Ga0495635_0005150_7222_7935 227
723 3300046675 Ga0495657_0025619 Ga0495657_0025619_14_727 227
724 3300047322 Ga0495680_0031039 Ga0495680_0031039_241_954 227
725 3300047471 Ga0495684_0006732 Ga0495684_0006732_3654_4367 227
726 3300048915 Ga0496112_0541432 Ga0496112_0541432_209_901 227
727 3300050508 nmdc:mga09592_270_c1 nmdc:mga09592_270_c1_12706_13398 227
728 3300050509 nmdc:mga0qj67_49989_c1 nmdc:mga0qj67_49989_c1_2297_2989 227
729 3300005435 Ga0070714_100010112 Ga0070714_1000101122 228
730 3300005937 Ga0081455_10095551 Ga0081455_100955512 228
731 3300009177 Ga0105248_10217998 Ga0105248_102179982 228
732 3300024225 Ga0224572_1034206 Ga0224572_10342062 228
733 3300025929 Ga0207664_10018715 Ga0207664_100187155 228
734 3300025941 Ga0207711_10262403 Ga0207711_102624032 228
735 3300053090 Ga0500646_0000227 Ga0500646_0000227_453_1160 228
736 3300053092 Ga0500583_0089433 Ga0500583_0089433_380_1087 228
737 3300053146 Ga0500588_0002499 Ga0500588_0002499_1492_2199 228
738 3300009177 Ga0105248_10261832 Ga0105248_102618321 229
739 3300031548 Ga0307408_100051849 Ga0307408_1000518493 229
740 3300034819 Ga0373958_0025723 Ga0373958_0025723_354_1058 229
741 3300046680 Ga0495646_0096802 Ga0495646_0096802_181_921 229
742 3300001979 JGI24740J21852_10039823 JGI24740J21852_100398233 230
743 3300005327 Ga0070658_10153054 Ga0070658_101530543 230
744 3300005337 Ga0070682_100092035 Ga0070682_1000920352 230
745 3300005355 Ga0070671_100396090 Ga0070671_1003960901 230
746 3300005455 Ga0070663_100757039 Ga0070663_1007570391 230
747 3300005468 Ga0070707_100375784 Ga0070707_1003757841 230
748 3300005548 Ga0070665_100397741 Ga0070665_1003977412 230
749 3300005549 Ga0070704_100255624 Ga0070704_1002556242 230
750 3300005563 Ga0068855_100030921 Ga0068855_1000309212 230
751 3300005614 Ga0068856_100055601 Ga0068856_1000556015 230
752 3300005614 Ga0068856_100115890 Ga0068856_1001158903 230
753 3300005616 Ga0068852_100926064 Ga0068852_1009260641 230
754 3300006028 Ga0070717_10365386 Ga0070717_103653862 230
755 3300006358 Ga0068871_100083681 Ga0068871_1000836811 230
756 3300006871 Ga0075434_100073124 Ga0075434_1000731243 230
757 3300007076 Ga0075435_100029558 Ga0075435_1000295584 230
758 3300009092 Ga0105250_10079341 Ga0105250_100793411 230
759 3300009147 Ga0114129_10258388 Ga0114129_102583882 230
760 3300009174 Ga0105241_10003063 Ga0105241_100030632 230
761 3300009551 Ga0105238_10031089 Ga0105238_100310895 230
762 3300013296 Ga0157374_10003857 Ga0157374_1000385715 230
763 3300013308 Ga0157375_10526053 Ga0157375_105260531 230
764 3300025898 Ga0207692_10189020 Ga0207692_101890202 230
765 3300025904 Ga0207647_10136243 Ga0207647_101362432 230
766 3300025911 Ga0207654_10509293 Ga0207654_105092931 230
767 3300025913 Ga0207695_10001059 Ga0207695_100010598 230
768 3300025914 Ga0207671_10001032 Ga0207671_100010322 230
769 3300025916 Ga0207663_10059686 Ga0207663_100596863 230
770 3300025916 Ga0207663_10196179 Ga0207663_101961791 230
771 3300025928 Ga0207700_10040353 Ga0207700_100403532 230
772 3300025931 Ga0207644_10351524 Ga0207644_103515242 230
773 3300026078 Ga0207702_10089728 Ga0207702_100897282 230
774 3300026078 Ga0207702_10376769 Ga0207702_103767692 230
775 3300026142 Ga0207698_10842970 Ga0207698_108429701 230
776 3300028379 Ga0268266_10098723 Ga0268266_100987232 230
777 3300028666 Ga0265336_10021017 Ga0265336_100210174 230
778 3300028800 Ga0265338_10037230 Ga0265338_100372301 230
779 3300030522 Ga0307512_10056095 Ga0307512_100560955 230
780 3300034820 Ga0373959_0006639 Ga0373959_0006639_843_1568 230
781 3300034957 Ga0373938_0058961 Ga0373938_0058961_67_804 230
782 3300035086 Ga0373934_0042906 Ga0373934_0042906_193_918 230
783 3300035091 Ga0373951_0024489 Ga0373951_0024489_76_801 230
784 3300035111 Ga0373923_0031760 Ga0373923_0031760_518_1243 230
785 3300035112 Ga0373932_0005708 Ga0373932_0005708_2012_2737 230
786 3300035113 Ga0373936_0033364 Ga0373936_0033364_419_1144 230
787 3300035114 Ga0373939_0018023 Ga0373939_0018023_1133_1858 230
788 3300035117 Ga0373953_0008839 Ga0373953_0008839_825_1550 230
789 3300035118 Ga0373954_0053090 Ga0373954_0053090_241_966 230
790 3300035120 Ga0373957_0025601 Ga0373957_0025601_211_948 230
791 3300035121 Ga0373960_0028843 Ga0373960_0028843_38_763 230
792 3300035171 Ga0373946_0070733 Ga0373946_0070733_575_1309 230
793 3300035172 Ga0373955_0032010 Ga0373955_0032010_1783_2508 230
794 3300035242 Ga0373962_0004632 Ga0373962_0004632_2223_2948 230
795 3300035410 Ga0373924_0013098 Ga0373924_0013098_720_1445 230
796 3300035691 Ga0373931_0012440 Ga0373931_0012440_3200_3925 230
797 3300035692 Ga0373935_0026712 Ga0373935_0026712_1211_1936 230
798 3300035724 Ga0373933_0070825 Ga0373933_0070825_1153_1878 230
799 3300035725 Ga0373947_0039900 Ga0373947_0039900_1667_2383 230
800 3300036401 Ga0373937_0001745 Ga0373937_0001745_10046_10771 230
801 3300037068 Ga0373925_0429930 Ga0373925_0429930_120_845 230
802 3300044656 Ga0466969_0009562 Ga0466969_0009562_639_1331 230
803 3300044658 Ga0466972_0088869 Ga0466972_0088869_271_963 230
804 3300044683 Ga0466965_0006957 Ga0466965_0006957_2739_3431 230
805 3300044684 Ga0466966_0000541 Ga0466966_0000541_13075_13767 230
806 3300044693 Ga0466961_0008206 Ga0466961_0008206_825_1529 230
807 3300044693 Ga0466961_0014126 Ga0466961_0014126_4072_4764 230
808 3300044694 Ga0466963_0007395 Ga0466963_0007395_603_1295 230
809 3300044694 Ga0466963_0041713 Ga0466963_0041713_1607_2299 230
810 3300044719 Ga0466971_0001219 Ga0466971_0001219_5255_5947 230
811 3300044765 Ga0466970_0127995 Ga0466970_0127995_139_831 230
812 3300044842 Ga0466957_0001172 Ga0466957_0001172_7735_8427 230
813 3300044842 Ga0466957_0087447 Ga0466957_0087447_390_1106 230
814 3300045049 Ga0466959_0001339 Ga0466959_0001339_8715_9407 230
815 3300045836 Ga0466958_0000654 Ga0466958_0000654_6357_7049 230
816 3300045976 Ga0466967_0004594 Ga0466967_0004594_4627_5319 230
817 3300045976 Ga0466967_0021666 Ga0466967_0021666_2065_2757 230
818 3300046454 Ga0495592_0013132 Ga0495592_0013132_5469_6194 230
819 3300046455 Ga0495603_0078045 Ga0495603_0078045_622_1314 230
820 3300046459 Ga0495629_0007578 Ga0495629_0007578_5475_6191 230
821 3300046459 Ga0495629_0051194 Ga0495629_0051194_764_1489 230
822 3300046461 Ga0495641_0235861 Ga0495641_0235861_30_758 230
823 3300046462 Ga0495651_0000394 Ga0495651_0000394_18009_18716 230
824 3300046462 Ga0495651_0098856 Ga0495651_0098856_685_1410 230
825 3300046463 Ga0495653_0011805 Ga0495653_0011805_4614_5339 230
826 3300046472 Ga0495580_0238742 Ga0495580_0238742_243_968 230
827 3300046473 Ga0495582_0015813 Ga0495582_0015813_1183_1908 230
828 3300046476 Ga0495662_0035913 Ga0495662_0035913_995_1720 230
829 3300046477 Ga0495664_0056565 Ga0495664_0056565_1354_2079 230
830 3300046499 Ga0495594_0035556 Ga0495594_0035556_1750_2442 230
831 3300046514 Ga0495618_0132519 Ga0495618_0132519_282_1007 230
832 3300046514 Ga0495618_0180762 Ga0495618_0180762_600_1316 230
833 3300046516 Ga0495628_0042394 Ga0495628_0042394_2748_3440 230
834 3300046516 Ga0495628_0182720 Ga0495628_0182720_746_1483 230
835 3300046517 Ga0495630_0112760 Ga0495630_0112760_447_1172 230
836 3300046529 Ga0495652_0033009 Ga0495652_0033009_1717_2424 230
837 3300046529 Ga0495652_0141347 Ga0495652_0141347_947_1684 230
838 3300046531 Ga0495665_0044751 Ga0495665_0044751_1364_2089 230
839 3300046531 Ga0495665_0195758 Ga0495665_0195758_122_850 230
840 3300046533 Ga0495640_0028884 Ga0495640_0028884_3133_3825 230
841 3300046533 Ga0495640_0147570 Ga0495640_0147570_209_946 230
842 3300046536 Ga0495587_0056836 Ga0495587_0056836_917_1642 230
843 3300046543 Ga0495645_0095322 Ga0495645_0095322_43_768 230
844 3300046559 Ga0495667_0026619 Ga0495667_0026619_2640_3365 230
845 3300046642 Ga0495634_0053314 Ga0495634_0053314_614_1339 230
846 3300046663 Ga0495635_0059348 Ga0495635_0059348_1227_1943 230
847 3300046663 Ga0495635_0193183 Ga0495635_0193183_349_1074 230
848 3300046674 Ga0495588_0071613 Ga0495588_0071613_615_1331 230
849 3300046675 Ga0495657_0018029 Ga0495657_0018029_163_855 230
850 3300046675 Ga0495657_0090532 Ga0495657_0090532_426_1151 230
851 3300046678 Ga0495599_0071120 Ga0495599_0071120_682_1407 230
852 3300046679 Ga0495623_0111178 Ga0495623_0111178_684_1409 230
853 3300046680 Ga0495646_0036219 Ga0495646_0036219_962_1687 230
854 3300046681 Ga0495647_0086430 Ga0495647_0086430_280_1005 230
855 3300046683 Ga0495658_0069353 Ga0495658_0069353_516_1241 230
856 3300046689 Ga0495613_0019176 Ga0495613_0019176_187_879 230
857 3300046689 Ga0495613_0095021 Ga0495613_0095021_828_1553 230
858 3300046690 Ga0495624_0144131 Ga0495624_0144131_582_1319 230
859 3300046691 Ga0495670_0092124 Ga0495670_0092124_768_1460 230
860 3300046809 Ga0495600_0020940 Ga0495600_0020940_1866_2573 230
861 3300046809 Ga0495600_0095488 Ga0495600_0095488_870_1595 230
862 3300047315 Ga0495581_0038840 Ga0495581_0038840_1468_2160 230
863 3300047315 Ga0495581_0059789 Ga0495581_0059789_930_1655 230
864 3300047317 Ga0495604_0015233 Ga0495604_0015233_4635_5360 230
865 3300047317 Ga0495604_0029324 Ga0495604_0029324_2504_3196 230
866 3300047318 Ga0495636_0034047 Ga0495636_0034047_368_1060 230
867 3300047319 Ga0495674_0052132 Ga0495674_0052132_2095_2811 230
868 3300047319 Ga0495674_0166509 Ga0495674_0166509_275_1000 230
869 3300047321 Ga0495676_0088227 Ga0495676_0088227_1569_2306 230
870 3300047322 Ga0495680_0034422 Ga0495680_0034422_792_1508 230
871 3300047322 Ga0495680_0071615 Ga0495680_0071615_995_1717 230
872 3300047444 Ga0495675_0068642 Ga0495675_0068642_567_1292 230
873 3300047447 Ga0495685_035437 Ga0495685_035437_465_1157 230
874 3300047471 Ga0495684_0027313 Ga0495684_0027313_3447_4163 230
875 3300047471 Ga0495684_0030709 Ga0495684_0030709_1226_1951 230
876 3300047673 Ga0495593_0023596 Ga0495593_0023596_1987_2712 230
877 3300047673 Ga0495593_0058014 Ga0495593_0058014_1292_1984 230
878 3300048088 Ga0495602_0099160 Ga0495602_0099160_1354_2079 230
879 3300048903 Ga0496100_0063048 Ga0496100_0063048_340_1065 230
880 3300048905 Ga0496102_0085413 Ga0496102_0085413_378_1106 230
881 3300048905 Ga0496102_0156224 Ga0496102_0156224_911_1636 230
882 3300048907 Ga0496104_0034615 Ga0496104_0034615_3901_4629 230
883 3300048907 Ga0496104_0209971 Ga0496104_0209971_625_1350 230
884 3300048908 Ga0496105_0047702 Ga0496105_0047702_534_1259 230
885 3300048908 Ga0496105_0056642 Ga0496105_0056642_565_1293 230
886 3300048909 Ga0496106_0304006 Ga0496106_0304006_27_752 230
887 3300048910 Ga0496107_0159698 Ga0496107_0159698_721_1446 230
888 3300048911 Ga0496108_0020456 Ga0496108_0020456_2411_3139 230
889 3300048911 Ga0496108_0119745 Ga0496108_0119745_993_1718 230
890 3300048916 Ga0496113_0215179 Ga0496113_0215179_473_1201 230
891 3300048917 Ga0496114_0155050 Ga0496114_0155050_178_903 230
892 3300048918 Ga0496115_0021261 Ga0496115_0021261_819_1547 230
893 3300048918 Ga0496115_0070080 Ga0496115_0070080_1131_1856 230
894 3300050513 nmdc:mga0rr50_28392_c1 nmdc:mga0rr50_28392_c1_2489_3214 230
895 3300050514 nmdc:mga08x19_35523_c1 nmdc:mga08x19_35523_c1_1905_2630 230
896 3300050515 nmdc:mga0a205_69593_c1 nmdc:mga0a205_69593_c1_94_819 230
897 3300053077 Ga0495601_0042702 Ga0495601_0042702_1226_1951 230
898 3300053078 Ga0495612_0054902 Ga0495612_0054902_859_1596 230
899 3300053084 Ga0495595_0062076 Ga0495595_0062076_973_1710 230
900 3300053085 Ga0495619_0072445 Ga0495619_0072445_212_949 230
901 3300061719 Ga0466962_0000491 Ga0466962_0000491_11192_11884 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

156

260

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9236 25 92
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9043 19 94
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.8763 3 95
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.8605 19 94
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.8483 3 93
ID Description Score Start End Superfamily
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9002 18 92 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8923 3 91 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8852 5 95 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8763 3 95 3.30.1360.20
af_Q54XF6_87_182_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8584 12 92 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A841BNV3-F1-model_v4 Glyoxalase-like domain-containing protein 0.9821 114 229
AF-A0A6B2UD65-F1-model_v4 deleted 0.9764 1 230
AF-A0A841BNV3-F1-model_v4 Glyoxalase-like domain-containing protein 0.9738 114 229
AF-A0A7W7SJU9-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9729 1 230 GO:0006729
GO:0008124
AF-A0A4V2FE73-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase 0.9709 1 230

Feature Viewer

pLDDT pTM Quality
92.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map