F485146

General Info

Members Datasets Scaffolds Average Seq Length
900 307 900 157

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10316005|Ga0207683_103160053
Length 193
Sequence VDSFLRTLGHRHRSDRYWPGFVRVFKIIGLPEGDTILNAQRREVLKRGGGMSLLALLAAAGWLKPEDALAADWNKAAFETKSVEDTVKALNGSAPTASKDIVFFSTPDIAENVAVVPIGITSQVPNTQSIAILVEKNPNMLAAVFDVPAGTDPSLSTRIKMGQSSNVYALVKADGKYFVASKEIKVTLGGCGG

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
250 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 4.11
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1031739 3300001976 Bacteria 698
2 JGI24746J21847_1017895 3300001977 Bacteria 1005
3 JGI24743J22301_10058372 3300001991 Bacteria 793
4 JGI24749J21850_1007123 3300002076 Bacteria 1556
5 JGI24035J26624_1017633 3300002126 Bacteria 741
6 Ga0065712_10106723 3300005290 Bacteria 1903
7 Ga0065715_10467076 3300005293 Bacteria 796
8 Ga0065715_10604844 3300005293 Bacteria 696
9 Ga0070658_10040615 3300005327 Bacteria 3754
10 Ga0070658_10049587 3300005327 Bacteria 3401
11 Ga0070658_10912505 3300005327 Bacteria 764
12 Ga0070676_10001017 3300005328 Bacteria 13919
13 Ga0070676_10027056 3300005328 Bacteria 3250
14 Ga0070676_10101032 3300005328 Bacteria 1781
15 Ga0070676_10376505 3300005328 Bacteria 982
16 Ga0070683_100053239 3300005329 Bacteria 3750
17 Ga0070683_100213175 3300005329 Bacteria 1835
18 Ga0070683_100726608 3300005329 Bacteria 951
19 Ga0070683_100948042 3300005329 Bacteria 826
20 Ga0070690_100000521 3300005330 Bacteria 19293
21 Ga0070690_100012188 3300005330 Bacteria 5054
22 Ga0070690_100029269 3300005330 Bacteria 3415
23 Ga0070670_100025429 3300005331 Bacteria 5095
24 Ga0070670_100039751 3300005331 Bacteria 4045
25 Ga0070670_100040658 3300005331 Bacteria 3996
26 Ga0070670_100058598 3300005331 Bacteria 3306
27 Ga0070670_100105401 3300005331 Bacteria 2429
28 Ga0070677_10000411 3300005333 Bacteria 14902
29 Ga0070677_10025678 3300005333 Bacteria 2201
30 Ga0068869_100003165 3300005334 Bacteria 10042
31 Ga0068869_100035164 3300005334 Bacteria 3549
32 Ga0068869_100091814 3300005334 Bacteria 2284
33 Ga0068869_100107766 3300005334 Bacteria 2116
34 Ga0070666_10014579 3300005335 Bacteria 5006
35 Ga0070666_10027874 3300005335 Bacteria 3703
36 Ga0070682_100090603 3300005337 Bacteria 2000
37 Ga0068868_100071048 3300005338 Bacteria 2776
38 Ga0068868_100078460 3300005338 Bacteria 2644
39 Ga0068868_100143733 3300005338 Bacteria 1960
40 Ga0068868_100174457 3300005338 Bacteria 1781
41 Ga0070660_100005982 3300005339 Bacteria 8410
42 Ga0070660_100018256 3300005339 Bacteria 5123
43 Ga0070660_100019235 3300005339 Bacteria 5000
44 Ga0070660_100093407 3300005339 Bacteria 2375
45 Ga0070660_100335830 3300005339 Bacteria 1243
46 Ga0070660_100414532 3300005339 Bacteria 1115
47 Ga0070689_100001865 3300005340 Bacteria 13584
48 Ga0070689_100022724 3300005340 Bacteria 4686
49 Ga0070689_100051703 3300005340 Bacteria 3176
50 Ga0070689_101487877 3300005340 Bacteria 613
51 Ga0070687_100021167 3300005343 Bacteria 3052
52 Ga0070687_100055680 3300005343 Bacteria 2066
53 Ga0070661_100000486 3300005344 Bacteria 30405
54 Ga0070661_100014142 3300005344 Bacteria 5622
55 Ga0070661_100019203 3300005344 Bacteria 4868
56 Ga0070661_100106760 3300005344 Bacteria 2088
57 Ga0070661_100140078 3300005344 Bacteria 1822
58 Ga0070661_100587866 3300005344 Bacteria 899
59 Ga0070661_100819108 3300005344 Bacteria 765
60 Ga0070661_101344791 3300005344 Bacteria 600
61 Ga0070692_10178983 3300005345 Bacteria 1228
62 Ga0070668_100001274 3300005347 Bacteria 18003
63 Ga0070668_100014576 3300005347 Bacteria 5875
64 Ga0070668_100019216 3300005347 Bacteria 5140
65 Ga0070668_100073075 3300005347 Bacteria 2673
66 Ga0070668_100175533 3300005347 Bacteria 1747
67 Ga0070668_100337286 3300005347 Bacteria 1273
68 Ga0070669_100000411 3300005353 Bacteria 32862
69 Ga0070669_100220920 3300005353 Bacteria 1498
70 Ga0070669_100490406 3300005353 Bacteria 1018
71 Ga0070675_100018529 3300005354 Bacteria 5542
72 Ga0070675_100023462 3300005354 Bacteria 4934
73 Ga0070675_100525094 3300005354 Bacteria 1068
74 Ga0070675_100608552 3300005354 Bacteria 991
75 Ga0070675_100664711 3300005354 Bacteria 947
76 Ga0070671_100000564 3300005355 Bacteria 26255
77 Ga0070671_100011838 3300005355 Bacteria 7018
78 Ga0070671_100012159 3300005355 Bacteria 6927
79 Ga0070671_100045506 3300005355 Bacteria 3648
80 Ga0070671_100111358 3300005355 Bacteria 2299
81 Ga0070671_100295150 3300005355 Bacteria 1380
82 Ga0070671_100667769 3300005355 Bacteria 900
83 Ga0070671_101016832 3300005355 Bacteria 726
84 Ga0070674_100004476 3300005356 Bacteria 7975
85 Ga0070674_100165018 3300005356 Bacteria 1684
86 Ga0070674_100320869 3300005356 Bacteria 1242
87 Ga0070674_101608452 3300005356 Bacteria 586
88 Ga0070673_100001499 3300005364 Bacteria 13706
89 Ga0070673_100016936 3300005364 Bacteria 5168
90 Ga0070673_100030647 3300005364 Bacteria 4029
91 Ga0070673_100056728 3300005364 Bacteria 3091
92 Ga0070673_100113023 3300005364 Bacteria 2255
93 Ga0070673_100130389 3300005364 Bacteria 2108
94 Ga0070688_100001247 3300005365 Bacteria 12689
95 Ga0070688_100042516 3300005365 Bacteria 2796
96 Ga0070688_100082815 3300005365 Bacteria 2080
97 Ga0070688_100335349 3300005365 Bacteria 1103
98 Ga0070688_100694049 3300005365 Bacteria 788
99 Ga0070659_100025962 3300005366 Bacteria 4506
100 Ga0070659_100143240 3300005366 Bacteria 1946
101 Ga0070659_100169921 3300005366 Bacteria 1785
102 Ga0070659_100170222 3300005366 Bacteria 1784
103 Ga0070659_100245103 3300005366 Bacteria 1484
104 Ga0070659_100257041 3300005366 Bacteria 1449
105 Ga0070659_100600200 3300005366 Bacteria 946
106 Ga0070667_100002084 3300005367 Bacteria 17667
107 Ga0070667_100002948 3300005367 Bacteria 14624
108 Ga0070667_100099238 3300005367 Bacteria 2514
109 Ga0070667_100124434 3300005367 Bacteria 2246
110 Ga0070667_100139752 3300005367 Bacteria 2120
111 Ga0070667_100280319 3300005367 Bacteria 1496
112 Ga0070667_101439158 3300005367 Bacteria 647
113 Ga0070703_10063910 3300005406 Bacteria 1211
114 Ga0070709_10525859 3300005434 Bacteria 902
115 Ga0070709_10608395 3300005434 Bacteria 842
116 Ga0070714_100013470 3300005435 Bacteria 6554
117 Ga0070713_100005194 3300005436 Bacteria 8866
118 Ga0070713_101116744 3300005436 Bacteria 762
119 Ga0070710_10005942 3300005437 Bacteria 5828
120 Ga0070701_10011424 3300005438 Bacteria 3969
121 Ga0070701_10127725 3300005438 Bacteria 1441
122 Ga0070701_10835550 3300005438 Bacteria 631
123 Ga0070711_100004130 3300005439 Bacteria 8535
124 Ga0070705_100178956 3300005440 Unclassified 1435
125 Ga0070700_100025803 3300005441 Bacteria 3464
126 Ga0070694_100489890 3300005444 Bacteria 977
127 Ga0070694_101440884 3300005444 Bacteria 582
128 Ga0070663_100004490 3300005455 Bacteria 8216
129 Ga0070663_100078580 3300005455 Bacteria 2419
130 Ga0070663_100226055 3300005455 Bacteria 1471
131 Ga0070663_100492323 3300005455 Bacteria 1017
132 Ga0070663_100620130 3300005455 Unclassified 912
133 Ga0070678_100000428 3300005456 Bacteria 19876
134 Ga0070678_100000948 3300005456 Bacteria 14931
135 Ga0070678_100009922 3300005456 Bacteria 5789
136 Ga0070678_100081000 3300005456 Bacteria 2460
137 Ga0070662_100001187 3300005457 Bacteria 15980
138 Ga0070662_100041275 3300005457 Bacteria 3291
139 Ga0070662_100202720 3300005457 Bacteria 1575
140 Ga0070662_100304460 3300005457 Bacteria 1296
141 Ga0070662_100919305 3300005457 Bacteria 747
142 Ga0070681_10003192 3300005458 Bacteria 15263
143 Ga0070681_10030700 3300005458 Bacteria 5392
144 Ga0070681_10188909 3300005458 Bacteria 1980
145 Ga0070681_10194030 3300005458 Bacteria 1950
146 Ga0070681_10504570 3300005458 Bacteria 1123
147 Ga0070681_10811526 3300005458 Bacteria 853
148 Ga0068867_100001129 3300005459 Bacteria 18260
149 Ga0068867_100065181 3300005459 Bacteria 2710
150 Ga0068867_100123999 3300005459 Bacteria 2000
151 Ga0068867_100232665 3300005459 Bacteria 1490
152 Ga0068867_100388882 3300005459 Bacteria 1173
153 Ga0068867_101328521 3300005459 Bacteria 664
154 Ga0070685_10002459 3300005466 Bacteria 9508
155 Ga0070685_10010782 3300005466 Bacteria 4760
156 Ga0070706_100094756 3300005467 Bacteria 2770
157 Ga0070706_100214599 3300005467 Bacteria 1796
158 Ga0070707_100845133 3300005468 Bacteria 879
159 Ga0070707_101034481 3300005468 Bacteria 787
160 Ga0070698_100035950 3300005471 Bacteria 5120
161 Ga0070699_100406334 3300005518 Bacteria 1232
162 Ga0070679_100014348 3300005530 Bacteria 7609
163 Ga0070679_100070126 3300005530 Bacteria 3497
164 Ga0070679_100102796 3300005530 Bacteria 2844
165 Ga0070679_100159282 3300005530 Bacteria 2232
166 Ga0070679_100332826 3300005530 Bacteria 1467
167 Ga0070679_100405991 3300005530 Bacteria 1308
168 Ga0070679_100509829 3300005530 Bacteria 1147
169 Ga0070684_100021273 3300005535 Bacteria 5394
170 Ga0070684_100114905 3300005535 Bacteria 2416
171 Ga0070684_100129561 3300005535 Bacteria 2275
172 Ga0070684_100368932 3300005535 Bacteria 1322
173 Ga0070684_100818708 3300005535 Unclassified 871
174 Ga0070697_100016402 3300005536 Bacteria 5824
175 Ga0070697_100431872 3300005536 Bacteria 1145
176 Ga0068853_100003043 3300005539 Bacteria 12805
177 Ga0068853_100030015 3300005539 Bacteria 4589
178 Ga0068853_100168009 3300005539 Bacteria 1983
179 Ga0068853_100224909 3300005539 Bacteria 1715
180 Ga0068853_100305460 3300005539 Bacteria 1472
181 Ga0068853_100365146 3300005539 Bacteria 1346
182 Ga0068853_100493124 3300005539 Bacteria 1156
183 Ga0068853_100616914 3300005539 Bacteria 1031
184 Ga0068853_100877381 3300005539 Bacteria 861
185 Ga0068853_100909222 3300005539 Bacteria 845
186 Ga0070672_100005917 3300005543 Bacteria 8158
187 Ga0070672_100016247 3300005543 Bacteria 5324
188 Ga0070672_100034147 3300005543 Bacteria 3859
189 Ga0070672_100240311 3300005543 Bacteria 1523
190 Ga0070686_100049768 3300005544 Bacteria 2660
191 Ga0070686_100178861 3300005544 Bacteria 1506
192 Ga0070695_101052251 3300005545 Unclassified 664
193 Ga0070696_100487323 3300005546 Bacteria 979
194 Ga0070696_101635060 3300005546 Unclassified 554
195 Ga0070693_100006888 3300005547 Bacteria 5525
196 Ga0070693_100025867 3300005547 Bacteria 3161
197 Ga0070693_100034500 3300005547 Bacteria 2800
198 Ga0070693_100270363 3300005547 Bacteria 1134
199 Ga0070693_100350170 3300005547 Bacteria 1011
200 Ga0070665_100005926 3300005548 Bacteria 12520
201 Ga0070665_100012339 3300005548 Bacteria 8611
202 Ga0070665_100036448 3300005548 Bacteria 4947
203 Ga0070665_100168948 3300005548 Bacteria 2189
204 Ga0070665_100754768 3300005548 Bacteria 986
205 Ga0070704_100005301 3300005549 Bacteria 7513
206 Ga0070704_100536136 3300005549 Bacteria 1021
207 Ga0068855_100001032 3300005563 Bacteria 34674
208 Ga0068855_100016905 3300005563 Bacteria 8773
209 Ga0068855_100030675 3300005563 Bacteria 6427
210 Ga0068855_100034796 3300005563 Bacteria 6004
211 Ga0068855_100169283 3300005563 Bacteria 2475
212 Ga0068855_100225886 3300005563 Bacteria 2098
213 Ga0068855_100769255 3300005563 Bacteria 1025
214 Ga0068855_101704408 3300005563 Bacteria 642
215 Ga0070664_100002383 3300005564 Bacteria 15096
216 Ga0070664_100014257 3300005564 Bacteria 6483
217 Ga0070664_100014914 3300005564 Bacteria 6340
218 Ga0070664_100031582 3300005564 Bacteria 4426
219 Ga0070664_100072810 3300005564 Bacteria 2947
220 Ga0070664_100113220 3300005564 Bacteria 2370
221 Ga0070664_100491782 3300005564 Bacteria 1130
222 Ga0070664_100811740 3300005564 Bacteria 875
223 Ga0070664_101233277 3300005564 Bacteria 706
224 Ga0070664_101488284 3300005564 Bacteria 640
225 Ga0068857_100002349 3300005577 Bacteria 15406
226 Ga0068857_100054191 3300005577 Bacteria 3558
227 Ga0068857_100231895 3300005577 Bacteria 1688
228 Ga0068854_100004207 3300005578 Bacteria 9063
229 Ga0068854_100012441 3300005578 Bacteria 5572
230 Ga0068854_100155845 3300005578 Bacteria 1765
231 Ga0068854_100231632 3300005578 Bacteria 1466
232 Ga0068856_100023479 3300005614 Bacteria 5996
233 Ga0068856_100063611 3300005614 Bacteria 3645
234 Ga0068856_100167707 3300005614 Bacteria 2207
235 Ga0068856_100237629 3300005614 Bacteria 1837
236 Ga0068856_100437096 3300005614 Bacteria 1329
237 Ga0068856_100734809 3300005614 Bacteria 1007
238 Ga0070702_100005551 3300005615 Bacteria 5891
239 Ga0070702_100128666 3300005615 Bacteria 1596
240 Ga0068852_100001314 3300005616 Bacteria 16622
241 Ga0068852_100002732 3300005616 Bacteria 12206
242 Ga0068852_100022936 3300005616 Bacteria 5015
243 Ga0068852_100072754 3300005616 Bacteria 3022
244 Ga0068852_100350950 3300005616 Bacteria 1440
245 Ga0068852_100766542 3300005616 Bacteria 977
246 Ga0068852_100775447 3300005616 Bacteria 972
247 Ga0068859_100000594 3300005617 Bacteria 36146
248 Ga0068859_100003144 3300005617 Bacteria 16788
249 Ga0068859_100068504 3300005617 Bacteria 3583
250 Ga0068859_100317459 3300005617 Bacteria 1652
251 Ga0068864_100015761 3300005618 Bacteria 6287
252 Ga0068864_100044410 3300005618 Bacteria 3809
253 Ga0068864_100098010 3300005618 Bacteria 2596
254 Ga0068864_100136959 3300005618 Bacteria 2205
255 Ga0068864_100324793 3300005618 Bacteria 1446
256 Ga0068864_100334895 3300005618 Bacteria 1425
257 Ga0068864_100448504 3300005618 Bacteria 1233
258 Ga0068864_100907797 3300005618 Bacteria 870
259 Ga0068866_10002216 3300005718 Bacteria 8066
260 Ga0068866_10047145 3300005718 Bacteria 2171
261 Ga0068866_10093823 3300005718 Bacteria 1640
262 Ga0068866_10131084 3300005718 Bacteria 1426
263 Ga0068861_100018747 3300005719 Bacteria 4933
264 Ga0068861_100135806 3300005719 Bacteria 2001
265 Ga0068861_100282136 3300005719 Bacteria 1431
266 Ga0068861_101277487 3300005719 Bacteria 713
267 Ga0068851_10006565 3300005834 Bacteria 5318
268 Ga0068851_10034062 3300005834 Bacteria 2541
269 Ga0068851_10047130 3300005834 Bacteria 2182
270 Ga0068851_10054503 3300005834 Bacteria 2037
271 Ga0068851_10068990 3300005834 Bacteria 1825
272 Ga0068851_10202659 3300005834 Bacteria 1108
273 Ga0068851_10275209 3300005834 Bacteria 961
274 Ga0068870_10002817 3300005840 Bacteria 7316
275 Ga0068870_10015713 3300005840 Bacteria 3599
276 Ga0068870_10594559 3300005840 Bacteria 751
277 Ga0068863_100004302 3300005841 Bacteria 14024
278 Ga0068863_100017463 3300005841 Bacteria 6879
279 Ga0068863_100020650 3300005841 Bacteria 6292
280 Ga0068863_100216115 3300005841 Unclassified 1846
281 Ga0068863_100779628 3300005841 Bacteria 953
282 Ga0068863_101460989 3300005841 Bacteria 692
283 Ga0068858_100002565 3300005842 Bacteria 18308
284 Ga0068858_100003040 3300005842 Bacteria 16816
285 Ga0068858_100019871 3300005842 Bacteria 6280
286 Ga0068858_100085273 3300005842 Bacteria 2938
287 Ga0068858_100321206 3300005842 Bacteria 1480
288 Ga0068858_101166469 3300005842 Bacteria 757
289 Ga0068860_100002537 3300005843 Bacteria 19105
290 Ga0068860_100065222 3300005843 Bacteria 3458
291 Ga0068860_100079082 3300005843 Bacteria 3127
292 Ga0068860_100103291 3300005843 Bacteria 2720
293 Ga0068860_100125523 3300005843 Bacteria 2459
294 Ga0068862_100068229 3300005844 Bacteria 3067
295 Ga0068862_100135274 3300005844 Bacteria 2184
296 Ga0068862_100454889 3300005844 Bacteria 1207
297 Ga0068862_100715505 3300005844 Bacteria 971
298 Ga0068862_100739427 3300005844 Bacteria 956
299 Ga0081539_10203957 3300005985 Bacteria 911
300 Ga0070717_10425171 3300006028 Bacteria 1195
301 Ga0075364_10019352 3300006051 Bacteria 4273
302 Ga0070715_10689223 3300006163 Bacteria 609
303 Ga0070716_100013908 3300006173 Bacteria 4112
304 Ga0070716_100038854 3300006173 Bacteria 2637
305 Ga0070716_100252163 3300006173 Bacteria 1203
306 Ga0070712_100002152 3300006175 Bacteria 12120
307 Ga0075369_10003906 3300006186 Bacteria 5466
308 Ga0075366_10022788 3300006195 Bacteria 3646
309 Ga0097621_100001502 3300006237 Bacteria 15972
310 Ga0097621_100005226 3300006237 Bacteria 9130
311 Ga0097621_101562817 3300006237 Bacteria 627
312 Ga0068871_100009028 3300006358 Bacteria 7201
313 Ga0068871_100687117 3300006358 Bacteria 937
314 Ga0075431_100784109 3300006847 Bacteria 927
315 Ga0075433_10033447 3300006852 Bacteria 4408
316 Ga0075434_100015476 3300006871 Bacteria 7316
317 Ga0068865_100002771 3300006881 Bacteria 10413
318 Ga0068865_100341340 3300006881 Bacteria 1210
319 Ga0075436_100004627 3300006914 Bacteria 9429
320 Ga0075436_100018047 3300006914 Bacteria 4832
321 Ga0075436_100042207 3300006914 Bacteria 3145
322 Ga0075436_100080231 3300006914 Bacteria 2261
323 Ga0075436_100231125 3300006914 Bacteria 1314
324 Ga0097620_100000594 3300006931 Bacteria 36146
325 Ga0097620_100003144 3300006931 Bacteria 16788
326 Ga0097620_100068504 3300006931 Bacteria 3583
327 Ga0097620_100317431 3300006931 Bacteria 1652
328 Ga0075435_100009247 3300007076 Bacteria 7119
329 Ga0075435_100354881 3300007076 Bacteria 1257
330 Ga0075435_100693867 3300007076 Bacteria 885
331 Ga0099794_10000530 3300007265 Bacteria 12764
332 Ga0099794_10014216 3300007265 Bacteria 3482
333 Ga0099795_10079738 3300007788 Bacteria 1250
334 Ga0105250_10366570 3300009092 Bacteria 633
335 Ga0105240_10002122 3300009093 Bacteria 32405
336 Ga0105240_10002895 3300009093 Bacteria 27079
337 Ga0105240_10071509 3300009093 Bacteria 4290
338 Ga0111539_10099260 3300009094 Bacteria 3420
339 Ga0111539_10265048 3300009094 Bacteria 2000
340 Ga0105245_10226190 3300009098 Bacteria 1807
341 Ga0105245_10248045 3300009098 Bacteria 1729
342 Ga0105245_10501206 3300009098 Bacteria 1230
343 Ga0105247_10047360 3300009101 Bacteria 2639
344 Ga0114129_10398433 3300009147 Bacteria 1814
345 Ga0114129_10799654 3300009147 Bacteria 1203
346 Ga0105243_10147437 3300009148 Bacteria 2015
347 Ga0105243_10235689 3300009148 Bacteria 1626
348 Ga0105241_10010701 3300009174 Bacteria 6731
349 Ga0105241_10010941 3300009174 Bacteria 6654
350 Ga0105241_10045851 3300009174 Bacteria 3318
351 Ga0105241_10389013 3300009174 Bacteria 1220
352 Ga0105242_10338886 3300009176 Bacteria 1385
353 Ga0105242_12542870 3300009176 Unclassified 560
354 Ga0105248_10002843 3300009177 Bacteria 19207
355 Ga0105248_10192957 3300009177 Bacteria 2295
356 Ga0105248_10400727 3300009177 Bacteria 1545
357 Ga0105248_10515319 3300009177 Bacteria 1348
358 Ga0105248_10870146 3300009177 Bacteria 1017
359 Ga0105248_11718318 3300009177 Bacteria 711
360 Ga0105248_12027421 3300009177 Bacteria 654
361 Ga0105237_10067547 3300009545 Bacteria 3569
362 Ga0105237_10516092 3300009545 Bacteria 1201
363 Ga0105238_10009710 3300009551 Bacteria 9634
364 Ga0105238_10020415 3300009551 Bacteria 6744
365 Ga0105238_10441453 3300009551 Bacteria 1298
366 Ga0105249_10112993 3300009553 Bacteria 2569
367 Ga0105249_10182578 3300009553 Bacteria 2042
368 Ga0105249_11291098 3300009553 Bacteria 801
369 Ga0105249_11401398 3300009553 Bacteria 771
370 Ga0099796_10048396 3300010159 Bacteria 1466
371 Ga0105239_10158693 3300010375 Bacteria 2527
372 Ga0105239_10362876 3300010375 Bacteria 1636
373 Ga0105246_10043845 3300011119 Bacteria 3037
374 Ga0157373_10005850 3300013100 Bacteria 9202
375 Ga0157373_10006334 3300013100 Bacteria 8843
376 Ga0157373_10171260 3300013100 Bacteria 1528
377 Ga0157371_10005607 3300013102 Bacteria 10554
378 Ga0157371_10247192 3300013102 Bacteria 1284
379 Ga0157371_10324076 3300013102 Bacteria 1118
380 Ga0157371_10514690 3300013102 Bacteria 885
381 Ga0157371_10557897 3300013102 Bacteria 849
382 Ga0157371_10576733 3300013102 Bacteria 835
383 Ga0157370_10007974 3300013104 Bacteria 11474
384 Ga0157370_10010466 3300013104 Bacteria 9769
385 Ga0157370_10071975 3300013104 Bacteria 3262
386 Ga0157370_10148013 3300013104 Bacteria 2186
387 Ga0157370_10206317 3300013104 Bacteria 1822
388 Ga0157369_10001474 3300013105 Bacteria 28847
389 Ga0157369_10015712 3300013105 Bacteria 8530
390 Ga0157369_10037727 3300013105 Bacteria 5289
391 Ga0157369_10191838 3300013105 Bacteria 2147
392 Ga0157369_10319921 3300013105 Bacteria 1613
393 Ga0157369_10478723 3300013105 Bacteria 1288
394 Ga0157369_11762387 3300013105 Bacteria 629
395 Ga0157374_10000698 3300013296 Bacteria 29556
396 Ga0157374_10002044 3300013296 Bacteria 16961
397 Ga0157374_10014763 3300013296 Bacteria 6839
398 Ga0157374_10036838 3300013296 Bacteria 4484
399 Ga0157374_10070589 3300013296 Bacteria 3292
400 Ga0157374_10810701 3300013296 Bacteria 952
401 Ga0157378_10332016 3300013297 Bacteria 1480
402 Ga0157378_10915375 3300013297 Bacteria 908
403 Ga0157378_11277041 3300013297 Bacteria 775
404 Ga0163162_10003371 3300013306 Bacteria 15289
405 Ga0163162_10122792 3300013306 Bacteria 2702
406 Ga0163162_10428948 3300013306 Bacteria 1454
407 Ga0157372_10002523 3300013307 Bacteria 19853
408 Ga0157372_10016533 3300013307 Bacteria 7917
409 Ga0157372_10029210 3300013307 Bacteria 6018
410 Ga0157372_10105643 3300013307 Bacteria 3221
411 Ga0157372_10257382 3300013307 Bacteria 2027
412 Ga0157372_10504468 3300013307 Bacteria 1411
413 Ga0157372_10622301 3300013307 Bacteria 1258
414 Ga0157372_12305295 3300013307 Bacteria 618
415 Ga0157375_10011577 3300013308 Bacteria 7793
416 Ga0157375_10021611 3300013308 Bacteria 5905
417 Ga0157375_10284040 3300013308 Bacteria 1818
418 Ga0157375_10403017 3300013308 Bacteria 1534
419 Ga0157375_10417046 3300013308 Bacteria 1509
420 Ga0157375_10514904 3300013308 Bacteria 1360
421 Ga0157375_10832615 3300013308 Bacteria 1070
422 Ga0157375_11081159 3300013308 Bacteria 938
423 Ga0163163_10000852 3300014325 Bacteria 25938
424 Ga0163163_10015485 3300014325 Bacteria 7050
425 Ga0163163_10091741 3300014325 Bacteria 3052
426 Ga0163163_11794536 3300014325 Unclassified 674
427 Ga0157380_10127055 3300014326 Bacteria 2169
428 Ga0157380_10152611 3300014326 Bacteria 1999
429 Ga0157380_12293490 3300014326 Bacteria 604
430 Ga0182008_10047309 3300014497 Bacteria 2137
431 Ga0157377_10002528 3300014745 Bacteria 8107
432 Ga0157379_10001809 3300014968 Bacteria 17653
433 Ga0157379_10004302 3300014968 Bacteria 12172
434 Ga0157379_10036886 3300014968 Bacteria 4359
435 Ga0157379_10178439 3300014968 Bacteria 1919
436 Ga0157379_10811404 3300014968 Bacteria 884
437 Ga0157376_10003873 3300014969 Bacteria 10342
438 Ga0157376_10167952 3300014969 Bacteria 1995
439 Ga0157376_10232022 3300014969 Bacteria 1715
440 Ga0163161_10043884 3300017792 Bacteria 3220
441 Ga0163161_10046765 3300017792 Bacteria 3123
442 Ga0163161_10072779 3300017792 Bacteria 2517
443 Ga0163161_10103138 3300017792 Bacteria 2125
444 Ga0206351_10432916 3300020077 Bacteria 866
445 Ga0206354_11647103 3300020081 Bacteria 1168
446 Ga0224712_10105938 3300022467 Bacteria 1200
447 Ga0207666_1002584 3300025271 Bacteria 2185
448 Ga0207697_10001482 3300025315 Bacteria 12807
449 Ga0207697_10009761 3300025315 Bacteria 4131
450 Ga0207697_10407251 3300025315 Unclassified 604
451 Ga0207656_10020022 3300025321 Bacteria 2654
452 Ga0207656_10060605 3300025321 Bacteria 1659
453 Ga0207656_10176159 3300025321 Bacteria 1024
454 Ga0207656_10212947 3300025321 Bacteria 937
455 Ga0207656_10243082 3300025321 Bacteria 880
456 Ga0207656_10277215 3300025321 Bacteria 826
457 Ga0207682_10000518 3300025893 Bacteria 17728
458 Ga0207682_10002927 3300025893 Bacteria 7530
459 Ga0207692_10072600 3300025898 Bacteria 1818
460 Ga0207642_10004680 3300025899 Bacteria 4421
461 Ga0207642_10069775 3300025899 Bacteria 1668
462 Ga0207642_10115052 3300025899 Bacteria 1377
463 Ga0207710_10028785 3300025900 Bacteria 2413
464 Ga0207688_10002094 3300025901 Bacteria 10722
465 Ga0207680_10024589 3300025903 Bacteria 3308
466 Ga0207680_10024669 3300025903 Bacteria 3304
467 Ga0207680_10287726 3300025903 Bacteria 1143
468 Ga0207685_10044048 3300025905 Bacteria 1685
469 Ga0207645_10000039 3300025907 Bacteria 88205
470 Ga0207645_10000331 3300025907 Bacteria 39499
471 Ga0207645_10003755 3300025907 Bacteria 11413
472 Ga0207645_10057581 3300025907 Bacteria 2481
473 Ga0207645_10288695 3300025907 Bacteria 1090
474 Ga0207645_10393413 3300025907 Bacteria 931
475 Ga0207645_10559360 3300025907 Bacteria 776
476 Ga0207645_10763146 3300025907 Bacteria 658
477 Ga0207643_10001108 3300025908 Bacteria 15982
478 Ga0207643_10062877 3300025908 Bacteria 2121
479 Ga0207643_10093916 3300025908 Bacteria 1752
480 Ga0207643_10508492 3300025908 Bacteria 770
481 Ga0207705_10024299 3300025909 Bacteria 4326
482 Ga0207705_10327913 3300025909 Bacteria 1177
483 Ga0207684_10085345 3300025910 Bacteria 2689
484 Ga0207684_10202051 3300025910 Bacteria 1714
485 Ga0207654_10017119 3300025911 Bacteria 3785
486 Ga0207654_10571162 3300025911 Bacteria 805
487 Ga0207707_10002045 3300025912 Bacteria 18314
488 Ga0207707_10126247 3300025912 Bacteria 2237
489 Ga0207707_10221445 3300025912 Bacteria 1647
490 Ga0207707_10258442 3300025912 Bacteria 1512
491 Ga0207695_10003454 3300025913 Bacteria 22268
492 Ga0207695_10092644 3300025913 Bacteria 3032
493 Ga0207695_10205379 3300025913 Bacteria 1883
494 Ga0207671_10037783 3300025914 Bacteria 3579
495 Ga0207693_10000397 3300025915 Bacteria 40037
496 Ga0207693_11306172 3300025915 Bacteria 542
497 Ga0207663_10177716 3300025916 Bacteria 1517
498 Ga0207663_10451318 3300025916 Bacteria 992
499 Ga0207660_10125577 3300025917 Bacteria 1948
500 Ga0207660_10218345 3300025917 Bacteria 1495
501 Ga0207662_10032953 3300025918 Bacteria 3018
502 Ga0207662_10061091 3300025918 Bacteria 2262
503 Ga0207657_10005177 3300025919 Bacteria 13680
504 Ga0207657_10027055 3300025919 Bacteria 5258
505 Ga0207657_10034155 3300025919 Bacteria 4577
506 Ga0207657_10041948 3300025919 Bacteria 4041
507 Ga0207657_10073512 3300025919 Bacteria 2889
508 Ga0207649_10006701 3300025920 Bacteria 6259
509 Ga0207649_10014745 3300025920 Bacteria 4383
510 Ga0207649_10024595 3300025920 Bacteria 3503
511 Ga0207649_10068989 3300025920 Bacteria 2249
512 Ga0207649_10136244 3300025920 Bacteria 1674
513 Ga0207649_10146974 3300025920 Bacteria 1619
514 Ga0207649_10176551 3300025920 Bacteria 1492
515 Ga0207649_10187114 3300025920 Bacteria 1453
516 Ga0207649_10646525 3300025920 Bacteria 817
517 Ga0207652_10023564 3300025921 Bacteria 5100
518 Ga0207652_10026703 3300025921 Bacteria 4811
519 Ga0207652_10198073 3300025921 Bacteria 1807
520 Ga0207652_10354131 3300025921 Bacteria 1325
521 Ga0207652_10405080 3300025921 Bacteria 1231
522 Ga0207646_10189148 3300025922 Bacteria 1859
523 Ga0207646_10553736 3300025922 Bacteria 1034
524 Ga0207681_10000711 3300025923 Bacteria 21871
525 Ga0207681_10055584 3300025923 Bacteria 2697
526 Ga0207681_10252038 3300025923 Bacteria 1378
527 Ga0207694_10001561 3300025924 Bacteria 19421
528 Ga0207694_10045447 3300025924 Bacteria 3392
529 Ga0207694_10571877 3300025924 Bacteria 949
530 Ga0207650_10007591 3300025925 Bacteria 7393
531 Ga0207650_10027790 3300025925 Bacteria 4052
532 Ga0207650_10121334 3300025925 Bacteria 2035
533 Ga0207650_10299946 3300025925 Bacteria 1312
534 Ga0207659_10000435 3300025926 Bacteria 25019
535 Ga0207659_10003543 3300025926 Bacteria 9391
536 Ga0207659_10029223 3300025926 Bacteria 3755
537 Ga0207659_10097016 3300025926 Bacteria 2214
538 Ga0207659_10878267 3300025926 Bacteria 771
539 Ga0207659_11035843 3300025926 Bacteria 706
540 Ga0207687_10000188 3300025927 Bacteria 41329
541 Ga0207687_10466569 3300025927 Bacteria 1049
542 Ga0207700_10003118 3300025928 Bacteria 9574
543 Ga0207700_10274089 3300025928 Bacteria 1449
544 Ga0207700_11401225 3300025928 Bacteria 621
545 Ga0207664_10008196 3300025929 Bacteria 7275
546 Ga0207664_10219695 3300025929 Bacteria 1647
547 Ga0207644_10002082 3300025931 Bacteria 12950
548 Ga0207644_10024417 3300025931 Bacteria 4149
549 Ga0207644_10044243 3300025931 Bacteria 3162
550 Ga0207644_10044946 3300025931 Bacteria 3140
551 Ga0207644_10373939 3300025931 Bacteria 1161
552 Ga0207644_10630953 3300025931 Bacteria 891
553 Ga0207690_10003168 3300025932 Bacteria 9888
554 Ga0207690_10099499 3300025932 Bacteria 2073
555 Ga0207690_10105818 3300025932 Bacteria 2018
556 Ga0207690_10205949 3300025932 Bacteria 1497
557 Ga0207706_10005905 3300025933 Bacteria 11388
558 Ga0207706_10052956 3300025933 Bacteria 3583
559 Ga0207706_10074311 3300025933 Bacteria 2989
560 Ga0207706_10470714 3300025933 Bacteria 1086
561 Ga0207706_10620616 3300025933 Bacteria 927
562 Ga0207706_11087651 3300025933 Bacteria 669
563 Ga0207686_10002345 3300025934 Bacteria 10348
564 Ga0207686_10465500 3300025934 Bacteria 975
565 Ga0207709_10118720 3300025935 Bacteria 1782
566 Ga0207670_10008342 3300025936 Bacteria 5842
567 Ga0207670_10010906 3300025936 Bacteria 5248
568 Ga0207670_10741503 3300025936 Bacteria 815
569 Ga0207670_11231501 3300025936 Bacteria 634
570 Ga0207670_11660851 3300025936 Bacteria 543
571 Ga0207669_10005231 3300025937 Bacteria 5800
572 Ga0207669_10012973 3300025937 Bacteria 4120
573 Ga0207669_10139070 3300025937 Bacteria 1682
574 Ga0207669_10250202 3300025937 Bacteria 1319
575 Ga0207669_10806975 3300025937 Bacteria 778
576 Ga0207669_10879589 3300025937 Bacteria 747
577 Ga0207704_10003085 3300025938 Bacteria 7529
578 Ga0207704_10131659 3300025938 Bacteria 1733
579 Ga0207704_10463618 3300025938 Bacteria 1014
580 Ga0207665_10025204 3300025939 Bacteria 3923
581 Ga0207665_10029871 3300025939 Bacteria 3602
582 Ga0207665_10297090 3300025939 Bacteria 1206
583 Ga0207691_10000027 3300025940 Bacteria 126502
584 Ga0207691_10000122 3300025940 Bacteria 70474
585 Ga0207691_10010048 3300025940 Bacteria 9082
586 Ga0207691_10036165 3300025940 Bacteria 4576
587 Ga0207691_10037836 3300025940 Bacteria 4466
588 Ga0207691_10055353 3300025940 Bacteria 3615
589 Ga0207711_10000116 3300025941 Bacteria 83390
590 Ga0207711_10079743 3300025941 Bacteria 2858
591 Ga0207711_10188008 3300025941 Bacteria 1881
592 Ga0207711_10377951 3300025941 Bacteria 1314
593 Ga0207711_11414844 3300025941 Bacteria 638
594 Ga0207689_10001927 3300025942 Bacteria 19632
595 Ga0207689_10004633 3300025942 Bacteria 12442
596 Ga0207689_10057760 3300025942 Bacteria 3191
597 Ga0207661_10053518 3300025944 Bacteria 3230
598 Ga0207661_10198182 3300025944 Bacteria 1764
599 Ga0207661_11236327 3300025944 Bacteria 687
600 Ga0207661_11593749 3300025944 Bacteria 597
601 Ga0207679_10005843 3300025945 Bacteria 7727
602 Ga0207679_10028613 3300025945 Bacteria 3870
603 Ga0207679_10067729 3300025945 Bacteria 2679
604 Ga0207679_10169716 3300025945 Bacteria 1795
605 Ga0207679_10238564 3300025945 Bacteria 1539
606 Ga0207679_10852541 3300025945 Bacteria 832
607 Ga0207667_10017510 3300025949 Bacteria 8062
608 Ga0207667_10059525 3300025949 Bacteria 4000
609 Ga0207667_10091486 3300025949 Bacteria 3143
610 Ga0207667_10095357 3300025949 Bacteria 3071
611 Ga0207667_10133338 3300025949 Bacteria 2559
612 Ga0207667_10186486 3300025949 Bacteria 2129
613 Ga0207667_10312139 3300025949 Bacteria 1606
614 Ga0207651_10003529 3300025960 Bacteria 7689
615 Ga0207651_10005037 3300025960 Bacteria 6735
616 Ga0207651_10018755 3300025960 Bacteria 4127
617 Ga0207651_10208583 3300025960 Bacteria 1571
618 Ga0207651_10274450 3300025960 Bacteria 1390
619 Ga0207712_10188819 3300025961 Bacteria 1625
620 Ga0207712_10975016 3300025961 Bacteria 751
621 Ga0207712_11399466 3300025961 Bacteria 626
622 Ga0207668_10001770 3300025972 Bacteria 12603
623 Ga0207668_10004950 3300025972 Bacteria 7838
624 Ga0207668_10007868 3300025972 Bacteria 6335
625 Ga0207668_10008608 3300025972 Bacteria 6091
626 Ga0207668_10066008 3300025972 Bacteria 2563
627 Ga0207668_10140462 3300025972 Bacteria 1856
628 Ga0207668_10180606 3300025972 Bacteria 1664
629 Ga0207668_11137673 3300025972 Bacteria 700
630 Ga0207668_11464666 3300025972 Bacteria 616
631 Ga0207640_10005623 3300025981 Bacteria 6834
632 Ga0207640_10016370 3300025981 Bacteria 4312
633 Ga0207640_10022734 3300025981 Bacteria 3758
634 Ga0207640_10036621 3300025981 Bacteria 3082
635 Ga0207640_10064200 3300025981 Bacteria 2444
636 Ga0207640_10112029 3300025981 Bacteria 1936
637 Ga0207658_10000682 3300025986 Bacteria 29584
638 Ga0207658_10002227 3300025986 Bacteria 14389
639 Ga0207658_10006279 3300025986 Bacteria 8121
640 Ga0207658_10113691 3300025986 Bacteria 2145
641 Ga0207658_10173405 3300025986 Bacteria 1779
642 Ga0207658_10175734 3300025986 Bacteria 1768
643 Ga0207658_10334372 3300025986 Bacteria 1315
644 Ga0207658_10601521 3300025986 Unclassified 988
645 Ga0207658_10693221 3300025986 Unclassified 920
646 Ga0207677_10000598 3300026023 Bacteria 22232
647 Ga0207677_10043540 3300026023 Bacteria 2985
648 Ga0207677_10350957 3300026023 Bacteria 1236
649 Ga0207677_10846578 3300026023 Bacteria 821
650 Ga0207703_10000357 3300026035 Bacteria 49166
651 Ga0207703_10004607 3300026035 Bacteria 11282
652 Ga0207703_10071612 3300026035 Bacteria 2864
653 Ga0207703_10312233 3300026035 Bacteria 1437
654 Ga0207703_10907248 3300026035 Bacteria 844
655 Ga0207639_10022564 3300026041 Bacteria 4535
656 Ga0207639_10125898 3300026041 Bacteria 2113
657 Ga0207639_10160019 3300026041 Bacteria 1896
658 Ga0207639_10403246 3300026041 Bacteria 1232
659 Ga0207678_10005532 3300026067 Bacteria 11289
660 Ga0207678_10009735 3300026067 Bacteria 8451
661 Ga0207678_10043974 3300026067 Bacteria 3865
662 Ga0207678_10084148 3300026067 Bacteria 2720
663 Ga0207678_10198440 3300026067 Bacteria 1715
664 Ga0207678_10215439 3300026067 Bacteria 1643
665 Ga0207678_10659258 3300026067 Unclassified 920
666 Ga0207678_11157097 3300026067 Bacteria 685
667 Ga0207708_10016592 3300026075 Bacteria 5540
668 Ga0207708_10641542 3300026075 Bacteria 903
669 Ga0207702_10015836 3300026078 Bacteria 6243
670 Ga0207702_10029001 3300026078 Bacteria 4602
671 Ga0207702_10040144 3300026078 Bacteria 3923
672 Ga0207702_10137718 3300026078 Bacteria 2205
673 Ga0207702_10417567 3300026078 Bacteria 1297
674 Ga0207641_10002436 3300026088 Bacteria 17199
675 Ga0207641_10004735 3300026088 Bacteria 11731
676 Ga0207641_10249091 3300026088 Unclassified 1658
677 Ga0207641_10276493 3300026088 Bacteria 1577
678 Ga0207641_10365834 3300026088 Bacteria 1378
679 Ga0207641_10794070 3300026088 Bacteria 936
680 Ga0207641_11339672 3300026088 Bacteria 716
681 Ga0207641_11400887 3300026088 Bacteria 700
682 Ga0207648_10000149 3300026089 Bacteria 70199
683 Ga0207648_10006522 3300026089 Bacteria 11581
684 Ga0207648_10039889 3300026089 Bacteria 4128
685 Ga0207648_10293574 3300026089 Bacteria 1456
686 Ga0207648_10464201 3300026089 Bacteria 1154
687 Ga0207676_10000236 3300026095 Bacteria 48498
688 Ga0207676_10013826 3300026095 Bacteria 5793
689 Ga0207676_10026292 3300026095 Bacteria 4328
690 Ga0207676_10029837 3300026095 Bacteria 4087
691 Ga0207676_10029999 3300026095 Bacteria 4077
692 Ga0207674_10000694 3300026116 Bacteria 43838
693 Ga0207674_10005278 3300026116 Bacteria 15380
694 Ga0207674_10167026 3300026116 Bacteria 2154
695 Ga0207674_10173302 3300026116 Bacteria 2110
696 Ga0207675_100000871 3300026118 Bacteria 30087
697 Ga0207675_100023629 3300026118 Bacteria 5719
698 Ga0207675_100135757 3300026118 Bacteria 2334
699 Ga0207675_100180865 3300026118 Bacteria 2019
700 Ga0207675_100203010 3300026118 Bacteria 1904
701 Ga0207675_100436814 3300026118 Bacteria 1295
702 Ga0207683_10000005 3300026121 Bacteria 187889
703 Ga0207683_10000061 3300026121 Bacteria 81399
704 Ga0207683_10030161 3300026121 Bacteria 4698
705 Ga0207683_10087067 3300026121 Bacteria 2778
706 Ga0207683_10316005 3300026121 Bacteria 1430
707 Ga0207698_10017048 3300026142 Bacteria 4918
708 Ga0207698_10021865 3300026142 Bacteria 4432
709 Ga0207698_10144635 3300026142 Bacteria 2054
710 Ga0207698_10211718 3300026142 Bacteria 1744
711 Ga0207698_10286049 3300026142 Bacteria 1527
712 Ga0207698_10320622 3300026142 Bacteria 1451
713 Ga0207698_10535342 3300026142 Bacteria 1145
714 Ga0207698_10754745 3300026142 Bacteria 972
715 Ga0209969_1006601 3300027360 Bacteria 1635
716 Ga0209179_1043840 3300027512 Bacteria 947
717 Ga0209968_1025339 3300027526 Bacteria 977
718 Ga0209982_1019229 3300027552 Bacteria 1047
719 Ga0209983_1088401 3300027665 Bacteria 697
720 Ga0209588_1039337 3300027671 Bacteria 1525
721 Ga0209971_1005246 3300027682 Bacteria 3079
722 Ga0209966_1046035 3300027695 Bacteria 920
723 Ga0209974_10000218 3300027876 Bacteria 18558
724 Ga0207428_10723112 3300027907 Bacteria 711
725 Ga0207428_10794745 3300027907 Bacteria 672
726 Ga0268266_10013747 3300028379 Bacteria 6970
727 Ga0268266_10027741 3300028379 Bacteria 4814
728 Ga0268266_10035967 3300028379 Bacteria 4212
729 Ga0268266_10604478 3300028379 Bacteria 1053
730 Ga0268265_10061114 3300028380 Bacteria 2890
731 Ga0268265_10267511 3300028380 Bacteria 1523
732 Ga0268264_10004572 3300028381 Bacteria 11783
733 Ga0268264_10015489 3300028381 Bacteria 6250
734 Ga0268264_10023690 3300028381 Bacteria 5006
735 Ga0268264_10148586 3300028381 Bacteria 2098
736 Ga0307408_100048361 3300031548 Bacteria 3050
737 Ga0307408_100424552 3300031548 Bacteria 1147
738 Ga0265313_10166573 3300031595 Bacteria 933
739 Ga0265342_10036941 3300031712 Bacteria 2981
740 Ga0307405_10021490 3300031731 Bacteria 3629
741 Ga0307405_11017543 3300031731 Bacteria 708
742 Ga0307413_10013563 3300031824 Bacteria 4101
743 Ga0307413_10127914 3300031824 Bacteria 1733
744 Ga0307410_10001942 3300031852 Bacteria 9711
745 Ga0307406_10046892 3300031901 Bacteria 2721
746 Ga0307406_10074478 3300031901 Bacteria 2235
747 Ga0307406_10843815 3300031901 Bacteria 776
748 Ga0307407_10060794 3300031903 Bacteria 2206
749 Ga0307412_10076144 3300031911 Bacteria 2304
750 Ga0307412_10280072 3300031911 Bacteria 1309
751 Ga0307409_100035247 3300031995 Bacteria 3664
752 Ga0307409_100035342 3300031995 Bacteria 3661
753 Ga0307416_100017374 3300032002 Bacteria 5032
754 Ga0307416_100068575 3300032002 Bacteria 2931
755 Ga0307416_100834579 3300032002 Bacteria 1019
756 Ga0307416_101812549 3300032002 Bacteria 714
757 Ga0307414_10227770 3300032004 Bacteria 1535
758 Ga0307414_10273454 3300032004 Bacteria 1416
759 Ga0307411_10000127 3300032005 Bacteria 23867
760 Ga0307411_10273507 3300032005 Bacteria 1341
761 Ga0373934_0000450 3300035086 Bacteria 14370
762 Ga0373945_0084556 3300035116 Bacteria 1220
763 Ga0373953_0140864 3300035117 Bacteria 1031
764 Ga0373953_0292204 3300035117 Bacteria 711
765 Ga0373954_0000090 3300035118 Bacteria 31033
766 Ga0373954_0005287 3300035118 Bacteria 5578
767 Ga0373956_0058736 3300035119 Bacteria 1739
768 Ga0373956_0066484 3300035119 Bacteria 1640
769 Ga0373957_0001365 3300035120 Bacteria 6570
770 Ga0373957_0030900 3300035120 Bacteria 1965
771 Ga0373943_0335190 3300035170 Bacteria 864
772 Ga0373943_0456629 3300035170 Bacteria 743
773 Ga0373946_0065115 3300035171 Bacteria 1560
774 Ga0373955_0002225 3300035172 Bacteria 8416
775 Ga0373955_0247100 3300035172 Unclassified 1069
776 Ga0373931_0125424 3300035691 Bacteria 1472
777 Ga0373931_0719612 3300035691 Bacteria 660
778 Ga0373935_0662166 3300035692 Bacteria 766
779 Ga0373927_0208736 3300035695 Bacteria 1283
780 Ga0373933_0117062 3300035724 Bacteria 1666
781 Ga0373933_0173393 3300035724 Bacteria 1373
782 Ga0373947_0263086 3300035725 Bacteria 1143
783 Ga0373937_0014898 3300036401 Bacteria 6867
784 Ga0373937_0016168 3300036401 Bacteria 6620
785 Ga0373937_0121600 3300036401 Bacteria 2433
786 Ga0373937_0191538 3300036401 Bacteria 1921
787 Ga0373937_0971568 3300036401 Bacteria 798
788 Ga0373937_1056531 3300036401 Bacteria 761
789 Ga0373925_0008046 3300037068 Bacteria 7680
790 Ga0373925_0459044 3300037068 Bacteria 1044
791 Ga0395899_0242674 3300037312 Bacteria 1239
792 Ga0395900_0140524 3300037418 Bacteria 2473
793 Ga0395898_0025562 3300037466 Bacteria 5948
794 Ga0395905_0971727 3300037471 Bacteria 752
795 Ga0395901_0071127 3300038443 Bacteria 3625
796 Ga0436365_0678556 3300039437 Bacteria 2326
797 Ga0451807_2483320 3300041486 Bacteria 639
798 Ga0451835_0590140 3300041492 Bacteria 815
799 Ga0451851_0265793 3300041507 Bacteria 1575
800 Ga0451853_3036030 3300041512 Bacteria 1104
801 Ga0439455_0152223 3300042012 Bacteria 659
802 Ga0466957_0592391 3300044842 Bacteria 776
803 Ga0466958_0174832 3300045836 Bacteria 1361
804 Ga0466967_0944918 3300045976 Bacteria 858
805 Ga0495592_0124858 3300046454 Bacteria 1807
806 Ga0495592_0289485 3300046454 Bacteria 1068
807 Ga0495580_0049434 3300046472 Bacteria 2976
808 Ga0495628_0258525 3300046516 Bacteria 1298
809 Ga0495586_0496317 3300046535 Bacteria 704
810 Ga0495621_0035570 3300046539 Bacteria 1726
811 Ga0495621_0244114 3300046539 Bacteria 732
812 Ga0495667_0086577 3300046559 Bacteria 2032
813 Ga0495659_0263468 3300046664 Bacteria 721
814 Ga0495599_0038730 3300046678 Bacteria 2996
815 Ga0495658_0133938 3300046683 Bacteria 1511
816 Ga0495658_0294975 3300046683 Bacteria 1025
817 Ga0495636_0240688 3300047318 Bacteria 835
818 Ga0496100_0083697 3300048903 Bacteria 2161
819 Ga0496100_0105039 3300048903 Bacteria 1953
820 Ga0496100_0385832 3300048903 Bacteria 1064
821 Ga0496101_0043820 3300048904 Bacteria 3199
822 Ga0496101_0170712 3300048904 Bacteria 1672
823 Ga0496102_0227108 3300048905 Bacteria 1760
824 Ga0496102_0621517 3300048905 Bacteria 1003
825 Ga0496104_0004741 3300048907 Bacteria 11838
826 Ga0496104_0054859 3300048907 Bacteria 3767
827 Ga0496105_0054554 3300048908 Bacteria 3300
828 Ga0496105_0396843 3300048908 Bacteria 1095
829 Ga0496106_0021506 3300048909 Bacteria 4789
830 Ga0496106_0379771 3300048909 Bacteria 1135
831 Ga0496106_0603830 3300048909 Bacteria 879
832 Ga0496106_0948459 3300048909 Bacteria 678
833 Ga0496107_0009831 3300048910 Bacteria 6634
834 Ga0496107_0022469 3300048910 Bacteria 4458
835 Ga0496107_0089645 3300048910 Bacteria 2246
836 Ga0496108_0001943 3300048911 Bacteria 16553
837 Ga0496108_0084716 3300048911 Bacteria 2690
838 Ga0496108_0131679 3300048911 Bacteria 2150
839 Ga0496108_0441073 3300048911 Bacteria 1137
840 Ga0496109_0003388 3300048912 Bacteria 13344
841 Ga0496109_0127593 3300048912 Bacteria 2372
842 Ga0496109_0476365 3300048912 Bacteria 1179
843 Ga0496110_0006654 3300048913 Bacteria 9181
844 Ga0496110_0663888 3300048913 Bacteria 943
845 Ga0496110_1123709 3300048913 Bacteria 694
846 Ga0496111_0032443 3300048914 Bacteria 3724
847 Ga0496111_0460520 3300048914 Bacteria 938
848 Ga0496112_0000540 3300048915 Bacteria 25909
849 Ga0496112_0031075 3300048915 Bacteria 5175
850 Ga0496113_0065055 3300048916 Bacteria 2759
851 Ga0496113_1335012 3300048916 Bacteria 557
852 Ga0496114_0021658 3300048917 Bacteria 5230
853 Ga0496114_0378016 3300048917 Bacteria 1254
854 Ga0501034_0308740 3300049571 Bacteria 1517
855 Ga0501037_0723549 3300049573 Bacteria 661
856 Ga0501046_0532530 3300049580 Unclassified 839
857 Ga0501047_0003041 3300049581 Bacteria 15910
858 Ga0501047_0167814 3300049581 Bacteria 2065
859 Ga0501068_0092590 3300049584 Bacteria 1866
860 Ga0501069_0000613 3300049585 Bacteria 16520
861 Ga0501070_0001894 3300049586 Bacteria 18500
862 Ga0501070_0168367 3300049586 Bacteria 1805
863 Ga0501070_0772709 3300049586 Bacteria 756
864 Ga0501072_0121924 3300049588 Bacteria 2077
865 Ga0501073_0001098 3300049589 Bacteria 19610
866 Ga0501073_0006351 3300049589 Bacteria 8799
867 Ga0501073_0812975 3300049589 Bacteria 644
868 Ga0501074_0000270 3300049590 Bacteria 29630
869 Ga0501074_0025248 3300049590 Bacteria 4317
870 Ga0501079_0114478 3300049741 Bacteria 2096
871 Ga0501080_0003122 3300049742 Bacteria 14606
872 Ga0501080_0006400 3300049742 Bacteria 10569
873 Ga0501080_0117785 3300049742 Bacteria 2462
874 Ga0501080_0652128 3300049742 Bacteria 931
875 Ga0501083_0001697 3300049744 Bacteria 15011
876 Ga0501083_0016009 3300049744 Bacteria 5252
877 Ga0501083_0114806 3300049744 Bacteria 1768
878 Ga0501035_0216726 3300049822 Bacteria 1636
879 Ga0501035_0867776 3300049822 Bacteria 717
880 Ga0501044_0393583 3300049823 Bacteria 1299
881 Ga0501044_0619204 3300049823 Bacteria 974
882 Ga0501045_1014422 3300049824 Bacteria 608
883 nmdc:mga00v17_137514_c1 3300050491 Bacteria 1565
884 nmdc:mga0k408_9536_c1 3300050493 Bacteria 5237
885 nmdc:mga05p37_1066953_c1 3300050507 Bacteria 850
886 nmdc:mga08y16_323454_c1 3300050511 Bacteria 1587
887 nmdc:mga08y16_452107_c1 3300050511 Bacteria 1310
888 nmdc:mga0n895_691463_c1 3300050512 Bacteria 1016
889 nmdc:mga0n895_96099_c1 3300050512 Bacteria 2968
890 nmdc:mga0rr50_31760_c1 3300050513 Bacteria 3755
891 nmdc:mga08x19_13403_c1 3300050514 Bacteria 4956
892 nmdc:mga08x19_73243_c1 3300050514 Bacteria 2236
893 nmdc:mga08x19_96782_c1 3300050514 Bacteria 1954
894 nmdc:mga0a205_4266_c1 3300050515 Bacteria 12836
895 nmdc:mga0a205_632077_c1 3300050515 Bacteria 922
896 Ga0495612_0020216 3300053078 Bacteria 2669
897 Ga0495619_0394938 3300053085 Unclassified 955
898 Ga0501084_0466944 3300054114 Bacteria 1067
899 Ga0501082_0691278 3300060353 Bacteria 893
900 Ga0501082_1116836 3300060353 Bacteria 689

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10504468 Ga0157372_105044683 139
2 3300009148 Ga0105243_10147437 Ga0105243_101474372 143
3 3300009177 Ga0105248_10002843 Ga0105248_1000284319 143
4 3300013296 Ga0157374_10002044 Ga0157374_1000204417 143
5 3300013306 Ga0163162_10003371 Ga0163162_100033716 143
6 3300013307 Ga0157372_10257382 Ga0157372_102573823 143
7 3300013308 Ga0157375_10021611 Ga0157375_100216117 143
8 3300014968 Ga0157379_10001809 Ga0157379_1000180915 143
9 3300014969 Ga0157376_10003873 Ga0157376_100038735 143
10 3300041486 Ga0451807_2483320 Ga0451807_2483320_151_585 143
11 3300041492 Ga0451835_0590140 Ga0451835_0590140_60_494 143
12 3300041507 Ga0451851_0265793 Ga0451851_0265793_357_791 143
13 3300048903 Ga0496100_0083697 Ga0496100_0083697_1285_1719 143
14 3300048904 Ga0496101_0170712 Ga0496101_0170712_247_681 143
15 3300048909 Ga0496106_0379771 Ga0496106_0379771_67_501 143
16 3300048910 Ga0496107_0089645 Ga0496107_0089645_555_989 143
17 3300048911 Ga0496108_0131679 Ga0496108_0131679_433_867 143
18 3300048912 Ga0496109_0127593 Ga0496109_0127593_1304_1738 143
19 3300048913 Ga0496110_0663888 Ga0496110_0663888_427_861 143
20 3300048917 Ga0496114_0378016 Ga0496114_0378016_565_999 143
21 3300006173 Ga0070716_100252163 Ga0070716_1002521633 146
22 3300025939 Ga0207665_10297090 Ga0207665_102970903 146
23 3300047318 Ga0495636_0240688 Ga0495636_0240688_159_602 147
24 3300005444 Ga0070694_100489890 Ga0070694_1004898902 148
25 3300049571 Ga0501034_0308740 Ga0501034_0308740_351_797 148
26 3300049580 Ga0501046_0532530 Ga0501046_0532530_241_690 148
27 3300049581 Ga0501047_0003041 Ga0501047_0003041_4142_4588 148
28 3300049584 Ga0501068_0092590 Ga0501068_0092590_1126_1572 148
29 3300049585 Ga0501069_0000613 Ga0501069_0000613_13202_13648 148
30 3300049586 Ga0501070_0001894 Ga0501070_0001894_7200_7646 148
31 3300049589 Ga0501073_0001098 Ga0501073_0001098_10556_11002 148
32 3300049590 Ga0501074_0000270 Ga0501074_0000270_8104_8550 148
33 3300049741 Ga0501079_0114478 Ga0501079_0114478_616_1062 148
34 3300049742 Ga0501080_0006400 Ga0501080_0006400_5593_6039 148
35 3300049744 Ga0501083_0001697 Ga0501083_0001697_4010_4456 148
36 3300049822 Ga0501035_0216726 Ga0501035_0216726_525_971 148
37 3300049823 Ga0501044_0619204 Ga0501044_0619204_208_654 148
38 3300054114 Ga0501084_0466944 Ga0501084_0466944_216_662 148
39 3300009147 Ga0114129_10398433 Ga0114129_103984331 149
40 3300050507 nmdc:mga05p37_1066953_c1 nmdc:mga05p37_1066953_c1_335_811 149
41 3300050514 nmdc:mga08x19_13403_c1 nmdc:mga08x19_13403_c1_3385_3834 149
42 3300005440 Ga0070705_100178956 Ga0070705_1001789562 153
43 3300005549 Ga0070704_100005301 Ga0070704_1000053012 153
44 3300006173 Ga0070716_100013908 Ga0070716_1000139085 153
45 3300025939 Ga0207665_10029871 Ga0207665_100298713 153
46 3300006914 Ga0075436_100004627 Ga0075436_1000046273 154
47 3300006914 Ga0075436_100080231 Ga0075436_1000802312 154
48 3300007265 Ga0099794_10000530 Ga0099794_1000053013 154
49 3300007265 Ga0099794_10014216 Ga0099794_100142164 154
50 3300007788 Ga0099795_10079738 Ga0099795_100797382 154
51 3300010159 Ga0099796_10048396 Ga0099796_100483962 154
52 3300027512 Ga0209179_1043840 Ga0209179_10438402 154
53 3300027671 Ga0209588_1039337 Ga0209588_10393372 154
54 3300046664 Ga0495659_0263468 Ga0495659_0263468_156_620 154
55 3300050514 nmdc:mga08x19_73243_c1 nmdc:mga08x19_73243_c1_965_1429 154
56 3300050514 nmdc:mga08x19_96782_c1 nmdc:mga08x19_96782_c1_778_1242 154
57 3300050515 nmdc:mga0a205_632077_c1 nmdc:mga0a205_632077_c1_258_737 154
58 3300005458 Ga0070681_10504570 Ga0070681_105045702 155
59 3300005530 Ga0070679_100509829 Ga0070679_1005098292 155
60 3300005563 Ga0068855_100016905 Ga0068855_1000169057 155
61 3300005563 Ga0068855_101704408 Ga0068855_1017044081 155
62 3300009093 Ga0105240_10071509 Ga0105240_100715096 155
63 3300013102 Ga0157371_10247192 Ga0157371_102471922 155
64 3300013104 Ga0157370_10010466 Ga0157370_100104669 155
65 3300013104 Ga0157370_10206317 Ga0157370_102063172 155
66 3300025315 Ga0207697_10407251 Ga0207697_104072511 155
67 3300025913 Ga0207695_10205379 Ga0207695_102053792 155
68 3300025921 Ga0207652_10354131 Ga0207652_103541313 155
69 3300025949 Ga0207667_10059525 Ga0207667_100595252 155
70 3300035117 Ga0373953_0292204 Ga0373953_0292204_196_666 155
71 3300049573 Ga0501037_0723549 Ga0501037_0723549_131_601 155
72 3300049581 Ga0501047_0167814 Ga0501047_0167814_1491_1958 155
73 3300049586 Ga0501070_0772709 Ga0501070_0772709_270_737 155
74 3300049589 Ga0501073_0812975 Ga0501073_0812975_38_505 155
75 3300049742 Ga0501080_0117785 Ga0501080_0117785_452_919 155
76 3300049822 Ga0501035_0867776 Ga0501035_0867776_172_639 155
77 3300049823 Ga0501044_0393583 Ga0501044_0393583_680_1147 155
78 3300060353 Ga0501082_0691278 Ga0501082_0691278_272_739 155
79 3300005293 Ga0065715_10604844 Ga0065715_106048441 156
80 3300005327 Ga0070658_10912505 Ga0070658_109125051 156
81 3300005329 Ga0070683_100213175 Ga0070683_1002131753 156
82 3300005338 Ga0068868_100143733 Ga0068868_1001437332 156
83 3300005339 Ga0070660_100018256 Ga0070660_1000182565 156
84 3300005339 Ga0070660_100019235 Ga0070660_1000192356 156
85 3300005340 Ga0070689_101487877 Ga0070689_1014878771 156
86 3300005344 Ga0070661_100587866 Ga0070661_1005878662 156
87 3300005354 Ga0070675_100525094 Ga0070675_1005250942 156
88 3300005355 Ga0070671_100295150 Ga0070671_1002951502 156
89 3300005356 Ga0070674_100320869 Ga0070674_1003208693 156
90 3300005356 Ga0070674_101608452 Ga0070674_1016084521 156
91 3300005364 Ga0070673_100113023 Ga0070673_1001130233 156
92 3300005365 Ga0070688_100335349 Ga0070688_1003353492 156
93 3300005366 Ga0070659_100245103 Ga0070659_1002451033 156
94 3300005367 Ga0070667_100099238 Ga0070667_1000992382 156
95 3300005367 Ga0070667_100124434 Ga0070667_1001244344 156
96 3300005438 Ga0070701_10835550 Ga0070701_108355501 156
97 3300005455 Ga0070663_100226055 Ga0070663_1002260552 156
98 3300005455 Ga0070663_100492323 Ga0070663_1004923232 156
99 3300005457 Ga0070662_100202720 Ga0070662_1002027202 156
100 3300005458 Ga0070681_10188909 Ga0070681_101889092 156
101 3300005458 Ga0070681_10194030 Ga0070681_101940302 156
102 3300005458 Ga0070681_10811526 Ga0070681_108115262 156
103 3300005459 Ga0068867_100388882 Ga0068867_1003888822 156
104 3300005530 Ga0070679_100102796 Ga0070679_1001027965 156
105 3300005530 Ga0070679_100332826 Ga0070679_1003328263 156
106 3300005530 Ga0070679_100405991 Ga0070679_1004059911 156
107 3300005535 Ga0070684_100114905 Ga0070684_1001149052 156
108 3300005539 Ga0068853_100493124 Ga0068853_1004931241 156
109 3300005539 Ga0068853_100616914 Ga0068853_1006169141 156
110 3300005543 Ga0070672_100034147 Ga0070672_1000341472 156
111 3300005548 Ga0070665_100168948 Ga0070665_1001689482 156
112 3300005548 Ga0070665_100754768 Ga0070665_1007547682 156
113 3300005563 Ga0068855_100030675 Ga0068855_1000306755 156
114 3300005563 Ga0068855_100169283 Ga0068855_1001692833 156
115 3300005564 Ga0070664_101233277 Ga0070664_1012332771 156
116 3300005614 Ga0068856_100167707 Ga0068856_1001677073 156
117 3300005616 Ga0068852_100775447 Ga0068852_1007754471 156
118 3300005618 Ga0068864_100324793 Ga0068864_1003247932 156
119 3300005618 Ga0068864_100907797 Ga0068864_1009077971 156
120 3300005719 Ga0068861_100282136 Ga0068861_1002821362 156
121 3300005719 Ga0068861_101277487 Ga0068861_1012774871 156
122 3300005834 Ga0068851_10068990 Ga0068851_100689903 156
123 3300005842 Ga0068858_100321206 Ga0068858_1003212061 156
124 3300005842 Ga0068858_101166469 Ga0068858_1011664691 156
125 3300005844 Ga0068862_100135274 Ga0068862_1001352743 156
126 3300005985 Ga0081539_10203957 Ga0081539_102039572 156
127 3300006028 Ga0070717_10425171 Ga0070717_104251712 156
128 3300006051 Ga0075364_10019352 Ga0075364_100193525 156
129 3300006186 Ga0075369_10003906 Ga0075369_100039065 156
130 3300006195 Ga0075366_10022788 Ga0075366_100227883 156
131 3300006237 Ga0097621_101562817 Ga0097621_1015628172 156
132 3300006914 Ga0075436_100018047 Ga0075436_1000180472 156
133 3300007076 Ga0075435_100354881 Ga0075435_1003548813 156
134 3300009093 Ga0105240_10002895 Ga0105240_100028954 156
135 3300009174 Ga0105241_10010941 Ga0105241_100109417 156
136 3300009551 Ga0105238_10020415 Ga0105238_100204156 156
137 3300009553 Ga0105249_10112993 Ga0105249_101129933 156
138 3300013104 Ga0157370_10007974 Ga0157370_1000797410 156
139 3300013105 Ga0157369_10319921 Ga0157369_103199213 156
140 3300013105 Ga0157369_11762387 Ga0157369_117623872 156
141 3300013296 Ga0157374_10810701 Ga0157374_108107012 156
142 3300013306 Ga0163162_10428948 Ga0163162_104289482 156
143 3300013307 Ga0157372_10016533 Ga0157372_100165336 156
144 3300013307 Ga0157372_10029210 Ga0157372_100292106 156
145 3300013307 Ga0157372_10105643 Ga0157372_101056434 156
146 3300013308 Ga0157375_10284040 Ga0157375_102840403 156
147 3300013308 Ga0157375_10832615 Ga0157375_108326152 156
148 3300014325 Ga0163163_11794536 Ga0163163_117945361 156
149 3300014326 Ga0157380_10127055 Ga0157380_101270552 156
150 3300020077 Ga0206351_10432916 Ga0206351_104329161 156
151 3300025321 Ga0207656_10060605 Ga0207656_100606052 156
152 3300025907 Ga0207645_10559360 Ga0207645_105593601 156
153 3300025908 Ga0207643_10093916 Ga0207643_100939161 156
154 3300025911 Ga0207654_10017119 Ga0207654_100171194 156
155 3300025912 Ga0207707_10126247 Ga0207707_101262472 156
156 3300025912 Ga0207707_10258442 Ga0207707_102584422 156
157 3300025913 Ga0207695_10003454 Ga0207695_100034544 156
158 3300025915 Ga0207693_11306172 Ga0207693_113061721 156
159 3300025919 Ga0207657_10027055 Ga0207657_100270555 156
160 3300025919 Ga0207657_10073512 Ga0207657_100735122 156
161 3300025920 Ga0207649_10187114 Ga0207649_101871142 156
162 3300025921 Ga0207652_10198073 Ga0207652_101980732 156
163 3300025921 Ga0207652_10405080 Ga0207652_104050802 156
164 3300025924 Ga0207694_10045447 Ga0207694_100454475 156
165 3300025926 Ga0207659_10029223 Ga0207659_100292233 156
166 3300025926 Ga0207659_10097016 Ga0207659_100970163 156
167 3300025928 Ga0207700_11401225 Ga0207700_114012252 156
168 3300025929 Ga0207664_10219695 Ga0207664_102196954 156
169 3300025931 Ga0207644_10630953 Ga0207644_106309532 156
170 3300025932 Ga0207690_10205949 Ga0207690_102059493 156
171 3300025933 Ga0207706_10470714 Ga0207706_104707142 156
172 3300025934 Ga0207686_10465500 Ga0207686_104655003 156
173 3300025936 Ga0207670_11231501 Ga0207670_112315012 156
174 3300025937 Ga0207669_10250202 Ga0207669_102502022 156
175 3300025937 Ga0207669_10879589 Ga0207669_108795891 156
176 3300025938 Ga0207704_10463618 Ga0207704_104636183 156
177 3300025940 Ga0207691_10036165 Ga0207691_100361655 156
178 3300025940 Ga0207691_10055353 Ga0207691_100553534 156
179 3300025944 Ga0207661_10198182 Ga0207661_101981823 156
180 3300025949 Ga0207667_10091486 Ga0207667_100914861 156
181 3300025949 Ga0207667_10095357 Ga0207667_100953574 156
182 3300025960 Ga0207651_10208583 Ga0207651_102085832 156
183 3300025961 Ga0207712_11399466 Ga0207712_113994662 156
184 3300025972 Ga0207668_10004950 Ga0207668_100049503 156
185 3300025972 Ga0207668_11137673 Ga0207668_111376731 156
186 3300025972 Ga0207668_11464666 Ga0207668_114646662 156
187 3300025981 Ga0207640_10064200 Ga0207640_100642003 156
188 3300025986 Ga0207658_10113691 Ga0207658_101136911 156
189 3300025986 Ga0207658_10173405 Ga0207658_101734052 156
190 3300026023 Ga0207677_10846578 Ga0207677_108465781 156
191 3300026035 Ga0207703_10907248 Ga0207703_109072482 156
192 3300026067 Ga0207678_10198440 Ga0207678_101984402 156
193 3300026078 Ga0207702_10040144 Ga0207702_100401442 156
194 3300026088 Ga0207641_10794070 Ga0207641_107940702 156
195 3300026089 Ga0207648_10293574 Ga0207648_102935742 156
196 3300026118 Ga0207675_100135757 Ga0207675_1001357572 156
197 3300026118 Ga0207675_100203010 Ga0207675_1002030103 156
198 3300026121 Ga0207683_10316005 Ga0207683_103160053 156
199 3300026142 Ga0207698_10211718 Ga0207698_102117182 156
200 3300026142 Ga0207698_10754745 Ga0207698_107547452 156
201 3300027907 Ga0207428_10794745 Ga0207428_107947452 156
202 3300028379 Ga0268266_10604478 Ga0268266_106044782 156
203 3300031595 Ga0265313_10166573 Ga0265313_101665732 156
204 3300031712 Ga0265342_10036941 Ga0265342_100369413 156
205 3300032002 Ga0307416_100834579 Ga0307416_1008345792 156
206 3300035118 Ga0373954_0005287 Ga0373954_0005287_2936_3454 156
207 3300035724 Ga0373933_0173393 Ga0373933_0173393_262_732 156
208 3300036401 Ga0373937_0121600 Ga0373937_0121600_1596_2066 156
209 3300037312 Ga0395899_0242674 Ga0395899_0242674_144_614 156
210 3300037418 Ga0395900_0140524 Ga0395900_0140524_1904_2374 156
211 3300037466 Ga0395898_0025562 Ga0395898_0025562_3193_3663 156
212 3300037471 Ga0395905_0971727 Ga0395905_0971727_213_683 156
213 3300038443 Ga0395901_0071127 Ga0395901_0071127_2855_3325 156
214 3300045836 Ga0466958_0174832 Ga0466958_0174832_220_690 156
215 3300045976 Ga0466967_0944918 Ga0466967_0944918_310_783 156
216 3300046454 Ga0495592_0124858 Ga0495592_0124858_991_1509 156
217 3300046539 Ga0495621_0244114 Ga0495621_0244114_113_586 156
218 3300046678 Ga0495599_0038730 Ga0495599_0038730_1821_2339 156
219 3300050491 nmdc:mga00v17_137514_c1 nmdc:mga00v17_137514_c1_699_1175 156
220 3300050493 nmdc:mga0k408_9536_c1 nmdc:mga0k408_9536_c1_1424_1900 156
221 3300001976 JGI24752J21851_1031739 JGI24752J21851_10317391 157
222 3300001977 JGI24746J21847_1017895 JGI24746J21847_10178951 157
223 3300001991 JGI24743J22301_10058372 JGI24743J22301_100583722 157
224 3300002076 JGI24749J21850_1007123 JGI24749J21850_10071232 157
225 3300002126 JGI24035J26624_1017633 JGI24035J26624_10176332 157
226 3300005290 Ga0065712_10106723 Ga0065712_101067232 157
227 3300005293 Ga0065715_10467076 Ga0065715_104670761 157
228 3300005327 Ga0070658_10040615 Ga0070658_100406152 157
229 3300005327 Ga0070658_10049587 Ga0070658_100495874 157
230 3300005328 Ga0070676_10001017 Ga0070676_100010177 157
231 3300005328 Ga0070676_10027056 Ga0070676_100270564 157
232 3300005328 Ga0070676_10101032 Ga0070676_101010323 157
233 3300005328 Ga0070676_10376505 Ga0070676_103765052 157
234 3300005329 Ga0070683_100053239 Ga0070683_1000532391 157
235 3300005329 Ga0070683_100726608 Ga0070683_1007266082 157
236 3300005329 Ga0070683_100948042 Ga0070683_1009480421 157
237 3300005330 Ga0070690_100000521 Ga0070690_10000052114 157
238 3300005330 Ga0070690_100012188 Ga0070690_1000121886 157
239 3300005330 Ga0070690_100029269 Ga0070690_1000292695 157
240 3300005331 Ga0070670_100025429 Ga0070670_1000254296 157
241 3300005331 Ga0070670_100039751 Ga0070670_1000397515 157
242 3300005331 Ga0070670_100040658 Ga0070670_1000406582 157
243 3300005331 Ga0070670_100058598 Ga0070670_1000585982 157
244 3300005331 Ga0070670_100105401 Ga0070670_1001054014 157
245 3300005333 Ga0070677_10000411 Ga0070677_1000041110 157
246 3300005333 Ga0070677_10025678 Ga0070677_100256783 157
247 3300005334 Ga0068869_100003165 Ga0068869_1000031658 157
248 3300005334 Ga0068869_100035164 Ga0068869_1000351643 157
249 3300005334 Ga0068869_100091814 Ga0068869_1000918143 157
250 3300005334 Ga0068869_100107766 Ga0068869_1001077661 157
251 3300005335 Ga0070666_10014579 Ga0070666_100145793 157
252 3300005335 Ga0070666_10027874 Ga0070666_100278746 157
253 3300005337 Ga0070682_100090603 Ga0070682_1000906032 157
254 3300005338 Ga0068868_100071048 Ga0068868_1000710483 157
255 3300005338 Ga0068868_100078460 Ga0068868_1000784602 157
256 3300005338 Ga0068868_100174457 Ga0068868_1001744573 157
257 3300005339 Ga0070660_100005982 Ga0070660_1000059821 157
258 3300005339 Ga0070660_100093407 Ga0070660_1000934072 157
259 3300005339 Ga0070660_100335830 Ga0070660_1003358302 157
260 3300005339 Ga0070660_100414532 Ga0070660_1004145321 157
261 3300005340 Ga0070689_100001865 Ga0070689_1000018653 157
262 3300005340 Ga0070689_100022724 Ga0070689_1000227244 157
263 3300005340 Ga0070689_100051703 Ga0070689_1000517033 157
264 3300005343 Ga0070687_100021167 Ga0070687_1000211675 157
265 3300005343 Ga0070687_100055680 Ga0070687_1000556803 157
266 3300005344 Ga0070661_100000486 Ga0070661_10000048617 157
267 3300005344 Ga0070661_100014142 Ga0070661_1000141425 157
268 3300005344 Ga0070661_100019203 Ga0070661_1000192035 157
269 3300005344 Ga0070661_100106760 Ga0070661_1001067603 157
270 3300005344 Ga0070661_100140078 Ga0070661_1001400782 157
271 3300005344 Ga0070661_100819108 Ga0070661_1008191081 157
272 3300005344 Ga0070661_101344791 Ga0070661_1013447911 157
273 3300005345 Ga0070692_10178983 Ga0070692_101789833 157
274 3300005347 Ga0070668_100001274 Ga0070668_1000012747 157
275 3300005347 Ga0070668_100014576 Ga0070668_1000145762 157
276 3300005347 Ga0070668_100019216 Ga0070668_1000192165 157
277 3300005347 Ga0070668_100073075 Ga0070668_1000730753 157
278 3300005347 Ga0070668_100175533 Ga0070668_1001755332 157
279 3300005347 Ga0070668_100337286 Ga0070668_1003372862 157
280 3300005353 Ga0070669_100000411 Ga0070669_10000041116 157
281 3300005353 Ga0070669_100220920 Ga0070669_1002209202 157
282 3300005353 Ga0070669_100490406 Ga0070669_1004904062 157
283 3300005354 Ga0070675_100018529 Ga0070675_1000185293 157
284 3300005354 Ga0070675_100023462 Ga0070675_1000234623 157
285 3300005354 Ga0070675_100608552 Ga0070675_1006085522 157
286 3300005354 Ga0070675_100664711 Ga0070675_1006647111 157
287 3300005355 Ga0070671_100000564 Ga0070671_10000056418 157
288 3300005355 Ga0070671_100011838 Ga0070671_1000118388 157
289 3300005355 Ga0070671_100012159 Ga0070671_1000121595 157
290 3300005355 Ga0070671_100045506 Ga0070671_1000455062 157
291 3300005355 Ga0070671_100111358 Ga0070671_1001113582 157
292 3300005355 Ga0070671_100667769 Ga0070671_1006677692 157
293 3300005355 Ga0070671_101016832 Ga0070671_1010168322 157
294 3300005356 Ga0070674_100004476 Ga0070674_1000044767 157
295 3300005356 Ga0070674_100165018 Ga0070674_1001650183 157
296 3300005364 Ga0070673_100001499 Ga0070673_1000014993 157
297 3300005364 Ga0070673_100016936 Ga0070673_1000169362 157
298 3300005364 Ga0070673_100030647 Ga0070673_1000306473 157
299 3300005364 Ga0070673_100056728 Ga0070673_1000567283 157
300 3300005364 Ga0070673_100130389 Ga0070673_1001303893 157
301 3300005365 Ga0070688_100001247 Ga0070688_1000012478 157
302 3300005365 Ga0070688_100042516 Ga0070688_1000425163 157
303 3300005365 Ga0070688_100082815 Ga0070688_1000828153 157
304 3300005365 Ga0070688_100694049 Ga0070688_1006940491 157
305 3300005366 Ga0070659_100025962 Ga0070659_1000259622 157
306 3300005366 Ga0070659_100143240 Ga0070659_1001432402 157
307 3300005366 Ga0070659_100169921 Ga0070659_1001699213 157
308 3300005366 Ga0070659_100170222 Ga0070659_1001702223 157
309 3300005366 Ga0070659_100257041 Ga0070659_1002570411 157
310 3300005366 Ga0070659_100600200 Ga0070659_1006002002 157
311 3300005367 Ga0070667_100002084 Ga0070667_10000208415 157
312 3300005367 Ga0070667_100002948 Ga0070667_1000029483 157
313 3300005367 Ga0070667_100139752 Ga0070667_1001397522 157
314 3300005367 Ga0070667_100280319 Ga0070667_1002803191 157
315 3300005367 Ga0070667_101439158 Ga0070667_1014391581 157
316 3300005406 Ga0070703_10063910 Ga0070703_100639101 157
317 3300005434 Ga0070709_10525859 Ga0070709_105258592 157
318 3300005434 Ga0070709_10608395 Ga0070709_106083951 157
319 3300005435 Ga0070714_100013470 Ga0070714_1000134703 157
320 3300005436 Ga0070713_100005194 Ga0070713_1000051949 157
321 3300005436 Ga0070713_101116744 Ga0070713_1011167441 157
322 3300005437 Ga0070710_10005942 Ga0070710_100059425 157
323 3300005438 Ga0070701_10011424 Ga0070701_100114242 157
324 3300005438 Ga0070701_10127725 Ga0070701_101277251 157
325 3300005439 Ga0070711_100004130 Ga0070711_1000041302 157
326 3300005441 Ga0070700_100025803 Ga0070700_1000258034 157
327 3300005444 Ga0070694_101440884 Ga0070694_1014408841 157
328 3300005455 Ga0070663_100004490 Ga0070663_1000044903 157
329 3300005455 Ga0070663_100078580 Ga0070663_1000785802 157
330 3300005455 Ga0070663_100620130 Ga0070663_1006201302 157
331 3300005456 Ga0070678_100000428 Ga0070678_10000042820 157
332 3300005456 Ga0070678_100000948 Ga0070678_10000094814 157
333 3300005456 Ga0070678_100009922 Ga0070678_1000099226 157
334 3300005456 Ga0070678_100081000 Ga0070678_1000810003 157
335 3300005457 Ga0070662_100001187 Ga0070662_1000011876 157
336 3300005457 Ga0070662_100041275 Ga0070662_1000412755 157
337 3300005457 Ga0070662_100304460 Ga0070662_1003044601 157
338 3300005457 Ga0070662_100919305 Ga0070662_1009193051 157
339 3300005458 Ga0070681_10003192 Ga0070681_1000319212 157
340 3300005458 Ga0070681_10030700 Ga0070681_100307002 157
341 3300005459 Ga0068867_100001129 Ga0068867_1000011299 157
342 3300005459 Ga0068867_100065181 Ga0068867_1000651812 157
343 3300005459 Ga0068867_100123999 Ga0068867_1001239992 157
344 3300005459 Ga0068867_100232665 Ga0068867_1002326651 157
345 3300005459 Ga0068867_101328521 Ga0068867_1013285211 157
346 3300005466 Ga0070685_10002459 Ga0070685_100024596 157
347 3300005466 Ga0070685_10010782 Ga0070685_100107826 157
348 3300005467 Ga0070706_100094756 Ga0070706_1000947563 157
349 3300005467 Ga0070706_100214599 Ga0070706_1002145993 157
350 3300005468 Ga0070707_100845133 Ga0070707_1008451331 157
351 3300005468 Ga0070707_101034481 Ga0070707_1010344811 157
352 3300005471 Ga0070698_100035950 Ga0070698_1000359505 157
353 3300005518 Ga0070699_100406334 Ga0070699_1004063341 157
354 3300005530 Ga0070679_100014348 Ga0070679_1000143483 157
355 3300005530 Ga0070679_100070126 Ga0070679_1000701261 157
356 3300005530 Ga0070679_100159282 Ga0070679_1001592824 157
357 3300005535 Ga0070684_100021273 Ga0070684_1000212734 157
358 3300005535 Ga0070684_100129561 Ga0070684_1001295614 157
359 3300005535 Ga0070684_100368932 Ga0070684_1003689323 157
360 3300005535 Ga0070684_100818708 Ga0070684_1008187082 157
361 3300005536 Ga0070697_100016402 Ga0070697_1000164025 157
362 3300005536 Ga0070697_100431872 Ga0070697_1004318722 157
363 3300005539 Ga0068853_100003043 Ga0068853_1000030433 157
364 3300005539 Ga0068853_100030015 Ga0068853_1000300154 157
365 3300005539 Ga0068853_100168009 Ga0068853_1001680092 157
366 3300005539 Ga0068853_100224909 Ga0068853_1002249093 157
367 3300005539 Ga0068853_100305460 Ga0068853_1003054603 157
368 3300005539 Ga0068853_100365146 Ga0068853_1003651461 157
369 3300005539 Ga0068853_100877381 Ga0068853_1008773812 157
370 3300005539 Ga0068853_100909222 Ga0068853_1009092221 157
371 3300005543 Ga0070672_100005917 Ga0070672_1000059178 157
372 3300005543 Ga0070672_100016247 Ga0070672_1000162473 157
373 3300005543 Ga0070672_100240311 Ga0070672_1002403111 157
374 3300005544 Ga0070686_100049768 Ga0070686_1000497684 157
375 3300005544 Ga0070686_100178861 Ga0070686_1001788611 157
376 3300005545 Ga0070695_101052251 Ga0070695_1010522511 157
377 3300005546 Ga0070696_100487323 Ga0070696_1004873231 157
378 3300005546 Ga0070696_101635060 Ga0070696_1016350601 157
379 3300005547 Ga0070693_100006888 Ga0070693_1000068885 157
380 3300005547 Ga0070693_100025867 Ga0070693_1000258672 157
381 3300005547 Ga0070693_100034500 Ga0070693_1000345004 157
382 3300005547 Ga0070693_100270363 Ga0070693_1002703631 157
383 3300005547 Ga0070693_100350170 Ga0070693_1003501701 157
384 3300005548 Ga0070665_100005926 Ga0070665_10000592615 157
385 3300005548 Ga0070665_100012339 Ga0070665_1000123397 157
386 3300005548 Ga0070665_100036448 Ga0070665_1000364484 157
387 3300005549 Ga0070704_100536136 Ga0070704_1005361362 157
388 3300005563 Ga0068855_100001032 Ga0068855_10000103237 157
389 3300005563 Ga0068855_100034796 Ga0068855_1000347968 157
390 3300005563 Ga0068855_100225886 Ga0068855_1002258863 157
391 3300005563 Ga0068855_100769255 Ga0068855_1007692552 157
392 3300005564 Ga0070664_100002383 Ga0070664_1000023837 157
393 3300005564 Ga0070664_100014257 Ga0070664_1000142577 157
394 3300005564 Ga0070664_100014914 Ga0070664_1000149144 157
395 3300005564 Ga0070664_100031582 Ga0070664_1000315825 157
396 3300005564 Ga0070664_100072810 Ga0070664_1000728105 157
397 3300005564 Ga0070664_100113220 Ga0070664_1001132202 157
398 3300005564 Ga0070664_100491782 Ga0070664_1004917822 157
399 3300005564 Ga0070664_100811740 Ga0070664_1008117402 157
400 3300005564 Ga0070664_101488284 Ga0070664_1014882841 157
401 3300005577 Ga0068857_100002349 Ga0068857_1000023493 157
402 3300005577 Ga0068857_100054191 Ga0068857_1000541913 157
403 3300005577 Ga0068857_100231895 Ga0068857_1002318953 157
404 3300005578 Ga0068854_100004207 Ga0068854_1000042074 157
405 3300005578 Ga0068854_100012441 Ga0068854_1000124414 157
406 3300005578 Ga0068854_100155845 Ga0068854_1001558452 157
407 3300005578 Ga0068854_100231632 Ga0068854_1002316322 157
408 3300005614 Ga0068856_100023479 Ga0068856_1000234794 157
409 3300005614 Ga0068856_100063611 Ga0068856_1000636115 157
410 3300005614 Ga0068856_100237629 Ga0068856_1002376292 157
411 3300005614 Ga0068856_100437096 Ga0068856_1004370961 157
412 3300005614 Ga0068856_100734809 Ga0068856_1007348092 157
413 3300005615 Ga0070702_100005551 Ga0070702_1000055515 157
414 3300005615 Ga0070702_100128666 Ga0070702_1001286663 157
415 3300005616 Ga0068852_100001314 Ga0068852_1000013149 157
416 3300005616 Ga0068852_100002732 Ga0068852_10000273213 157
417 3300005616 Ga0068852_100022936 Ga0068852_1000229365 157
418 3300005616 Ga0068852_100072754 Ga0068852_1000727543 157
419 3300005616 Ga0068852_100350950 Ga0068852_1003509503 157
420 3300005616 Ga0068852_100766542 Ga0068852_1007665421 157
421 3300005617 Ga0068859_100000594 Ga0068859_10000059421 157
422 3300005617 Ga0068859_100003144 Ga0068859_10000314413 157
423 3300005617 Ga0068859_100068504 Ga0068859_1000685042 157
424 3300005617 Ga0068859_100317459 Ga0068859_1003174592 157
425 3300005618 Ga0068864_100015761 Ga0068864_1000157617 157
426 3300005618 Ga0068864_100044410 Ga0068864_1000444103 157
427 3300005618 Ga0068864_100098010 Ga0068864_1000980102 157
428 3300005618 Ga0068864_100136959 Ga0068864_1001369592 157
429 3300005618 Ga0068864_100334895 Ga0068864_1003348952 157
430 3300005618 Ga0068864_100448504 Ga0068864_1004485042 157
431 3300005718 Ga0068866_10002216 Ga0068866_100022165 157
432 3300005718 Ga0068866_10047145 Ga0068866_100471453 157
433 3300005718 Ga0068866_10093823 Ga0068866_100938231 157
434 3300005718 Ga0068866_10131084 Ga0068866_101310841 157
435 3300005719 Ga0068861_100018747 Ga0068861_1000187476 157
436 3300005719 Ga0068861_100135806 Ga0068861_1001358063 157
437 3300005834 Ga0068851_10006565 Ga0068851_100065655 157
438 3300005834 Ga0068851_10034062 Ga0068851_100340622 157
439 3300005834 Ga0068851_10047130 Ga0068851_100471302 157
440 3300005834 Ga0068851_10054503 Ga0068851_100545034 157
441 3300005834 Ga0068851_10202659 Ga0068851_102026592 157
442 3300005834 Ga0068851_10275209 Ga0068851_102752092 157
443 3300005840 Ga0068870_10002817 Ga0068870_100028177 157
444 3300005840 Ga0068870_10015713 Ga0068870_100157132 157
445 3300005840 Ga0068870_10594559 Ga0068870_105945592 157
446 3300005841 Ga0068863_100004302 Ga0068863_1000043023 157
447 3300005841 Ga0068863_100017463 Ga0068863_1000174635 157
448 3300005841 Ga0068863_100020650 Ga0068863_1000206503 157
449 3300005841 Ga0068863_100216115 Ga0068863_1002161153 157
450 3300005841 Ga0068863_100779628 Ga0068863_1007796282 157
451 3300005841 Ga0068863_101460989 Ga0068863_1014609891 157
452 3300005842 Ga0068858_100002565 Ga0068858_1000025654 157
453 3300005842 Ga0068858_100003040 Ga0068858_1000030409 157
454 3300005842 Ga0068858_100019871 Ga0068858_1000198716 157
455 3300005842 Ga0068858_100085273 Ga0068858_1000852731 157
456 3300005843 Ga0068860_100002537 Ga0068860_1000025376 157
457 3300005843 Ga0068860_100065222 Ga0068860_1000652224 157
458 3300005843 Ga0068860_100079082 Ga0068860_1000790822 157
459 3300005843 Ga0068860_100103291 Ga0068860_1001032913 157
460 3300005843 Ga0068860_100125523 Ga0068860_1001255233 157
461 3300005844 Ga0068862_100068229 Ga0068862_1000682295 157
462 3300005844 Ga0068862_100454889 Ga0068862_1004548893 157
463 3300005844 Ga0068862_100715505 Ga0068862_1007155052 157
464 3300005844 Ga0068862_100739427 Ga0068862_1007394272 157
465 3300006163 Ga0070715_10689223 Ga0070715_106892231 157
466 3300006173 Ga0070716_100038854 Ga0070716_1000388543 157
467 3300006175 Ga0070712_100002152 Ga0070712_1000021527 157
468 3300006237 Ga0097621_100001502 Ga0097621_10000150215 157
469 3300006237 Ga0097621_100005226 Ga0097621_1000052266 157
470 3300006358 Ga0068871_100009028 Ga0068871_1000090288 157
471 3300006358 Ga0068871_100687117 Ga0068871_1006871172 157
472 3300006847 Ga0075431_100784109 Ga0075431_1007841091 157
473 3300006852 Ga0075433_10033447 Ga0075433_100334472 157
474 3300006871 Ga0075434_100015476 Ga0075434_1000154765 157
475 3300006881 Ga0068865_100002771 Ga0068865_1000027718 157
476 3300006881 Ga0068865_100341340 Ga0068865_1003413402 157
477 3300006914 Ga0075436_100042207 Ga0075436_1000422075 157
478 3300006914 Ga0075436_100231125 Ga0075436_1002311252 157
479 3300006931 Ga0097620_100000594 Ga0097620_10000059421 157
480 3300006931 Ga0097620_100003144 Ga0097620_1000031448 157
481 3300006931 Ga0097620_100068504 Ga0097620_1000685042 157
482 3300006931 Ga0097620_100317431 Ga0097620_1003174312 157
483 3300007076 Ga0075435_100009247 Ga0075435_1000092474 157
484 3300007076 Ga0075435_100693867 Ga0075435_1006938672 157
485 3300009092 Ga0105250_10366570 Ga0105250_103665702 157
486 3300009093 Ga0105240_10002122 Ga0105240_1000212212 157
487 3300009094 Ga0111539_10099260 Ga0111539_100992603 157
488 3300009094 Ga0111539_10265048 Ga0111539_102650483 157
489 3300009098 Ga0105245_10226190 Ga0105245_102261902 157
490 3300009098 Ga0105245_10248045 Ga0105245_102480453 157
491 3300009098 Ga0105245_10501206 Ga0105245_105012062 157
492 3300009101 Ga0105247_10047360 Ga0105247_100473602 157
493 3300009147 Ga0114129_10799654 Ga0114129_107996542 157
494 3300009148 Ga0105243_10235689 Ga0105243_102356893 157
495 3300009174 Ga0105241_10010701 Ga0105241_100107015 157
496 3300009174 Ga0105241_10045851 Ga0105241_100458515 157
497 3300009174 Ga0105241_10389013 Ga0105241_103890132 157
498 3300009176 Ga0105242_10338886 Ga0105242_103388862 157
499 3300009176 Ga0105242_12542870 Ga0105242_125428701 157
500 3300009177 Ga0105248_10192957 Ga0105248_101929572 157
501 3300009177 Ga0105248_10400727 Ga0105248_104007273 157
502 3300009177 Ga0105248_10515319 Ga0105248_105153192 157
503 3300009177 Ga0105248_10870146 Ga0105248_108701462 157
504 3300009177 Ga0105248_11718318 Ga0105248_117183181 157
505 3300009177 Ga0105248_12027421 Ga0105248_120274211 157
506 3300009545 Ga0105237_10067547 Ga0105237_100675474 157
507 3300009545 Ga0105237_10516092 Ga0105237_105160921 157
508 3300009551 Ga0105238_10009710 Ga0105238_1000971010 157
509 3300009551 Ga0105238_10441453 Ga0105238_104414531 157
510 3300009553 Ga0105249_10182578 Ga0105249_101825782 157
511 3300009553 Ga0105249_11291098 Ga0105249_112910982 157
512 3300009553 Ga0105249_11401398 Ga0105249_114013981 157
513 3300010375 Ga0105239_10158693 Ga0105239_101586933 157
514 3300010375 Ga0105239_10362876 Ga0105239_103628762 157
515 3300011119 Ga0105246_10043845 Ga0105246_100438453 157
516 3300013100 Ga0157373_10005850 Ga0157373_100058505 157
517 3300013100 Ga0157373_10006334 Ga0157373_100063344 157
518 3300013100 Ga0157373_10171260 Ga0157373_101712602 157
519 3300013102 Ga0157371_10005607 Ga0157371_100056071 157
520 3300013102 Ga0157371_10324076 Ga0157371_103240763 157
521 3300013102 Ga0157371_10514690 Ga0157371_105146902 157
522 3300013102 Ga0157371_10557897 Ga0157371_105578972 157
523 3300013102 Ga0157371_10576733 Ga0157371_105767332 157
524 3300013104 Ga0157370_10071975 Ga0157370_100719755 157
525 3300013104 Ga0157370_10148013 Ga0157370_101480134 157
526 3300013105 Ga0157369_10001474 Ga0157369_100014746 157
527 3300013105 Ga0157369_10015712 Ga0157369_100157123 157
528 3300013105 Ga0157369_10037727 Ga0157369_100377274 157
529 3300013105 Ga0157369_10191838 Ga0157369_101918384 157
530 3300013105 Ga0157369_10478723 Ga0157369_104787232 157
531 3300013296 Ga0157374_10000698 Ga0157374_100006989 157
532 3300013296 Ga0157374_10014763 Ga0157374_100147634 157
533 3300013296 Ga0157374_10036838 Ga0157374_100368385 157
534 3300013296 Ga0157374_10070589 Ga0157374_100705895 157
535 3300013297 Ga0157378_10332016 Ga0157378_103320162 157
536 3300013297 Ga0157378_10915375 Ga0157378_109153752 157
537 3300013297 Ga0157378_11277041 Ga0157378_112770412 157
538 3300013306 Ga0163162_10122792 Ga0163162_101227923 157
539 3300013307 Ga0157372_10002523 Ga0157372_100025238 157
540 3300013307 Ga0157372_10622301 Ga0157372_106223012 157
541 3300013307 Ga0157372_12305295 Ga0157372_123052952 157
542 3300013308 Ga0157375_10011577 Ga0157375_100115772 157
543 3300013308 Ga0157375_10403017 Ga0157375_104030172 157
544 3300013308 Ga0157375_10417046 Ga0157375_104170461 157
545 3300013308 Ga0157375_10514904 Ga0157375_105149042 157
546 3300013308 Ga0157375_11081159 Ga0157375_110811591 157
547 3300014325 Ga0163163_10000852 Ga0163163_100008526 157
548 3300014325 Ga0163163_10015485 Ga0163163_100154855 157
549 3300014325 Ga0163163_10091741 Ga0163163_100917413 157
550 3300014326 Ga0157380_10152611 Ga0157380_101526112 157
551 3300014326 Ga0157380_12293490 Ga0157380_122934901 157
552 3300014497 Ga0182008_10047309 Ga0182008_100473093 157
553 3300014745 Ga0157377_10002528 Ga0157377_100025285 157
554 3300014968 Ga0157379_10004302 Ga0157379_100043026 157
555 3300014968 Ga0157379_10036886 Ga0157379_100368864 157
556 3300014968 Ga0157379_10178439 Ga0157379_101784392 157
557 3300014968 Ga0157379_10811404 Ga0157379_108114042 157
558 3300014969 Ga0157376_10167952 Ga0157376_101679522 157
559 3300014969 Ga0157376_10232022 Ga0157376_102320223 157
560 3300017792 Ga0163161_10043884 Ga0163161_100438844 157
561 3300017792 Ga0163161_10046765 Ga0163161_100467653 157
562 3300017792 Ga0163161_10072779 Ga0163161_100727794 157
563 3300017792 Ga0163161_10103138 Ga0163161_101031382 157
564 3300020081 Ga0206354_11647103 Ga0206354_116471031 157
565 3300022467 Ga0224712_10105938 Ga0224712_101059382 157
566 3300025271 Ga0207666_1002584 Ga0207666_10025842 157
567 3300025315 Ga0207697_10001482 Ga0207697_100014825 157
568 3300025315 Ga0207697_10009761 Ga0207697_100097613 157
569 3300025321 Ga0207656_10020022 Ga0207656_100200222 157
570 3300025321 Ga0207656_10176159 Ga0207656_101761592 157
571 3300025321 Ga0207656_10212947 Ga0207656_102129472 157
572 3300025321 Ga0207656_10243082 Ga0207656_102430822 157
573 3300025321 Ga0207656_10277215 Ga0207656_102772152 157
574 3300025893 Ga0207682_10000518 Ga0207682_100005187 157
575 3300025893 Ga0207682_10002927 Ga0207682_100029278 157
576 3300025898 Ga0207692_10072600 Ga0207692_100726002 157
577 3300025899 Ga0207642_10004680 Ga0207642_100046805 157
578 3300025899 Ga0207642_10069775 Ga0207642_100697751 157
579 3300025899 Ga0207642_10115052 Ga0207642_101150522 157
580 3300025900 Ga0207710_10028785 Ga0207710_100287852 157
581 3300025901 Ga0207688_10002094 Ga0207688_100020948 157
582 3300025903 Ga0207680_10024589 Ga0207680_100245894 157
583 3300025903 Ga0207680_10024669 Ga0207680_100246693 157
584 3300025903 Ga0207680_10287726 Ga0207680_102877261 157
585 3300025905 Ga0207685_10044048 Ga0207685_100440482 157
586 3300025907 Ga0207645_10000039 Ga0207645_1000003959 157
587 3300025907 Ga0207645_10000331 Ga0207645_1000033134 157
588 3300025907 Ga0207645_10003755 Ga0207645_100037555 157
589 3300025907 Ga0207645_10057581 Ga0207645_100575813 157
590 3300025907 Ga0207645_10288695 Ga0207645_102886951 157
591 3300025907 Ga0207645_10393413 Ga0207645_103934132 157
592 3300025907 Ga0207645_10763146 Ga0207645_107631461 157
593 3300025908 Ga0207643_10001108 Ga0207643_100011084 157
594 3300025908 Ga0207643_10062877 Ga0207643_100628773 157
595 3300025908 Ga0207643_10508492 Ga0207643_105084921 157
596 3300025909 Ga0207705_10024299 Ga0207705_100242993 157
597 3300025909 Ga0207705_10327913 Ga0207705_103279133 157
598 3300025910 Ga0207684_10085345 Ga0207684_100853453 157
599 3300025910 Ga0207684_10202051 Ga0207684_102020513 157
600 3300025911 Ga0207654_10571162 Ga0207654_105711621 157
601 3300025912 Ga0207707_10002045 Ga0207707_100020456 157
602 3300025912 Ga0207707_10221445 Ga0207707_102214452 157
603 3300025913 Ga0207695_10092644 Ga0207695_100926443 157
604 3300025914 Ga0207671_10037783 Ga0207671_100377833 157
605 3300025915 Ga0207693_10000397 Ga0207693_1000039714 157
606 3300025916 Ga0207663_10177716 Ga0207663_101777162 157
607 3300025916 Ga0207663_10451318 Ga0207663_104513182 157
608 3300025917 Ga0207660_10125577 Ga0207660_101255773 157
609 3300025917 Ga0207660_10218345 Ga0207660_102183452 157
610 3300025918 Ga0207662_10032953 Ga0207662_100329531 157
611 3300025918 Ga0207662_10061091 Ga0207662_100610913 157
612 3300025919 Ga0207657_10005177 Ga0207657_1000517714 157
613 3300025919 Ga0207657_10034155 Ga0207657_100341552 157
614 3300025919 Ga0207657_10041948 Ga0207657_100419482 157
615 3300025920 Ga0207649_10006701 Ga0207649_100067017 157
616 3300025920 Ga0207649_10014745 Ga0207649_100147455 157
617 3300025920 Ga0207649_10024595 Ga0207649_100245953 157
618 3300025920 Ga0207649_10068989 Ga0207649_100689892 157
619 3300025920 Ga0207649_10136244 Ga0207649_101362442 157
620 3300025920 Ga0207649_10146974 Ga0207649_101469741 157
621 3300025920 Ga0207649_10176551 Ga0207649_101765512 157
622 3300025920 Ga0207649_10646525 Ga0207649_106465251 157
623 3300025921 Ga0207652_10023564 Ga0207652_100235642 157
624 3300025921 Ga0207652_10026703 Ga0207652_100267032 157
625 3300025922 Ga0207646_10189148 Ga0207646_101891481 157
626 3300025922 Ga0207646_10553736 Ga0207646_105537362 157
627 3300025923 Ga0207681_10000711 Ga0207681_100007119 157
628 3300025923 Ga0207681_10055584 Ga0207681_100555843 157
629 3300025923 Ga0207681_10252038 Ga0207681_102520382 157
630 3300025924 Ga0207694_10001561 Ga0207694_1000156113 157
631 3300025924 Ga0207694_10571877 Ga0207694_105718772 157
632 3300025925 Ga0207650_10007591 Ga0207650_100075912 157
633 3300025925 Ga0207650_10027790 Ga0207650_100277905 157
634 3300025925 Ga0207650_10121334 Ga0207650_101213342 157
635 3300025925 Ga0207650_10299946 Ga0207650_102999463 157
636 3300025926 Ga0207659_10000435 Ga0207659_1000043516 157
637 3300025926 Ga0207659_10003543 Ga0207659_100035438 157
638 3300025926 Ga0207659_10878267 Ga0207659_108782672 157
639 3300025926 Ga0207659_11035843 Ga0207659_110358432 157
640 3300025927 Ga0207687_10000188 Ga0207687_1000018827 157
641 3300025927 Ga0207687_10466569 Ga0207687_104665692 157
642 3300025928 Ga0207700_10003118 Ga0207700_100031189 157
643 3300025928 Ga0207700_10274089 Ga0207700_102740892 157
644 3300025929 Ga0207664_10008196 Ga0207664_100081968 157
645 3300025931 Ga0207644_10002082 Ga0207644_100020825 157
646 3300025931 Ga0207644_10024417 Ga0207644_100244174 157
647 3300025931 Ga0207644_10044243 Ga0207644_100442432 157
648 3300025931 Ga0207644_10044946 Ga0207644_100449463 157
649 3300025931 Ga0207644_10373939 Ga0207644_103739392 157
650 3300025932 Ga0207690_10003168 Ga0207690_100031683 157
651 3300025932 Ga0207690_10099499 Ga0207690_100994993 157
652 3300025932 Ga0207690_10105818 Ga0207690_101058183 157
653 3300025933 Ga0207706_10005905 Ga0207706_100059055 157
654 3300025933 Ga0207706_10052956 Ga0207706_100529562 157
655 3300025933 Ga0207706_10074311 Ga0207706_100743113 157
656 3300025933 Ga0207706_10620616 Ga0207706_106206162 157
657 3300025933 Ga0207706_11087651 Ga0207706_110876512 157
658 3300025934 Ga0207686_10002345 Ga0207686_100023459 157
659 3300025935 Ga0207709_10118720 Ga0207709_101187201 157
660 3300025936 Ga0207670_10008342 Ga0207670_100083424 157
661 3300025936 Ga0207670_10010906 Ga0207670_100109063 157
662 3300025936 Ga0207670_10741503 Ga0207670_107415032 157
663 3300025936 Ga0207670_11660851 Ga0207670_116608511 157
664 3300025937 Ga0207669_10005231 Ga0207669_100052315 157
665 3300025937 Ga0207669_10012973 Ga0207669_100129735 157
666 3300025937 Ga0207669_10139070 Ga0207669_101390703 157
667 3300025937 Ga0207669_10806975 Ga0207669_108069752 157
668 3300025938 Ga0207704_10003085 Ga0207704_100030858 157
669 3300025938 Ga0207704_10131659 Ga0207704_101316593 157
670 3300025939 Ga0207665_10025204 Ga0207665_100252044 157
671 3300025940 Ga0207691_10000027 Ga0207691_1000002760 157
672 3300025940 Ga0207691_10000122 Ga0207691_100001222 157
673 3300025940 Ga0207691_10010048 Ga0207691_100100487 157
674 3300025940 Ga0207691_10037836 Ga0207691_100378362 157
675 3300025941 Ga0207711_10000116 Ga0207711_1000011663 157
676 3300025941 Ga0207711_10079743 Ga0207711_100797433 157
677 3300025941 Ga0207711_10188008 Ga0207711_101880083 157
678 3300025941 Ga0207711_10377951 Ga0207711_103779513 157
679 3300025941 Ga0207711_11414844 Ga0207711_114148441 157
680 3300025942 Ga0207689_10001927 Ga0207689_100019275 157
681 3300025942 Ga0207689_10004633 Ga0207689_100046339 157
682 3300025942 Ga0207689_10057760 Ga0207689_100577604 157
683 3300025944 Ga0207661_10053518 Ga0207661_100535185 157
684 3300025944 Ga0207661_11236327 Ga0207661_112363272 157
685 3300025944 Ga0207661_11593749 Ga0207661_115937492 157
686 3300025945 Ga0207679_10005843 Ga0207679_100058435 157
687 3300025945 Ga0207679_10028613 Ga0207679_100286135 157
688 3300025945 Ga0207679_10067729 Ga0207679_100677292 157
689 3300025945 Ga0207679_10169716 Ga0207679_101697163 157
690 3300025945 Ga0207679_10238564 Ga0207679_102385642 157
691 3300025945 Ga0207679_10852541 Ga0207679_108525411 157
692 3300025949 Ga0207667_10017510 Ga0207667_100175101 157
693 3300025949 Ga0207667_10133338 Ga0207667_101333382 157
694 3300025949 Ga0207667_10186486 Ga0207667_101864862 157
695 3300025949 Ga0207667_10312139 Ga0207667_103121391 157
696 3300025960 Ga0207651_10003529 Ga0207651_100035292 157
697 3300025960 Ga0207651_10005037 Ga0207651_100050372 157
698 3300025960 Ga0207651_10018755 Ga0207651_100187554 157
699 3300025960 Ga0207651_10274450 Ga0207651_102744502 157
700 3300025961 Ga0207712_10188819 Ga0207712_101888193 157
701 3300025961 Ga0207712_10975016 Ga0207712_109750162 157
702 3300025972 Ga0207668_10001770 Ga0207668_100017708 157
703 3300025972 Ga0207668_10007868 Ga0207668_100078683 157
704 3300025972 Ga0207668_10008608 Ga0207668_100086088 157
705 3300025972 Ga0207668_10066008 Ga0207668_100660083 157
706 3300025972 Ga0207668_10140462 Ga0207668_101404623 157
707 3300025972 Ga0207668_10180606 Ga0207668_101806063 157
708 3300025981 Ga0207640_10005623 Ga0207640_100056234 157
709 3300025981 Ga0207640_10016370 Ga0207640_100163703 157
710 3300025981 Ga0207640_10022734 Ga0207640_100227345 157
711 3300025981 Ga0207640_10036621 Ga0207640_100366212 157
712 3300025981 Ga0207640_10112029 Ga0207640_101120293 157
713 3300025986 Ga0207658_10000682 Ga0207658_1000068217 157
714 3300025986 Ga0207658_10002227 Ga0207658_100022277 157
715 3300025986 Ga0207658_10006279 Ga0207658_100062798 157
716 3300025986 Ga0207658_10175734 Ga0207658_101757343 157
717 3300025986 Ga0207658_10334372 Ga0207658_103343722 157
718 3300025986 Ga0207658_10601521 Ga0207658_106015211 157
719 3300025986 Ga0207658_10693221 Ga0207658_106932212 157
720 3300026023 Ga0207677_10000598 Ga0207677_1000059819 157
721 3300026023 Ga0207677_10043540 Ga0207677_100435402 157
722 3300026023 Ga0207677_10350957 Ga0207677_103509572 157
723 3300026035 Ga0207703_10000357 Ga0207703_1000035715 157
724 3300026035 Ga0207703_10004607 Ga0207703_1000460710 157
725 3300026035 Ga0207703_10071612 Ga0207703_100716124 157
726 3300026035 Ga0207703_10312233 Ga0207703_103122333 157
727 3300026041 Ga0207639_10022564 Ga0207639_100225644 157
728 3300026041 Ga0207639_10125898 Ga0207639_101258982 157
729 3300026041 Ga0207639_10160019 Ga0207639_101600193 157
730 3300026041 Ga0207639_10403246 Ga0207639_104032462 157
731 3300026067 Ga0207678_10005532 Ga0207678_1000553214 157
732 3300026067 Ga0207678_10009735 Ga0207678_100097356 157
733 3300026067 Ga0207678_10043974 Ga0207678_100439745 157
734 3300026067 Ga0207678_10084148 Ga0207678_100841483 157
735 3300026067 Ga0207678_10215439 Ga0207678_102154391 157
736 3300026067 Ga0207678_10659258 Ga0207678_106592582 157
737 3300026067 Ga0207678_11157097 Ga0207678_111570972 157
738 3300026075 Ga0207708_10016592 Ga0207708_100165925 157
739 3300026075 Ga0207708_10641542 Ga0207708_106415421 157
740 3300026078 Ga0207702_10015836 Ga0207702_100158367 157
741 3300026078 Ga0207702_10029001 Ga0207702_100290015 157
742 3300026078 Ga0207702_10137718 Ga0207702_101377182 157
743 3300026078 Ga0207702_10417567 Ga0207702_104175672 157
744 3300026088 Ga0207641_10002436 Ga0207641_100024368 157
745 3300026088 Ga0207641_10004735 Ga0207641_100047359 157
746 3300026088 Ga0207641_10249091 Ga0207641_102490913 157
747 3300026088 Ga0207641_10276493 Ga0207641_102764931 157
748 3300026088 Ga0207641_10365834 Ga0207641_103658342 157
749 3300026088 Ga0207641_11339672 Ga0207641_113396721 157
750 3300026088 Ga0207641_11400887 Ga0207641_114008871 157
751 3300026089 Ga0207648_10000149 Ga0207648_1000014926 157
752 3300026089 Ga0207648_10006522 Ga0207648_100065229 157
753 3300026089 Ga0207648_10039889 Ga0207648_100398895 157
754 3300026089 Ga0207648_10464201 Ga0207648_104642011 157
755 3300026095 Ga0207676_10000236 Ga0207676_1000023629 157
756 3300026095 Ga0207676_10013826 Ga0207676_100138264 157
757 3300026095 Ga0207676_10026292 Ga0207676_100262923 157
758 3300026095 Ga0207676_10029837 Ga0207676_100298373 157
759 3300026095 Ga0207676_10029999 Ga0207676_100299993 157
760 3300026116 Ga0207674_10000694 Ga0207674_1000069426 157
761 3300026116 Ga0207674_10005278 Ga0207674_1000527815 157
762 3300026116 Ga0207674_10167026 Ga0207674_101670263 157
763 3300026116 Ga0207674_10173302 Ga0207674_101733022 157
764 3300026118 Ga0207675_100000871 Ga0207675_10000087112 157
765 3300026118 Ga0207675_100023629 Ga0207675_1000236293 157
766 3300026118 Ga0207675_100180865 Ga0207675_1001808652 157
767 3300026118 Ga0207675_100436814 Ga0207675_1004368142 157
768 3300026121 Ga0207683_10000005 Ga0207683_1000000524 157
769 3300026121 Ga0207683_10000061 Ga0207683_1000006163 157
770 3300026121 Ga0207683_10030161 Ga0207683_100301615 157
771 3300026121 Ga0207683_10087067 Ga0207683_100870672 157
772 3300026142 Ga0207698_10017048 Ga0207698_100170483 157
773 3300026142 Ga0207698_10021865 Ga0207698_100218655 157
774 3300026142 Ga0207698_10144635 Ga0207698_101446351 157
775 3300026142 Ga0207698_10286049 Ga0207698_102860492 157
776 3300026142 Ga0207698_10320622 Ga0207698_103206222 157
777 3300026142 Ga0207698_10535342 Ga0207698_105353421 157
778 3300027360 Ga0209969_1006601 Ga0209969_10066012 157
779 3300027526 Ga0209968_1025339 Ga0209968_10253392 157
780 3300027552 Ga0209982_1019229 Ga0209982_10192292 157
781 3300027665 Ga0209983_1088401 Ga0209983_10884012 157
782 3300027682 Ga0209971_1005246 Ga0209971_10052463 157
783 3300027695 Ga0209966_1046035 Ga0209966_10460351 157
784 3300027876 Ga0209974_10000218 Ga0209974_100002187 157
785 3300027907 Ga0207428_10723112 Ga0207428_107231121 157
786 3300028379 Ga0268266_10013747 Ga0268266_100137472 157
787 3300028379 Ga0268266_10027741 Ga0268266_100277413 157
788 3300028379 Ga0268266_10035967 Ga0268266_100359675 157
789 3300028380 Ga0268265_10061114 Ga0268265_100611143 157
790 3300028380 Ga0268265_10267511 Ga0268265_102675112 157
791 3300028381 Ga0268264_10004572 Ga0268264_100045728 157
792 3300028381 Ga0268264_10015489 Ga0268264_100154893 157
793 3300028381 Ga0268264_10023690 Ga0268264_100236905 157
794 3300028381 Ga0268264_10148586 Ga0268264_101485863 157
795 3300031548 Ga0307408_100048361 Ga0307408_1000483615 157
796 3300031548 Ga0307408_100424552 Ga0307408_1004245521 157
797 3300031731 Ga0307405_10021490 Ga0307405_100214902 157
798 3300031731 Ga0307405_11017543 Ga0307405_110175431 157
799 3300031824 Ga0307413_10013563 Ga0307413_100135633 157
800 3300031824 Ga0307413_10127914 Ga0307413_101279143 157
801 3300031852 Ga0307410_10001942 Ga0307410_100019427 157
802 3300031901 Ga0307406_10046892 Ga0307406_100468923 157
803 3300031901 Ga0307406_10074478 Ga0307406_100744783 157
804 3300031901 Ga0307406_10843815 Ga0307406_108438152 157
805 3300031903 Ga0307407_10060794 Ga0307407_100607943 157
806 3300031911 Ga0307412_10076144 Ga0307412_100761443 157
807 3300031911 Ga0307412_10280072 Ga0307412_102800721 157
808 3300031995 Ga0307409_100035247 Ga0307409_1000352472 157
809 3300031995 Ga0307409_100035342 Ga0307409_1000353422 157
810 3300032002 Ga0307416_100017374 Ga0307416_1000173743 157
811 3300032002 Ga0307416_100068575 Ga0307416_1000685752 157
812 3300032002 Ga0307416_101812549 Ga0307416_1018125492 157
813 3300032004 Ga0307414_10227770 Ga0307414_102277702 157
814 3300032004 Ga0307414_10273454 Ga0307414_102734542 157
815 3300032005 Ga0307411_10000127 Ga0307411_100001275 157
816 3300032005 Ga0307411_10273507 Ga0307411_102735072 157
817 3300035086 Ga0373934_0000450 Ga0373934_0000450_1703_2176 157
818 3300035116 Ga0373945_0084556 Ga0373945_0084556_457_930 157
819 3300035117 Ga0373953_0140864 Ga0373953_0140864_429_902 157
820 3300035118 Ga0373954_0000090 Ga0373954_0000090_11919_12392 157
821 3300035119 Ga0373956_0058736 Ga0373956_0058736_1160_1633 157
822 3300035119 Ga0373956_0066484 Ga0373956_0066484_547_1020 157
823 3300035120 Ga0373957_0001365 Ga0373957_0001365_3494_3967 157
824 3300035120 Ga0373957_0030900 Ga0373957_0030900_951_1424 157
825 3300035170 Ga0373943_0335190 Ga0373943_0335190_213_686 157
826 3300035170 Ga0373943_0456629 Ga0373943_0456629_100_573 157
827 3300035171 Ga0373946_0065115 Ga0373946_0065115_177_650 157
828 3300035172 Ga0373955_0002225 Ga0373955_0002225_1875_2348 157
829 3300035172 Ga0373955_0247100 Ga0373955_0247100_378_851 157
830 3300035691 Ga0373931_0125424 Ga0373931_0125424_118_591 157
831 3300035691 Ga0373931_0719612 Ga0373931_0719612_165_641 157
832 3300035692 Ga0373935_0662166 Ga0373935_0662166_170_643 157
833 3300035695 Ga0373927_0208736 Ga0373927_0208736_349_822 157
834 3300035724 Ga0373933_0117062 Ga0373933_0117062_730_1203 157
835 3300035725 Ga0373947_0263086 Ga0373947_0263086_61_534 157
836 3300036401 Ga0373937_0014898 Ga0373937_0014898_407_880 157
837 3300036401 Ga0373937_0016168 Ga0373937_0016168_91_564 157
838 3300036401 Ga0373937_0191538 Ga0373937_0191538_758_1231 157
839 3300036401 Ga0373937_0971568 Ga0373937_0971568_41_517 157
840 3300036401 Ga0373937_1056531 Ga0373937_1056531_40_516 157
841 3300037068 Ga0373925_0008046 Ga0373925_0008046_780_1253 157
842 3300037068 Ga0373925_0459044 Ga0373925_0459044_523_996 157
843 3300039437 Ga0436365_0678556 Ga0436365_0678556_560_1138 157
844 3300041512 Ga0451853_3036030 Ga0451853_3036030_528_1001 157
845 3300042012 Ga0439455_0152223 Ga0439455_0152223_72_548 157
846 3300044842 Ga0466957_0592391 Ga0466957_0592391_277_753 157
847 3300046454 Ga0495592_0289485 Ga0495592_0289485_231_704 157
848 3300046472 Ga0495580_0049434 Ga0495580_0049434_256_729 157
849 3300046516 Ga0495628_0258525 Ga0495628_0258525_415_888 157
850 3300046535 Ga0495586_0496317 Ga0495586_0496317_184_657 157
851 3300046539 Ga0495621_0035570 Ga0495621_0035570_714_1187 157
852 3300046559 Ga0495667_0086577 Ga0495667_0086577_386_859 157
853 3300046683 Ga0495658_0133938 Ga0495658_0133938_907_1380 157
854 3300046683 Ga0495658_0294975 Ga0495658_0294975_43_516 157
855 3300048903 Ga0496100_0105039 Ga0496100_0105039_619_1095 157
856 3300048903 Ga0496100_0385832 Ga0496100_0385832_511_984 157
857 3300048904 Ga0496101_0043820 Ga0496101_0043820_174_647 157
858 3300048905 Ga0496102_0227108 Ga0496102_0227108_128_604 157
859 3300048905 Ga0496102_0621517 Ga0496102_0621517_403_876 157
860 3300048907 Ga0496104_0004741 Ga0496104_0004741_6883_7356 157
861 3300048907 Ga0496104_0054859 Ga0496104_0054859_2328_2801 157
862 3300048908 Ga0496105_0054554 Ga0496105_0054554_2709_3182 157
863 3300048908 Ga0496105_0396843 Ga0496105_0396843_419_892 157
864 3300048909 Ga0496106_0021506 Ga0496106_0021506_1157_1633 157
865 3300048909 Ga0496106_0603830 Ga0496106_0603830_350_823 157
866 3300048909 Ga0496106_0948459 Ga0496106_0948459_171_644 157
867 3300048910 Ga0496107_0009831 Ga0496107_0009831_1427_1900 157
868 3300048910 Ga0496107_0022469 Ga0496107_0022469_771_1247 157
869 3300048911 Ga0496108_0001943 Ga0496108_0001943_13850_14323 157
870 3300048911 Ga0496108_0084716 Ga0496108_0084716_795_1268 157
871 3300048911 Ga0496108_0441073 Ga0496108_0441073_359_832 157
872 3300048912 Ga0496109_0003388 Ga0496109_0003388_69_542 157
873 3300048912 Ga0496109_0476365 Ga0496109_0476365_228_704 157
874 3300048913 Ga0496110_0006654 Ga0496110_0006654_7278_7751 157
875 3300048913 Ga0496110_1123709 Ga0496110_1123709_207_683 157
876 3300048914 Ga0496111_0032443 Ga0496111_0032443_234_707 157
877 3300048914 Ga0496111_0460520 Ga0496111_0460520_338_811 157
878 3300048915 Ga0496112_0000540 Ga0496112_0000540_10944_11417 157
879 3300048915 Ga0496112_0031075 Ga0496112_0031075_2114_2587 157
880 3300048916 Ga0496113_0065055 Ga0496113_0065055_629_1102 157
881 3300048916 Ga0496113_1335012 Ga0496113_1335012_26_499 157
882 3300048917 Ga0496114_0021658 Ga0496114_0021658_314_787 157
883 3300049586 Ga0501070_0168367 Ga0501070_0168367_914_1399 157
884 3300049588 Ga0501072_0121924 Ga0501072_0121924_569_1054 157
885 3300049589 Ga0501073_0006351 Ga0501073_0006351_145_630 157
886 3300049590 Ga0501074_0025248 Ga0501074_0025248_138_623 157
887 3300049742 Ga0501080_0003122 Ga0501080_0003122_12522_13007 157
888 3300049742 Ga0501080_0652128 Ga0501080_0652128_52_537 157
889 3300049744 Ga0501083_0016009 Ga0501083_0016009_309_794 157
890 3300049744 Ga0501083_0114806 Ga0501083_0114806_787_1272 157
891 3300049824 Ga0501045_1014422 Ga0501045_1014422_112_588 157
892 3300050511 nmdc:mga08y16_323454_c1 nmdc:mga08y16_323454_c1_752_1228 157
893 3300050511 nmdc:mga08y16_452107_c1 nmdc:mga08y16_452107_c1_223_696 157
894 3300050512 nmdc:mga0n895_691463_c1 nmdc:mga0n895_691463_c1_157_630 157
895 3300050512 nmdc:mga0n895_96099_c1 nmdc:mga0n895_96099_c1_427_906 157
896 3300050513 nmdc:mga0rr50_31760_c1 nmdc:mga0rr50_31760_c1_562_1041 157
897 3300050515 nmdc:mga0a205_4266_c1 nmdc:mga0a205_4266_c1_8512_8991 157
898 3300053078 Ga0495612_0020216 Ga0495612_0020216_881_1354 157
899 3300053085 Ga0495619_0394938 Ga0495619_0394938_216_689 157
900 3300060353 Ga0501082_1116836 Ga0501082_1116836_29_514 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

87

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8656 47 151
4uwq-assembly1.cif.gz_K crystal structure of the disulfide-linked complex of the thiosulfodyrolase soxb with the carrier-protein soxyz from thermus thermophilus 0.8381 59 155
4brj-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis t24k 0.8367 65 150
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8218 47 151
2oxh-assembly3.cif.gz_D the soxyz complex of paracoccus pantotrophus 0.8178 46 153
ID Description Score Start End Superfamily
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8656 47 151 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8218 47 151 2.60.40.2470
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8141 46 153 2.60.40.2470
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8006 46 153 2.60.40.2470
af_Q9NFV8_406_499_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.7753 65 150 2.60.40.1930
ID Description Score Start End GO Terms
AF-A0A2E9DL54-F1-model_v4 deleted 0.9025 57 150
AF-A0A7Y3IVM2-F1-model_v4 Ig-like SoxY domain-containing protein 0.9008 42 153
AF-A0A537D0A5-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.8992 41 156
AF-A0A7C5H134-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.8971 42 156
AF-A0A831W176-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.8899 75 156

Feature Viewer

pLDDT pTM Quality
72.84 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map