F485146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 900 | 307 | 900 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10316005|Ga0207683_103160053 |
| Length | 193 |
| Sequence | VDSFLRTLGHRHRSDRYWPGFVRVFKIIGLPEGDTILNAQRREVLKRGGGMSLLALLAAAGWLKPEDALAADWNKAAFETKSVEDTVKALNGSAPTASKDIVFFSTPDIAENVAVVPIGITSQVPNTQSIAILVEKNPNMLAAVFDVPAGTDPSLSTRIKMGQSSNVYALVKADGKYFVASKEIKVTLGGCGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 250 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 4.11 |
| Rhizosphere | 94.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1031739 | 3300001976 | Bacteria | 698 |
| 2 | JGI24746J21847_1017895 | 3300001977 | Bacteria | 1005 |
| 3 | JGI24743J22301_10058372 | 3300001991 | Bacteria | 793 |
| 4 | JGI24749J21850_1007123 | 3300002076 | Bacteria | 1556 |
| 5 | JGI24035J26624_1017633 | 3300002126 | Bacteria | 741 |
| 6 | Ga0065712_10106723 | 3300005290 | Bacteria | 1903 |
| 7 | Ga0065715_10467076 | 3300005293 | Bacteria | 796 |
| 8 | Ga0065715_10604844 | 3300005293 | Bacteria | 696 |
| 9 | Ga0070658_10040615 | 3300005327 | Bacteria | 3754 |
| 10 | Ga0070658_10049587 | 3300005327 | Bacteria | 3401 |
| 11 | Ga0070658_10912505 | 3300005327 | Bacteria | 764 |
| 12 | Ga0070676_10001017 | 3300005328 | Bacteria | 13919 |
| 13 | Ga0070676_10027056 | 3300005328 | Bacteria | 3250 |
| 14 | Ga0070676_10101032 | 3300005328 | Bacteria | 1781 |
| 15 | Ga0070676_10376505 | 3300005328 | Bacteria | 982 |
| 16 | Ga0070683_100053239 | 3300005329 | Bacteria | 3750 |
| 17 | Ga0070683_100213175 | 3300005329 | Bacteria | 1835 |
| 18 | Ga0070683_100726608 | 3300005329 | Bacteria | 951 |
| 19 | Ga0070683_100948042 | 3300005329 | Bacteria | 826 |
| 20 | Ga0070690_100000521 | 3300005330 | Bacteria | 19293 |
| 21 | Ga0070690_100012188 | 3300005330 | Bacteria | 5054 |
| 22 | Ga0070690_100029269 | 3300005330 | Bacteria | 3415 |
| 23 | Ga0070670_100025429 | 3300005331 | Bacteria | 5095 |
| 24 | Ga0070670_100039751 | 3300005331 | Bacteria | 4045 |
| 25 | Ga0070670_100040658 | 3300005331 | Bacteria | 3996 |
| 26 | Ga0070670_100058598 | 3300005331 | Bacteria | 3306 |
| 27 | Ga0070670_100105401 | 3300005331 | Bacteria | 2429 |
| 28 | Ga0070677_10000411 | 3300005333 | Bacteria | 14902 |
| 29 | Ga0070677_10025678 | 3300005333 | Bacteria | 2201 |
| 30 | Ga0068869_100003165 | 3300005334 | Bacteria | 10042 |
| 31 | Ga0068869_100035164 | 3300005334 | Bacteria | 3549 |
| 32 | Ga0068869_100091814 | 3300005334 | Bacteria | 2284 |
| 33 | Ga0068869_100107766 | 3300005334 | Bacteria | 2116 |
| 34 | Ga0070666_10014579 | 3300005335 | Bacteria | 5006 |
| 35 | Ga0070666_10027874 | 3300005335 | Bacteria | 3703 |
| 36 | Ga0070682_100090603 | 3300005337 | Bacteria | 2000 |
| 37 | Ga0068868_100071048 | 3300005338 | Bacteria | 2776 |
| 38 | Ga0068868_100078460 | 3300005338 | Bacteria | 2644 |
| 39 | Ga0068868_100143733 | 3300005338 | Bacteria | 1960 |
| 40 | Ga0068868_100174457 | 3300005338 | Bacteria | 1781 |
| 41 | Ga0070660_100005982 | 3300005339 | Bacteria | 8410 |
| 42 | Ga0070660_100018256 | 3300005339 | Bacteria | 5123 |
| 43 | Ga0070660_100019235 | 3300005339 | Bacteria | 5000 |
| 44 | Ga0070660_100093407 | 3300005339 | Bacteria | 2375 |
| 45 | Ga0070660_100335830 | 3300005339 | Bacteria | 1243 |
| 46 | Ga0070660_100414532 | 3300005339 | Bacteria | 1115 |
| 47 | Ga0070689_100001865 | 3300005340 | Bacteria | 13584 |
| 48 | Ga0070689_100022724 | 3300005340 | Bacteria | 4686 |
| 49 | Ga0070689_100051703 | 3300005340 | Bacteria | 3176 |
| 50 | Ga0070689_101487877 | 3300005340 | Bacteria | 613 |
| 51 | Ga0070687_100021167 | 3300005343 | Bacteria | 3052 |
| 52 | Ga0070687_100055680 | 3300005343 | Bacteria | 2066 |
| 53 | Ga0070661_100000486 | 3300005344 | Bacteria | 30405 |
| 54 | Ga0070661_100014142 | 3300005344 | Bacteria | 5622 |
| 55 | Ga0070661_100019203 | 3300005344 | Bacteria | 4868 |
| 56 | Ga0070661_100106760 | 3300005344 | Bacteria | 2088 |
| 57 | Ga0070661_100140078 | 3300005344 | Bacteria | 1822 |
| 58 | Ga0070661_100587866 | 3300005344 | Bacteria | 899 |
| 59 | Ga0070661_100819108 | 3300005344 | Bacteria | 765 |
| 60 | Ga0070661_101344791 | 3300005344 | Bacteria | 600 |
| 61 | Ga0070692_10178983 | 3300005345 | Bacteria | 1228 |
| 62 | Ga0070668_100001274 | 3300005347 | Bacteria | 18003 |
| 63 | Ga0070668_100014576 | 3300005347 | Bacteria | 5875 |
| 64 | Ga0070668_100019216 | 3300005347 | Bacteria | 5140 |
| 65 | Ga0070668_100073075 | 3300005347 | Bacteria | 2673 |
| 66 | Ga0070668_100175533 | 3300005347 | Bacteria | 1747 |
| 67 | Ga0070668_100337286 | 3300005347 | Bacteria | 1273 |
| 68 | Ga0070669_100000411 | 3300005353 | Bacteria | 32862 |
| 69 | Ga0070669_100220920 | 3300005353 | Bacteria | 1498 |
| 70 | Ga0070669_100490406 | 3300005353 | Bacteria | 1018 |
| 71 | Ga0070675_100018529 | 3300005354 | Bacteria | 5542 |
| 72 | Ga0070675_100023462 | 3300005354 | Bacteria | 4934 |
| 73 | Ga0070675_100525094 | 3300005354 | Bacteria | 1068 |
| 74 | Ga0070675_100608552 | 3300005354 | Bacteria | 991 |
| 75 | Ga0070675_100664711 | 3300005354 | Bacteria | 947 |
| 76 | Ga0070671_100000564 | 3300005355 | Bacteria | 26255 |
| 77 | Ga0070671_100011838 | 3300005355 | Bacteria | 7018 |
| 78 | Ga0070671_100012159 | 3300005355 | Bacteria | 6927 |
| 79 | Ga0070671_100045506 | 3300005355 | Bacteria | 3648 |
| 80 | Ga0070671_100111358 | 3300005355 | Bacteria | 2299 |
| 81 | Ga0070671_100295150 | 3300005355 | Bacteria | 1380 |
| 82 | Ga0070671_100667769 | 3300005355 | Bacteria | 900 |
| 83 | Ga0070671_101016832 | 3300005355 | Bacteria | 726 |
| 84 | Ga0070674_100004476 | 3300005356 | Bacteria | 7975 |
| 85 | Ga0070674_100165018 | 3300005356 | Bacteria | 1684 |
| 86 | Ga0070674_100320869 | 3300005356 | Bacteria | 1242 |
| 87 | Ga0070674_101608452 | 3300005356 | Bacteria | 586 |
| 88 | Ga0070673_100001499 | 3300005364 | Bacteria | 13706 |
| 89 | Ga0070673_100016936 | 3300005364 | Bacteria | 5168 |
| 90 | Ga0070673_100030647 | 3300005364 | Bacteria | 4029 |
| 91 | Ga0070673_100056728 | 3300005364 | Bacteria | 3091 |
| 92 | Ga0070673_100113023 | 3300005364 | Bacteria | 2255 |
| 93 | Ga0070673_100130389 | 3300005364 | Bacteria | 2108 |
| 94 | Ga0070688_100001247 | 3300005365 | Bacteria | 12689 |
| 95 | Ga0070688_100042516 | 3300005365 | Bacteria | 2796 |
| 96 | Ga0070688_100082815 | 3300005365 | Bacteria | 2080 |
| 97 | Ga0070688_100335349 | 3300005365 | Bacteria | 1103 |
| 98 | Ga0070688_100694049 | 3300005365 | Bacteria | 788 |
| 99 | Ga0070659_100025962 | 3300005366 | Bacteria | 4506 |
| 100 | Ga0070659_100143240 | 3300005366 | Bacteria | 1946 |
| 101 | Ga0070659_100169921 | 3300005366 | Bacteria | 1785 |
| 102 | Ga0070659_100170222 | 3300005366 | Bacteria | 1784 |
| 103 | Ga0070659_100245103 | 3300005366 | Bacteria | 1484 |
| 104 | Ga0070659_100257041 | 3300005366 | Bacteria | 1449 |
| 105 | Ga0070659_100600200 | 3300005366 | Bacteria | 946 |
| 106 | Ga0070667_100002084 | 3300005367 | Bacteria | 17667 |
| 107 | Ga0070667_100002948 | 3300005367 | Bacteria | 14624 |
| 108 | Ga0070667_100099238 | 3300005367 | Bacteria | 2514 |
| 109 | Ga0070667_100124434 | 3300005367 | Bacteria | 2246 |
| 110 | Ga0070667_100139752 | 3300005367 | Bacteria | 2120 |
| 111 | Ga0070667_100280319 | 3300005367 | Bacteria | 1496 |
| 112 | Ga0070667_101439158 | 3300005367 | Bacteria | 647 |
| 113 | Ga0070703_10063910 | 3300005406 | Bacteria | 1211 |
| 114 | Ga0070709_10525859 | 3300005434 | Bacteria | 902 |
| 115 | Ga0070709_10608395 | 3300005434 | Bacteria | 842 |
| 116 | Ga0070714_100013470 | 3300005435 | Bacteria | 6554 |
| 117 | Ga0070713_100005194 | 3300005436 | Bacteria | 8866 |
| 118 | Ga0070713_101116744 | 3300005436 | Bacteria | 762 |
| 119 | Ga0070710_10005942 | 3300005437 | Bacteria | 5828 |
| 120 | Ga0070701_10011424 | 3300005438 | Bacteria | 3969 |
| 121 | Ga0070701_10127725 | 3300005438 | Bacteria | 1441 |
| 122 | Ga0070701_10835550 | 3300005438 | Bacteria | 631 |
| 123 | Ga0070711_100004130 | 3300005439 | Bacteria | 8535 |
| 124 | Ga0070705_100178956 | 3300005440 | Unclassified | 1435 |
| 125 | Ga0070700_100025803 | 3300005441 | Bacteria | 3464 |
| 126 | Ga0070694_100489890 | 3300005444 | Bacteria | 977 |
| 127 | Ga0070694_101440884 | 3300005444 | Bacteria | 582 |
| 128 | Ga0070663_100004490 | 3300005455 | Bacteria | 8216 |
| 129 | Ga0070663_100078580 | 3300005455 | Bacteria | 2419 |
| 130 | Ga0070663_100226055 | 3300005455 | Bacteria | 1471 |
| 131 | Ga0070663_100492323 | 3300005455 | Bacteria | 1017 |
| 132 | Ga0070663_100620130 | 3300005455 | Unclassified | 912 |
| 133 | Ga0070678_100000428 | 3300005456 | Bacteria | 19876 |
| 134 | Ga0070678_100000948 | 3300005456 | Bacteria | 14931 |
| 135 | Ga0070678_100009922 | 3300005456 | Bacteria | 5789 |
| 136 | Ga0070678_100081000 | 3300005456 | Bacteria | 2460 |
| 137 | Ga0070662_100001187 | 3300005457 | Bacteria | 15980 |
| 138 | Ga0070662_100041275 | 3300005457 | Bacteria | 3291 |
| 139 | Ga0070662_100202720 | 3300005457 | Bacteria | 1575 |
| 140 | Ga0070662_100304460 | 3300005457 | Bacteria | 1296 |
| 141 | Ga0070662_100919305 | 3300005457 | Bacteria | 747 |
| 142 | Ga0070681_10003192 | 3300005458 | Bacteria | 15263 |
| 143 | Ga0070681_10030700 | 3300005458 | Bacteria | 5392 |
| 144 | Ga0070681_10188909 | 3300005458 | Bacteria | 1980 |
| 145 | Ga0070681_10194030 | 3300005458 | Bacteria | 1950 |
| 146 | Ga0070681_10504570 | 3300005458 | Bacteria | 1123 |
| 147 | Ga0070681_10811526 | 3300005458 | Bacteria | 853 |
| 148 | Ga0068867_100001129 | 3300005459 | Bacteria | 18260 |
| 149 | Ga0068867_100065181 | 3300005459 | Bacteria | 2710 |
| 150 | Ga0068867_100123999 | 3300005459 | Bacteria | 2000 |
| 151 | Ga0068867_100232665 | 3300005459 | Bacteria | 1490 |
| 152 | Ga0068867_100388882 | 3300005459 | Bacteria | 1173 |
| 153 | Ga0068867_101328521 | 3300005459 | Bacteria | 664 |
| 154 | Ga0070685_10002459 | 3300005466 | Bacteria | 9508 |
| 155 | Ga0070685_10010782 | 3300005466 | Bacteria | 4760 |
| 156 | Ga0070706_100094756 | 3300005467 | Bacteria | 2770 |
| 157 | Ga0070706_100214599 | 3300005467 | Bacteria | 1796 |
| 158 | Ga0070707_100845133 | 3300005468 | Bacteria | 879 |
| 159 | Ga0070707_101034481 | 3300005468 | Bacteria | 787 |
| 160 | Ga0070698_100035950 | 3300005471 | Bacteria | 5120 |
| 161 | Ga0070699_100406334 | 3300005518 | Bacteria | 1232 |
| 162 | Ga0070679_100014348 | 3300005530 | Bacteria | 7609 |
| 163 | Ga0070679_100070126 | 3300005530 | Bacteria | 3497 |
| 164 | Ga0070679_100102796 | 3300005530 | Bacteria | 2844 |
| 165 | Ga0070679_100159282 | 3300005530 | Bacteria | 2232 |
| 166 | Ga0070679_100332826 | 3300005530 | Bacteria | 1467 |
| 167 | Ga0070679_100405991 | 3300005530 | Bacteria | 1308 |
| 168 | Ga0070679_100509829 | 3300005530 | Bacteria | 1147 |
| 169 | Ga0070684_100021273 | 3300005535 | Bacteria | 5394 |
| 170 | Ga0070684_100114905 | 3300005535 | Bacteria | 2416 |
| 171 | Ga0070684_100129561 | 3300005535 | Bacteria | 2275 |
| 172 | Ga0070684_100368932 | 3300005535 | Bacteria | 1322 |
| 173 | Ga0070684_100818708 | 3300005535 | Unclassified | 871 |
| 174 | Ga0070697_100016402 | 3300005536 | Bacteria | 5824 |
| 175 | Ga0070697_100431872 | 3300005536 | Bacteria | 1145 |
| 176 | Ga0068853_100003043 | 3300005539 | Bacteria | 12805 |
| 177 | Ga0068853_100030015 | 3300005539 | Bacteria | 4589 |
| 178 | Ga0068853_100168009 | 3300005539 | Bacteria | 1983 |
| 179 | Ga0068853_100224909 | 3300005539 | Bacteria | 1715 |
| 180 | Ga0068853_100305460 | 3300005539 | Bacteria | 1472 |
| 181 | Ga0068853_100365146 | 3300005539 | Bacteria | 1346 |
| 182 | Ga0068853_100493124 | 3300005539 | Bacteria | 1156 |
| 183 | Ga0068853_100616914 | 3300005539 | Bacteria | 1031 |
| 184 | Ga0068853_100877381 | 3300005539 | Bacteria | 861 |
| 185 | Ga0068853_100909222 | 3300005539 | Bacteria | 845 |
| 186 | Ga0070672_100005917 | 3300005543 | Bacteria | 8158 |
| 187 | Ga0070672_100016247 | 3300005543 | Bacteria | 5324 |
| 188 | Ga0070672_100034147 | 3300005543 | Bacteria | 3859 |
| 189 | Ga0070672_100240311 | 3300005543 | Bacteria | 1523 |
| 190 | Ga0070686_100049768 | 3300005544 | Bacteria | 2660 |
| 191 | Ga0070686_100178861 | 3300005544 | Bacteria | 1506 |
| 192 | Ga0070695_101052251 | 3300005545 | Unclassified | 664 |
| 193 | Ga0070696_100487323 | 3300005546 | Bacteria | 979 |
| 194 | Ga0070696_101635060 | 3300005546 | Unclassified | 554 |
| 195 | Ga0070693_100006888 | 3300005547 | Bacteria | 5525 |
| 196 | Ga0070693_100025867 | 3300005547 | Bacteria | 3161 |
| 197 | Ga0070693_100034500 | 3300005547 | Bacteria | 2800 |
| 198 | Ga0070693_100270363 | 3300005547 | Bacteria | 1134 |
| 199 | Ga0070693_100350170 | 3300005547 | Bacteria | 1011 |
| 200 | Ga0070665_100005926 | 3300005548 | Bacteria | 12520 |
| 201 | Ga0070665_100012339 | 3300005548 | Bacteria | 8611 |
| 202 | Ga0070665_100036448 | 3300005548 | Bacteria | 4947 |
| 203 | Ga0070665_100168948 | 3300005548 | Bacteria | 2189 |
| 204 | Ga0070665_100754768 | 3300005548 | Bacteria | 986 |
| 205 | Ga0070704_100005301 | 3300005549 | Bacteria | 7513 |
| 206 | Ga0070704_100536136 | 3300005549 | Bacteria | 1021 |
| 207 | Ga0068855_100001032 | 3300005563 | Bacteria | 34674 |
| 208 | Ga0068855_100016905 | 3300005563 | Bacteria | 8773 |
| 209 | Ga0068855_100030675 | 3300005563 | Bacteria | 6427 |
| 210 | Ga0068855_100034796 | 3300005563 | Bacteria | 6004 |
| 211 | Ga0068855_100169283 | 3300005563 | Bacteria | 2475 |
| 212 | Ga0068855_100225886 | 3300005563 | Bacteria | 2098 |
| 213 | Ga0068855_100769255 | 3300005563 | Bacteria | 1025 |
| 214 | Ga0068855_101704408 | 3300005563 | Bacteria | 642 |
| 215 | Ga0070664_100002383 | 3300005564 | Bacteria | 15096 |
| 216 | Ga0070664_100014257 | 3300005564 | Bacteria | 6483 |
| 217 | Ga0070664_100014914 | 3300005564 | Bacteria | 6340 |
| 218 | Ga0070664_100031582 | 3300005564 | Bacteria | 4426 |
| 219 | Ga0070664_100072810 | 3300005564 | Bacteria | 2947 |
| 220 | Ga0070664_100113220 | 3300005564 | Bacteria | 2370 |
| 221 | Ga0070664_100491782 | 3300005564 | Bacteria | 1130 |
| 222 | Ga0070664_100811740 | 3300005564 | Bacteria | 875 |
| 223 | Ga0070664_101233277 | 3300005564 | Bacteria | 706 |
| 224 | Ga0070664_101488284 | 3300005564 | Bacteria | 640 |
| 225 | Ga0068857_100002349 | 3300005577 | Bacteria | 15406 |
| 226 | Ga0068857_100054191 | 3300005577 | Bacteria | 3558 |
| 227 | Ga0068857_100231895 | 3300005577 | Bacteria | 1688 |
| 228 | Ga0068854_100004207 | 3300005578 | Bacteria | 9063 |
| 229 | Ga0068854_100012441 | 3300005578 | Bacteria | 5572 |
| 230 | Ga0068854_100155845 | 3300005578 | Bacteria | 1765 |
| 231 | Ga0068854_100231632 | 3300005578 | Bacteria | 1466 |
| 232 | Ga0068856_100023479 | 3300005614 | Bacteria | 5996 |
| 233 | Ga0068856_100063611 | 3300005614 | Bacteria | 3645 |
| 234 | Ga0068856_100167707 | 3300005614 | Bacteria | 2207 |
| 235 | Ga0068856_100237629 | 3300005614 | Bacteria | 1837 |
| 236 | Ga0068856_100437096 | 3300005614 | Bacteria | 1329 |
| 237 | Ga0068856_100734809 | 3300005614 | Bacteria | 1007 |
| 238 | Ga0070702_100005551 | 3300005615 | Bacteria | 5891 |
| 239 | Ga0070702_100128666 | 3300005615 | Bacteria | 1596 |
| 240 | Ga0068852_100001314 | 3300005616 | Bacteria | 16622 |
| 241 | Ga0068852_100002732 | 3300005616 | Bacteria | 12206 |
| 242 | Ga0068852_100022936 | 3300005616 | Bacteria | 5015 |
| 243 | Ga0068852_100072754 | 3300005616 | Bacteria | 3022 |
| 244 | Ga0068852_100350950 | 3300005616 | Bacteria | 1440 |
| 245 | Ga0068852_100766542 | 3300005616 | Bacteria | 977 |
| 246 | Ga0068852_100775447 | 3300005616 | Bacteria | 972 |
| 247 | Ga0068859_100000594 | 3300005617 | Bacteria | 36146 |
| 248 | Ga0068859_100003144 | 3300005617 | Bacteria | 16788 |
| 249 | Ga0068859_100068504 | 3300005617 | Bacteria | 3583 |
| 250 | Ga0068859_100317459 | 3300005617 | Bacteria | 1652 |
| 251 | Ga0068864_100015761 | 3300005618 | Bacteria | 6287 |
| 252 | Ga0068864_100044410 | 3300005618 | Bacteria | 3809 |
| 253 | Ga0068864_100098010 | 3300005618 | Bacteria | 2596 |
| 254 | Ga0068864_100136959 | 3300005618 | Bacteria | 2205 |
| 255 | Ga0068864_100324793 | 3300005618 | Bacteria | 1446 |
| 256 | Ga0068864_100334895 | 3300005618 | Bacteria | 1425 |
| 257 | Ga0068864_100448504 | 3300005618 | Bacteria | 1233 |
| 258 | Ga0068864_100907797 | 3300005618 | Bacteria | 870 |
| 259 | Ga0068866_10002216 | 3300005718 | Bacteria | 8066 |
| 260 | Ga0068866_10047145 | 3300005718 | Bacteria | 2171 |
| 261 | Ga0068866_10093823 | 3300005718 | Bacteria | 1640 |
| 262 | Ga0068866_10131084 | 3300005718 | Bacteria | 1426 |
| 263 | Ga0068861_100018747 | 3300005719 | Bacteria | 4933 |
| 264 | Ga0068861_100135806 | 3300005719 | Bacteria | 2001 |
| 265 | Ga0068861_100282136 | 3300005719 | Bacteria | 1431 |
| 266 | Ga0068861_101277487 | 3300005719 | Bacteria | 713 |
| 267 | Ga0068851_10006565 | 3300005834 | Bacteria | 5318 |
| 268 | Ga0068851_10034062 | 3300005834 | Bacteria | 2541 |
| 269 | Ga0068851_10047130 | 3300005834 | Bacteria | 2182 |
| 270 | Ga0068851_10054503 | 3300005834 | Bacteria | 2037 |
| 271 | Ga0068851_10068990 | 3300005834 | Bacteria | 1825 |
| 272 | Ga0068851_10202659 | 3300005834 | Bacteria | 1108 |
| 273 | Ga0068851_10275209 | 3300005834 | Bacteria | 961 |
| 274 | Ga0068870_10002817 | 3300005840 | Bacteria | 7316 |
| 275 | Ga0068870_10015713 | 3300005840 | Bacteria | 3599 |
| 276 | Ga0068870_10594559 | 3300005840 | Bacteria | 751 |
| 277 | Ga0068863_100004302 | 3300005841 | Bacteria | 14024 |
| 278 | Ga0068863_100017463 | 3300005841 | Bacteria | 6879 |
| 279 | Ga0068863_100020650 | 3300005841 | Bacteria | 6292 |
| 280 | Ga0068863_100216115 | 3300005841 | Unclassified | 1846 |
| 281 | Ga0068863_100779628 | 3300005841 | Bacteria | 953 |
| 282 | Ga0068863_101460989 | 3300005841 | Bacteria | 692 |
| 283 | Ga0068858_100002565 | 3300005842 | Bacteria | 18308 |
| 284 | Ga0068858_100003040 | 3300005842 | Bacteria | 16816 |
| 285 | Ga0068858_100019871 | 3300005842 | Bacteria | 6280 |
| 286 | Ga0068858_100085273 | 3300005842 | Bacteria | 2938 |
| 287 | Ga0068858_100321206 | 3300005842 | Bacteria | 1480 |
| 288 | Ga0068858_101166469 | 3300005842 | Bacteria | 757 |
| 289 | Ga0068860_100002537 | 3300005843 | Bacteria | 19105 |
| 290 | Ga0068860_100065222 | 3300005843 | Bacteria | 3458 |
| 291 | Ga0068860_100079082 | 3300005843 | Bacteria | 3127 |
| 292 | Ga0068860_100103291 | 3300005843 | Bacteria | 2720 |
| 293 | Ga0068860_100125523 | 3300005843 | Bacteria | 2459 |
| 294 | Ga0068862_100068229 | 3300005844 | Bacteria | 3067 |
| 295 | Ga0068862_100135274 | 3300005844 | Bacteria | 2184 |
| 296 | Ga0068862_100454889 | 3300005844 | Bacteria | 1207 |
| 297 | Ga0068862_100715505 | 3300005844 | Bacteria | 971 |
| 298 | Ga0068862_100739427 | 3300005844 | Bacteria | 956 |
| 299 | Ga0081539_10203957 | 3300005985 | Bacteria | 911 |
| 300 | Ga0070717_10425171 | 3300006028 | Bacteria | 1195 |
| 301 | Ga0075364_10019352 | 3300006051 | Bacteria | 4273 |
| 302 | Ga0070715_10689223 | 3300006163 | Bacteria | 609 |
| 303 | Ga0070716_100013908 | 3300006173 | Bacteria | 4112 |
| 304 | Ga0070716_100038854 | 3300006173 | Bacteria | 2637 |
| 305 | Ga0070716_100252163 | 3300006173 | Bacteria | 1203 |
| 306 | Ga0070712_100002152 | 3300006175 | Bacteria | 12120 |
| 307 | Ga0075369_10003906 | 3300006186 | Bacteria | 5466 |
| 308 | Ga0075366_10022788 | 3300006195 | Bacteria | 3646 |
| 309 | Ga0097621_100001502 | 3300006237 | Bacteria | 15972 |
| 310 | Ga0097621_100005226 | 3300006237 | Bacteria | 9130 |
| 311 | Ga0097621_101562817 | 3300006237 | Bacteria | 627 |
| 312 | Ga0068871_100009028 | 3300006358 | Bacteria | 7201 |
| 313 | Ga0068871_100687117 | 3300006358 | Bacteria | 937 |
| 314 | Ga0075431_100784109 | 3300006847 | Bacteria | 927 |
| 315 | Ga0075433_10033447 | 3300006852 | Bacteria | 4408 |
| 316 | Ga0075434_100015476 | 3300006871 | Bacteria | 7316 |
| 317 | Ga0068865_100002771 | 3300006881 | Bacteria | 10413 |
| 318 | Ga0068865_100341340 | 3300006881 | Bacteria | 1210 |
| 319 | Ga0075436_100004627 | 3300006914 | Bacteria | 9429 |
| 320 | Ga0075436_100018047 | 3300006914 | Bacteria | 4832 |
| 321 | Ga0075436_100042207 | 3300006914 | Bacteria | 3145 |
| 322 | Ga0075436_100080231 | 3300006914 | Bacteria | 2261 |
| 323 | Ga0075436_100231125 | 3300006914 | Bacteria | 1314 |
| 324 | Ga0097620_100000594 | 3300006931 | Bacteria | 36146 |
| 325 | Ga0097620_100003144 | 3300006931 | Bacteria | 16788 |
| 326 | Ga0097620_100068504 | 3300006931 | Bacteria | 3583 |
| 327 | Ga0097620_100317431 | 3300006931 | Bacteria | 1652 |
| 328 | Ga0075435_100009247 | 3300007076 | Bacteria | 7119 |
| 329 | Ga0075435_100354881 | 3300007076 | Bacteria | 1257 |
| 330 | Ga0075435_100693867 | 3300007076 | Bacteria | 885 |
| 331 | Ga0099794_10000530 | 3300007265 | Bacteria | 12764 |
| 332 | Ga0099794_10014216 | 3300007265 | Bacteria | 3482 |
| 333 | Ga0099795_10079738 | 3300007788 | Bacteria | 1250 |
| 334 | Ga0105250_10366570 | 3300009092 | Bacteria | 633 |
| 335 | Ga0105240_10002122 | 3300009093 | Bacteria | 32405 |
| 336 | Ga0105240_10002895 | 3300009093 | Bacteria | 27079 |
| 337 | Ga0105240_10071509 | 3300009093 | Bacteria | 4290 |
| 338 | Ga0111539_10099260 | 3300009094 | Bacteria | 3420 |
| 339 | Ga0111539_10265048 | 3300009094 | Bacteria | 2000 |
| 340 | Ga0105245_10226190 | 3300009098 | Bacteria | 1807 |
| 341 | Ga0105245_10248045 | 3300009098 | Bacteria | 1729 |
| 342 | Ga0105245_10501206 | 3300009098 | Bacteria | 1230 |
| 343 | Ga0105247_10047360 | 3300009101 | Bacteria | 2639 |
| 344 | Ga0114129_10398433 | 3300009147 | Bacteria | 1814 |
| 345 | Ga0114129_10799654 | 3300009147 | Bacteria | 1203 |
| 346 | Ga0105243_10147437 | 3300009148 | Bacteria | 2015 |
| 347 | Ga0105243_10235689 | 3300009148 | Bacteria | 1626 |
| 348 | Ga0105241_10010701 | 3300009174 | Bacteria | 6731 |
| 349 | Ga0105241_10010941 | 3300009174 | Bacteria | 6654 |
| 350 | Ga0105241_10045851 | 3300009174 | Bacteria | 3318 |
| 351 | Ga0105241_10389013 | 3300009174 | Bacteria | 1220 |
| 352 | Ga0105242_10338886 | 3300009176 | Bacteria | 1385 |
| 353 | Ga0105242_12542870 | 3300009176 | Unclassified | 560 |
| 354 | Ga0105248_10002843 | 3300009177 | Bacteria | 19207 |
| 355 | Ga0105248_10192957 | 3300009177 | Bacteria | 2295 |
| 356 | Ga0105248_10400727 | 3300009177 | Bacteria | 1545 |
| 357 | Ga0105248_10515319 | 3300009177 | Bacteria | 1348 |
| 358 | Ga0105248_10870146 | 3300009177 | Bacteria | 1017 |
| 359 | Ga0105248_11718318 | 3300009177 | Bacteria | 711 |
| 360 | Ga0105248_12027421 | 3300009177 | Bacteria | 654 |
| 361 | Ga0105237_10067547 | 3300009545 | Bacteria | 3569 |
| 362 | Ga0105237_10516092 | 3300009545 | Bacteria | 1201 |
| 363 | Ga0105238_10009710 | 3300009551 | Bacteria | 9634 |
| 364 | Ga0105238_10020415 | 3300009551 | Bacteria | 6744 |
| 365 | Ga0105238_10441453 | 3300009551 | Bacteria | 1298 |
| 366 | Ga0105249_10112993 | 3300009553 | Bacteria | 2569 |
| 367 | Ga0105249_10182578 | 3300009553 | Bacteria | 2042 |
| 368 | Ga0105249_11291098 | 3300009553 | Bacteria | 801 |
| 369 | Ga0105249_11401398 | 3300009553 | Bacteria | 771 |
| 370 | Ga0099796_10048396 | 3300010159 | Bacteria | 1466 |
| 371 | Ga0105239_10158693 | 3300010375 | Bacteria | 2527 |
| 372 | Ga0105239_10362876 | 3300010375 | Bacteria | 1636 |
| 373 | Ga0105246_10043845 | 3300011119 | Bacteria | 3037 |
| 374 | Ga0157373_10005850 | 3300013100 | Bacteria | 9202 |
| 375 | Ga0157373_10006334 | 3300013100 | Bacteria | 8843 |
| 376 | Ga0157373_10171260 | 3300013100 | Bacteria | 1528 |
| 377 | Ga0157371_10005607 | 3300013102 | Bacteria | 10554 |
| 378 | Ga0157371_10247192 | 3300013102 | Bacteria | 1284 |
| 379 | Ga0157371_10324076 | 3300013102 | Bacteria | 1118 |
| 380 | Ga0157371_10514690 | 3300013102 | Bacteria | 885 |
| 381 | Ga0157371_10557897 | 3300013102 | Bacteria | 849 |
| 382 | Ga0157371_10576733 | 3300013102 | Bacteria | 835 |
| 383 | Ga0157370_10007974 | 3300013104 | Bacteria | 11474 |
| 384 | Ga0157370_10010466 | 3300013104 | Bacteria | 9769 |
| 385 | Ga0157370_10071975 | 3300013104 | Bacteria | 3262 |
| 386 | Ga0157370_10148013 | 3300013104 | Bacteria | 2186 |
| 387 | Ga0157370_10206317 | 3300013104 | Bacteria | 1822 |
| 388 | Ga0157369_10001474 | 3300013105 | Bacteria | 28847 |
| 389 | Ga0157369_10015712 | 3300013105 | Bacteria | 8530 |
| 390 | Ga0157369_10037727 | 3300013105 | Bacteria | 5289 |
| 391 | Ga0157369_10191838 | 3300013105 | Bacteria | 2147 |
| 392 | Ga0157369_10319921 | 3300013105 | Bacteria | 1613 |
| 393 | Ga0157369_10478723 | 3300013105 | Bacteria | 1288 |
| 394 | Ga0157369_11762387 | 3300013105 | Bacteria | 629 |
| 395 | Ga0157374_10000698 | 3300013296 | Bacteria | 29556 |
| 396 | Ga0157374_10002044 | 3300013296 | Bacteria | 16961 |
| 397 | Ga0157374_10014763 | 3300013296 | Bacteria | 6839 |
| 398 | Ga0157374_10036838 | 3300013296 | Bacteria | 4484 |
| 399 | Ga0157374_10070589 | 3300013296 | Bacteria | 3292 |
| 400 | Ga0157374_10810701 | 3300013296 | Bacteria | 952 |
| 401 | Ga0157378_10332016 | 3300013297 | Bacteria | 1480 |
| 402 | Ga0157378_10915375 | 3300013297 | Bacteria | 908 |
| 403 | Ga0157378_11277041 | 3300013297 | Bacteria | 775 |
| 404 | Ga0163162_10003371 | 3300013306 | Bacteria | 15289 |
| 405 | Ga0163162_10122792 | 3300013306 | Bacteria | 2702 |
| 406 | Ga0163162_10428948 | 3300013306 | Bacteria | 1454 |
| 407 | Ga0157372_10002523 | 3300013307 | Bacteria | 19853 |
| 408 | Ga0157372_10016533 | 3300013307 | Bacteria | 7917 |
| 409 | Ga0157372_10029210 | 3300013307 | Bacteria | 6018 |
| 410 | Ga0157372_10105643 | 3300013307 | Bacteria | 3221 |
| 411 | Ga0157372_10257382 | 3300013307 | Bacteria | 2027 |
| 412 | Ga0157372_10504468 | 3300013307 | Bacteria | 1411 |
| 413 | Ga0157372_10622301 | 3300013307 | Bacteria | 1258 |
| 414 | Ga0157372_12305295 | 3300013307 | Bacteria | 618 |
| 415 | Ga0157375_10011577 | 3300013308 | Bacteria | 7793 |
| 416 | Ga0157375_10021611 | 3300013308 | Bacteria | 5905 |
| 417 | Ga0157375_10284040 | 3300013308 | Bacteria | 1818 |
| 418 | Ga0157375_10403017 | 3300013308 | Bacteria | 1534 |
| 419 | Ga0157375_10417046 | 3300013308 | Bacteria | 1509 |
| 420 | Ga0157375_10514904 | 3300013308 | Bacteria | 1360 |
| 421 | Ga0157375_10832615 | 3300013308 | Bacteria | 1070 |
| 422 | Ga0157375_11081159 | 3300013308 | Bacteria | 938 |
| 423 | Ga0163163_10000852 | 3300014325 | Bacteria | 25938 |
| 424 | Ga0163163_10015485 | 3300014325 | Bacteria | 7050 |
| 425 | Ga0163163_10091741 | 3300014325 | Bacteria | 3052 |
| 426 | Ga0163163_11794536 | 3300014325 | Unclassified | 674 |
| 427 | Ga0157380_10127055 | 3300014326 | Bacteria | 2169 |
| 428 | Ga0157380_10152611 | 3300014326 | Bacteria | 1999 |
| 429 | Ga0157380_12293490 | 3300014326 | Bacteria | 604 |
| 430 | Ga0182008_10047309 | 3300014497 | Bacteria | 2137 |
| 431 | Ga0157377_10002528 | 3300014745 | Bacteria | 8107 |
| 432 | Ga0157379_10001809 | 3300014968 | Bacteria | 17653 |
| 433 | Ga0157379_10004302 | 3300014968 | Bacteria | 12172 |
| 434 | Ga0157379_10036886 | 3300014968 | Bacteria | 4359 |
| 435 | Ga0157379_10178439 | 3300014968 | Bacteria | 1919 |
| 436 | Ga0157379_10811404 | 3300014968 | Bacteria | 884 |
| 437 | Ga0157376_10003873 | 3300014969 | Bacteria | 10342 |
| 438 | Ga0157376_10167952 | 3300014969 | Bacteria | 1995 |
| 439 | Ga0157376_10232022 | 3300014969 | Bacteria | 1715 |
| 440 | Ga0163161_10043884 | 3300017792 | Bacteria | 3220 |
| 441 | Ga0163161_10046765 | 3300017792 | Bacteria | 3123 |
| 442 | Ga0163161_10072779 | 3300017792 | Bacteria | 2517 |
| 443 | Ga0163161_10103138 | 3300017792 | Bacteria | 2125 |
| 444 | Ga0206351_10432916 | 3300020077 | Bacteria | 866 |
| 445 | Ga0206354_11647103 | 3300020081 | Bacteria | 1168 |
| 446 | Ga0224712_10105938 | 3300022467 | Bacteria | 1200 |
| 447 | Ga0207666_1002584 | 3300025271 | Bacteria | 2185 |
| 448 | Ga0207697_10001482 | 3300025315 | Bacteria | 12807 |
| 449 | Ga0207697_10009761 | 3300025315 | Bacteria | 4131 |
| 450 | Ga0207697_10407251 | 3300025315 | Unclassified | 604 |
| 451 | Ga0207656_10020022 | 3300025321 | Bacteria | 2654 |
| 452 | Ga0207656_10060605 | 3300025321 | Bacteria | 1659 |
| 453 | Ga0207656_10176159 | 3300025321 | Bacteria | 1024 |
| 454 | Ga0207656_10212947 | 3300025321 | Bacteria | 937 |
| 455 | Ga0207656_10243082 | 3300025321 | Bacteria | 880 |
| 456 | Ga0207656_10277215 | 3300025321 | Bacteria | 826 |
| 457 | Ga0207682_10000518 | 3300025893 | Bacteria | 17728 |
| 458 | Ga0207682_10002927 | 3300025893 | Bacteria | 7530 |
| 459 | Ga0207692_10072600 | 3300025898 | Bacteria | 1818 |
| 460 | Ga0207642_10004680 | 3300025899 | Bacteria | 4421 |
| 461 | Ga0207642_10069775 | 3300025899 | Bacteria | 1668 |
| 462 | Ga0207642_10115052 | 3300025899 | Bacteria | 1377 |
| 463 | Ga0207710_10028785 | 3300025900 | Bacteria | 2413 |
| 464 | Ga0207688_10002094 | 3300025901 | Bacteria | 10722 |
| 465 | Ga0207680_10024589 | 3300025903 | Bacteria | 3308 |
| 466 | Ga0207680_10024669 | 3300025903 | Bacteria | 3304 |
| 467 | Ga0207680_10287726 | 3300025903 | Bacteria | 1143 |
| 468 | Ga0207685_10044048 | 3300025905 | Bacteria | 1685 |
| 469 | Ga0207645_10000039 | 3300025907 | Bacteria | 88205 |
| 470 | Ga0207645_10000331 | 3300025907 | Bacteria | 39499 |
| 471 | Ga0207645_10003755 | 3300025907 | Bacteria | 11413 |
| 472 | Ga0207645_10057581 | 3300025907 | Bacteria | 2481 |
| 473 | Ga0207645_10288695 | 3300025907 | Bacteria | 1090 |
| 474 | Ga0207645_10393413 | 3300025907 | Bacteria | 931 |
| 475 | Ga0207645_10559360 | 3300025907 | Bacteria | 776 |
| 476 | Ga0207645_10763146 | 3300025907 | Bacteria | 658 |
| 477 | Ga0207643_10001108 | 3300025908 | Bacteria | 15982 |
| 478 | Ga0207643_10062877 | 3300025908 | Bacteria | 2121 |
| 479 | Ga0207643_10093916 | 3300025908 | Bacteria | 1752 |
| 480 | Ga0207643_10508492 | 3300025908 | Bacteria | 770 |
| 481 | Ga0207705_10024299 | 3300025909 | Bacteria | 4326 |
| 482 | Ga0207705_10327913 | 3300025909 | Bacteria | 1177 |
| 483 | Ga0207684_10085345 | 3300025910 | Bacteria | 2689 |
| 484 | Ga0207684_10202051 | 3300025910 | Bacteria | 1714 |
| 485 | Ga0207654_10017119 | 3300025911 | Bacteria | 3785 |
| 486 | Ga0207654_10571162 | 3300025911 | Bacteria | 805 |
| 487 | Ga0207707_10002045 | 3300025912 | Bacteria | 18314 |
| 488 | Ga0207707_10126247 | 3300025912 | Bacteria | 2237 |
| 489 | Ga0207707_10221445 | 3300025912 | Bacteria | 1647 |
| 490 | Ga0207707_10258442 | 3300025912 | Bacteria | 1512 |
| 491 | Ga0207695_10003454 | 3300025913 | Bacteria | 22268 |
| 492 | Ga0207695_10092644 | 3300025913 | Bacteria | 3032 |
| 493 | Ga0207695_10205379 | 3300025913 | Bacteria | 1883 |
| 494 | Ga0207671_10037783 | 3300025914 | Bacteria | 3579 |
| 495 | Ga0207693_10000397 | 3300025915 | Bacteria | 40037 |
| 496 | Ga0207693_11306172 | 3300025915 | Bacteria | 542 |
| 497 | Ga0207663_10177716 | 3300025916 | Bacteria | 1517 |
| 498 | Ga0207663_10451318 | 3300025916 | Bacteria | 992 |
| 499 | Ga0207660_10125577 | 3300025917 | Bacteria | 1948 |
| 500 | Ga0207660_10218345 | 3300025917 | Bacteria | 1495 |
| 501 | Ga0207662_10032953 | 3300025918 | Bacteria | 3018 |
| 502 | Ga0207662_10061091 | 3300025918 | Bacteria | 2262 |
| 503 | Ga0207657_10005177 | 3300025919 | Bacteria | 13680 |
| 504 | Ga0207657_10027055 | 3300025919 | Bacteria | 5258 |
| 505 | Ga0207657_10034155 | 3300025919 | Bacteria | 4577 |
| 506 | Ga0207657_10041948 | 3300025919 | Bacteria | 4041 |
| 507 | Ga0207657_10073512 | 3300025919 | Bacteria | 2889 |
| 508 | Ga0207649_10006701 | 3300025920 | Bacteria | 6259 |
| 509 | Ga0207649_10014745 | 3300025920 | Bacteria | 4383 |
| 510 | Ga0207649_10024595 | 3300025920 | Bacteria | 3503 |
| 511 | Ga0207649_10068989 | 3300025920 | Bacteria | 2249 |
| 512 | Ga0207649_10136244 | 3300025920 | Bacteria | 1674 |
| 513 | Ga0207649_10146974 | 3300025920 | Bacteria | 1619 |
| 514 | Ga0207649_10176551 | 3300025920 | Bacteria | 1492 |
| 515 | Ga0207649_10187114 | 3300025920 | Bacteria | 1453 |
| 516 | Ga0207649_10646525 | 3300025920 | Bacteria | 817 |
| 517 | Ga0207652_10023564 | 3300025921 | Bacteria | 5100 |
| 518 | Ga0207652_10026703 | 3300025921 | Bacteria | 4811 |
| 519 | Ga0207652_10198073 | 3300025921 | Bacteria | 1807 |
| 520 | Ga0207652_10354131 | 3300025921 | Bacteria | 1325 |
| 521 | Ga0207652_10405080 | 3300025921 | Bacteria | 1231 |
| 522 | Ga0207646_10189148 | 3300025922 | Bacteria | 1859 |
| 523 | Ga0207646_10553736 | 3300025922 | Bacteria | 1034 |
| 524 | Ga0207681_10000711 | 3300025923 | Bacteria | 21871 |
| 525 | Ga0207681_10055584 | 3300025923 | Bacteria | 2697 |
| 526 | Ga0207681_10252038 | 3300025923 | Bacteria | 1378 |
| 527 | Ga0207694_10001561 | 3300025924 | Bacteria | 19421 |
| 528 | Ga0207694_10045447 | 3300025924 | Bacteria | 3392 |
| 529 | Ga0207694_10571877 | 3300025924 | Bacteria | 949 |
| 530 | Ga0207650_10007591 | 3300025925 | Bacteria | 7393 |
| 531 | Ga0207650_10027790 | 3300025925 | Bacteria | 4052 |
| 532 | Ga0207650_10121334 | 3300025925 | Bacteria | 2035 |
| 533 | Ga0207650_10299946 | 3300025925 | Bacteria | 1312 |
| 534 | Ga0207659_10000435 | 3300025926 | Bacteria | 25019 |
| 535 | Ga0207659_10003543 | 3300025926 | Bacteria | 9391 |
| 536 | Ga0207659_10029223 | 3300025926 | Bacteria | 3755 |
| 537 | Ga0207659_10097016 | 3300025926 | Bacteria | 2214 |
| 538 | Ga0207659_10878267 | 3300025926 | Bacteria | 771 |
| 539 | Ga0207659_11035843 | 3300025926 | Bacteria | 706 |
| 540 | Ga0207687_10000188 | 3300025927 | Bacteria | 41329 |
| 541 | Ga0207687_10466569 | 3300025927 | Bacteria | 1049 |
| 542 | Ga0207700_10003118 | 3300025928 | Bacteria | 9574 |
| 543 | Ga0207700_10274089 | 3300025928 | Bacteria | 1449 |
| 544 | Ga0207700_11401225 | 3300025928 | Bacteria | 621 |
| 545 | Ga0207664_10008196 | 3300025929 | Bacteria | 7275 |
| 546 | Ga0207664_10219695 | 3300025929 | Bacteria | 1647 |
| 547 | Ga0207644_10002082 | 3300025931 | Bacteria | 12950 |
| 548 | Ga0207644_10024417 | 3300025931 | Bacteria | 4149 |
| 549 | Ga0207644_10044243 | 3300025931 | Bacteria | 3162 |
| 550 | Ga0207644_10044946 | 3300025931 | Bacteria | 3140 |
| 551 | Ga0207644_10373939 | 3300025931 | Bacteria | 1161 |
| 552 | Ga0207644_10630953 | 3300025931 | Bacteria | 891 |
| 553 | Ga0207690_10003168 | 3300025932 | Bacteria | 9888 |
| 554 | Ga0207690_10099499 | 3300025932 | Bacteria | 2073 |
| 555 | Ga0207690_10105818 | 3300025932 | Bacteria | 2018 |
| 556 | Ga0207690_10205949 | 3300025932 | Bacteria | 1497 |
| 557 | Ga0207706_10005905 | 3300025933 | Bacteria | 11388 |
| 558 | Ga0207706_10052956 | 3300025933 | Bacteria | 3583 |
| 559 | Ga0207706_10074311 | 3300025933 | Bacteria | 2989 |
| 560 | Ga0207706_10470714 | 3300025933 | Bacteria | 1086 |
| 561 | Ga0207706_10620616 | 3300025933 | Bacteria | 927 |
| 562 | Ga0207706_11087651 | 3300025933 | Bacteria | 669 |
| 563 | Ga0207686_10002345 | 3300025934 | Bacteria | 10348 |
| 564 | Ga0207686_10465500 | 3300025934 | Bacteria | 975 |
| 565 | Ga0207709_10118720 | 3300025935 | Bacteria | 1782 |
| 566 | Ga0207670_10008342 | 3300025936 | Bacteria | 5842 |
| 567 | Ga0207670_10010906 | 3300025936 | Bacteria | 5248 |
| 568 | Ga0207670_10741503 | 3300025936 | Bacteria | 815 |
| 569 | Ga0207670_11231501 | 3300025936 | Bacteria | 634 |
| 570 | Ga0207670_11660851 | 3300025936 | Bacteria | 543 |
| 571 | Ga0207669_10005231 | 3300025937 | Bacteria | 5800 |
| 572 | Ga0207669_10012973 | 3300025937 | Bacteria | 4120 |
| 573 | Ga0207669_10139070 | 3300025937 | Bacteria | 1682 |
| 574 | Ga0207669_10250202 | 3300025937 | Bacteria | 1319 |
| 575 | Ga0207669_10806975 | 3300025937 | Bacteria | 778 |
| 576 | Ga0207669_10879589 | 3300025937 | Bacteria | 747 |
| 577 | Ga0207704_10003085 | 3300025938 | Bacteria | 7529 |
| 578 | Ga0207704_10131659 | 3300025938 | Bacteria | 1733 |
| 579 | Ga0207704_10463618 | 3300025938 | Bacteria | 1014 |
| 580 | Ga0207665_10025204 | 3300025939 | Bacteria | 3923 |
| 581 | Ga0207665_10029871 | 3300025939 | Bacteria | 3602 |
| 582 | Ga0207665_10297090 | 3300025939 | Bacteria | 1206 |
| 583 | Ga0207691_10000027 | 3300025940 | Bacteria | 126502 |
| 584 | Ga0207691_10000122 | 3300025940 | Bacteria | 70474 |
| 585 | Ga0207691_10010048 | 3300025940 | Bacteria | 9082 |
| 586 | Ga0207691_10036165 | 3300025940 | Bacteria | 4576 |
| 587 | Ga0207691_10037836 | 3300025940 | Bacteria | 4466 |
| 588 | Ga0207691_10055353 | 3300025940 | Bacteria | 3615 |
| 589 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 590 | Ga0207711_10079743 | 3300025941 | Bacteria | 2858 |
| 591 | Ga0207711_10188008 | 3300025941 | Bacteria | 1881 |
| 592 | Ga0207711_10377951 | 3300025941 | Bacteria | 1314 |
| 593 | Ga0207711_11414844 | 3300025941 | Bacteria | 638 |
| 594 | Ga0207689_10001927 | 3300025942 | Bacteria | 19632 |
| 595 | Ga0207689_10004633 | 3300025942 | Bacteria | 12442 |
| 596 | Ga0207689_10057760 | 3300025942 | Bacteria | 3191 |
| 597 | Ga0207661_10053518 | 3300025944 | Bacteria | 3230 |
| 598 | Ga0207661_10198182 | 3300025944 | Bacteria | 1764 |
| 599 | Ga0207661_11236327 | 3300025944 | Bacteria | 687 |
| 600 | Ga0207661_11593749 | 3300025944 | Bacteria | 597 |
| 601 | Ga0207679_10005843 | 3300025945 | Bacteria | 7727 |
| 602 | Ga0207679_10028613 | 3300025945 | Bacteria | 3870 |
| 603 | Ga0207679_10067729 | 3300025945 | Bacteria | 2679 |
| 604 | Ga0207679_10169716 | 3300025945 | Bacteria | 1795 |
| 605 | Ga0207679_10238564 | 3300025945 | Bacteria | 1539 |
| 606 | Ga0207679_10852541 | 3300025945 | Bacteria | 832 |
| 607 | Ga0207667_10017510 | 3300025949 | Bacteria | 8062 |
| 608 | Ga0207667_10059525 | 3300025949 | Bacteria | 4000 |
| 609 | Ga0207667_10091486 | 3300025949 | Bacteria | 3143 |
| 610 | Ga0207667_10095357 | 3300025949 | Bacteria | 3071 |
| 611 | Ga0207667_10133338 | 3300025949 | Bacteria | 2559 |
| 612 | Ga0207667_10186486 | 3300025949 | Bacteria | 2129 |
| 613 | Ga0207667_10312139 | 3300025949 | Bacteria | 1606 |
| 614 | Ga0207651_10003529 | 3300025960 | Bacteria | 7689 |
| 615 | Ga0207651_10005037 | 3300025960 | Bacteria | 6735 |
| 616 | Ga0207651_10018755 | 3300025960 | Bacteria | 4127 |
| 617 | Ga0207651_10208583 | 3300025960 | Bacteria | 1571 |
| 618 | Ga0207651_10274450 | 3300025960 | Bacteria | 1390 |
| 619 | Ga0207712_10188819 | 3300025961 | Bacteria | 1625 |
| 620 | Ga0207712_10975016 | 3300025961 | Bacteria | 751 |
| 621 | Ga0207712_11399466 | 3300025961 | Bacteria | 626 |
| 622 | Ga0207668_10001770 | 3300025972 | Bacteria | 12603 |
| 623 | Ga0207668_10004950 | 3300025972 | Bacteria | 7838 |
| 624 | Ga0207668_10007868 | 3300025972 | Bacteria | 6335 |
| 625 | Ga0207668_10008608 | 3300025972 | Bacteria | 6091 |
| 626 | Ga0207668_10066008 | 3300025972 | Bacteria | 2563 |
| 627 | Ga0207668_10140462 | 3300025972 | Bacteria | 1856 |
| 628 | Ga0207668_10180606 | 3300025972 | Bacteria | 1664 |
| 629 | Ga0207668_11137673 | 3300025972 | Bacteria | 700 |
| 630 | Ga0207668_11464666 | 3300025972 | Bacteria | 616 |
| 631 | Ga0207640_10005623 | 3300025981 | Bacteria | 6834 |
| 632 | Ga0207640_10016370 | 3300025981 | Bacteria | 4312 |
| 633 | Ga0207640_10022734 | 3300025981 | Bacteria | 3758 |
| 634 | Ga0207640_10036621 | 3300025981 | Bacteria | 3082 |
| 635 | Ga0207640_10064200 | 3300025981 | Bacteria | 2444 |
| 636 | Ga0207640_10112029 | 3300025981 | Bacteria | 1936 |
| 637 | Ga0207658_10000682 | 3300025986 | Bacteria | 29584 |
| 638 | Ga0207658_10002227 | 3300025986 | Bacteria | 14389 |
| 639 | Ga0207658_10006279 | 3300025986 | Bacteria | 8121 |
| 640 | Ga0207658_10113691 | 3300025986 | Bacteria | 2145 |
| 641 | Ga0207658_10173405 | 3300025986 | Bacteria | 1779 |
| 642 | Ga0207658_10175734 | 3300025986 | Bacteria | 1768 |
| 643 | Ga0207658_10334372 | 3300025986 | Bacteria | 1315 |
| 644 | Ga0207658_10601521 | 3300025986 | Unclassified | 988 |
| 645 | Ga0207658_10693221 | 3300025986 | Unclassified | 920 |
| 646 | Ga0207677_10000598 | 3300026023 | Bacteria | 22232 |
| 647 | Ga0207677_10043540 | 3300026023 | Bacteria | 2985 |
| 648 | Ga0207677_10350957 | 3300026023 | Bacteria | 1236 |
| 649 | Ga0207677_10846578 | 3300026023 | Bacteria | 821 |
| 650 | Ga0207703_10000357 | 3300026035 | Bacteria | 49166 |
| 651 | Ga0207703_10004607 | 3300026035 | Bacteria | 11282 |
| 652 | Ga0207703_10071612 | 3300026035 | Bacteria | 2864 |
| 653 | Ga0207703_10312233 | 3300026035 | Bacteria | 1437 |
| 654 | Ga0207703_10907248 | 3300026035 | Bacteria | 844 |
| 655 | Ga0207639_10022564 | 3300026041 | Bacteria | 4535 |
| 656 | Ga0207639_10125898 | 3300026041 | Bacteria | 2113 |
| 657 | Ga0207639_10160019 | 3300026041 | Bacteria | 1896 |
| 658 | Ga0207639_10403246 | 3300026041 | Bacteria | 1232 |
| 659 | Ga0207678_10005532 | 3300026067 | Bacteria | 11289 |
| 660 | Ga0207678_10009735 | 3300026067 | Bacteria | 8451 |
| 661 | Ga0207678_10043974 | 3300026067 | Bacteria | 3865 |
| 662 | Ga0207678_10084148 | 3300026067 | Bacteria | 2720 |
| 663 | Ga0207678_10198440 | 3300026067 | Bacteria | 1715 |
| 664 | Ga0207678_10215439 | 3300026067 | Bacteria | 1643 |
| 665 | Ga0207678_10659258 | 3300026067 | Unclassified | 920 |
| 666 | Ga0207678_11157097 | 3300026067 | Bacteria | 685 |
| 667 | Ga0207708_10016592 | 3300026075 | Bacteria | 5540 |
| 668 | Ga0207708_10641542 | 3300026075 | Bacteria | 903 |
| 669 | Ga0207702_10015836 | 3300026078 | Bacteria | 6243 |
| 670 | Ga0207702_10029001 | 3300026078 | Bacteria | 4602 |
| 671 | Ga0207702_10040144 | 3300026078 | Bacteria | 3923 |
| 672 | Ga0207702_10137718 | 3300026078 | Bacteria | 2205 |
| 673 | Ga0207702_10417567 | 3300026078 | Bacteria | 1297 |
| 674 | Ga0207641_10002436 | 3300026088 | Bacteria | 17199 |
| 675 | Ga0207641_10004735 | 3300026088 | Bacteria | 11731 |
| 676 | Ga0207641_10249091 | 3300026088 | Unclassified | 1658 |
| 677 | Ga0207641_10276493 | 3300026088 | Bacteria | 1577 |
| 678 | Ga0207641_10365834 | 3300026088 | Bacteria | 1378 |
| 679 | Ga0207641_10794070 | 3300026088 | Bacteria | 936 |
| 680 | Ga0207641_11339672 | 3300026088 | Bacteria | 716 |
| 681 | Ga0207641_11400887 | 3300026088 | Bacteria | 700 |
| 682 | Ga0207648_10000149 | 3300026089 | Bacteria | 70199 |
| 683 | Ga0207648_10006522 | 3300026089 | Bacteria | 11581 |
| 684 | Ga0207648_10039889 | 3300026089 | Bacteria | 4128 |
| 685 | Ga0207648_10293574 | 3300026089 | Bacteria | 1456 |
| 686 | Ga0207648_10464201 | 3300026089 | Bacteria | 1154 |
| 687 | Ga0207676_10000236 | 3300026095 | Bacteria | 48498 |
| 688 | Ga0207676_10013826 | 3300026095 | Bacteria | 5793 |
| 689 | Ga0207676_10026292 | 3300026095 | Bacteria | 4328 |
| 690 | Ga0207676_10029837 | 3300026095 | Bacteria | 4087 |
| 691 | Ga0207676_10029999 | 3300026095 | Bacteria | 4077 |
| 692 | Ga0207674_10000694 | 3300026116 | Bacteria | 43838 |
| 693 | Ga0207674_10005278 | 3300026116 | Bacteria | 15380 |
| 694 | Ga0207674_10167026 | 3300026116 | Bacteria | 2154 |
| 695 | Ga0207674_10173302 | 3300026116 | Bacteria | 2110 |
| 696 | Ga0207675_100000871 | 3300026118 | Bacteria | 30087 |
| 697 | Ga0207675_100023629 | 3300026118 | Bacteria | 5719 |
| 698 | Ga0207675_100135757 | 3300026118 | Bacteria | 2334 |
| 699 | Ga0207675_100180865 | 3300026118 | Bacteria | 2019 |
| 700 | Ga0207675_100203010 | 3300026118 | Bacteria | 1904 |
| 701 | Ga0207675_100436814 | 3300026118 | Bacteria | 1295 |
| 702 | Ga0207683_10000005 | 3300026121 | Bacteria | 187889 |
| 703 | Ga0207683_10000061 | 3300026121 | Bacteria | 81399 |
| 704 | Ga0207683_10030161 | 3300026121 | Bacteria | 4698 |
| 705 | Ga0207683_10087067 | 3300026121 | Bacteria | 2778 |
| 706 | Ga0207683_10316005 | 3300026121 | Bacteria | 1430 |
| 707 | Ga0207698_10017048 | 3300026142 | Bacteria | 4918 |
| 708 | Ga0207698_10021865 | 3300026142 | Bacteria | 4432 |
| 709 | Ga0207698_10144635 | 3300026142 | Bacteria | 2054 |
| 710 | Ga0207698_10211718 | 3300026142 | Bacteria | 1744 |
| 711 | Ga0207698_10286049 | 3300026142 | Bacteria | 1527 |
| 712 | Ga0207698_10320622 | 3300026142 | Bacteria | 1451 |
| 713 | Ga0207698_10535342 | 3300026142 | Bacteria | 1145 |
| 714 | Ga0207698_10754745 | 3300026142 | Bacteria | 972 |
| 715 | Ga0209969_1006601 | 3300027360 | Bacteria | 1635 |
| 716 | Ga0209179_1043840 | 3300027512 | Bacteria | 947 |
| 717 | Ga0209968_1025339 | 3300027526 | Bacteria | 977 |
| 718 | Ga0209982_1019229 | 3300027552 | Bacteria | 1047 |
| 719 | Ga0209983_1088401 | 3300027665 | Bacteria | 697 |
| 720 | Ga0209588_1039337 | 3300027671 | Bacteria | 1525 |
| 721 | Ga0209971_1005246 | 3300027682 | Bacteria | 3079 |
| 722 | Ga0209966_1046035 | 3300027695 | Bacteria | 920 |
| 723 | Ga0209974_10000218 | 3300027876 | Bacteria | 18558 |
| 724 | Ga0207428_10723112 | 3300027907 | Bacteria | 711 |
| 725 | Ga0207428_10794745 | 3300027907 | Bacteria | 672 |
| 726 | Ga0268266_10013747 | 3300028379 | Bacteria | 6970 |
| 727 | Ga0268266_10027741 | 3300028379 | Bacteria | 4814 |
| 728 | Ga0268266_10035967 | 3300028379 | Bacteria | 4212 |
| 729 | Ga0268266_10604478 | 3300028379 | Bacteria | 1053 |
| 730 | Ga0268265_10061114 | 3300028380 | Bacteria | 2890 |
| 731 | Ga0268265_10267511 | 3300028380 | Bacteria | 1523 |
| 732 | Ga0268264_10004572 | 3300028381 | Bacteria | 11783 |
| 733 | Ga0268264_10015489 | 3300028381 | Bacteria | 6250 |
| 734 | Ga0268264_10023690 | 3300028381 | Bacteria | 5006 |
| 735 | Ga0268264_10148586 | 3300028381 | Bacteria | 2098 |
| 736 | Ga0307408_100048361 | 3300031548 | Bacteria | 3050 |
| 737 | Ga0307408_100424552 | 3300031548 | Bacteria | 1147 |
| 738 | Ga0265313_10166573 | 3300031595 | Bacteria | 933 |
| 739 | Ga0265342_10036941 | 3300031712 | Bacteria | 2981 |
| 740 | Ga0307405_10021490 | 3300031731 | Bacteria | 3629 |
| 741 | Ga0307405_11017543 | 3300031731 | Bacteria | 708 |
| 742 | Ga0307413_10013563 | 3300031824 | Bacteria | 4101 |
| 743 | Ga0307413_10127914 | 3300031824 | Bacteria | 1733 |
| 744 | Ga0307410_10001942 | 3300031852 | Bacteria | 9711 |
| 745 | Ga0307406_10046892 | 3300031901 | Bacteria | 2721 |
| 746 | Ga0307406_10074478 | 3300031901 | Bacteria | 2235 |
| 747 | Ga0307406_10843815 | 3300031901 | Bacteria | 776 |
| 748 | Ga0307407_10060794 | 3300031903 | Bacteria | 2206 |
| 749 | Ga0307412_10076144 | 3300031911 | Bacteria | 2304 |
| 750 | Ga0307412_10280072 | 3300031911 | Bacteria | 1309 |
| 751 | Ga0307409_100035247 | 3300031995 | Bacteria | 3664 |
| 752 | Ga0307409_100035342 | 3300031995 | Bacteria | 3661 |
| 753 | Ga0307416_100017374 | 3300032002 | Bacteria | 5032 |
| 754 | Ga0307416_100068575 | 3300032002 | Bacteria | 2931 |
| 755 | Ga0307416_100834579 | 3300032002 | Bacteria | 1019 |
| 756 | Ga0307416_101812549 | 3300032002 | Bacteria | 714 |
| 757 | Ga0307414_10227770 | 3300032004 | Bacteria | 1535 |
| 758 | Ga0307414_10273454 | 3300032004 | Bacteria | 1416 |
| 759 | Ga0307411_10000127 | 3300032005 | Bacteria | 23867 |
| 760 | Ga0307411_10273507 | 3300032005 | Bacteria | 1341 |
| 761 | Ga0373934_0000450 | 3300035086 | Bacteria | 14370 |
| 762 | Ga0373945_0084556 | 3300035116 | Bacteria | 1220 |
| 763 | Ga0373953_0140864 | 3300035117 | Bacteria | 1031 |
| 764 | Ga0373953_0292204 | 3300035117 | Bacteria | 711 |
| 765 | Ga0373954_0000090 | 3300035118 | Bacteria | 31033 |
| 766 | Ga0373954_0005287 | 3300035118 | Bacteria | 5578 |
| 767 | Ga0373956_0058736 | 3300035119 | Bacteria | 1739 |
| 768 | Ga0373956_0066484 | 3300035119 | Bacteria | 1640 |
| 769 | Ga0373957_0001365 | 3300035120 | Bacteria | 6570 |
| 770 | Ga0373957_0030900 | 3300035120 | Bacteria | 1965 |
| 771 | Ga0373943_0335190 | 3300035170 | Bacteria | 864 |
| 772 | Ga0373943_0456629 | 3300035170 | Bacteria | 743 |
| 773 | Ga0373946_0065115 | 3300035171 | Bacteria | 1560 |
| 774 | Ga0373955_0002225 | 3300035172 | Bacteria | 8416 |
| 775 | Ga0373955_0247100 | 3300035172 | Unclassified | 1069 |
| 776 | Ga0373931_0125424 | 3300035691 | Bacteria | 1472 |
| 777 | Ga0373931_0719612 | 3300035691 | Bacteria | 660 |
| 778 | Ga0373935_0662166 | 3300035692 | Bacteria | 766 |
| 779 | Ga0373927_0208736 | 3300035695 | Bacteria | 1283 |
| 780 | Ga0373933_0117062 | 3300035724 | Bacteria | 1666 |
| 781 | Ga0373933_0173393 | 3300035724 | Bacteria | 1373 |
| 782 | Ga0373947_0263086 | 3300035725 | Bacteria | 1143 |
| 783 | Ga0373937_0014898 | 3300036401 | Bacteria | 6867 |
| 784 | Ga0373937_0016168 | 3300036401 | Bacteria | 6620 |
| 785 | Ga0373937_0121600 | 3300036401 | Bacteria | 2433 |
| 786 | Ga0373937_0191538 | 3300036401 | Bacteria | 1921 |
| 787 | Ga0373937_0971568 | 3300036401 | Bacteria | 798 |
| 788 | Ga0373937_1056531 | 3300036401 | Bacteria | 761 |
| 789 | Ga0373925_0008046 | 3300037068 | Bacteria | 7680 |
| 790 | Ga0373925_0459044 | 3300037068 | Bacteria | 1044 |
| 791 | Ga0395899_0242674 | 3300037312 | Bacteria | 1239 |
| 792 | Ga0395900_0140524 | 3300037418 | Bacteria | 2473 |
| 793 | Ga0395898_0025562 | 3300037466 | Bacteria | 5948 |
| 794 | Ga0395905_0971727 | 3300037471 | Bacteria | 752 |
| 795 | Ga0395901_0071127 | 3300038443 | Bacteria | 3625 |
| 796 | Ga0436365_0678556 | 3300039437 | Bacteria | 2326 |
| 797 | Ga0451807_2483320 | 3300041486 | Bacteria | 639 |
| 798 | Ga0451835_0590140 | 3300041492 | Bacteria | 815 |
| 799 | Ga0451851_0265793 | 3300041507 | Bacteria | 1575 |
| 800 | Ga0451853_3036030 | 3300041512 | Bacteria | 1104 |
| 801 | Ga0439455_0152223 | 3300042012 | Bacteria | 659 |
| 802 | Ga0466957_0592391 | 3300044842 | Bacteria | 776 |
| 803 | Ga0466958_0174832 | 3300045836 | Bacteria | 1361 |
| 804 | Ga0466967_0944918 | 3300045976 | Bacteria | 858 |
| 805 | Ga0495592_0124858 | 3300046454 | Bacteria | 1807 |
| 806 | Ga0495592_0289485 | 3300046454 | Bacteria | 1068 |
| 807 | Ga0495580_0049434 | 3300046472 | Bacteria | 2976 |
| 808 | Ga0495628_0258525 | 3300046516 | Bacteria | 1298 |
| 809 | Ga0495586_0496317 | 3300046535 | Bacteria | 704 |
| 810 | Ga0495621_0035570 | 3300046539 | Bacteria | 1726 |
| 811 | Ga0495621_0244114 | 3300046539 | Bacteria | 732 |
| 812 | Ga0495667_0086577 | 3300046559 | Bacteria | 2032 |
| 813 | Ga0495659_0263468 | 3300046664 | Bacteria | 721 |
| 814 | Ga0495599_0038730 | 3300046678 | Bacteria | 2996 |
| 815 | Ga0495658_0133938 | 3300046683 | Bacteria | 1511 |
| 816 | Ga0495658_0294975 | 3300046683 | Bacteria | 1025 |
| 817 | Ga0495636_0240688 | 3300047318 | Bacteria | 835 |
| 818 | Ga0496100_0083697 | 3300048903 | Bacteria | 2161 |
| 819 | Ga0496100_0105039 | 3300048903 | Bacteria | 1953 |
| 820 | Ga0496100_0385832 | 3300048903 | Bacteria | 1064 |
| 821 | Ga0496101_0043820 | 3300048904 | Bacteria | 3199 |
| 822 | Ga0496101_0170712 | 3300048904 | Bacteria | 1672 |
| 823 | Ga0496102_0227108 | 3300048905 | Bacteria | 1760 |
| 824 | Ga0496102_0621517 | 3300048905 | Bacteria | 1003 |
| 825 | Ga0496104_0004741 | 3300048907 | Bacteria | 11838 |
| 826 | Ga0496104_0054859 | 3300048907 | Bacteria | 3767 |
| 827 | Ga0496105_0054554 | 3300048908 | Bacteria | 3300 |
| 828 | Ga0496105_0396843 | 3300048908 | Bacteria | 1095 |
| 829 | Ga0496106_0021506 | 3300048909 | Bacteria | 4789 |
| 830 | Ga0496106_0379771 | 3300048909 | Bacteria | 1135 |
| 831 | Ga0496106_0603830 | 3300048909 | Bacteria | 879 |
| 832 | Ga0496106_0948459 | 3300048909 | Bacteria | 678 |
| 833 | Ga0496107_0009831 | 3300048910 | Bacteria | 6634 |
| 834 | Ga0496107_0022469 | 3300048910 | Bacteria | 4458 |
| 835 | Ga0496107_0089645 | 3300048910 | Bacteria | 2246 |
| 836 | Ga0496108_0001943 | 3300048911 | Bacteria | 16553 |
| 837 | Ga0496108_0084716 | 3300048911 | Bacteria | 2690 |
| 838 | Ga0496108_0131679 | 3300048911 | Bacteria | 2150 |
| 839 | Ga0496108_0441073 | 3300048911 | Bacteria | 1137 |
| 840 | Ga0496109_0003388 | 3300048912 | Bacteria | 13344 |
| 841 | Ga0496109_0127593 | 3300048912 | Bacteria | 2372 |
| 842 | Ga0496109_0476365 | 3300048912 | Bacteria | 1179 |
| 843 | Ga0496110_0006654 | 3300048913 | Bacteria | 9181 |
| 844 | Ga0496110_0663888 | 3300048913 | Bacteria | 943 |
| 845 | Ga0496110_1123709 | 3300048913 | Bacteria | 694 |
| 846 | Ga0496111_0032443 | 3300048914 | Bacteria | 3724 |
| 847 | Ga0496111_0460520 | 3300048914 | Bacteria | 938 |
| 848 | Ga0496112_0000540 | 3300048915 | Bacteria | 25909 |
| 849 | Ga0496112_0031075 | 3300048915 | Bacteria | 5175 |
| 850 | Ga0496113_0065055 | 3300048916 | Bacteria | 2759 |
| 851 | Ga0496113_1335012 | 3300048916 | Bacteria | 557 |
| 852 | Ga0496114_0021658 | 3300048917 | Bacteria | 5230 |
| 853 | Ga0496114_0378016 | 3300048917 | Bacteria | 1254 |
| 854 | Ga0501034_0308740 | 3300049571 | Bacteria | 1517 |
| 855 | Ga0501037_0723549 | 3300049573 | Bacteria | 661 |
| 856 | Ga0501046_0532530 | 3300049580 | Unclassified | 839 |
| 857 | Ga0501047_0003041 | 3300049581 | Bacteria | 15910 |
| 858 | Ga0501047_0167814 | 3300049581 | Bacteria | 2065 |
| 859 | Ga0501068_0092590 | 3300049584 | Bacteria | 1866 |
| 860 | Ga0501069_0000613 | 3300049585 | Bacteria | 16520 |
| 861 | Ga0501070_0001894 | 3300049586 | Bacteria | 18500 |
| 862 | Ga0501070_0168367 | 3300049586 | Bacteria | 1805 |
| 863 | Ga0501070_0772709 | 3300049586 | Bacteria | 756 |
| 864 | Ga0501072_0121924 | 3300049588 | Bacteria | 2077 |
| 865 | Ga0501073_0001098 | 3300049589 | Bacteria | 19610 |
| 866 | Ga0501073_0006351 | 3300049589 | Bacteria | 8799 |
| 867 | Ga0501073_0812975 | 3300049589 | Bacteria | 644 |
| 868 | Ga0501074_0000270 | 3300049590 | Bacteria | 29630 |
| 869 | Ga0501074_0025248 | 3300049590 | Bacteria | 4317 |
| 870 | Ga0501079_0114478 | 3300049741 | Bacteria | 2096 |
| 871 | Ga0501080_0003122 | 3300049742 | Bacteria | 14606 |
| 872 | Ga0501080_0006400 | 3300049742 | Bacteria | 10569 |
| 873 | Ga0501080_0117785 | 3300049742 | Bacteria | 2462 |
| 874 | Ga0501080_0652128 | 3300049742 | Bacteria | 931 |
| 875 | Ga0501083_0001697 | 3300049744 | Bacteria | 15011 |
| 876 | Ga0501083_0016009 | 3300049744 | Bacteria | 5252 |
| 877 | Ga0501083_0114806 | 3300049744 | Bacteria | 1768 |
| 878 | Ga0501035_0216726 | 3300049822 | Bacteria | 1636 |
| 879 | Ga0501035_0867776 | 3300049822 | Bacteria | 717 |
| 880 | Ga0501044_0393583 | 3300049823 | Bacteria | 1299 |
| 881 | Ga0501044_0619204 | 3300049823 | Bacteria | 974 |
| 882 | Ga0501045_1014422 | 3300049824 | Bacteria | 608 |
| 883 | nmdc:mga00v17_137514_c1 | 3300050491 | Bacteria | 1565 |
| 884 | nmdc:mga0k408_9536_c1 | 3300050493 | Bacteria | 5237 |
| 885 | nmdc:mga05p37_1066953_c1 | 3300050507 | Bacteria | 850 |
| 886 | nmdc:mga08y16_323454_c1 | 3300050511 | Bacteria | 1587 |
| 887 | nmdc:mga08y16_452107_c1 | 3300050511 | Bacteria | 1310 |
| 888 | nmdc:mga0n895_691463_c1 | 3300050512 | Bacteria | 1016 |
| 889 | nmdc:mga0n895_96099_c1 | 3300050512 | Bacteria | 2968 |
| 890 | nmdc:mga0rr50_31760_c1 | 3300050513 | Bacteria | 3755 |
| 891 | nmdc:mga08x19_13403_c1 | 3300050514 | Bacteria | 4956 |
| 892 | nmdc:mga08x19_73243_c1 | 3300050514 | Bacteria | 2236 |
| 893 | nmdc:mga08x19_96782_c1 | 3300050514 | Bacteria | 1954 |
| 894 | nmdc:mga0a205_4266_c1 | 3300050515 | Bacteria | 12836 |
| 895 | nmdc:mga0a205_632077_c1 | 3300050515 | Bacteria | 922 |
| 896 | Ga0495612_0020216 | 3300053078 | Bacteria | 2669 |
| 897 | Ga0495619_0394938 | 3300053085 | Unclassified | 955 |
| 898 | Ga0501084_0466944 | 3300054114 | Bacteria | 1067 |
| 899 | Ga0501082_0691278 | 3300060353 | Bacteria | 893 |
| 900 | Ga0501082_1116836 | 3300060353 | Bacteria | 689 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10504468 | Ga0157372_105044683 | 139 |
| 2 | 3300009148 | Ga0105243_10147437 | Ga0105243_101474372 | 143 |
| 3 | 3300009177 | Ga0105248_10002843 | Ga0105248_1000284319 | 143 |
| 4 | 3300013296 | Ga0157374_10002044 | Ga0157374_1000204417 | 143 |
| 5 | 3300013306 | Ga0163162_10003371 | Ga0163162_100033716 | 143 |
| 6 | 3300013307 | Ga0157372_10257382 | Ga0157372_102573823 | 143 |
| 7 | 3300013308 | Ga0157375_10021611 | Ga0157375_100216117 | 143 |
| 8 | 3300014968 | Ga0157379_10001809 | Ga0157379_1000180915 | 143 |
| 9 | 3300014969 | Ga0157376_10003873 | Ga0157376_100038735 | 143 |
| 10 | 3300041486 | Ga0451807_2483320 | Ga0451807_2483320_151_585 | 143 |
| 11 | 3300041492 | Ga0451835_0590140 | Ga0451835_0590140_60_494 | 143 |
| 12 | 3300041507 | Ga0451851_0265793 | Ga0451851_0265793_357_791 | 143 |
| 13 | 3300048903 | Ga0496100_0083697 | Ga0496100_0083697_1285_1719 | 143 |
| 14 | 3300048904 | Ga0496101_0170712 | Ga0496101_0170712_247_681 | 143 |
| 15 | 3300048909 | Ga0496106_0379771 | Ga0496106_0379771_67_501 | 143 |
| 16 | 3300048910 | Ga0496107_0089645 | Ga0496107_0089645_555_989 | 143 |
| 17 | 3300048911 | Ga0496108_0131679 | Ga0496108_0131679_433_867 | 143 |
| 18 | 3300048912 | Ga0496109_0127593 | Ga0496109_0127593_1304_1738 | 143 |
| 19 | 3300048913 | Ga0496110_0663888 | Ga0496110_0663888_427_861 | 143 |
| 20 | 3300048917 | Ga0496114_0378016 | Ga0496114_0378016_565_999 | 143 |
| 21 | 3300006173 | Ga0070716_100252163 | Ga0070716_1002521633 | 146 |
| 22 | 3300025939 | Ga0207665_10297090 | Ga0207665_102970903 | 146 |
| 23 | 3300047318 | Ga0495636_0240688 | Ga0495636_0240688_159_602 | 147 |
| 24 | 3300005444 | Ga0070694_100489890 | Ga0070694_1004898902 | 148 |
| 25 | 3300049571 | Ga0501034_0308740 | Ga0501034_0308740_351_797 | 148 |
| 26 | 3300049580 | Ga0501046_0532530 | Ga0501046_0532530_241_690 | 148 |
| 27 | 3300049581 | Ga0501047_0003041 | Ga0501047_0003041_4142_4588 | 148 |
| 28 | 3300049584 | Ga0501068_0092590 | Ga0501068_0092590_1126_1572 | 148 |
| 29 | 3300049585 | Ga0501069_0000613 | Ga0501069_0000613_13202_13648 | 148 |
| 30 | 3300049586 | Ga0501070_0001894 | Ga0501070_0001894_7200_7646 | 148 |
| 31 | 3300049589 | Ga0501073_0001098 | Ga0501073_0001098_10556_11002 | 148 |
| 32 | 3300049590 | Ga0501074_0000270 | Ga0501074_0000270_8104_8550 | 148 |
| 33 | 3300049741 | Ga0501079_0114478 | Ga0501079_0114478_616_1062 | 148 |
| 34 | 3300049742 | Ga0501080_0006400 | Ga0501080_0006400_5593_6039 | 148 |
| 35 | 3300049744 | Ga0501083_0001697 | Ga0501083_0001697_4010_4456 | 148 |
| 36 | 3300049822 | Ga0501035_0216726 | Ga0501035_0216726_525_971 | 148 |
| 37 | 3300049823 | Ga0501044_0619204 | Ga0501044_0619204_208_654 | 148 |
| 38 | 3300054114 | Ga0501084_0466944 | Ga0501084_0466944_216_662 | 148 |
| 39 | 3300009147 | Ga0114129_10398433 | Ga0114129_103984331 | 149 |
| 40 | 3300050507 | nmdc:mga05p37_1066953_c1 | nmdc:mga05p37_1066953_c1_335_811 | 149 |
| 41 | 3300050514 | nmdc:mga08x19_13403_c1 | nmdc:mga08x19_13403_c1_3385_3834 | 149 |
| 42 | 3300005440 | Ga0070705_100178956 | Ga0070705_1001789562 | 153 |
| 43 | 3300005549 | Ga0070704_100005301 | Ga0070704_1000053012 | 153 |
| 44 | 3300006173 | Ga0070716_100013908 | Ga0070716_1000139085 | 153 |
| 45 | 3300025939 | Ga0207665_10029871 | Ga0207665_100298713 | 153 |
| 46 | 3300006914 | Ga0075436_100004627 | Ga0075436_1000046273 | 154 |
| 47 | 3300006914 | Ga0075436_100080231 | Ga0075436_1000802312 | 154 |
| 48 | 3300007265 | Ga0099794_10000530 | Ga0099794_1000053013 | 154 |
| 49 | 3300007265 | Ga0099794_10014216 | Ga0099794_100142164 | 154 |
| 50 | 3300007788 | Ga0099795_10079738 | Ga0099795_100797382 | 154 |
| 51 | 3300010159 | Ga0099796_10048396 | Ga0099796_100483962 | 154 |
| 52 | 3300027512 | Ga0209179_1043840 | Ga0209179_10438402 | 154 |
| 53 | 3300027671 | Ga0209588_1039337 | Ga0209588_10393372 | 154 |
| 54 | 3300046664 | Ga0495659_0263468 | Ga0495659_0263468_156_620 | 154 |
| 55 | 3300050514 | nmdc:mga08x19_73243_c1 | nmdc:mga08x19_73243_c1_965_1429 | 154 |
| 56 | 3300050514 | nmdc:mga08x19_96782_c1 | nmdc:mga08x19_96782_c1_778_1242 | 154 |
| 57 | 3300050515 | nmdc:mga0a205_632077_c1 | nmdc:mga0a205_632077_c1_258_737 | 154 |
| 58 | 3300005458 | Ga0070681_10504570 | Ga0070681_105045702 | 155 |
| 59 | 3300005530 | Ga0070679_100509829 | Ga0070679_1005098292 | 155 |
| 60 | 3300005563 | Ga0068855_100016905 | Ga0068855_1000169057 | 155 |
| 61 | 3300005563 | Ga0068855_101704408 | Ga0068855_1017044081 | 155 |
| 62 | 3300009093 | Ga0105240_10071509 | Ga0105240_100715096 | 155 |
| 63 | 3300013102 | Ga0157371_10247192 | Ga0157371_102471922 | 155 |
| 64 | 3300013104 | Ga0157370_10010466 | Ga0157370_100104669 | 155 |
| 65 | 3300013104 | Ga0157370_10206317 | Ga0157370_102063172 | 155 |
| 66 | 3300025315 | Ga0207697_10407251 | Ga0207697_104072511 | 155 |
| 67 | 3300025913 | Ga0207695_10205379 | Ga0207695_102053792 | 155 |
| 68 | 3300025921 | Ga0207652_10354131 | Ga0207652_103541313 | 155 |
| 69 | 3300025949 | Ga0207667_10059525 | Ga0207667_100595252 | 155 |
| 70 | 3300035117 | Ga0373953_0292204 | Ga0373953_0292204_196_666 | 155 |
| 71 | 3300049573 | Ga0501037_0723549 | Ga0501037_0723549_131_601 | 155 |
| 72 | 3300049581 | Ga0501047_0167814 | Ga0501047_0167814_1491_1958 | 155 |
| 73 | 3300049586 | Ga0501070_0772709 | Ga0501070_0772709_270_737 | 155 |
| 74 | 3300049589 | Ga0501073_0812975 | Ga0501073_0812975_38_505 | 155 |
| 75 | 3300049742 | Ga0501080_0117785 | Ga0501080_0117785_452_919 | 155 |
| 76 | 3300049822 | Ga0501035_0867776 | Ga0501035_0867776_172_639 | 155 |
| 77 | 3300049823 | Ga0501044_0393583 | Ga0501044_0393583_680_1147 | 155 |
| 78 | 3300060353 | Ga0501082_0691278 | Ga0501082_0691278_272_739 | 155 |
| 79 | 3300005293 | Ga0065715_10604844 | Ga0065715_106048441 | 156 |
| 80 | 3300005327 | Ga0070658_10912505 | Ga0070658_109125051 | 156 |
| 81 | 3300005329 | Ga0070683_100213175 | Ga0070683_1002131753 | 156 |
| 82 | 3300005338 | Ga0068868_100143733 | Ga0068868_1001437332 | 156 |
| 83 | 3300005339 | Ga0070660_100018256 | Ga0070660_1000182565 | 156 |
| 84 | 3300005339 | Ga0070660_100019235 | Ga0070660_1000192356 | 156 |
| 85 | 3300005340 | Ga0070689_101487877 | Ga0070689_1014878771 | 156 |
| 86 | 3300005344 | Ga0070661_100587866 | Ga0070661_1005878662 | 156 |
| 87 | 3300005354 | Ga0070675_100525094 | Ga0070675_1005250942 | 156 |
| 88 | 3300005355 | Ga0070671_100295150 | Ga0070671_1002951502 | 156 |
| 89 | 3300005356 | Ga0070674_100320869 | Ga0070674_1003208693 | 156 |
| 90 | 3300005356 | Ga0070674_101608452 | Ga0070674_1016084521 | 156 |
| 91 | 3300005364 | Ga0070673_100113023 | Ga0070673_1001130233 | 156 |
| 92 | 3300005365 | Ga0070688_100335349 | Ga0070688_1003353492 | 156 |
| 93 | 3300005366 | Ga0070659_100245103 | Ga0070659_1002451033 | 156 |
| 94 | 3300005367 | Ga0070667_100099238 | Ga0070667_1000992382 | 156 |
| 95 | 3300005367 | Ga0070667_100124434 | Ga0070667_1001244344 | 156 |
| 96 | 3300005438 | Ga0070701_10835550 | Ga0070701_108355501 | 156 |
| 97 | 3300005455 | Ga0070663_100226055 | Ga0070663_1002260552 | 156 |
| 98 | 3300005455 | Ga0070663_100492323 | Ga0070663_1004923232 | 156 |
| 99 | 3300005457 | Ga0070662_100202720 | Ga0070662_1002027202 | 156 |
| 100 | 3300005458 | Ga0070681_10188909 | Ga0070681_101889092 | 156 |
| 101 | 3300005458 | Ga0070681_10194030 | Ga0070681_101940302 | 156 |
| 102 | 3300005458 | Ga0070681_10811526 | Ga0070681_108115262 | 156 |
| 103 | 3300005459 | Ga0068867_100388882 | Ga0068867_1003888822 | 156 |
| 104 | 3300005530 | Ga0070679_100102796 | Ga0070679_1001027965 | 156 |
| 105 | 3300005530 | Ga0070679_100332826 | Ga0070679_1003328263 | 156 |
| 106 | 3300005530 | Ga0070679_100405991 | Ga0070679_1004059911 | 156 |
| 107 | 3300005535 | Ga0070684_100114905 | Ga0070684_1001149052 | 156 |
| 108 | 3300005539 | Ga0068853_100493124 | Ga0068853_1004931241 | 156 |
| 109 | 3300005539 | Ga0068853_100616914 | Ga0068853_1006169141 | 156 |
| 110 | 3300005543 | Ga0070672_100034147 | Ga0070672_1000341472 | 156 |
| 111 | 3300005548 | Ga0070665_100168948 | Ga0070665_1001689482 | 156 |
| 112 | 3300005548 | Ga0070665_100754768 | Ga0070665_1007547682 | 156 |
| 113 | 3300005563 | Ga0068855_100030675 | Ga0068855_1000306755 | 156 |
| 114 | 3300005563 | Ga0068855_100169283 | Ga0068855_1001692833 | 156 |
| 115 | 3300005564 | Ga0070664_101233277 | Ga0070664_1012332771 | 156 |
| 116 | 3300005614 | Ga0068856_100167707 | Ga0068856_1001677073 | 156 |
| 117 | 3300005616 | Ga0068852_100775447 | Ga0068852_1007754471 | 156 |
| 118 | 3300005618 | Ga0068864_100324793 | Ga0068864_1003247932 | 156 |
| 119 | 3300005618 | Ga0068864_100907797 | Ga0068864_1009077971 | 156 |
| 120 | 3300005719 | Ga0068861_100282136 | Ga0068861_1002821362 | 156 |
| 121 | 3300005719 | Ga0068861_101277487 | Ga0068861_1012774871 | 156 |
| 122 | 3300005834 | Ga0068851_10068990 | Ga0068851_100689903 | 156 |
| 123 | 3300005842 | Ga0068858_100321206 | Ga0068858_1003212061 | 156 |
| 124 | 3300005842 | Ga0068858_101166469 | Ga0068858_1011664691 | 156 |
| 125 | 3300005844 | Ga0068862_100135274 | Ga0068862_1001352743 | 156 |
| 126 | 3300005985 | Ga0081539_10203957 | Ga0081539_102039572 | 156 |
| 127 | 3300006028 | Ga0070717_10425171 | Ga0070717_104251712 | 156 |
| 128 | 3300006051 | Ga0075364_10019352 | Ga0075364_100193525 | 156 |
| 129 | 3300006186 | Ga0075369_10003906 | Ga0075369_100039065 | 156 |
| 130 | 3300006195 | Ga0075366_10022788 | Ga0075366_100227883 | 156 |
| 131 | 3300006237 | Ga0097621_101562817 | Ga0097621_1015628172 | 156 |
| 132 | 3300006914 | Ga0075436_100018047 | Ga0075436_1000180472 | 156 |
| 133 | 3300007076 | Ga0075435_100354881 | Ga0075435_1003548813 | 156 |
| 134 | 3300009093 | Ga0105240_10002895 | Ga0105240_100028954 | 156 |
| 135 | 3300009174 | Ga0105241_10010941 | Ga0105241_100109417 | 156 |
| 136 | 3300009551 | Ga0105238_10020415 | Ga0105238_100204156 | 156 |
| 137 | 3300009553 | Ga0105249_10112993 | Ga0105249_101129933 | 156 |
| 138 | 3300013104 | Ga0157370_10007974 | Ga0157370_1000797410 | 156 |
| 139 | 3300013105 | Ga0157369_10319921 | Ga0157369_103199213 | 156 |
| 140 | 3300013105 | Ga0157369_11762387 | Ga0157369_117623872 | 156 |
| 141 | 3300013296 | Ga0157374_10810701 | Ga0157374_108107012 | 156 |
| 142 | 3300013306 | Ga0163162_10428948 | Ga0163162_104289482 | 156 |
| 143 | 3300013307 | Ga0157372_10016533 | Ga0157372_100165336 | 156 |
| 144 | 3300013307 | Ga0157372_10029210 | Ga0157372_100292106 | 156 |
| 145 | 3300013307 | Ga0157372_10105643 | Ga0157372_101056434 | 156 |
| 146 | 3300013308 | Ga0157375_10284040 | Ga0157375_102840403 | 156 |
| 147 | 3300013308 | Ga0157375_10832615 | Ga0157375_108326152 | 156 |
| 148 | 3300014325 | Ga0163163_11794536 | Ga0163163_117945361 | 156 |
| 149 | 3300014326 | Ga0157380_10127055 | Ga0157380_101270552 | 156 |
| 150 | 3300020077 | Ga0206351_10432916 | Ga0206351_104329161 | 156 |
| 151 | 3300025321 | Ga0207656_10060605 | Ga0207656_100606052 | 156 |
| 152 | 3300025907 | Ga0207645_10559360 | Ga0207645_105593601 | 156 |
| 153 | 3300025908 | Ga0207643_10093916 | Ga0207643_100939161 | 156 |
| 154 | 3300025911 | Ga0207654_10017119 | Ga0207654_100171194 | 156 |
| 155 | 3300025912 | Ga0207707_10126247 | Ga0207707_101262472 | 156 |
| 156 | 3300025912 | Ga0207707_10258442 | Ga0207707_102584422 | 156 |
| 157 | 3300025913 | Ga0207695_10003454 | Ga0207695_100034544 | 156 |
| 158 | 3300025915 | Ga0207693_11306172 | Ga0207693_113061721 | 156 |
| 159 | 3300025919 | Ga0207657_10027055 | Ga0207657_100270555 | 156 |
| 160 | 3300025919 | Ga0207657_10073512 | Ga0207657_100735122 | 156 |
| 161 | 3300025920 | Ga0207649_10187114 | Ga0207649_101871142 | 156 |
| 162 | 3300025921 | Ga0207652_10198073 | Ga0207652_101980732 | 156 |
| 163 | 3300025921 | Ga0207652_10405080 | Ga0207652_104050802 | 156 |
| 164 | 3300025924 | Ga0207694_10045447 | Ga0207694_100454475 | 156 |
| 165 | 3300025926 | Ga0207659_10029223 | Ga0207659_100292233 | 156 |
| 166 | 3300025926 | Ga0207659_10097016 | Ga0207659_100970163 | 156 |
| 167 | 3300025928 | Ga0207700_11401225 | Ga0207700_114012252 | 156 |
| 168 | 3300025929 | Ga0207664_10219695 | Ga0207664_102196954 | 156 |
| 169 | 3300025931 | Ga0207644_10630953 | Ga0207644_106309532 | 156 |
| 170 | 3300025932 | Ga0207690_10205949 | Ga0207690_102059493 | 156 |
| 171 | 3300025933 | Ga0207706_10470714 | Ga0207706_104707142 | 156 |
| 172 | 3300025934 | Ga0207686_10465500 | Ga0207686_104655003 | 156 |
| 173 | 3300025936 | Ga0207670_11231501 | Ga0207670_112315012 | 156 |
| 174 | 3300025937 | Ga0207669_10250202 | Ga0207669_102502022 | 156 |
| 175 | 3300025937 | Ga0207669_10879589 | Ga0207669_108795891 | 156 |
| 176 | 3300025938 | Ga0207704_10463618 | Ga0207704_104636183 | 156 |
| 177 | 3300025940 | Ga0207691_10036165 | Ga0207691_100361655 | 156 |
| 178 | 3300025940 | Ga0207691_10055353 | Ga0207691_100553534 | 156 |
| 179 | 3300025944 | Ga0207661_10198182 | Ga0207661_101981823 | 156 |
| 180 | 3300025949 | Ga0207667_10091486 | Ga0207667_100914861 | 156 |
| 181 | 3300025949 | Ga0207667_10095357 | Ga0207667_100953574 | 156 |
| 182 | 3300025960 | Ga0207651_10208583 | Ga0207651_102085832 | 156 |
| 183 | 3300025961 | Ga0207712_11399466 | Ga0207712_113994662 | 156 |
| 184 | 3300025972 | Ga0207668_10004950 | Ga0207668_100049503 | 156 |
| 185 | 3300025972 | Ga0207668_11137673 | Ga0207668_111376731 | 156 |
| 186 | 3300025972 | Ga0207668_11464666 | Ga0207668_114646662 | 156 |
| 187 | 3300025981 | Ga0207640_10064200 | Ga0207640_100642003 | 156 |
| 188 | 3300025986 | Ga0207658_10113691 | Ga0207658_101136911 | 156 |
| 189 | 3300025986 | Ga0207658_10173405 | Ga0207658_101734052 | 156 |
| 190 | 3300026023 | Ga0207677_10846578 | Ga0207677_108465781 | 156 |
| 191 | 3300026035 | Ga0207703_10907248 | Ga0207703_109072482 | 156 |
| 192 | 3300026067 | Ga0207678_10198440 | Ga0207678_101984402 | 156 |
| 193 | 3300026078 | Ga0207702_10040144 | Ga0207702_100401442 | 156 |
| 194 | 3300026088 | Ga0207641_10794070 | Ga0207641_107940702 | 156 |
| 195 | 3300026089 | Ga0207648_10293574 | Ga0207648_102935742 | 156 |
| 196 | 3300026118 | Ga0207675_100135757 | Ga0207675_1001357572 | 156 |
| 197 | 3300026118 | Ga0207675_100203010 | Ga0207675_1002030103 | 156 |
| 198 | 3300026121 | Ga0207683_10316005 | Ga0207683_103160053 | 156 |
| 199 | 3300026142 | Ga0207698_10211718 | Ga0207698_102117182 | 156 |
| 200 | 3300026142 | Ga0207698_10754745 | Ga0207698_107547452 | 156 |
| 201 | 3300027907 | Ga0207428_10794745 | Ga0207428_107947452 | 156 |
| 202 | 3300028379 | Ga0268266_10604478 | Ga0268266_106044782 | 156 |
| 203 | 3300031595 | Ga0265313_10166573 | Ga0265313_101665732 | 156 |
| 204 | 3300031712 | Ga0265342_10036941 | Ga0265342_100369413 | 156 |
| 205 | 3300032002 | Ga0307416_100834579 | Ga0307416_1008345792 | 156 |
| 206 | 3300035118 | Ga0373954_0005287 | Ga0373954_0005287_2936_3454 | 156 |
| 207 | 3300035724 | Ga0373933_0173393 | Ga0373933_0173393_262_732 | 156 |
| 208 | 3300036401 | Ga0373937_0121600 | Ga0373937_0121600_1596_2066 | 156 |
| 209 | 3300037312 | Ga0395899_0242674 | Ga0395899_0242674_144_614 | 156 |
| 210 | 3300037418 | Ga0395900_0140524 | Ga0395900_0140524_1904_2374 | 156 |
| 211 | 3300037466 | Ga0395898_0025562 | Ga0395898_0025562_3193_3663 | 156 |
| 212 | 3300037471 | Ga0395905_0971727 | Ga0395905_0971727_213_683 | 156 |
| 213 | 3300038443 | Ga0395901_0071127 | Ga0395901_0071127_2855_3325 | 156 |
| 214 | 3300045836 | Ga0466958_0174832 | Ga0466958_0174832_220_690 | 156 |
| 215 | 3300045976 | Ga0466967_0944918 | Ga0466967_0944918_310_783 | 156 |
| 216 | 3300046454 | Ga0495592_0124858 | Ga0495592_0124858_991_1509 | 156 |
| 217 | 3300046539 | Ga0495621_0244114 | Ga0495621_0244114_113_586 | 156 |
| 218 | 3300046678 | Ga0495599_0038730 | Ga0495599_0038730_1821_2339 | 156 |
| 219 | 3300050491 | nmdc:mga00v17_137514_c1 | nmdc:mga00v17_137514_c1_699_1175 | 156 |
| 220 | 3300050493 | nmdc:mga0k408_9536_c1 | nmdc:mga0k408_9536_c1_1424_1900 | 156 |
| 221 | 3300001976 | JGI24752J21851_1031739 | JGI24752J21851_10317391 | 157 |
| 222 | 3300001977 | JGI24746J21847_1017895 | JGI24746J21847_10178951 | 157 |
| 223 | 3300001991 | JGI24743J22301_10058372 | JGI24743J22301_100583722 | 157 |
| 224 | 3300002076 | JGI24749J21850_1007123 | JGI24749J21850_10071232 | 157 |
| 225 | 3300002126 | JGI24035J26624_1017633 | JGI24035J26624_10176332 | 157 |
| 226 | 3300005290 | Ga0065712_10106723 | Ga0065712_101067232 | 157 |
| 227 | 3300005293 | Ga0065715_10467076 | Ga0065715_104670761 | 157 |
| 228 | 3300005327 | Ga0070658_10040615 | Ga0070658_100406152 | 157 |
| 229 | 3300005327 | Ga0070658_10049587 | Ga0070658_100495874 | 157 |
| 230 | 3300005328 | Ga0070676_10001017 | Ga0070676_100010177 | 157 |
| 231 | 3300005328 | Ga0070676_10027056 | Ga0070676_100270564 | 157 |
| 232 | 3300005328 | Ga0070676_10101032 | Ga0070676_101010323 | 157 |
| 233 | 3300005328 | Ga0070676_10376505 | Ga0070676_103765052 | 157 |
| 234 | 3300005329 | Ga0070683_100053239 | Ga0070683_1000532391 | 157 |
| 235 | 3300005329 | Ga0070683_100726608 | Ga0070683_1007266082 | 157 |
| 236 | 3300005329 | Ga0070683_100948042 | Ga0070683_1009480421 | 157 |
| 237 | 3300005330 | Ga0070690_100000521 | Ga0070690_10000052114 | 157 |
| 238 | 3300005330 | Ga0070690_100012188 | Ga0070690_1000121886 | 157 |
| 239 | 3300005330 | Ga0070690_100029269 | Ga0070690_1000292695 | 157 |
| 240 | 3300005331 | Ga0070670_100025429 | Ga0070670_1000254296 | 157 |
| 241 | 3300005331 | Ga0070670_100039751 | Ga0070670_1000397515 | 157 |
| 242 | 3300005331 | Ga0070670_100040658 | Ga0070670_1000406582 | 157 |
| 243 | 3300005331 | Ga0070670_100058598 | Ga0070670_1000585982 | 157 |
| 244 | 3300005331 | Ga0070670_100105401 | Ga0070670_1001054014 | 157 |
| 245 | 3300005333 | Ga0070677_10000411 | Ga0070677_1000041110 | 157 |
| 246 | 3300005333 | Ga0070677_10025678 | Ga0070677_100256783 | 157 |
| 247 | 3300005334 | Ga0068869_100003165 | Ga0068869_1000031658 | 157 |
| 248 | 3300005334 | Ga0068869_100035164 | Ga0068869_1000351643 | 157 |
| 249 | 3300005334 | Ga0068869_100091814 | Ga0068869_1000918143 | 157 |
| 250 | 3300005334 | Ga0068869_100107766 | Ga0068869_1001077661 | 157 |
| 251 | 3300005335 | Ga0070666_10014579 | Ga0070666_100145793 | 157 |
| 252 | 3300005335 | Ga0070666_10027874 | Ga0070666_100278746 | 157 |
| 253 | 3300005337 | Ga0070682_100090603 | Ga0070682_1000906032 | 157 |
| 254 | 3300005338 | Ga0068868_100071048 | Ga0068868_1000710483 | 157 |
| 255 | 3300005338 | Ga0068868_100078460 | Ga0068868_1000784602 | 157 |
| 256 | 3300005338 | Ga0068868_100174457 | Ga0068868_1001744573 | 157 |
| 257 | 3300005339 | Ga0070660_100005982 | Ga0070660_1000059821 | 157 |
| 258 | 3300005339 | Ga0070660_100093407 | Ga0070660_1000934072 | 157 |
| 259 | 3300005339 | Ga0070660_100335830 | Ga0070660_1003358302 | 157 |
| 260 | 3300005339 | Ga0070660_100414532 | Ga0070660_1004145321 | 157 |
| 261 | 3300005340 | Ga0070689_100001865 | Ga0070689_1000018653 | 157 |
| 262 | 3300005340 | Ga0070689_100022724 | Ga0070689_1000227244 | 157 |
| 263 | 3300005340 | Ga0070689_100051703 | Ga0070689_1000517033 | 157 |
| 264 | 3300005343 | Ga0070687_100021167 | Ga0070687_1000211675 | 157 |
| 265 | 3300005343 | Ga0070687_100055680 | Ga0070687_1000556803 | 157 |
| 266 | 3300005344 | Ga0070661_100000486 | Ga0070661_10000048617 | 157 |
| 267 | 3300005344 | Ga0070661_100014142 | Ga0070661_1000141425 | 157 |
| 268 | 3300005344 | Ga0070661_100019203 | Ga0070661_1000192035 | 157 |
| 269 | 3300005344 | Ga0070661_100106760 | Ga0070661_1001067603 | 157 |
| 270 | 3300005344 | Ga0070661_100140078 | Ga0070661_1001400782 | 157 |
| 271 | 3300005344 | Ga0070661_100819108 | Ga0070661_1008191081 | 157 |
| 272 | 3300005344 | Ga0070661_101344791 | Ga0070661_1013447911 | 157 |
| 273 | 3300005345 | Ga0070692_10178983 | Ga0070692_101789833 | 157 |
| 274 | 3300005347 | Ga0070668_100001274 | Ga0070668_1000012747 | 157 |
| 275 | 3300005347 | Ga0070668_100014576 | Ga0070668_1000145762 | 157 |
| 276 | 3300005347 | Ga0070668_100019216 | Ga0070668_1000192165 | 157 |
| 277 | 3300005347 | Ga0070668_100073075 | Ga0070668_1000730753 | 157 |
| 278 | 3300005347 | Ga0070668_100175533 | Ga0070668_1001755332 | 157 |
| 279 | 3300005347 | Ga0070668_100337286 | Ga0070668_1003372862 | 157 |
| 280 | 3300005353 | Ga0070669_100000411 | Ga0070669_10000041116 | 157 |
| 281 | 3300005353 | Ga0070669_100220920 | Ga0070669_1002209202 | 157 |
| 282 | 3300005353 | Ga0070669_100490406 | Ga0070669_1004904062 | 157 |
| 283 | 3300005354 | Ga0070675_100018529 | Ga0070675_1000185293 | 157 |
| 284 | 3300005354 | Ga0070675_100023462 | Ga0070675_1000234623 | 157 |
| 285 | 3300005354 | Ga0070675_100608552 | Ga0070675_1006085522 | 157 |
| 286 | 3300005354 | Ga0070675_100664711 | Ga0070675_1006647111 | 157 |
| 287 | 3300005355 | Ga0070671_100000564 | Ga0070671_10000056418 | 157 |
| 288 | 3300005355 | Ga0070671_100011838 | Ga0070671_1000118388 | 157 |
| 289 | 3300005355 | Ga0070671_100012159 | Ga0070671_1000121595 | 157 |
| 290 | 3300005355 | Ga0070671_100045506 | Ga0070671_1000455062 | 157 |
| 291 | 3300005355 | Ga0070671_100111358 | Ga0070671_1001113582 | 157 |
| 292 | 3300005355 | Ga0070671_100667769 | Ga0070671_1006677692 | 157 |
| 293 | 3300005355 | Ga0070671_101016832 | Ga0070671_1010168322 | 157 |
| 294 | 3300005356 | Ga0070674_100004476 | Ga0070674_1000044767 | 157 |
| 295 | 3300005356 | Ga0070674_100165018 | Ga0070674_1001650183 | 157 |
| 296 | 3300005364 | Ga0070673_100001499 | Ga0070673_1000014993 | 157 |
| 297 | 3300005364 | Ga0070673_100016936 | Ga0070673_1000169362 | 157 |
| 298 | 3300005364 | Ga0070673_100030647 | Ga0070673_1000306473 | 157 |
| 299 | 3300005364 | Ga0070673_100056728 | Ga0070673_1000567283 | 157 |
| 300 | 3300005364 | Ga0070673_100130389 | Ga0070673_1001303893 | 157 |
| 301 | 3300005365 | Ga0070688_100001247 | Ga0070688_1000012478 | 157 |
| 302 | 3300005365 | Ga0070688_100042516 | Ga0070688_1000425163 | 157 |
| 303 | 3300005365 | Ga0070688_100082815 | Ga0070688_1000828153 | 157 |
| 304 | 3300005365 | Ga0070688_100694049 | Ga0070688_1006940491 | 157 |
| 305 | 3300005366 | Ga0070659_100025962 | Ga0070659_1000259622 | 157 |
| 306 | 3300005366 | Ga0070659_100143240 | Ga0070659_1001432402 | 157 |
| 307 | 3300005366 | Ga0070659_100169921 | Ga0070659_1001699213 | 157 |
| 308 | 3300005366 | Ga0070659_100170222 | Ga0070659_1001702223 | 157 |
| 309 | 3300005366 | Ga0070659_100257041 | Ga0070659_1002570411 | 157 |
| 310 | 3300005366 | Ga0070659_100600200 | Ga0070659_1006002002 | 157 |
| 311 | 3300005367 | Ga0070667_100002084 | Ga0070667_10000208415 | 157 |
| 312 | 3300005367 | Ga0070667_100002948 | Ga0070667_1000029483 | 157 |
| 313 | 3300005367 | Ga0070667_100139752 | Ga0070667_1001397522 | 157 |
| 314 | 3300005367 | Ga0070667_100280319 | Ga0070667_1002803191 | 157 |
| 315 | 3300005367 | Ga0070667_101439158 | Ga0070667_1014391581 | 157 |
| 316 | 3300005406 | Ga0070703_10063910 | Ga0070703_100639101 | 157 |
| 317 | 3300005434 | Ga0070709_10525859 | Ga0070709_105258592 | 157 |
| 318 | 3300005434 | Ga0070709_10608395 | Ga0070709_106083951 | 157 |
| 319 | 3300005435 | Ga0070714_100013470 | Ga0070714_1000134703 | 157 |
| 320 | 3300005436 | Ga0070713_100005194 | Ga0070713_1000051949 | 157 |
| 321 | 3300005436 | Ga0070713_101116744 | Ga0070713_1011167441 | 157 |
| 322 | 3300005437 | Ga0070710_10005942 | Ga0070710_100059425 | 157 |
| 323 | 3300005438 | Ga0070701_10011424 | Ga0070701_100114242 | 157 |
| 324 | 3300005438 | Ga0070701_10127725 | Ga0070701_101277251 | 157 |
| 325 | 3300005439 | Ga0070711_100004130 | Ga0070711_1000041302 | 157 |
| 326 | 3300005441 | Ga0070700_100025803 | Ga0070700_1000258034 | 157 |
| 327 | 3300005444 | Ga0070694_101440884 | Ga0070694_1014408841 | 157 |
| 328 | 3300005455 | Ga0070663_100004490 | Ga0070663_1000044903 | 157 |
| 329 | 3300005455 | Ga0070663_100078580 | Ga0070663_1000785802 | 157 |
| 330 | 3300005455 | Ga0070663_100620130 | Ga0070663_1006201302 | 157 |
| 331 | 3300005456 | Ga0070678_100000428 | Ga0070678_10000042820 | 157 |
| 332 | 3300005456 | Ga0070678_100000948 | Ga0070678_10000094814 | 157 |
| 333 | 3300005456 | Ga0070678_100009922 | Ga0070678_1000099226 | 157 |
| 334 | 3300005456 | Ga0070678_100081000 | Ga0070678_1000810003 | 157 |
| 335 | 3300005457 | Ga0070662_100001187 | Ga0070662_1000011876 | 157 |
| 336 | 3300005457 | Ga0070662_100041275 | Ga0070662_1000412755 | 157 |
| 337 | 3300005457 | Ga0070662_100304460 | Ga0070662_1003044601 | 157 |
| 338 | 3300005457 | Ga0070662_100919305 | Ga0070662_1009193051 | 157 |
| 339 | 3300005458 | Ga0070681_10003192 | Ga0070681_1000319212 | 157 |
| 340 | 3300005458 | Ga0070681_10030700 | Ga0070681_100307002 | 157 |
| 341 | 3300005459 | Ga0068867_100001129 | Ga0068867_1000011299 | 157 |
| 342 | 3300005459 | Ga0068867_100065181 | Ga0068867_1000651812 | 157 |
| 343 | 3300005459 | Ga0068867_100123999 | Ga0068867_1001239992 | 157 |
| 344 | 3300005459 | Ga0068867_100232665 | Ga0068867_1002326651 | 157 |
| 345 | 3300005459 | Ga0068867_101328521 | Ga0068867_1013285211 | 157 |
| 346 | 3300005466 | Ga0070685_10002459 | Ga0070685_100024596 | 157 |
| 347 | 3300005466 | Ga0070685_10010782 | Ga0070685_100107826 | 157 |
| 348 | 3300005467 | Ga0070706_100094756 | Ga0070706_1000947563 | 157 |
| 349 | 3300005467 | Ga0070706_100214599 | Ga0070706_1002145993 | 157 |
| 350 | 3300005468 | Ga0070707_100845133 | Ga0070707_1008451331 | 157 |
| 351 | 3300005468 | Ga0070707_101034481 | Ga0070707_1010344811 | 157 |
| 352 | 3300005471 | Ga0070698_100035950 | Ga0070698_1000359505 | 157 |
| 353 | 3300005518 | Ga0070699_100406334 | Ga0070699_1004063341 | 157 |
| 354 | 3300005530 | Ga0070679_100014348 | Ga0070679_1000143483 | 157 |
| 355 | 3300005530 | Ga0070679_100070126 | Ga0070679_1000701261 | 157 |
| 356 | 3300005530 | Ga0070679_100159282 | Ga0070679_1001592824 | 157 |
| 357 | 3300005535 | Ga0070684_100021273 | Ga0070684_1000212734 | 157 |
| 358 | 3300005535 | Ga0070684_100129561 | Ga0070684_1001295614 | 157 |
| 359 | 3300005535 | Ga0070684_100368932 | Ga0070684_1003689323 | 157 |
| 360 | 3300005535 | Ga0070684_100818708 | Ga0070684_1008187082 | 157 |
| 361 | 3300005536 | Ga0070697_100016402 | Ga0070697_1000164025 | 157 |
| 362 | 3300005536 | Ga0070697_100431872 | Ga0070697_1004318722 | 157 |
| 363 | 3300005539 | Ga0068853_100003043 | Ga0068853_1000030433 | 157 |
| 364 | 3300005539 | Ga0068853_100030015 | Ga0068853_1000300154 | 157 |
| 365 | 3300005539 | Ga0068853_100168009 | Ga0068853_1001680092 | 157 |
| 366 | 3300005539 | Ga0068853_100224909 | Ga0068853_1002249093 | 157 |
| 367 | 3300005539 | Ga0068853_100305460 | Ga0068853_1003054603 | 157 |
| 368 | 3300005539 | Ga0068853_100365146 | Ga0068853_1003651461 | 157 |
| 369 | 3300005539 | Ga0068853_100877381 | Ga0068853_1008773812 | 157 |
| 370 | 3300005539 | Ga0068853_100909222 | Ga0068853_1009092221 | 157 |
| 371 | 3300005543 | Ga0070672_100005917 | Ga0070672_1000059178 | 157 |
| 372 | 3300005543 | Ga0070672_100016247 | Ga0070672_1000162473 | 157 |
| 373 | 3300005543 | Ga0070672_100240311 | Ga0070672_1002403111 | 157 |
| 374 | 3300005544 | Ga0070686_100049768 | Ga0070686_1000497684 | 157 |
| 375 | 3300005544 | Ga0070686_100178861 | Ga0070686_1001788611 | 157 |
| 376 | 3300005545 | Ga0070695_101052251 | Ga0070695_1010522511 | 157 |
| 377 | 3300005546 | Ga0070696_100487323 | Ga0070696_1004873231 | 157 |
| 378 | 3300005546 | Ga0070696_101635060 | Ga0070696_1016350601 | 157 |
| 379 | 3300005547 | Ga0070693_100006888 | Ga0070693_1000068885 | 157 |
| 380 | 3300005547 | Ga0070693_100025867 | Ga0070693_1000258672 | 157 |
| 381 | 3300005547 | Ga0070693_100034500 | Ga0070693_1000345004 | 157 |
| 382 | 3300005547 | Ga0070693_100270363 | Ga0070693_1002703631 | 157 |
| 383 | 3300005547 | Ga0070693_100350170 | Ga0070693_1003501701 | 157 |
| 384 | 3300005548 | Ga0070665_100005926 | Ga0070665_10000592615 | 157 |
| 385 | 3300005548 | Ga0070665_100012339 | Ga0070665_1000123397 | 157 |
| 386 | 3300005548 | Ga0070665_100036448 | Ga0070665_1000364484 | 157 |
| 387 | 3300005549 | Ga0070704_100536136 | Ga0070704_1005361362 | 157 |
| 388 | 3300005563 | Ga0068855_100001032 | Ga0068855_10000103237 | 157 |
| 389 | 3300005563 | Ga0068855_100034796 | Ga0068855_1000347968 | 157 |
| 390 | 3300005563 | Ga0068855_100225886 | Ga0068855_1002258863 | 157 |
| 391 | 3300005563 | Ga0068855_100769255 | Ga0068855_1007692552 | 157 |
| 392 | 3300005564 | Ga0070664_100002383 | Ga0070664_1000023837 | 157 |
| 393 | 3300005564 | Ga0070664_100014257 | Ga0070664_1000142577 | 157 |
| 394 | 3300005564 | Ga0070664_100014914 | Ga0070664_1000149144 | 157 |
| 395 | 3300005564 | Ga0070664_100031582 | Ga0070664_1000315825 | 157 |
| 396 | 3300005564 | Ga0070664_100072810 | Ga0070664_1000728105 | 157 |
| 397 | 3300005564 | Ga0070664_100113220 | Ga0070664_1001132202 | 157 |
| 398 | 3300005564 | Ga0070664_100491782 | Ga0070664_1004917822 | 157 |
| 399 | 3300005564 | Ga0070664_100811740 | Ga0070664_1008117402 | 157 |
| 400 | 3300005564 | Ga0070664_101488284 | Ga0070664_1014882841 | 157 |
| 401 | 3300005577 | Ga0068857_100002349 | Ga0068857_1000023493 | 157 |
| 402 | 3300005577 | Ga0068857_100054191 | Ga0068857_1000541913 | 157 |
| 403 | 3300005577 | Ga0068857_100231895 | Ga0068857_1002318953 | 157 |
| 404 | 3300005578 | Ga0068854_100004207 | Ga0068854_1000042074 | 157 |
| 405 | 3300005578 | Ga0068854_100012441 | Ga0068854_1000124414 | 157 |
| 406 | 3300005578 | Ga0068854_100155845 | Ga0068854_1001558452 | 157 |
| 407 | 3300005578 | Ga0068854_100231632 | Ga0068854_1002316322 | 157 |
| 408 | 3300005614 | Ga0068856_100023479 | Ga0068856_1000234794 | 157 |
| 409 | 3300005614 | Ga0068856_100063611 | Ga0068856_1000636115 | 157 |
| 410 | 3300005614 | Ga0068856_100237629 | Ga0068856_1002376292 | 157 |
| 411 | 3300005614 | Ga0068856_100437096 | Ga0068856_1004370961 | 157 |
| 412 | 3300005614 | Ga0068856_100734809 | Ga0068856_1007348092 | 157 |
| 413 | 3300005615 | Ga0070702_100005551 | Ga0070702_1000055515 | 157 |
| 414 | 3300005615 | Ga0070702_100128666 | Ga0070702_1001286663 | 157 |
| 415 | 3300005616 | Ga0068852_100001314 | Ga0068852_1000013149 | 157 |
| 416 | 3300005616 | Ga0068852_100002732 | Ga0068852_10000273213 | 157 |
| 417 | 3300005616 | Ga0068852_100022936 | Ga0068852_1000229365 | 157 |
| 418 | 3300005616 | Ga0068852_100072754 | Ga0068852_1000727543 | 157 |
| 419 | 3300005616 | Ga0068852_100350950 | Ga0068852_1003509503 | 157 |
| 420 | 3300005616 | Ga0068852_100766542 | Ga0068852_1007665421 | 157 |
| 421 | 3300005617 | Ga0068859_100000594 | Ga0068859_10000059421 | 157 |
| 422 | 3300005617 | Ga0068859_100003144 | Ga0068859_10000314413 | 157 |
| 423 | 3300005617 | Ga0068859_100068504 | Ga0068859_1000685042 | 157 |
| 424 | 3300005617 | Ga0068859_100317459 | Ga0068859_1003174592 | 157 |
| 425 | 3300005618 | Ga0068864_100015761 | Ga0068864_1000157617 | 157 |
| 426 | 3300005618 | Ga0068864_100044410 | Ga0068864_1000444103 | 157 |
| 427 | 3300005618 | Ga0068864_100098010 | Ga0068864_1000980102 | 157 |
| 428 | 3300005618 | Ga0068864_100136959 | Ga0068864_1001369592 | 157 |
| 429 | 3300005618 | Ga0068864_100334895 | Ga0068864_1003348952 | 157 |
| 430 | 3300005618 | Ga0068864_100448504 | Ga0068864_1004485042 | 157 |
| 431 | 3300005718 | Ga0068866_10002216 | Ga0068866_100022165 | 157 |
| 432 | 3300005718 | Ga0068866_10047145 | Ga0068866_100471453 | 157 |
| 433 | 3300005718 | Ga0068866_10093823 | Ga0068866_100938231 | 157 |
| 434 | 3300005718 | Ga0068866_10131084 | Ga0068866_101310841 | 157 |
| 435 | 3300005719 | Ga0068861_100018747 | Ga0068861_1000187476 | 157 |
| 436 | 3300005719 | Ga0068861_100135806 | Ga0068861_1001358063 | 157 |
| 437 | 3300005834 | Ga0068851_10006565 | Ga0068851_100065655 | 157 |
| 438 | 3300005834 | Ga0068851_10034062 | Ga0068851_100340622 | 157 |
| 439 | 3300005834 | Ga0068851_10047130 | Ga0068851_100471302 | 157 |
| 440 | 3300005834 | Ga0068851_10054503 | Ga0068851_100545034 | 157 |
| 441 | 3300005834 | Ga0068851_10202659 | Ga0068851_102026592 | 157 |
| 442 | 3300005834 | Ga0068851_10275209 | Ga0068851_102752092 | 157 |
| 443 | 3300005840 | Ga0068870_10002817 | Ga0068870_100028177 | 157 |
| 444 | 3300005840 | Ga0068870_10015713 | Ga0068870_100157132 | 157 |
| 445 | 3300005840 | Ga0068870_10594559 | Ga0068870_105945592 | 157 |
| 446 | 3300005841 | Ga0068863_100004302 | Ga0068863_1000043023 | 157 |
| 447 | 3300005841 | Ga0068863_100017463 | Ga0068863_1000174635 | 157 |
| 448 | 3300005841 | Ga0068863_100020650 | Ga0068863_1000206503 | 157 |
| 449 | 3300005841 | Ga0068863_100216115 | Ga0068863_1002161153 | 157 |
| 450 | 3300005841 | Ga0068863_100779628 | Ga0068863_1007796282 | 157 |
| 451 | 3300005841 | Ga0068863_101460989 | Ga0068863_1014609891 | 157 |
| 452 | 3300005842 | Ga0068858_100002565 | Ga0068858_1000025654 | 157 |
| 453 | 3300005842 | Ga0068858_100003040 | Ga0068858_1000030409 | 157 |
| 454 | 3300005842 | Ga0068858_100019871 | Ga0068858_1000198716 | 157 |
| 455 | 3300005842 | Ga0068858_100085273 | Ga0068858_1000852731 | 157 |
| 456 | 3300005843 | Ga0068860_100002537 | Ga0068860_1000025376 | 157 |
| 457 | 3300005843 | Ga0068860_100065222 | Ga0068860_1000652224 | 157 |
| 458 | 3300005843 | Ga0068860_100079082 | Ga0068860_1000790822 | 157 |
| 459 | 3300005843 | Ga0068860_100103291 | Ga0068860_1001032913 | 157 |
| 460 | 3300005843 | Ga0068860_100125523 | Ga0068860_1001255233 | 157 |
| 461 | 3300005844 | Ga0068862_100068229 | Ga0068862_1000682295 | 157 |
| 462 | 3300005844 | Ga0068862_100454889 | Ga0068862_1004548893 | 157 |
| 463 | 3300005844 | Ga0068862_100715505 | Ga0068862_1007155052 | 157 |
| 464 | 3300005844 | Ga0068862_100739427 | Ga0068862_1007394272 | 157 |
| 465 | 3300006163 | Ga0070715_10689223 | Ga0070715_106892231 | 157 |
| 466 | 3300006173 | Ga0070716_100038854 | Ga0070716_1000388543 | 157 |
| 467 | 3300006175 | Ga0070712_100002152 | Ga0070712_1000021527 | 157 |
| 468 | 3300006237 | Ga0097621_100001502 | Ga0097621_10000150215 | 157 |
| 469 | 3300006237 | Ga0097621_100005226 | Ga0097621_1000052266 | 157 |
| 470 | 3300006358 | Ga0068871_100009028 | Ga0068871_1000090288 | 157 |
| 471 | 3300006358 | Ga0068871_100687117 | Ga0068871_1006871172 | 157 |
| 472 | 3300006847 | Ga0075431_100784109 | Ga0075431_1007841091 | 157 |
| 473 | 3300006852 | Ga0075433_10033447 | Ga0075433_100334472 | 157 |
| 474 | 3300006871 | Ga0075434_100015476 | Ga0075434_1000154765 | 157 |
| 475 | 3300006881 | Ga0068865_100002771 | Ga0068865_1000027718 | 157 |
| 476 | 3300006881 | Ga0068865_100341340 | Ga0068865_1003413402 | 157 |
| 477 | 3300006914 | Ga0075436_100042207 | Ga0075436_1000422075 | 157 |
| 478 | 3300006914 | Ga0075436_100231125 | Ga0075436_1002311252 | 157 |
| 479 | 3300006931 | Ga0097620_100000594 | Ga0097620_10000059421 | 157 |
| 480 | 3300006931 | Ga0097620_100003144 | Ga0097620_1000031448 | 157 |
| 481 | 3300006931 | Ga0097620_100068504 | Ga0097620_1000685042 | 157 |
| 482 | 3300006931 | Ga0097620_100317431 | Ga0097620_1003174312 | 157 |
| 483 | 3300007076 | Ga0075435_100009247 | Ga0075435_1000092474 | 157 |
| 484 | 3300007076 | Ga0075435_100693867 | Ga0075435_1006938672 | 157 |
| 485 | 3300009092 | Ga0105250_10366570 | Ga0105250_103665702 | 157 |
| 486 | 3300009093 | Ga0105240_10002122 | Ga0105240_1000212212 | 157 |
| 487 | 3300009094 | Ga0111539_10099260 | Ga0111539_100992603 | 157 |
| 488 | 3300009094 | Ga0111539_10265048 | Ga0111539_102650483 | 157 |
| 489 | 3300009098 | Ga0105245_10226190 | Ga0105245_102261902 | 157 |
| 490 | 3300009098 | Ga0105245_10248045 | Ga0105245_102480453 | 157 |
| 491 | 3300009098 | Ga0105245_10501206 | Ga0105245_105012062 | 157 |
| 492 | 3300009101 | Ga0105247_10047360 | Ga0105247_100473602 | 157 |
| 493 | 3300009147 | Ga0114129_10799654 | Ga0114129_107996542 | 157 |
| 494 | 3300009148 | Ga0105243_10235689 | Ga0105243_102356893 | 157 |
| 495 | 3300009174 | Ga0105241_10010701 | Ga0105241_100107015 | 157 |
| 496 | 3300009174 | Ga0105241_10045851 | Ga0105241_100458515 | 157 |
| 497 | 3300009174 | Ga0105241_10389013 | Ga0105241_103890132 | 157 |
| 498 | 3300009176 | Ga0105242_10338886 | Ga0105242_103388862 | 157 |
| 499 | 3300009176 | Ga0105242_12542870 | Ga0105242_125428701 | 157 |
| 500 | 3300009177 | Ga0105248_10192957 | Ga0105248_101929572 | 157 |
| 501 | 3300009177 | Ga0105248_10400727 | Ga0105248_104007273 | 157 |
| 502 | 3300009177 | Ga0105248_10515319 | Ga0105248_105153192 | 157 |
| 503 | 3300009177 | Ga0105248_10870146 | Ga0105248_108701462 | 157 |
| 504 | 3300009177 | Ga0105248_11718318 | Ga0105248_117183181 | 157 |
| 505 | 3300009177 | Ga0105248_12027421 | Ga0105248_120274211 | 157 |
| 506 | 3300009545 | Ga0105237_10067547 | Ga0105237_100675474 | 157 |
| 507 | 3300009545 | Ga0105237_10516092 | Ga0105237_105160921 | 157 |
| 508 | 3300009551 | Ga0105238_10009710 | Ga0105238_1000971010 | 157 |
| 509 | 3300009551 | Ga0105238_10441453 | Ga0105238_104414531 | 157 |
| 510 | 3300009553 | Ga0105249_10182578 | Ga0105249_101825782 | 157 |
| 511 | 3300009553 | Ga0105249_11291098 | Ga0105249_112910982 | 157 |
| 512 | 3300009553 | Ga0105249_11401398 | Ga0105249_114013981 | 157 |
| 513 | 3300010375 | Ga0105239_10158693 | Ga0105239_101586933 | 157 |
| 514 | 3300010375 | Ga0105239_10362876 | Ga0105239_103628762 | 157 |
| 515 | 3300011119 | Ga0105246_10043845 | Ga0105246_100438453 | 157 |
| 516 | 3300013100 | Ga0157373_10005850 | Ga0157373_100058505 | 157 |
| 517 | 3300013100 | Ga0157373_10006334 | Ga0157373_100063344 | 157 |
| 518 | 3300013100 | Ga0157373_10171260 | Ga0157373_101712602 | 157 |
| 519 | 3300013102 | Ga0157371_10005607 | Ga0157371_100056071 | 157 |
| 520 | 3300013102 | Ga0157371_10324076 | Ga0157371_103240763 | 157 |
| 521 | 3300013102 | Ga0157371_10514690 | Ga0157371_105146902 | 157 |
| 522 | 3300013102 | Ga0157371_10557897 | Ga0157371_105578972 | 157 |
| 523 | 3300013102 | Ga0157371_10576733 | Ga0157371_105767332 | 157 |
| 524 | 3300013104 | Ga0157370_10071975 | Ga0157370_100719755 | 157 |
| 525 | 3300013104 | Ga0157370_10148013 | Ga0157370_101480134 | 157 |
| 526 | 3300013105 | Ga0157369_10001474 | Ga0157369_100014746 | 157 |
| 527 | 3300013105 | Ga0157369_10015712 | Ga0157369_100157123 | 157 |
| 528 | 3300013105 | Ga0157369_10037727 | Ga0157369_100377274 | 157 |
| 529 | 3300013105 | Ga0157369_10191838 | Ga0157369_101918384 | 157 |
| 530 | 3300013105 | Ga0157369_10478723 | Ga0157369_104787232 | 157 |
| 531 | 3300013296 | Ga0157374_10000698 | Ga0157374_100006989 | 157 |
| 532 | 3300013296 | Ga0157374_10014763 | Ga0157374_100147634 | 157 |
| 533 | 3300013296 | Ga0157374_10036838 | Ga0157374_100368385 | 157 |
| 534 | 3300013296 | Ga0157374_10070589 | Ga0157374_100705895 | 157 |
| 535 | 3300013297 | Ga0157378_10332016 | Ga0157378_103320162 | 157 |
| 536 | 3300013297 | Ga0157378_10915375 | Ga0157378_109153752 | 157 |
| 537 | 3300013297 | Ga0157378_11277041 | Ga0157378_112770412 | 157 |
| 538 | 3300013306 | Ga0163162_10122792 | Ga0163162_101227923 | 157 |
| 539 | 3300013307 | Ga0157372_10002523 | Ga0157372_100025238 | 157 |
| 540 | 3300013307 | Ga0157372_10622301 | Ga0157372_106223012 | 157 |
| 541 | 3300013307 | Ga0157372_12305295 | Ga0157372_123052952 | 157 |
| 542 | 3300013308 | Ga0157375_10011577 | Ga0157375_100115772 | 157 |
| 543 | 3300013308 | Ga0157375_10403017 | Ga0157375_104030172 | 157 |
| 544 | 3300013308 | Ga0157375_10417046 | Ga0157375_104170461 | 157 |
| 545 | 3300013308 | Ga0157375_10514904 | Ga0157375_105149042 | 157 |
| 546 | 3300013308 | Ga0157375_11081159 | Ga0157375_110811591 | 157 |
| 547 | 3300014325 | Ga0163163_10000852 | Ga0163163_100008526 | 157 |
| 548 | 3300014325 | Ga0163163_10015485 | Ga0163163_100154855 | 157 |
| 549 | 3300014325 | Ga0163163_10091741 | Ga0163163_100917413 | 157 |
| 550 | 3300014326 | Ga0157380_10152611 | Ga0157380_101526112 | 157 |
| 551 | 3300014326 | Ga0157380_12293490 | Ga0157380_122934901 | 157 |
| 552 | 3300014497 | Ga0182008_10047309 | Ga0182008_100473093 | 157 |
| 553 | 3300014745 | Ga0157377_10002528 | Ga0157377_100025285 | 157 |
| 554 | 3300014968 | Ga0157379_10004302 | Ga0157379_100043026 | 157 |
| 555 | 3300014968 | Ga0157379_10036886 | Ga0157379_100368864 | 157 |
| 556 | 3300014968 | Ga0157379_10178439 | Ga0157379_101784392 | 157 |
| 557 | 3300014968 | Ga0157379_10811404 | Ga0157379_108114042 | 157 |
| 558 | 3300014969 | Ga0157376_10167952 | Ga0157376_101679522 | 157 |
| 559 | 3300014969 | Ga0157376_10232022 | Ga0157376_102320223 | 157 |
| 560 | 3300017792 | Ga0163161_10043884 | Ga0163161_100438844 | 157 |
| 561 | 3300017792 | Ga0163161_10046765 | Ga0163161_100467653 | 157 |
| 562 | 3300017792 | Ga0163161_10072779 | Ga0163161_100727794 | 157 |
| 563 | 3300017792 | Ga0163161_10103138 | Ga0163161_101031382 | 157 |
| 564 | 3300020081 | Ga0206354_11647103 | Ga0206354_116471031 | 157 |
| 565 | 3300022467 | Ga0224712_10105938 | Ga0224712_101059382 | 157 |
| 566 | 3300025271 | Ga0207666_1002584 | Ga0207666_10025842 | 157 |
| 567 | 3300025315 | Ga0207697_10001482 | Ga0207697_100014825 | 157 |
| 568 | 3300025315 | Ga0207697_10009761 | Ga0207697_100097613 | 157 |
| 569 | 3300025321 | Ga0207656_10020022 | Ga0207656_100200222 | 157 |
| 570 | 3300025321 | Ga0207656_10176159 | Ga0207656_101761592 | 157 |
| 571 | 3300025321 | Ga0207656_10212947 | Ga0207656_102129472 | 157 |
| 572 | 3300025321 | Ga0207656_10243082 | Ga0207656_102430822 | 157 |
| 573 | 3300025321 | Ga0207656_10277215 | Ga0207656_102772152 | 157 |
| 574 | 3300025893 | Ga0207682_10000518 | Ga0207682_100005187 | 157 |
| 575 | 3300025893 | Ga0207682_10002927 | Ga0207682_100029278 | 157 |
| 576 | 3300025898 | Ga0207692_10072600 | Ga0207692_100726002 | 157 |
| 577 | 3300025899 | Ga0207642_10004680 | Ga0207642_100046805 | 157 |
| 578 | 3300025899 | Ga0207642_10069775 | Ga0207642_100697751 | 157 |
| 579 | 3300025899 | Ga0207642_10115052 | Ga0207642_101150522 | 157 |
| 580 | 3300025900 | Ga0207710_10028785 | Ga0207710_100287852 | 157 |
| 581 | 3300025901 | Ga0207688_10002094 | Ga0207688_100020948 | 157 |
| 582 | 3300025903 | Ga0207680_10024589 | Ga0207680_100245894 | 157 |
| 583 | 3300025903 | Ga0207680_10024669 | Ga0207680_100246693 | 157 |
| 584 | 3300025903 | Ga0207680_10287726 | Ga0207680_102877261 | 157 |
| 585 | 3300025905 | Ga0207685_10044048 | Ga0207685_100440482 | 157 |
| 586 | 3300025907 | Ga0207645_10000039 | Ga0207645_1000003959 | 157 |
| 587 | 3300025907 | Ga0207645_10000331 | Ga0207645_1000033134 | 157 |
| 588 | 3300025907 | Ga0207645_10003755 | Ga0207645_100037555 | 157 |
| 589 | 3300025907 | Ga0207645_10057581 | Ga0207645_100575813 | 157 |
| 590 | 3300025907 | Ga0207645_10288695 | Ga0207645_102886951 | 157 |
| 591 | 3300025907 | Ga0207645_10393413 | Ga0207645_103934132 | 157 |
| 592 | 3300025907 | Ga0207645_10763146 | Ga0207645_107631461 | 157 |
| 593 | 3300025908 | Ga0207643_10001108 | Ga0207643_100011084 | 157 |
| 594 | 3300025908 | Ga0207643_10062877 | Ga0207643_100628773 | 157 |
| 595 | 3300025908 | Ga0207643_10508492 | Ga0207643_105084921 | 157 |
| 596 | 3300025909 | Ga0207705_10024299 | Ga0207705_100242993 | 157 |
| 597 | 3300025909 | Ga0207705_10327913 | Ga0207705_103279133 | 157 |
| 598 | 3300025910 | Ga0207684_10085345 | Ga0207684_100853453 | 157 |
| 599 | 3300025910 | Ga0207684_10202051 | Ga0207684_102020513 | 157 |
| 600 | 3300025911 | Ga0207654_10571162 | Ga0207654_105711621 | 157 |
| 601 | 3300025912 | Ga0207707_10002045 | Ga0207707_100020456 | 157 |
| 602 | 3300025912 | Ga0207707_10221445 | Ga0207707_102214452 | 157 |
| 603 | 3300025913 | Ga0207695_10092644 | Ga0207695_100926443 | 157 |
| 604 | 3300025914 | Ga0207671_10037783 | Ga0207671_100377833 | 157 |
| 605 | 3300025915 | Ga0207693_10000397 | Ga0207693_1000039714 | 157 |
| 606 | 3300025916 | Ga0207663_10177716 | Ga0207663_101777162 | 157 |
| 607 | 3300025916 | Ga0207663_10451318 | Ga0207663_104513182 | 157 |
| 608 | 3300025917 | Ga0207660_10125577 | Ga0207660_101255773 | 157 |
| 609 | 3300025917 | Ga0207660_10218345 | Ga0207660_102183452 | 157 |
| 610 | 3300025918 | Ga0207662_10032953 | Ga0207662_100329531 | 157 |
| 611 | 3300025918 | Ga0207662_10061091 | Ga0207662_100610913 | 157 |
| 612 | 3300025919 | Ga0207657_10005177 | Ga0207657_1000517714 | 157 |
| 613 | 3300025919 | Ga0207657_10034155 | Ga0207657_100341552 | 157 |
| 614 | 3300025919 | Ga0207657_10041948 | Ga0207657_100419482 | 157 |
| 615 | 3300025920 | Ga0207649_10006701 | Ga0207649_100067017 | 157 |
| 616 | 3300025920 | Ga0207649_10014745 | Ga0207649_100147455 | 157 |
| 617 | 3300025920 | Ga0207649_10024595 | Ga0207649_100245953 | 157 |
| 618 | 3300025920 | Ga0207649_10068989 | Ga0207649_100689892 | 157 |
| 619 | 3300025920 | Ga0207649_10136244 | Ga0207649_101362442 | 157 |
| 620 | 3300025920 | Ga0207649_10146974 | Ga0207649_101469741 | 157 |
| 621 | 3300025920 | Ga0207649_10176551 | Ga0207649_101765512 | 157 |
| 622 | 3300025920 | Ga0207649_10646525 | Ga0207649_106465251 | 157 |
| 623 | 3300025921 | Ga0207652_10023564 | Ga0207652_100235642 | 157 |
| 624 | 3300025921 | Ga0207652_10026703 | Ga0207652_100267032 | 157 |
| 625 | 3300025922 | Ga0207646_10189148 | Ga0207646_101891481 | 157 |
| 626 | 3300025922 | Ga0207646_10553736 | Ga0207646_105537362 | 157 |
| 627 | 3300025923 | Ga0207681_10000711 | Ga0207681_100007119 | 157 |
| 628 | 3300025923 | Ga0207681_10055584 | Ga0207681_100555843 | 157 |
| 629 | 3300025923 | Ga0207681_10252038 | Ga0207681_102520382 | 157 |
| 630 | 3300025924 | Ga0207694_10001561 | Ga0207694_1000156113 | 157 |
| 631 | 3300025924 | Ga0207694_10571877 | Ga0207694_105718772 | 157 |
| 632 | 3300025925 | Ga0207650_10007591 | Ga0207650_100075912 | 157 |
| 633 | 3300025925 | Ga0207650_10027790 | Ga0207650_100277905 | 157 |
| 634 | 3300025925 | Ga0207650_10121334 | Ga0207650_101213342 | 157 |
| 635 | 3300025925 | Ga0207650_10299946 | Ga0207650_102999463 | 157 |
| 636 | 3300025926 | Ga0207659_10000435 | Ga0207659_1000043516 | 157 |
| 637 | 3300025926 | Ga0207659_10003543 | Ga0207659_100035438 | 157 |
| 638 | 3300025926 | Ga0207659_10878267 | Ga0207659_108782672 | 157 |
| 639 | 3300025926 | Ga0207659_11035843 | Ga0207659_110358432 | 157 |
| 640 | 3300025927 | Ga0207687_10000188 | Ga0207687_1000018827 | 157 |
| 641 | 3300025927 | Ga0207687_10466569 | Ga0207687_104665692 | 157 |
| 642 | 3300025928 | Ga0207700_10003118 | Ga0207700_100031189 | 157 |
| 643 | 3300025928 | Ga0207700_10274089 | Ga0207700_102740892 | 157 |
| 644 | 3300025929 | Ga0207664_10008196 | Ga0207664_100081968 | 157 |
| 645 | 3300025931 | Ga0207644_10002082 | Ga0207644_100020825 | 157 |
| 646 | 3300025931 | Ga0207644_10024417 | Ga0207644_100244174 | 157 |
| 647 | 3300025931 | Ga0207644_10044243 | Ga0207644_100442432 | 157 |
| 648 | 3300025931 | Ga0207644_10044946 | Ga0207644_100449463 | 157 |
| 649 | 3300025931 | Ga0207644_10373939 | Ga0207644_103739392 | 157 |
| 650 | 3300025932 | Ga0207690_10003168 | Ga0207690_100031683 | 157 |
| 651 | 3300025932 | Ga0207690_10099499 | Ga0207690_100994993 | 157 |
| 652 | 3300025932 | Ga0207690_10105818 | Ga0207690_101058183 | 157 |
| 653 | 3300025933 | Ga0207706_10005905 | Ga0207706_100059055 | 157 |
| 654 | 3300025933 | Ga0207706_10052956 | Ga0207706_100529562 | 157 |
| 655 | 3300025933 | Ga0207706_10074311 | Ga0207706_100743113 | 157 |
| 656 | 3300025933 | Ga0207706_10620616 | Ga0207706_106206162 | 157 |
| 657 | 3300025933 | Ga0207706_11087651 | Ga0207706_110876512 | 157 |
| 658 | 3300025934 | Ga0207686_10002345 | Ga0207686_100023459 | 157 |
| 659 | 3300025935 | Ga0207709_10118720 | Ga0207709_101187201 | 157 |
| 660 | 3300025936 | Ga0207670_10008342 | Ga0207670_100083424 | 157 |
| 661 | 3300025936 | Ga0207670_10010906 | Ga0207670_100109063 | 157 |
| 662 | 3300025936 | Ga0207670_10741503 | Ga0207670_107415032 | 157 |
| 663 | 3300025936 | Ga0207670_11660851 | Ga0207670_116608511 | 157 |
| 664 | 3300025937 | Ga0207669_10005231 | Ga0207669_100052315 | 157 |
| 665 | 3300025937 | Ga0207669_10012973 | Ga0207669_100129735 | 157 |
| 666 | 3300025937 | Ga0207669_10139070 | Ga0207669_101390703 | 157 |
| 667 | 3300025937 | Ga0207669_10806975 | Ga0207669_108069752 | 157 |
| 668 | 3300025938 | Ga0207704_10003085 | Ga0207704_100030858 | 157 |
| 669 | 3300025938 | Ga0207704_10131659 | Ga0207704_101316593 | 157 |
| 670 | 3300025939 | Ga0207665_10025204 | Ga0207665_100252044 | 157 |
| 671 | 3300025940 | Ga0207691_10000027 | Ga0207691_1000002760 | 157 |
| 672 | 3300025940 | Ga0207691_10000122 | Ga0207691_100001222 | 157 |
| 673 | 3300025940 | Ga0207691_10010048 | Ga0207691_100100487 | 157 |
| 674 | 3300025940 | Ga0207691_10037836 | Ga0207691_100378362 | 157 |
| 675 | 3300025941 | Ga0207711_10000116 | Ga0207711_1000011663 | 157 |
| 676 | 3300025941 | Ga0207711_10079743 | Ga0207711_100797433 | 157 |
| 677 | 3300025941 | Ga0207711_10188008 | Ga0207711_101880083 | 157 |
| 678 | 3300025941 | Ga0207711_10377951 | Ga0207711_103779513 | 157 |
| 679 | 3300025941 | Ga0207711_11414844 | Ga0207711_114148441 | 157 |
| 680 | 3300025942 | Ga0207689_10001927 | Ga0207689_100019275 | 157 |
| 681 | 3300025942 | Ga0207689_10004633 | Ga0207689_100046339 | 157 |
| 682 | 3300025942 | Ga0207689_10057760 | Ga0207689_100577604 | 157 |
| 683 | 3300025944 | Ga0207661_10053518 | Ga0207661_100535185 | 157 |
| 684 | 3300025944 | Ga0207661_11236327 | Ga0207661_112363272 | 157 |
| 685 | 3300025944 | Ga0207661_11593749 | Ga0207661_115937492 | 157 |
| 686 | 3300025945 | Ga0207679_10005843 | Ga0207679_100058435 | 157 |
| 687 | 3300025945 | Ga0207679_10028613 | Ga0207679_100286135 | 157 |
| 688 | 3300025945 | Ga0207679_10067729 | Ga0207679_100677292 | 157 |
| 689 | 3300025945 | Ga0207679_10169716 | Ga0207679_101697163 | 157 |
| 690 | 3300025945 | Ga0207679_10238564 | Ga0207679_102385642 | 157 |
| 691 | 3300025945 | Ga0207679_10852541 | Ga0207679_108525411 | 157 |
| 692 | 3300025949 | Ga0207667_10017510 | Ga0207667_100175101 | 157 |
| 693 | 3300025949 | Ga0207667_10133338 | Ga0207667_101333382 | 157 |
| 694 | 3300025949 | Ga0207667_10186486 | Ga0207667_101864862 | 157 |
| 695 | 3300025949 | Ga0207667_10312139 | Ga0207667_103121391 | 157 |
| 696 | 3300025960 | Ga0207651_10003529 | Ga0207651_100035292 | 157 |
| 697 | 3300025960 | Ga0207651_10005037 | Ga0207651_100050372 | 157 |
| 698 | 3300025960 | Ga0207651_10018755 | Ga0207651_100187554 | 157 |
| 699 | 3300025960 | Ga0207651_10274450 | Ga0207651_102744502 | 157 |
| 700 | 3300025961 | Ga0207712_10188819 | Ga0207712_101888193 | 157 |
| 701 | 3300025961 | Ga0207712_10975016 | Ga0207712_109750162 | 157 |
| 702 | 3300025972 | Ga0207668_10001770 | Ga0207668_100017708 | 157 |
| 703 | 3300025972 | Ga0207668_10007868 | Ga0207668_100078683 | 157 |
| 704 | 3300025972 | Ga0207668_10008608 | Ga0207668_100086088 | 157 |
| 705 | 3300025972 | Ga0207668_10066008 | Ga0207668_100660083 | 157 |
| 706 | 3300025972 | Ga0207668_10140462 | Ga0207668_101404623 | 157 |
| 707 | 3300025972 | Ga0207668_10180606 | Ga0207668_101806063 | 157 |
| 708 | 3300025981 | Ga0207640_10005623 | Ga0207640_100056234 | 157 |
| 709 | 3300025981 | Ga0207640_10016370 | Ga0207640_100163703 | 157 |
| 710 | 3300025981 | Ga0207640_10022734 | Ga0207640_100227345 | 157 |
| 711 | 3300025981 | Ga0207640_10036621 | Ga0207640_100366212 | 157 |
| 712 | 3300025981 | Ga0207640_10112029 | Ga0207640_101120293 | 157 |
| 713 | 3300025986 | Ga0207658_10000682 | Ga0207658_1000068217 | 157 |
| 714 | 3300025986 | Ga0207658_10002227 | Ga0207658_100022277 | 157 |
| 715 | 3300025986 | Ga0207658_10006279 | Ga0207658_100062798 | 157 |
| 716 | 3300025986 | Ga0207658_10175734 | Ga0207658_101757343 | 157 |
| 717 | 3300025986 | Ga0207658_10334372 | Ga0207658_103343722 | 157 |
| 718 | 3300025986 | Ga0207658_10601521 | Ga0207658_106015211 | 157 |
| 719 | 3300025986 | Ga0207658_10693221 | Ga0207658_106932212 | 157 |
| 720 | 3300026023 | Ga0207677_10000598 | Ga0207677_1000059819 | 157 |
| 721 | 3300026023 | Ga0207677_10043540 | Ga0207677_100435402 | 157 |
| 722 | 3300026023 | Ga0207677_10350957 | Ga0207677_103509572 | 157 |
| 723 | 3300026035 | Ga0207703_10000357 | Ga0207703_1000035715 | 157 |
| 724 | 3300026035 | Ga0207703_10004607 | Ga0207703_1000460710 | 157 |
| 725 | 3300026035 | Ga0207703_10071612 | Ga0207703_100716124 | 157 |
| 726 | 3300026035 | Ga0207703_10312233 | Ga0207703_103122333 | 157 |
| 727 | 3300026041 | Ga0207639_10022564 | Ga0207639_100225644 | 157 |
| 728 | 3300026041 | Ga0207639_10125898 | Ga0207639_101258982 | 157 |
| 729 | 3300026041 | Ga0207639_10160019 | Ga0207639_101600193 | 157 |
| 730 | 3300026041 | Ga0207639_10403246 | Ga0207639_104032462 | 157 |
| 731 | 3300026067 | Ga0207678_10005532 | Ga0207678_1000553214 | 157 |
| 732 | 3300026067 | Ga0207678_10009735 | Ga0207678_100097356 | 157 |
| 733 | 3300026067 | Ga0207678_10043974 | Ga0207678_100439745 | 157 |
| 734 | 3300026067 | Ga0207678_10084148 | Ga0207678_100841483 | 157 |
| 735 | 3300026067 | Ga0207678_10215439 | Ga0207678_102154391 | 157 |
| 736 | 3300026067 | Ga0207678_10659258 | Ga0207678_106592582 | 157 |
| 737 | 3300026067 | Ga0207678_11157097 | Ga0207678_111570972 | 157 |
| 738 | 3300026075 | Ga0207708_10016592 | Ga0207708_100165925 | 157 |
| 739 | 3300026075 | Ga0207708_10641542 | Ga0207708_106415421 | 157 |
| 740 | 3300026078 | Ga0207702_10015836 | Ga0207702_100158367 | 157 |
| 741 | 3300026078 | Ga0207702_10029001 | Ga0207702_100290015 | 157 |
| 742 | 3300026078 | Ga0207702_10137718 | Ga0207702_101377182 | 157 |
| 743 | 3300026078 | Ga0207702_10417567 | Ga0207702_104175672 | 157 |
| 744 | 3300026088 | Ga0207641_10002436 | Ga0207641_100024368 | 157 |
| 745 | 3300026088 | Ga0207641_10004735 | Ga0207641_100047359 | 157 |
| 746 | 3300026088 | Ga0207641_10249091 | Ga0207641_102490913 | 157 |
| 747 | 3300026088 | Ga0207641_10276493 | Ga0207641_102764931 | 157 |
| 748 | 3300026088 | Ga0207641_10365834 | Ga0207641_103658342 | 157 |
| 749 | 3300026088 | Ga0207641_11339672 | Ga0207641_113396721 | 157 |
| 750 | 3300026088 | Ga0207641_11400887 | Ga0207641_114008871 | 157 |
| 751 | 3300026089 | Ga0207648_10000149 | Ga0207648_1000014926 | 157 |
| 752 | 3300026089 | Ga0207648_10006522 | Ga0207648_100065229 | 157 |
| 753 | 3300026089 | Ga0207648_10039889 | Ga0207648_100398895 | 157 |
| 754 | 3300026089 | Ga0207648_10464201 | Ga0207648_104642011 | 157 |
| 755 | 3300026095 | Ga0207676_10000236 | Ga0207676_1000023629 | 157 |
| 756 | 3300026095 | Ga0207676_10013826 | Ga0207676_100138264 | 157 |
| 757 | 3300026095 | Ga0207676_10026292 | Ga0207676_100262923 | 157 |
| 758 | 3300026095 | Ga0207676_10029837 | Ga0207676_100298373 | 157 |
| 759 | 3300026095 | Ga0207676_10029999 | Ga0207676_100299993 | 157 |
| 760 | 3300026116 | Ga0207674_10000694 | Ga0207674_1000069426 | 157 |
| 761 | 3300026116 | Ga0207674_10005278 | Ga0207674_1000527815 | 157 |
| 762 | 3300026116 | Ga0207674_10167026 | Ga0207674_101670263 | 157 |
| 763 | 3300026116 | Ga0207674_10173302 | Ga0207674_101733022 | 157 |
| 764 | 3300026118 | Ga0207675_100000871 | Ga0207675_10000087112 | 157 |
| 765 | 3300026118 | Ga0207675_100023629 | Ga0207675_1000236293 | 157 |
| 766 | 3300026118 | Ga0207675_100180865 | Ga0207675_1001808652 | 157 |
| 767 | 3300026118 | Ga0207675_100436814 | Ga0207675_1004368142 | 157 |
| 768 | 3300026121 | Ga0207683_10000005 | Ga0207683_1000000524 | 157 |
| 769 | 3300026121 | Ga0207683_10000061 | Ga0207683_1000006163 | 157 |
| 770 | 3300026121 | Ga0207683_10030161 | Ga0207683_100301615 | 157 |
| 771 | 3300026121 | Ga0207683_10087067 | Ga0207683_100870672 | 157 |
| 772 | 3300026142 | Ga0207698_10017048 | Ga0207698_100170483 | 157 |
| 773 | 3300026142 | Ga0207698_10021865 | Ga0207698_100218655 | 157 |
| 774 | 3300026142 | Ga0207698_10144635 | Ga0207698_101446351 | 157 |
| 775 | 3300026142 | Ga0207698_10286049 | Ga0207698_102860492 | 157 |
| 776 | 3300026142 | Ga0207698_10320622 | Ga0207698_103206222 | 157 |
| 777 | 3300026142 | Ga0207698_10535342 | Ga0207698_105353421 | 157 |
| 778 | 3300027360 | Ga0209969_1006601 | Ga0209969_10066012 | 157 |
| 779 | 3300027526 | Ga0209968_1025339 | Ga0209968_10253392 | 157 |
| 780 | 3300027552 | Ga0209982_1019229 | Ga0209982_10192292 | 157 |
| 781 | 3300027665 | Ga0209983_1088401 | Ga0209983_10884012 | 157 |
| 782 | 3300027682 | Ga0209971_1005246 | Ga0209971_10052463 | 157 |
| 783 | 3300027695 | Ga0209966_1046035 | Ga0209966_10460351 | 157 |
| 784 | 3300027876 | Ga0209974_10000218 | Ga0209974_100002187 | 157 |
| 785 | 3300027907 | Ga0207428_10723112 | Ga0207428_107231121 | 157 |
| 786 | 3300028379 | Ga0268266_10013747 | Ga0268266_100137472 | 157 |
| 787 | 3300028379 | Ga0268266_10027741 | Ga0268266_100277413 | 157 |
| 788 | 3300028379 | Ga0268266_10035967 | Ga0268266_100359675 | 157 |
| 789 | 3300028380 | Ga0268265_10061114 | Ga0268265_100611143 | 157 |
| 790 | 3300028380 | Ga0268265_10267511 | Ga0268265_102675112 | 157 |
| 791 | 3300028381 | Ga0268264_10004572 | Ga0268264_100045728 | 157 |
| 792 | 3300028381 | Ga0268264_10015489 | Ga0268264_100154893 | 157 |
| 793 | 3300028381 | Ga0268264_10023690 | Ga0268264_100236905 | 157 |
| 794 | 3300028381 | Ga0268264_10148586 | Ga0268264_101485863 | 157 |
| 795 | 3300031548 | Ga0307408_100048361 | Ga0307408_1000483615 | 157 |
| 796 | 3300031548 | Ga0307408_100424552 | Ga0307408_1004245521 | 157 |
| 797 | 3300031731 | Ga0307405_10021490 | Ga0307405_100214902 | 157 |
| 798 | 3300031731 | Ga0307405_11017543 | Ga0307405_110175431 | 157 |
| 799 | 3300031824 | Ga0307413_10013563 | Ga0307413_100135633 | 157 |
| 800 | 3300031824 | Ga0307413_10127914 | Ga0307413_101279143 | 157 |
| 801 | 3300031852 | Ga0307410_10001942 | Ga0307410_100019427 | 157 |
| 802 | 3300031901 | Ga0307406_10046892 | Ga0307406_100468923 | 157 |
| 803 | 3300031901 | Ga0307406_10074478 | Ga0307406_100744783 | 157 |
| 804 | 3300031901 | Ga0307406_10843815 | Ga0307406_108438152 | 157 |
| 805 | 3300031903 | Ga0307407_10060794 | Ga0307407_100607943 | 157 |
| 806 | 3300031911 | Ga0307412_10076144 | Ga0307412_100761443 | 157 |
| 807 | 3300031911 | Ga0307412_10280072 | Ga0307412_102800721 | 157 |
| 808 | 3300031995 | Ga0307409_100035247 | Ga0307409_1000352472 | 157 |
| 809 | 3300031995 | Ga0307409_100035342 | Ga0307409_1000353422 | 157 |
| 810 | 3300032002 | Ga0307416_100017374 | Ga0307416_1000173743 | 157 |
| 811 | 3300032002 | Ga0307416_100068575 | Ga0307416_1000685752 | 157 |
| 812 | 3300032002 | Ga0307416_101812549 | Ga0307416_1018125492 | 157 |
| 813 | 3300032004 | Ga0307414_10227770 | Ga0307414_102277702 | 157 |
| 814 | 3300032004 | Ga0307414_10273454 | Ga0307414_102734542 | 157 |
| 815 | 3300032005 | Ga0307411_10000127 | Ga0307411_100001275 | 157 |
| 816 | 3300032005 | Ga0307411_10273507 | Ga0307411_102735072 | 157 |
| 817 | 3300035086 | Ga0373934_0000450 | Ga0373934_0000450_1703_2176 | 157 |
| 818 | 3300035116 | Ga0373945_0084556 | Ga0373945_0084556_457_930 | 157 |
| 819 | 3300035117 | Ga0373953_0140864 | Ga0373953_0140864_429_902 | 157 |
| 820 | 3300035118 | Ga0373954_0000090 | Ga0373954_0000090_11919_12392 | 157 |
| 821 | 3300035119 | Ga0373956_0058736 | Ga0373956_0058736_1160_1633 | 157 |
| 822 | 3300035119 | Ga0373956_0066484 | Ga0373956_0066484_547_1020 | 157 |
| 823 | 3300035120 | Ga0373957_0001365 | Ga0373957_0001365_3494_3967 | 157 |
| 824 | 3300035120 | Ga0373957_0030900 | Ga0373957_0030900_951_1424 | 157 |
| 825 | 3300035170 | Ga0373943_0335190 | Ga0373943_0335190_213_686 | 157 |
| 826 | 3300035170 | Ga0373943_0456629 | Ga0373943_0456629_100_573 | 157 |
| 827 | 3300035171 | Ga0373946_0065115 | Ga0373946_0065115_177_650 | 157 |
| 828 | 3300035172 | Ga0373955_0002225 | Ga0373955_0002225_1875_2348 | 157 |
| 829 | 3300035172 | Ga0373955_0247100 | Ga0373955_0247100_378_851 | 157 |
| 830 | 3300035691 | Ga0373931_0125424 | Ga0373931_0125424_118_591 | 157 |
| 831 | 3300035691 | Ga0373931_0719612 | Ga0373931_0719612_165_641 | 157 |
| 832 | 3300035692 | Ga0373935_0662166 | Ga0373935_0662166_170_643 | 157 |
| 833 | 3300035695 | Ga0373927_0208736 | Ga0373927_0208736_349_822 | 157 |
| 834 | 3300035724 | Ga0373933_0117062 | Ga0373933_0117062_730_1203 | 157 |
| 835 | 3300035725 | Ga0373947_0263086 | Ga0373947_0263086_61_534 | 157 |
| 836 | 3300036401 | Ga0373937_0014898 | Ga0373937_0014898_407_880 | 157 |
| 837 | 3300036401 | Ga0373937_0016168 | Ga0373937_0016168_91_564 | 157 |
| 838 | 3300036401 | Ga0373937_0191538 | Ga0373937_0191538_758_1231 | 157 |
| 839 | 3300036401 | Ga0373937_0971568 | Ga0373937_0971568_41_517 | 157 |
| 840 | 3300036401 | Ga0373937_1056531 | Ga0373937_1056531_40_516 | 157 |
| 841 | 3300037068 | Ga0373925_0008046 | Ga0373925_0008046_780_1253 | 157 |
| 842 | 3300037068 | Ga0373925_0459044 | Ga0373925_0459044_523_996 | 157 |
| 843 | 3300039437 | Ga0436365_0678556 | Ga0436365_0678556_560_1138 | 157 |
| 844 | 3300041512 | Ga0451853_3036030 | Ga0451853_3036030_528_1001 | 157 |
| 845 | 3300042012 | Ga0439455_0152223 | Ga0439455_0152223_72_548 | 157 |
| 846 | 3300044842 | Ga0466957_0592391 | Ga0466957_0592391_277_753 | 157 |
| 847 | 3300046454 | Ga0495592_0289485 | Ga0495592_0289485_231_704 | 157 |
| 848 | 3300046472 | Ga0495580_0049434 | Ga0495580_0049434_256_729 | 157 |
| 849 | 3300046516 | Ga0495628_0258525 | Ga0495628_0258525_415_888 | 157 |
| 850 | 3300046535 | Ga0495586_0496317 | Ga0495586_0496317_184_657 | 157 |
| 851 | 3300046539 | Ga0495621_0035570 | Ga0495621_0035570_714_1187 | 157 |
| 852 | 3300046559 | Ga0495667_0086577 | Ga0495667_0086577_386_859 | 157 |
| 853 | 3300046683 | Ga0495658_0133938 | Ga0495658_0133938_907_1380 | 157 |
| 854 | 3300046683 | Ga0495658_0294975 | Ga0495658_0294975_43_516 | 157 |
| 855 | 3300048903 | Ga0496100_0105039 | Ga0496100_0105039_619_1095 | 157 |
| 856 | 3300048903 | Ga0496100_0385832 | Ga0496100_0385832_511_984 | 157 |
| 857 | 3300048904 | Ga0496101_0043820 | Ga0496101_0043820_174_647 | 157 |
| 858 | 3300048905 | Ga0496102_0227108 | Ga0496102_0227108_128_604 | 157 |
| 859 | 3300048905 | Ga0496102_0621517 | Ga0496102_0621517_403_876 | 157 |
| 860 | 3300048907 | Ga0496104_0004741 | Ga0496104_0004741_6883_7356 | 157 |
| 861 | 3300048907 | Ga0496104_0054859 | Ga0496104_0054859_2328_2801 | 157 |
| 862 | 3300048908 | Ga0496105_0054554 | Ga0496105_0054554_2709_3182 | 157 |
| 863 | 3300048908 | Ga0496105_0396843 | Ga0496105_0396843_419_892 | 157 |
| 864 | 3300048909 | Ga0496106_0021506 | Ga0496106_0021506_1157_1633 | 157 |
| 865 | 3300048909 | Ga0496106_0603830 | Ga0496106_0603830_350_823 | 157 |
| 866 | 3300048909 | Ga0496106_0948459 | Ga0496106_0948459_171_644 | 157 |
| 867 | 3300048910 | Ga0496107_0009831 | Ga0496107_0009831_1427_1900 | 157 |
| 868 | 3300048910 | Ga0496107_0022469 | Ga0496107_0022469_771_1247 | 157 |
| 869 | 3300048911 | Ga0496108_0001943 | Ga0496108_0001943_13850_14323 | 157 |
| 870 | 3300048911 | Ga0496108_0084716 | Ga0496108_0084716_795_1268 | 157 |
| 871 | 3300048911 | Ga0496108_0441073 | Ga0496108_0441073_359_832 | 157 |
| 872 | 3300048912 | Ga0496109_0003388 | Ga0496109_0003388_69_542 | 157 |
| 873 | 3300048912 | Ga0496109_0476365 | Ga0496109_0476365_228_704 | 157 |
| 874 | 3300048913 | Ga0496110_0006654 | Ga0496110_0006654_7278_7751 | 157 |
| 875 | 3300048913 | Ga0496110_1123709 | Ga0496110_1123709_207_683 | 157 |
| 876 | 3300048914 | Ga0496111_0032443 | Ga0496111_0032443_234_707 | 157 |
| 877 | 3300048914 | Ga0496111_0460520 | Ga0496111_0460520_338_811 | 157 |
| 878 | 3300048915 | Ga0496112_0000540 | Ga0496112_0000540_10944_11417 | 157 |
| 879 | 3300048915 | Ga0496112_0031075 | Ga0496112_0031075_2114_2587 | 157 |
| 880 | 3300048916 | Ga0496113_0065055 | Ga0496113_0065055_629_1102 | 157 |
| 881 | 3300048916 | Ga0496113_1335012 | Ga0496113_1335012_26_499 | 157 |
| 882 | 3300048917 | Ga0496114_0021658 | Ga0496114_0021658_314_787 | 157 |
| 883 | 3300049586 | Ga0501070_0168367 | Ga0501070_0168367_914_1399 | 157 |
| 884 | 3300049588 | Ga0501072_0121924 | Ga0501072_0121924_569_1054 | 157 |
| 885 | 3300049589 | Ga0501073_0006351 | Ga0501073_0006351_145_630 | 157 |
| 886 | 3300049590 | Ga0501074_0025248 | Ga0501074_0025248_138_623 | 157 |
| 887 | 3300049742 | Ga0501080_0003122 | Ga0501080_0003122_12522_13007 | 157 |
| 888 | 3300049742 | Ga0501080_0652128 | Ga0501080_0652128_52_537 | 157 |
| 889 | 3300049744 | Ga0501083_0016009 | Ga0501083_0016009_309_794 | 157 |
| 890 | 3300049744 | Ga0501083_0114806 | Ga0501083_0114806_787_1272 | 157 |
| 891 | 3300049824 | Ga0501045_1014422 | Ga0501045_1014422_112_588 | 157 |
| 892 | 3300050511 | nmdc:mga08y16_323454_c1 | nmdc:mga08y16_323454_c1_752_1228 | 157 |
| 893 | 3300050511 | nmdc:mga08y16_452107_c1 | nmdc:mga08y16_452107_c1_223_696 | 157 |
| 894 | 3300050512 | nmdc:mga0n895_691463_c1 | nmdc:mga0n895_691463_c1_157_630 | 157 |
| 895 | 3300050512 | nmdc:mga0n895_96099_c1 | nmdc:mga0n895_96099_c1_427_906 | 157 |
| 896 | 3300050513 | nmdc:mga0rr50_31760_c1 | nmdc:mga0rr50_31760_c1_562_1041 | 157 |
| 897 | 3300050515 | nmdc:mga0a205_4266_c1 | nmdc:mga0a205_4266_c1_8512_8991 | 157 |
| 898 | 3300053078 | Ga0495612_0020216 | Ga0495612_0020216_881_1354 | 157 |
| 899 | 3300053085 | Ga0495619_0394938 | Ga0495619_0394938_216_689 | 157 |
| 900 | 3300060353 | Ga0501082_1116836 | Ga0501082_1116836_29_514 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nnc-assembly1.cif.gz_A | structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum | 0.8656 | 47 | 151 |
| 4uwq-assembly1.cif.gz_K | crystal structure of the disulfide-linked complex of the thiosulfodyrolase soxb with the carrier-protein soxyz from thermus thermophilus | 0.8381 | 59 | 155 |
| 4brj-assembly1.cif.gz_A | superoxide reductase (neelaredoxin) from ignicoccus hospitalis t24k | 0.8367 | 65 | 150 |
| 2nnc-assembly1.cif.gz_A | structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum | 0.8218 | 47 | 151 |
| 2oxh-assembly3.cif.gz_D | the soxyz complex of paracoccus pantotrophus | 0.8178 | 46 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8656 | 47 | 151 | 2.60.40.2470 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8218 | 47 | 151 | 2.60.40.2470 |
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8141 | 46 | 153 | 2.60.40.2470 |
| 2ox5B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8006 | 46 | 153 | 2.60.40.2470 |
| af_Q9NFV8_406_499_2.60.40.1930 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.7753 | 65 | 150 | 2.60.40.1930 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9DL54-F1-model_v4 | deleted | 0.9025 | 57 | 150 |
|
| AF-A0A7Y3IVM2-F1-model_v4 | Ig-like SoxY domain-containing protein | 0.9008 | 42 | 153 |
|
| AF-A0A537D0A5-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.8992 | 41 | 156 |
|
| AF-A0A7C5H134-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.8971 | 42 | 156 |
|
| AF-A0A831W176-F1-model_v4 | Thiosulfate oxidation carrier protein SoxY | 0.8899 | 75 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar