F485145

General Info

Members Datasets Scaffolds Average Seq Length
900 313 1800 279

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10040504|Ga0207645_100405041
Length 301
Sequence MRLGRIPWINCYPVYGAIDRGIVPMSAELVDGVPTALNHEMKLGTLDVSVISAVEYARDSTKYLLLPDLSICSDGPVRSVVLFSKRPASDLQGRRVLVSRSSMTSVALLELLFENVWDAKPAFVPSNSELSDIARFGEEEHDARLVIGDAALHLWSRLRSPELYPDDAGLTNYRYAYDLGGEWKRWTDLPFVFAVWVAQRTTPVAEALGVHAGLIASRDWGLQHLETLAAQAAIATGVHKNVCLEYLSGLDYGLSYQHLAGLTEFFRRLVAAGKVPNGSLAFLPADLLDAFRFGTGGAALL

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.11
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10040504 3300025907 Bacteria 2983
2 MBSR1b_contig_8577748 2162886012 Unclassified 1203
3 MBSR1b_contig_8722026 2162886012 Bacteria 1204
4 JGI25406J46586_10003355 3300003203 Bacteria 7540
5 Ga0065715_10002333 3300005293 Bacteria 5295
6 Ga0065715_10089503 3300005293 Bacteria 9808
7 Ga0065715_10090989 3300005293 Bacteria 6241
8 Ga0065707_10191026 3300005295 Bacteria 1361
9 Ga0070658_10011273 3300005327 Bacteria 7164
10 Ga0070658_10043599 3300005327 Bacteria 3623
11 Ga0070658_10135764 3300005327 Bacteria 2052
12 Ga0070676_10003376 3300005328 Bacteria 8313
13 Ga0070676_10009490 3300005328 Bacteria 5256
14 Ga0070676_10032310 3300005328 Bacteria 2998
15 Ga0070676_10045529 3300005328 Bacteria 2556
16 Ga0070683_100002685 3300005329 Bacteria 14217
17 Ga0070683_100008944 3300005329 Bacteria 8535
18 Ga0070683_100013557 3300005329 Bacteria 7112
19 Ga0070683_100028453 3300005329 Bacteria 5051
20 Ga0070683_100033449 3300005329 Bacteria 4688
21 Ga0070683_100049546 3300005329 Bacteria 3885
22 Ga0070683_100055897 3300005329 Bacteria 3664
23 Ga0070683_100147755 3300005329 Bacteria 2228
24 Ga0070683_100199202 3300005329 Bacteria 1902
25 Ga0070683_100209431 3300005329 Bacteria 1852
26 Ga0070683_100350691 3300005329 Bacteria 1405
27 Ga0070683_100420592 3300005329 Bacteria 1275
28 Ga0070683_100751778 3300005329 Unclassified 934
29 Ga0070690_100115424 3300005330 Bacteria 1796
30 Ga0070690_100118653 3300005330 Bacteria 1774
31 Ga0070690_100207317 3300005330 Bacteria 1367
32 Ga0070670_100019709 3300005331 Bacteria 5791
33 Ga0070670_100150417 3300005331 Bacteria 2015
34 Ga0070670_100270426 3300005331 Bacteria 1483
35 Ga0070670_100387013 3300005331 Bacteria 1233
36 Ga0070680_100001576 3300005336 Bacteria 16636
37 Ga0070680_100002007 3300005336 Bacteria 14992
38 Ga0070680_100003449 3300005336 Bacteria 11798
39 Ga0070680_100004265 3300005336 Bacteria 10734
40 Ga0070680_100010037 3300005336 Bacteria 7294
41 Ga0070680_100018513 3300005336 Bacteria 5504
42 Ga0070680_100030167 3300005336 Bacteria 4356
43 Ga0070680_100041594 3300005336 Bacteria 3726
44 Ga0070680_100065488 3300005336 Bacteria 2978
45 Ga0070680_100133834 3300005336 Bacteria 2075
46 Ga0070680_100314068 3300005336 Bacteria 1330
47 Ga0070682_100001764 3300005337 Bacteria 12048
48 Ga0070682_100003131 3300005337 Bacteria 9167
49 Ga0070682_100004688 3300005337 Bacteria 7597
50 Ga0070682_100004795 3300005337 Bacteria 7512
51 Ga0068868_100004512 3300005338 Bacteria 9766
52 Ga0068868_100021662 3300005338 Bacteria 4841
53 Ga0068868_100089634 3300005338 Bacteria 2476
54 Ga0068868_100163108 3300005338 Bacteria 1842
55 Ga0068868_100193724 3300005338 Bacteria 1691
56 Ga0070660_100061858 3300005339 Bacteria 2907
57 Ga0070660_100237794 3300005339 Bacteria 1483
58 Ga0070691_10037607 3300005341 Bacteria 2284
59 Ga0070691_10101453 3300005341 Bacteria 1430
60 Ga0070691_10110246 3300005341 Bacteria 1376
61 Ga0070661_100000287 3300005344 Bacteria 40709
62 Ga0070661_100079613 3300005344 Bacteria 2418
63 Ga0070661_100203907 3300005344 Bacteria 1512
64 Ga0070661_100222626 3300005344 Bacteria 1448
65 Ga0070661_100261708 3300005344 Bacteria 1337
66 Ga0070661_100315920 3300005344 Bacteria 1219
67 Ga0070692_10040969 3300005345 Bacteria 2371
68 Ga0070668_100129861 3300005347 Bacteria 2021
69 Ga0070669_100001817 3300005353 Bacteria 15371
70 Ga0070675_100021685 3300005354 Bacteria 5132
71 Ga0070675_100024935 3300005354 Bacteria 4793
72 Ga0070675_100113334 3300005354 Bacteria 2296
73 Ga0070675_100264318 3300005354 Bacteria 1509
74 Ga0070675_100633891 3300005354 Bacteria 971
75 Ga0070671_100023711 3300005355 Bacteria 5024
76 Ga0070671_100157583 3300005355 Bacteria 1918
77 Ga0070671_100295859 3300005355 Bacteria 1378
78 Ga0070674_100220947 3300005356 Bacteria 1474
79 Ga0070674_100337982 3300005356 Bacteria 1212
80 Ga0070673_100019114 3300005364 Bacteria 4915
81 Ga0070673_100033087 3300005364 Bacteria 3899
82 Ga0070673_100166875 3300005364 Bacteria 1877
83 Ga0070673_100324384 3300005364 Bacteria 1361
84 Ga0070673_100347235 3300005364 Bacteria 1316
85 Ga0070688_100022562 3300005365 Bacteria 3691
86 Ga0070688_100159960 3300005365 Bacteria 1547
87 Ga0070659_100000726 3300005366 Bacteria 23942
88 Ga0070667_100051656 3300005367 Bacteria 3466
89 Ga0070667_100119380 3300005367 Bacteria 2293
90 Ga0070667_100515717 3300005367 Bacteria 1097
91 Ga0070709_10032261 3300005434 Bacteria 3156
92 Ga0070709_10081591 3300005434 Bacteria 2111
93 Ga0070714_100260846 3300005435 Bacteria 1605
94 Ga0070713_100032226 3300005436 Bacteria 4184
95 Ga0070710_10019174 3300005437 Bacteria 3532
96 Ga0070710_10357180 3300005437 Unclassified 969
97 Ga0070711_100000573 3300005439 Bacteria 19204
98 Ga0070711_100336977 3300005439 Bacteria 1209
99 Ga0070705_100002147 3300005440 Bacteria 10027
100 Ga0070705_100111299 3300005440 Unclassified 1750
101 Ga0070705_100132815 3300005440 Bacteria 1626
102 Ga0070700_100061191 3300005441 Bacteria 2375
103 Ga0070700_100202962 3300005441 Unclassified 1394
104 Ga0070694_100076861 3300005444 Bacteria 2312
105 Ga0070708_100000086 3300005445 Bacteria 61026
106 Ga0070708_100000265 3300005445 Bacteria 38895
107 Ga0070708_100004934 3300005445 Bacteria 10550
108 Ga0070708_100009641 3300005445 Bacteria 7788
109 Ga0070708_100230064 3300005445 Bacteria 1739
110 Ga0070662_100015423 3300005457 Bacteria 5118
111 Ga0070662_100043224 3300005457 Bacteria 3222
112 Ga0070662_100065520 3300005457 Bacteria 2663
113 Ga0070681_10000220 3300005458 Bacteria 44725
114 Ga0070681_10000222 3300005458 Bacteria 44616
115 Ga0070681_10002241 3300005458 Bacteria 17639
116 Ga0070681_10002413 3300005458 Bacteria 17098
117 Ga0070681_10002965 3300005458 Bacteria 15756
118 Ga0070681_10005036 3300005458 Bacteria 12740
119 Ga0070681_10017250 3300005458 Bacteria 7217
120 Ga0070681_10048544 3300005458 Bacteria 4241
121 Ga0070681_10063535 3300005458 Bacteria 3664
122 Ga0070681_10129048 3300005458 Bacteria 2461
123 Ga0070681_10224813 3300005458 Bacteria 1792
124 Ga0070681_10316256 3300005458 Bacteria 1471
125 Ga0070681_10470510 3300005458 Bacteria 1169
126 Ga0070681_10528827 3300005458 Bacteria 1093
127 Ga0070681_10602560 3300005458 Bacteria 1013
128 Ga0068867_100204592 3300005459 Bacteria 1582
129 Ga0070685_10107159 3300005466 Unclassified 1716
130 Ga0070706_100004404 3300005467 Bacteria 13607
131 Ga0070706_100300115 3300005467 Bacteria 1499
132 Ga0070707_100006707 3300005468 Bacteria 10670
133 Ga0070707_100063386 3300005468 Bacteria 3548
134 Ga0070707_100174318 3300005468 Bacteria 2096
135 Ga0070707_100239922 3300005468 Bacteria 1764
136 Ga0070698_100009208 3300005471 Bacteria 10596
137 Ga0070698_100011989 3300005471 Bacteria 9194
138 Ga0070698_100025546 3300005471 Bacteria 6157
139 Ga0070698_100034953 3300005471 Bacteria 5198
140 Ga0070698_100067803 3300005471 Bacteria 3587
141 Ga0070698_100318426 3300005471 Bacteria 1486
142 Ga0070699_100006343 3300005518 Bacteria 10313
143 Ga0070699_100006480 3300005518 Bacteria 10194
144 Ga0070699_100129617 3300005518 Unclassified 2223
145 Ga0070699_100165735 3300005518 Bacteria 1957
146 Ga0070699_100340361 3300005518 Bacteria 1350
147 Ga0070699_100428433 3300005518 Unclassified 1198
148 Ga0070679_100000984 3300005530 Bacteria 24839
149 Ga0070679_100006040 3300005530 Bacteria 11262
150 Ga0070679_100007847 3300005530 Bacteria 10005
151 Ga0070679_100011171 3300005530 Bacteria 8555
152 Ga0070679_100011933 3300005530 Bacteria 8294
153 Ga0070679_100013182 3300005530 Bacteria 7915
154 Ga0070679_100014269 3300005530 Bacteria 7628
155 Ga0070679_100045190 3300005530 Bacteria 4389
156 Ga0070679_100112086 3300005530 Bacteria 2714
157 Ga0070679_100195077 3300005530 Bacteria 1993
158 Ga0070679_100432740 3300005530 Bacteria 1261
159 Ga0070679_100459566 3300005530 Bacteria 1218
160 Ga0070684_100001391 3300005535 Bacteria 17386
161 Ga0070684_100003297 3300005535 Bacteria 12087
162 Ga0070684_100007869 3300005535 Bacteria 8313
163 Ga0070684_100010607 3300005535 Bacteria 7307
164 Ga0070684_100026612 3300005535 Bacteria 4874
165 Ga0070684_100035629 3300005535 Bacteria 4260
166 Ga0070684_100066367 3300005535 Bacteria 3168
167 Ga0070684_100112463 3300005535 Bacteria 2443
168 Ga0070684_100122656 3300005535 Unclassified 2338
169 Ga0070684_100160091 3300005535 Bacteria 2042
170 Ga0070684_100231890 3300005535 Bacteria 1686
171 Ga0070697_100007220 3300005536 Bacteria 8642
172 Ga0070697_100130528 3300005536 Bacteria 2107
173 Ga0068853_100103354 3300005539 Bacteria 2522
174 Ga0068853_100134613 3300005539 Bacteria 2214
175 Ga0068853_100471017 3300005539 Bacteria 1183
176 Ga0070672_100031158 3300005543 Bacteria 4012
177 Ga0070672_100070705 3300005543 Bacteria 2774
178 Ga0070672_100119791 3300005543 Bacteria 2153
179 Ga0070672_100134450 3300005543 Bacteria 2035
180 Ga0070672_100550353 3300005543 Bacteria 1002
181 Ga0070686_100018883 3300005544 Bacteria 4055
182 Ga0070686_100022681 3300005544 Bacteria 3743
183 Ga0070686_100069410 3300005544 Bacteria 2302
184 Ga0070686_100153810 3300005544 Bacteria 1613
185 Ga0070695_100024342 3300005545 Bacteria 3729
186 Ga0070695_100265714 3300005545 Bacteria 1255
187 Ga0070696_100001801 3300005546 Bacteria 14060
188 Ga0070696_100004106 3300005546 Bacteria 9705
189 Ga0070696_100027347 3300005546 Bacteria 3885
190 Ga0070696_100036662 3300005546 Bacteria 3382
191 Ga0070696_100056487 3300005546 Bacteria 2738
192 Ga0070696_100155338 3300005546 Bacteria 1682
193 Ga0070696_100159863 3300005546 Bacteria 1659
194 Ga0070693_100001903 3300005547 Bacteria 9541
195 Ga0070693_100010051 3300005547 Bacteria 4724
196 Ga0070693_100147402 3300005547 Bacteria 1487
197 Ga0070693_100223524 3300005547 Bacteria 1235
198 Ga0070665_100030097 3300005548 Bacteria 5463
199 Ga0070665_100554189 3300005548 Unclassified 1162
200 Ga0070704_100004573 3300005549 Bacteria 7996
201 Ga0070704_100086269 3300005549 Bacteria 2326
202 Ga0070704_100136675 3300005549 Bacteria 1908
203 Ga0070704_100411052 3300005549 Bacteria 1157
204 Ga0068855_100002450 3300005563 Bacteria 22929
205 Ga0068855_100007670 3300005563 Bacteria 13044
206 Ga0068855_100007956 3300005563 Bacteria 12807
207 Ga0068855_100364208 3300005563 Bacteria 1590
208 Ga0070664_100003703 3300005564 Bacteria 12320
209 Ga0070664_100037137 3300005564 Bacteria 4093
210 Ga0070664_100043369 3300005564 Bacteria 3795
211 Ga0070664_100125451 3300005564 Bacteria 2251
212 Ga0070664_100317633 3300005564 Unclassified 1411
213 Ga0068857_100024116 3300005577 Bacteria 5354
214 Ga0068857_100057308 3300005577 Bacteria 3458
215 Ga0068857_100119313 3300005577 Bacteria 2374
216 Ga0068857_100260973 3300005577 Bacteria 1590
217 Ga0068857_100740257 3300005577 Unclassified 936
218 Ga0068854_100006008 3300005578 Bacteria 7691
219 Ga0068854_100033243 3300005578 Bacteria 3595
220 Ga0068856_100040030 3300005614 Bacteria 4603
221 Ga0068856_100040068 3300005614 Bacteria 4600
222 Ga0068856_100097252 3300005614 Bacteria 2933
223 Ga0068856_100147134 3300005614 Bacteria 2363
224 Ga0068856_100282394 3300005614 Bacteria 1677
225 Ga0070702_100000691 3300005615 Bacteria 12687
226 Ga0068852_100026584 3300005616 Bacteria 4707
227 Ga0068852_100106759 3300005616 Bacteria 2539
228 Ga0068852_100217903 3300005616 Bacteria 1814
229 Ga0068852_100428853 3300005616 Bacteria 1305
230 Ga0068852_100458880 3300005616 Bacteria 1263
231 Ga0068859_100024452 3300005617 Bacteria 6059
232 Ga0068859_100068050 3300005617 Bacteria 3596
233 Ga0068859_100178683 3300005617 Bacteria 2205
234 Ga0068864_100005316 3300005618 Bacteria 10546
235 Ga0068864_100069272 3300005618 Bacteria 3067
236 Ga0068864_100183949 3300005618 Bacteria 1912
237 Ga0068864_100262631 3300005618 Bacteria 1607
238 Ga0068864_100320367 3300005618 Unclassified 1456
239 Ga0068866_10014928 3300005718 Bacteria 3440
240 Ga0068861_100119282 3300005719 Bacteria 2126
241 Ga0068870_10073553 3300005840 Bacteria 1870
242 Ga0068870_10127289 3300005840 Unclassified 1475
243 Ga0068863_100014116 3300005841 Bacteria 7695
244 Ga0068858_100220870 3300005842 Unclassified 1794
245 Ga0068860_100028935 3300005843 Bacteria 5331
246 Ga0068860_100274034 3300005843 Bacteria 1647
247 Ga0081539_10000103 3300005985 Bacteria 197839
248 Ga0070712_100004579 3300006175 Bacteria 8537
249 Ga0070712_100091150 3300006175 Bacteria 2233
250 Ga0070712_100391486 3300006175 Bacteria 1146
251 Ga0097621_100019555 3300006237 Bacteria 5200
252 Ga0097621_100275108 3300006237 Bacteria 1481
253 Ga0097621_100705800 3300006237 Bacteria 929
254 Ga0068871_100005554 3300006358 Bacteria 8841
255 Ga0068871_100231875 3300006358 Bacteria 1602
256 Ga0075428_100054118 3300006844 Bacteria 4398
257 Ga0075430_100001593 3300006846 Bacteria 18540
258 Ga0075430_100070681 3300006846 Bacteria 2927
259 Ga0075431_100004530 3300006847 Bacteria 13645
260 Ga0075431_100012338 3300006847 Bacteria 8623
261 Ga0075431_100275657 3300006847 Bacteria 1703
262 Ga0075431_100459785 3300006847 Bacteria 1267
263 Ga0075431_100644036 3300006847 Unclassified 1041
264 Ga0075433_10099460 3300006852 Bacteria 2575
265 Ga0075433_10170445 3300006852 Bacteria 1937
266 Ga0075433_10182148 3300006852 Bacteria 1869
267 Ga0075433_10412333 3300006852 Bacteria 1191
268 Ga0075434_100015921 3300006871 Bacteria 7224
269 Ga0075434_100042070 3300006871 Bacteria 4529
270 Ga0075434_100076798 3300006871 Bacteria 3335
271 Ga0075434_100162440 3300006871 Bacteria 2253
272 Ga0075434_100239953 3300006871 Bacteria 1832
273 Ga0075429_100025902 3300006880 Bacteria 5091
274 Ga0075429_100087690 3300006880 Bacteria 2712
275 Ga0075429_100136827 3300006880 Bacteria 2144
276 Ga0075429_100301596 3300006880 Unclassified 1402
277 Ga0068865_100036733 3300006881 Bacteria 3304
278 Ga0075436_100078813 3300006914 Bacteria 2282
279 Ga0097620_100024453 3300006931 Bacteria 6059
280 Ga0097620_100068054 3300006931 Bacteria 3596
281 Ga0097620_100178681 3300006931 Bacteria 2205
282 Ga0075435_100158298 3300007076 Bacteria 1907
283 Ga0075435_100667052 3300007076 Bacteria 903
284 Ga0105240_10033173 3300009093 Bacteria 6674
285 Ga0105240_10087486 3300009093 Bacteria 3816
286 Ga0105240_10185389 3300009093 Unclassified 2451
287 Ga0105240_10502289 3300009093 Bacteria 1348
288 Ga0105240_10504745 3300009093 Bacteria 1344
289 Ga0105245_10098951 3300009098 Bacteria 2696
290 Ga0105245_10147516 3300009098 Bacteria 2221
291 Ga0105245_10270911 3300009098 Bacteria 1656
292 Ga0105245_10714072 3300009098 Bacteria 1036
293 Ga0114129_10000112 3300009147 Bacteria 80956
294 Ga0114129_10112082 3300009147 Bacteria 3762
295 Ga0114129_10195490 3300009147 Bacteria 2743
296 Ga0105241_10000025 3300009174 Bacteria 132929
297 Ga0105241_10076288 3300009174 Bacteria 2613
298 Ga0105242_10030108 3300009176 Bacteria 4334
299 Ga0105242_10437139 3300009176 Unclassified 1230
300 Ga0105248_10007306 3300009177 Bacteria 12121
301 Ga0105248_10018583 3300009177 Bacteria 7684
302 Ga0105248_10027527 3300009177 Bacteria 6330
303 Ga0105248_10108984 3300009177 Bacteria 3122
304 Ga0105248_10111389 3300009177 Bacteria 3087
305 Ga0105248_10246262 3300009177 Bacteria 2012
306 Ga0105248_10246450 3300009177 Bacteria 2011
307 Ga0105248_10263826 3300009177 Bacteria 1939
308 Ga0105248_10283322 3300009177 Bacteria 1866
309 Ga0105248_10331439 3300009177 Bacteria 1714
310 Ga0105237_10057918 3300009545 Bacteria 3877
311 Ga0105238_10041781 3300009551 Bacteria 4644
312 Ga0105238_10090522 3300009551 Bacteria 3046
313 Ga0105238_10115923 3300009551 Bacteria 2658
314 Ga0105238_10133724 3300009551 Bacteria 2458
315 Ga0105238_10190032 3300009551 Bacteria 2030
316 Ga0105239_10024821 3300010375 Bacteria 6604
317 Ga0105239_10248196 3300010375 Bacteria 1999
318 Ga0105239_10320384 3300010375 Bacteria 1748
319 Ga0105239_10596340 3300010375 Bacteria 1260
320 Ga0105246_10011927 3300011119 Bacteria 5407
321 Ga0157373_10027315 3300013100 Bacteria 4117
322 Ga0157373_10168014 3300013100 Bacteria 1544
323 Ga0157371_10066892 3300013102 Bacteria 2544
324 Ga0157370_10001352 3300013104 Bacteria 30418
325 Ga0157370_10005925 3300013104 Bacteria 13619
326 Ga0157370_10013219 3300013104 Bacteria 8510
327 Ga0157370_10018592 3300013104 Bacteria 6987
328 Ga0157370_10027402 3300013104 Bacteria 5618
329 Ga0157370_10053294 3300013104 Bacteria 3858
330 Ga0157370_10231685 3300013104 Bacteria 1709
331 Ga0157370_10293634 3300013104 Bacteria 1501
332 Ga0157370_10312114 3300013104 Bacteria 1451
333 Ga0157369_10015693 3300013105 Bacteria 8536
334 Ga0157369_10019452 3300013105 Bacteria 7596
335 Ga0157369_10046069 3300013105 Bacteria 4740
336 Ga0157369_10091519 3300013105 Bacteria 3247
337 Ga0157369_10155065 3300013105 Bacteria 2419
338 Ga0157369_10298898 3300013105 Bacteria 1675
339 Ga0157369_10373419 3300013105 Bacteria 1480
340 Ga0157369_10383206 3300013105 Bacteria 1459
341 Ga0157369_10415373 3300013105 Bacteria 1395
342 Ga0157374_10005425 3300013296 Bacteria 10714
343 Ga0157374_10245632 3300013296 Bacteria 1761
344 Ga0157374_10452867 3300013296 Bacteria 1285
345 Ga0157374_10542284 3300013296 Unclassified 1170
346 Ga0157378_10014992 3300013297 Bacteria 6786
347 Ga0157378_10354917 3300013297 Bacteria 1433
348 Ga0163162_10312917 3300013306 Bacteria 1703
349 Ga0163162_10656637 3300013306 Bacteria 1172
350 Ga0157372_10001141 3300013307 Bacteria 28828
351 Ga0157372_10002494 3300013307 Bacteria 19954
352 Ga0157372_10010939 3300013307 Bacteria 9657
353 Ga0157372_10020943 3300013307 Bacteria 7059
354 Ga0157372_10025682 3300013307 Bacteria 6406
355 Ga0157372_10037081 3300013307 Bacteria 5374
356 Ga0157372_10037712 3300013307 Bacteria 5332
357 Ga0157372_10076985 3300013307 Bacteria 3767
358 Ga0157372_10133392 3300013307 Bacteria 2859
359 Ga0157372_10287816 3300013307 Bacteria 1911
360 Ga0157372_10534200 3300013307 Bacteria 1367
361 Ga0157375_10101001 3300013308 Bacteria 2966
362 Ga0157375_10332345 3300013308 Bacteria 1685
363 Ga0157375_10340355 3300013308 Bacteria 1665
364 Ga0157375_10429316 3300013308 Bacteria 1487
365 Ga0163163_10032617 3300014325 Bacteria 5032
366 Ga0163163_10106850 3300014325 Bacteria 2825
367 Ga0157380_10441823 3300014326 Bacteria 1247
368 Ga0157377_10002606 3300014745 Bacteria 8008
369 Ga0157377_10243495 3300014745 Bacteria 1162
370 Ga0157379_10072366 3300014968 Bacteria 3084
371 Ga0157376_10004937 3300014969 Bacteria 9303
372 Ga0157376_10310131 3300014969 Bacteria 1497
373 Ga0157376_10642470 3300014969 Bacteria 1061
374 Ga0163161_10129706 3300017792 Bacteria 1901
375 Ga0213876_10012247 3300021384 Bacteria 4566
376 Ga0213876_10018827 3300021384 Bacteria 3646
377 Ga0207697_10021929 3300025315 Bacteria 2617
378 Ga0207656_10211214 3300025321 Bacteria 941
379 Ga0207692_10015845 3300025898 Bacteria 3325
380 Ga0207642_10114033 3300025899 Bacteria 1382
381 Ga0207642_10120176 3300025899 Bacteria 1354
382 Ga0207680_10186319 3300025903 Bacteria 1406
383 Ga0207699_10025053 3300025906 Bacteria 3271
384 Ga0207699_10193989 3300025906 Bacteria 1372
385 Ga0207645_10002673 3300025907 Bacteria 13887
386 Ga0207645_10020443 3300025907 Bacteria 4334
387 Ga0207645_10102609 3300025907 Bacteria 1846
388 Ga0207645_10129199 3300025907 Bacteria 1644
389 Ga0207645_10269577 3300025907 Bacteria 1129
390 Ga0207643_10002623 3300025908 Bacteria 9729
391 Ga0207705_10095688 3300025909 Bacteria 2179
392 Ga0207705_10148903 3300025909 Bacteria 1753
393 Ga0207684_10006258 3300025910 Bacteria 10867
394 Ga0207654_10000187 3300025911 Bacteria 38292
395 Ga0207654_10010629 3300025911 Bacteria 4687
396 Ga0207707_10000368 3300025912 Bacteria 47267
397 Ga0207707_10001363 3300025912 Bacteria 22677
398 Ga0207707_10005124 3300025912 Bacteria 11489
399 Ga0207707_10012116 3300025912 Bacteria 7494
400 Ga0207707_10012350 3300025912 Bacteria 7423
401 Ga0207707_10017280 3300025912 Bacteria 6287
402 Ga0207707_10032210 3300025912 Bacteria 4588
403 Ga0207707_10149111 3300025912 Bacteria 2045
404 Ga0207707_10242503 3300025912 Bacteria 1567
405 Ga0207695_10003984 3300025913 Bacteria 20376
406 Ga0207695_10008659 3300025913 Bacteria 12697
407 Ga0207695_10074608 3300025913 Bacteria 3454
408 Ga0207695_10114946 3300025913 Bacteria 2666
409 Ga0207695_10180479 3300025913 Bacteria 2032
410 Ga0207695_10428058 3300025913 Bacteria 1207
411 Ga0207671_10319938 3300025914 Unclassified 1228
412 Ga0207693_10068255 3300025915 Bacteria 2783
413 Ga0207663_10114551 3300025916 Bacteria 1835
414 Ga0207660_10000017 3300025917 Bacteria 75942
415 Ga0207660_10001873 3300025917 Bacteria 14025
416 Ga0207660_10003526 3300025917 Bacteria 10195
417 Ga0207660_10024415 3300025917 Bacteria 4093
418 Ga0207660_10057991 3300025917 Bacteria 2775
419 Ga0207660_10075291 3300025917 Bacteria 2466
420 Ga0207660_10193876 3300025917 Bacteria 1584
421 Ga0207660_10268900 3300025917 Unclassified 1350
422 Ga0207657_10001418 3300025919 Bacteria 25590
423 Ga0207657_10122439 3300025919 Bacteria 2139
424 Ga0207649_10005528 3300025920 Bacteria 6841
425 Ga0207649_10008516 3300025920 Bacteria 5594
426 Ga0207649_10054331 3300025920 Bacteria 2492
427 Ga0207649_10068687 3300025920 Bacteria 2254
428 Ga0207649_10254648 3300025920 Bacteria 1266
429 Ga0207649_10444524 3300025920 Unclassified 977
430 Ga0207652_10001054 3300025921 Bacteria 25084
431 Ga0207652_10001788 3300025921 Bacteria 18701
432 Ga0207652_10003275 3300025921 Bacteria 13419
433 Ga0207652_10004889 3300025921 Bacteria 10841
434 Ga0207652_10009093 3300025921 Bacteria 8001
435 Ga0207652_10020987 3300025921 Bacteria 5387
436 Ga0207652_10024228 3300025921 Bacteria 5034
437 Ga0207652_10063070 3300025921 Bacteria 3204
438 Ga0207652_10083471 3300025921 Bacteria 2797
439 Ga0207652_10102650 3300025921 Bacteria 2528
440 Ga0207652_10130098 3300025921 Bacteria 2244
441 Ga0207652_10187870 3300025921 Bacteria 1858
442 Ga0207652_10262297 3300025921 Bacteria 1558
443 Ga0207646_10004898 3300025922 Bacteria 14334
444 Ga0207646_10095221 3300025922 Bacteria 2667
445 Ga0207646_10105317 3300025922 Bacteria 2529
446 Ga0207646_10115346 3300025922 Bacteria 2413
447 Ga0207646_10420135 3300025922 Bacteria 1207
448 Ga0207681_10002709 3300025923 Bacteria 11224
449 Ga0207681_10097333 3300025923 Bacteria 2115
450 Ga0207681_10163979 3300025923 Unclassified 1678
451 Ga0207694_10026154 3300025924 Bacteria 4437
452 Ga0207694_10387344 3300025924 Unclassified 1161
453 Ga0207650_10067152 3300025925 Bacteria 2690
454 Ga0207650_10248310 3300025925 Bacteria 1440
455 Ga0207650_10248678 3300025925 Bacteria 1439
456 Ga0207659_10002341 3300025926 Bacteria 11285
457 Ga0207659_10146946 3300025926 Bacteria 1837
458 Ga0207659_10227955 3300025926 Unclassified 1501
459 Ga0207687_10011236 3300025927 Bacteria 5848
460 Ga0207687_10241763 3300025927 Bacteria 1431
461 Ga0207700_10046694 3300025928 Bacteria 3205
462 Ga0207644_10003159 3300025931 Bacteria 10598
463 Ga0207644_10046632 3300025931 Bacteria 3089
464 Ga0207644_10193639 3300025931 Bacteria 1600
465 Ga0207690_10003915 3300025932 Bacteria 8802
466 Ga0207690_10075772 3300025932 Bacteria 2334
467 Ga0207706_10006158 3300025933 Bacteria 11141
468 Ga0207706_10026811 3300025933 Bacteria 5157
469 Ga0207706_10100785 3300025933 Bacteria 2540
470 Ga0207706_10103361 3300025933 Bacteria 2506
471 Ga0207670_10069292 3300025936 Bacteria 2433
472 Ga0207670_10155814 3300025936 Bacteria 1700
473 Ga0207669_10175865 3300025937 Bacteria 1529
474 Ga0207669_10194362 3300025937 Bacteria 1467
475 Ga0207704_10227271 3300025938 Bacteria 1385
476 Ga0207704_10260147 3300025938 Bacteria 1308
477 Ga0207704_10292518 3300025938 Bacteria 1244
478 Ga0207665_10004059 3300025939 Bacteria 9774
479 Ga0207691_10004269 3300025940 Bacteria 13882
480 Ga0207691_10020319 3300025940 Bacteria 6279
481 Ga0207691_10053003 3300025940 Bacteria 3705
482 Ga0207691_10362227 3300025940 Bacteria 1240
483 Ga0207711_10104699 3300025941 Bacteria 2508
484 Ga0207711_10142004 3300025941 Bacteria 2161
485 Ga0207711_10316602 3300025941 Bacteria 1441
486 Ga0207689_10057011 3300025942 Bacteria 3214
487 Ga0207661_10001891 3300025944 Bacteria 14352
488 Ga0207661_10003915 3300025944 Bacteria 10394
489 Ga0207661_10005970 3300025944 Bacteria 8599
490 Ga0207661_10013955 3300025944 Bacteria 5874
491 Ga0207661_10016323 3300025944 Bacteria 5477
492 Ga0207661_10034924 3300025944 Bacteria 3914
493 Ga0207661_10042016 3300025944 Bacteria 3603
494 Ga0207661_10050451 3300025944 Bacteria 3315
495 Ga0207661_10113479 3300025944 Bacteria 2296
496 Ga0207661_10309416 3300025944 Unclassified 1418
497 Ga0207661_10322825 3300025944 Bacteria 1388
498 Ga0207679_10003199 3300025945 Bacteria 10102
499 Ga0207679_10012060 3300025945 Bacteria 5621
500 Ga0207679_10024789 3300025945 Bacteria 4116
501 Ga0207679_10063573 3300025945 Bacteria 2755
502 Ga0207679_10078560 3300025945 Bacteria 2514
503 Ga0207679_10123912 3300025945 Bacteria 2062
504 Ga0207679_10214160 3300025945 Bacteria 1617
505 Ga0207679_10336618 3300025945 Bacteria 1311
506 Ga0207679_10548062 3300025945 Bacteria 1037
507 Ga0207667_10042532 3300025949 Bacteria 4828
508 Ga0207667_10116538 3300025949 Bacteria 2753
509 Ga0207667_10191728 3300025949 Bacteria 2097
510 Ga0207667_10325594 3300025949 Bacteria 1569
511 Ga0207651_10040421 3300025960 Bacteria 3085
512 Ga0207651_10068593 3300025960 Bacteria 2501
513 Ga0207712_10102785 3300025961 Bacteria 2128
514 Ga0207640_10017641 3300025981 Bacteria 4180
515 Ga0207640_10143155 3300025981 Bacteria 1746
516 Ga0207658_10140867 3300025986 Bacteria 1951
517 Ga0207658_10195977 3300025986 Bacteria 1683
518 Ga0207658_10402931 3300025986 Bacteria 1203
519 Ga0207677_10073456 3300026023 Bacteria 2422
520 Ga0207677_10080759 3300026023 Bacteria 2331
521 Ga0207677_10270174 3300026023 Bacteria 1390
522 Ga0207677_10278175 3300026023 Bacteria 1372
523 Ga0207677_10538064 3300026023 Unclassified 1016
524 Ga0207703_10218123 3300026035 Bacteria 1704
525 Ga0207639_10080223 3300026041 Bacteria 2581
526 Ga0207639_10177203 3300026041 Bacteria 1810
527 Ga0207639_10228202 3300026041 Bacteria 1612
528 Ga0207639_10543122 3300026041 Bacteria 1066
529 Ga0207678_10000466 3300026067 Bacteria 36698
530 Ga0207708_10053219 3300026075 Bacteria 3084
531 Ga0207708_10489049 3300026075 Bacteria 1030
532 Ga0207702_10013208 3300026078 Bacteria 6868
533 Ga0207702_10031500 3300026078 Bacteria 4420
534 Ga0207702_10111092 3300026078 Bacteria 2437
535 Ga0207702_10305196 3300026078 Bacteria 1512
536 Ga0207641_10009005 3300026088 Bacteria 8245
537 Ga0207641_10220896 3300026088 Bacteria 1757
538 Ga0207641_10557659 3300026088 Bacteria 1118
539 Ga0207648_10082367 3300026089 Bacteria 2806
540 Ga0207648_10413923 3300026089 Bacteria 1223
541 Ga0207648_10479460 3300026089 Unclassified 1136
542 Ga0207676_10001153 3300026095 Bacteria 19908
543 Ga0207676_10006811 3300026095 Bacteria 8091
544 Ga0207676_10101402 3300026095 Bacteria 2387
545 Ga0207676_10171817 3300026095 Bacteria 1889
546 Ga0207676_10241831 3300026095 Bacteria 1620
547 Ga0207676_10287679 3300026095 Bacteria 1495
548 Ga0207674_10002099 3300026116 Bacteria 25266
549 Ga0207674_10004722 3300026116 Bacteria 16334
550 Ga0207674_10035393 3300026116 Bacteria 5211
551 Ga0207674_10067120 3300026116 Bacteria 3612
552 Ga0207674_10146449 3300026116 Bacteria 2320
553 Ga0207674_10288708 3300026116 Bacteria 1589
554 Ga0207674_10552274 3300026116 Bacteria 1113
555 Ga0207675_100146194 3300026118 Bacteria 2248
556 Ga0207683_10398817 3300026121 Bacteria 1265
557 Ga0207698_10018067 3300026142 Bacteria 4798
558 Ga0207698_10020884 3300026142 Bacteria 4518
559 Ga0207698_10077814 3300026142 Bacteria 2661
560 Ga0207698_10147249 3300026142 Bacteria 2038
561 Ga0207698_10160640 3300026142 Bacteria 1964
562 Ga0209999_1020629 3300027543 Bacteria 1210
563 Ga0268266_10446022 3300028379 Unclassified 1230
564 Ga0268265_10238249 3300028380 Bacteria 1604
565 Ga0268264_10022770 3300028381 Bacteria 5112
566 Ga0268264_10073534 3300028381 Bacteria 2901
567 Ga0265332_10040118 3300031238 Bacteria 2027
568 Ga0307408_100010569 3300031548 Bacteria 6087
569 Ga0307408_100046915 3300031548 Bacteria 3092
570 Ga0307408_100083768 3300031548 Bacteria 2390
571 Ga0307408_100188659 3300031548 Bacteria 1659
572 Ga0265314_10040777 3300031711 Bacteria 3329
573 Ga0307405_10055910 3300031731 Bacteria 2472
574 Ga0307413_10010373 3300031824 Bacteria 4515
575 Ga0307413_10037090 3300031824 Bacteria 2813
576 Ga0307413_10058437 3300031824 Bacteria 2364
577 Ga0307413_10122045 3300031824 Unclassified 1767
578 Ga0307413_10219150 3300031824 Bacteria 1388
579 Ga0307413_10379900 3300031824 Bacteria 1100
580 Ga0307410_10006805 3300031852 Bacteria 6205
581 Ga0307410_10012461 3300031852 Bacteria 4920
582 Ga0307410_10019809 3300031852 Bacteria 4101
583 Ga0307410_10044530 3300031852 Bacteria 2948
584 Ga0307410_10071378 3300031852 Bacteria 2408
585 Ga0307410_10087066 3300031852 Bacteria 2208
586 Ga0307406_10038928 3300031901 Bacteria 2946
587 Ga0307406_10089294 3300031901 Bacteria 2070
588 Ga0307406_10294783 3300031901 Bacteria 1243
589 Ga0307407_10005350 3300031903 Bacteria 5562
590 Ga0307407_10118180 3300031903 Bacteria 1676
591 Ga0307407_10165353 3300031903 Bacteria 1452
592 Ga0307407_10275771 3300031903 Bacteria 1162
593 Ga0307412_10119100 3300031911 Bacteria 1898
594 Ga0307409_100075687 3300031995 Bacteria 2696
595 Ga0307409_100105813 3300031995 Bacteria 2346
596 Ga0307409_100281794 3300031995 Bacteria 1537
597 Ga0307409_100487448 3300031995 Bacteria 1197
598 Ga0307416_100003807 3300032002 Bacteria 8963
599 Ga0307416_100009633 3300032002 Bacteria 6336
600 Ga0307416_100266086 3300032002 Unclassified 1679
601 Ga0307416_100325661 3300032002 Bacteria 1541
602 Ga0307416_100559515 3300032002 Bacteria 1218
603 Ga0307414_10018396 3300032004 Bacteria 4301
604 Ga0307414_10079457 3300032004 Bacteria 2395
605 Ga0307414_10163243 3300032004 Bacteria 1772
606 Ga0307414_10360504 3300032004 Bacteria 1251
607 Ga0307411_10000833 3300032005 Bacteria 11538
608 Ga0307411_10099038 3300032005 Bacteria 2056
609 Ga0307411_10130647 3300032005 Bacteria 1835
610 Ga0307411_10144973 3300032005 Bacteria 1756
611 Ga0307411_10177965 3300032005 Bacteria 1611
612 Ga0307415_100000666 3300032126 Bacteria 15183
613 Ga0307415_100064386 3300032126 Bacteria 2551
614 Ga0307415_100161485 3300032126 Bacteria 1737
615 Ga0373934_0000219 3300035086 Bacteria 20869
616 Ga0373934_0006580 3300035086 Bacteria 4310
617 Ga0373934_0090785 3300035086 Bacteria 1231
618 Ga0373940_0009659 3300035088 Bacteria 2248
619 Ga0373940_0066383 3300035088 Bacteria 1042
620 Ga0373953_0002688 3300035117 Bacteria 5392
621 Ga0373956_0000144 3300035119 Bacteria 25834
622 Ga0373957_0024527 3300035120 Bacteria 2166
623 Ga0373960_0056080 3300035121 Unclassified 1182
624 Ga0373943_0049466 3300035170 Bacteria 2063
625 Ga0373943_0072244 3300035170 Bacteria 1750
626 Ga0373946_0026180 3300035171 Bacteria 2299
627 Ga0373955_0006033 3300035172 Bacteria 5496
628 Ga0373955_0018797 3300035172 Bacteria 3444
629 Ga0373942_0083868 3300035207 Bacteria 950
630 Ga0373961_0013347 3300035241 Bacteria 2071
631 Ga0373924_0018874 3300035410 Bacteria 2665
632 Ga0373931_0004853 3300035691 Bacteria 6178
633 Ga0373931_0043732 3300035691 Bacteria 2360
634 Ga0373931_0186046 3300035691 Bacteria 1233
635 Ga0373927_0026479 3300035695 Bacteria 3790
636 Ga0373933_0000353 3300035724 Bacteria 29440
637 Ga0373933_0054996 3300035724 Bacteria 2386
638 Ga0373947_0004333 3300035725 Bacteria 8334
639 Ga0373937_0000450 3300036401 Bacteria 37946
640 Ga0373937_0002043 3300036401 Bacteria 16865
641 Ga0373937_0050445 3300036401 Bacteria 3811
642 Ga0373937_0127956 3300036401 Bacteria 2370
643 Ga0373937_0349729 3300036401 Bacteria 1400
644 Ga0395905_0565114 3300037471 Bacteria 1039
645 Ga0436364_0054570 3300037853 Bacteria 2341
646 Ga0436365_0252582 3300039437 Unclassified 1598
647 Ga0436365_1557839 3300039437 Bacteria 12711
648 Ga0451577_0009949 3300042876 Bacteria 9115
649 Ga0451577_0015744 3300042876 Bacteria 7021
650 Ga0451577_0238817 3300042876 Bacteria 1644
651 Ga0451577_0456373 3300042876 Bacteria 1160
652 Ga0453683_0093778 3300044673 Bacteria 1883
653 Ga0453684_0000886 3300044712 Bacteria 100081
654 Ga0453684_0523607 3300044712 Bacteria 1309
655 Ga0451576_0033383 3300045051 Bacteria 5470
656 Ga0451576_0116722 3300045051 Bacteria 2778
657 Ga0451576_0128697 3300045051 Bacteria 2639
658 Ga0451576_0203755 3300045051 Bacteria 2066
659 Ga0451576_0286316 3300045051 Bacteria 1723
660 Ga0451576_0584020 3300045051 Bacteria 1174
661 Ga0466967_0103003 3300045976 Bacteria 2612
662 Ga0466967_0538678 3300045976 Bacteria 1148
663 Ga0495592_0013907 3300046454 Bacteria 6114
664 Ga0495592_0087487 3300046454 Bacteria 2241
665 Ga0495629_0015582 3300046459 Bacteria 5457
666 Ga0495629_0056564 3300046459 Bacteria 2742
667 Ga0495629_0220787 3300046459 Bacteria 1307
668 Ga0495651_0000050 3300046462 Bacteria 87816
669 Ga0495651_0025817 3300046462 Bacteria 4574
670 Ga0495651_0053696 3300046462 Bacteria 3101
671 Ga0495653_0000195 3300046463 Bacteria 49244
672 Ga0495653_0095493 3300046463 Bacteria 2164
673 Ga0495580_0003045 3300046472 Bacteria 14355
674 Ga0495580_0012371 3300046472 Bacteria 6545
675 Ga0495580_0107200 3300046472 Bacteria 1940
676 Ga0495582_0037184 3300046473 Bacteria 2678
677 Ga0495664_0009814 3300046477 Bacteria 5367
678 Ga0495664_0058141 3300046477 Bacteria 2300
679 Ga0495664_0091181 3300046477 Bacteria 1832
680 Ga0495594_0041291 3300046499 Bacteria 2526
681 Ga0495594_0077916 3300046499 Bacteria 1849
682 Ga0495594_0091903 3300046499 Bacteria 1701
683 Ga0495594_0190496 3300046499 Bacteria 1168
684 Ga0495596_0026082 3300046500 Bacteria 2357
685 Ga0495608_0000787 3300046511 Bacteria 22269
686 Ga0495608_0029218 3300046511 Bacteria 3742
687 Ga0495618_0043324 3300046514 Bacteria 2840
688 Ga0495618_0178414 3300046514 Bacteria 1350
689 Ga0495628_0001915 3300046516 Bacteria 18878
690 Ga0495628_0149579 3300046516 Bacteria 1779
691 Ga0495628_0179696 3300046516 Bacteria 1601
692 Ga0495630_0006626 3300046517 Bacteria 8251
693 Ga0495630_0045996 3300046517 Bacteria 3262
694 Ga0495630_0077455 3300046517 Bacteria 2507
695 Ga0495630_0080633 3300046517 Bacteria 2455
696 Ga0495652_0001266 3300046529 Bacteria 28253
697 Ga0495652_0008501 3300046529 Bacteria 9363
698 Ga0495665_0131133 3300046531 Unclassified 1312
699 Ga0495640_0080318 3300046533 Bacteria 2169
700 Ga0495586_0026611 3300046535 Bacteria 3095
701 Ga0495586_0036756 3300046535 Bacteria 2629
702 Ga0495587_0000114 3300046536 Bacteria 61671
703 Ga0495587_0001632 3300046536 Bacteria 14944
704 Ga0495587_0027313 3300046536 Bacteria 3476
705 Ga0495587_0035035 3300046536 Bacteria 3025
706 Ga0495621_0009244 3300046539 Bacteria 2987
707 Ga0495645_0000144 3300046543 Bacteria 48490
708 Ga0495645_0032745 3300046543 Bacteria 3792
709 Ga0495645_0086982 3300046543 Bacteria 2236
710 Ga0495645_0111844 3300046543 Bacteria 1931
711 Ga0495667_0000241 3300046559 Bacteria 35516
712 Ga0495667_0014810 3300046559 Bacteria 5270
713 Ga0495667_0119000 3300046559 Bacteria 1706
714 Ga0495656_0160301 3300046615 Bacteria 1093
715 Ga0495634_0057536 3300046642 Bacteria 2595
716 Ga0495635_0002069 3300046663 Bacteria 13601
717 Ga0495635_0078130 3300046663 Bacteria 2266
718 Ga0495588_0005185 3300046674 Bacteria 5790
719 Ga0495657_0000210 3300046675 Bacteria 52663
720 Ga0495657_0083356 3300046675 Bacteria 2064
721 Ga0495599_0000436 3300046678 Bacteria 23725
722 Ga0495599_0001286 3300046678 Bacteria 14242
723 Ga0495599_0016850 3300046678 Bacteria 4539
724 Ga0495599_0049223 3300046678 Bacteria 2641
725 Ga0495599_0193968 3300046678 Bacteria 1249
726 Ga0495623_0000305 3300046679 Bacteria 31845
727 Ga0495623_0019522 3300046679 Bacteria 4379
728 Ga0495623_0054750 3300046679 Bacteria 2516
729 Ga0495646_0023136 3300046680 Bacteria 3912
730 Ga0495647_0010808 3300046681 Bacteria 3117
731 Ga0495658_0011573 3300046683 Bacteria 4443
732 Ga0495613_0047595 3300046689 Bacteria 3168
733 Ga0495613_0167812 3300046689 Bacteria 1559
734 Ga0495613_0269959 3300046689 Bacteria 1183
735 Ga0495600_0000023 3300046809 Bacteria 94401
736 Ga0495600_0112076 3300046809 Bacteria 1776
737 Ga0495581_0009214 3300047315 Bacteria 5710
738 Ga0495581_0294948 3300047315 Bacteria 948
739 Ga0495604_0000251 3300047317 Bacteria 47665
740 Ga0495604_0121543 3300047317 Bacteria 1890
741 Ga0495604_0125005 3300047317 Bacteria 1856
742 Ga0495674_0000339 3300047319 Bacteria 41326
743 Ga0495674_0041034 3300047319 Bacteria 4136
744 Ga0495674_0154712 3300047319 Bacteria 1921
745 Ga0495674_0168286 3300047319 Bacteria 1830
746 Ga0495672_0016711 3300047320 Bacteria 4930
747 Ga0495680_0001928 3300047322 Bacteria 21805
748 Ga0495680_0124103 3300047322 Bacteria 1904
749 Ga0495675_0002320 3300047444 Bacteria 11370
750 Ga0495675_0007433 3300047444 Bacteria 6746
751 Ga0495675_0034890 3300047444 Bacteria 3212
752 Ga0495675_0127476 3300047444 Bacteria 1583
753 Ga0495675_0168140 3300047444 Bacteria 1348
754 Ga0495685_033067 3300047447 Bacteria 1777
755 Ga0495684_0000037 3300047471 Bacteria 106933
756 Ga0495684_0016428 3300047471 Bacteria 5700
757 Ga0495684_0085104 3300047471 Bacteria 2398
758 Ga0495684_0253110 3300047471 Bacteria 1280
759 Ga0495593_0071857 3300047673 Bacteria 1797
760 Ga0495602_0047876 3300048088 Bacteria 3847
761 Ga0495614_0001483 3300048089 Bacteria 10159
762 Ga0496100_0019149 3300048903 Bacteria 4078
763 Ga0496101_0041757 3300048904 Bacteria 3272
764 Ga0496102_0007849 3300048905 Bacteria 9118
765 Ga0496102_0048232 3300048905 Bacteria 3872
766 Ga0496102_0585678 3300048905 Bacteria 1038
767 Ga0496104_0011908 3300048907 Bacteria 7803
768 Ga0496104_0025131 3300048907 Bacteria 5489
769 Ga0496105_0072177 3300048908 Bacteria 2853
770 Ga0496105_0122411 3300048908 Bacteria 2145
771 Ga0496105_0495709 3300048908 Bacteria 959
772 Ga0496106_0005482 3300048909 Bacteria 9388
773 Ga0496106_0226435 3300048909 Bacteria 1492
774 Ga0496106_0381394 3300048909 Bacteria 1133
775 Ga0496106_0643478 3300048909 Unclassified 847
776 Ga0496107_0195716 3300048910 Bacteria 1502
777 Ga0496107_0200975 3300048910 Bacteria 1481
778 Ga0496108_0006558 3300048911 Bacteria 9442
779 Ga0496108_0016052 3300048911 Bacteria 6106
780 Ga0496108_0016217 3300048911 Bacteria 6075
781 Ga0496109_0002800 3300048912 Bacteria 14601
782 Ga0496109_0006454 3300048912 Bacteria 9877
783 Ga0496109_0041970 3300048912 Bacteria 4143
784 Ga0496109_0292472 3300048912 Bacteria 1536
785 Ga0496110_0012160 3300048913 Bacteria 7071
786 Ga0496110_0058329 3300048913 Bacteria 3400
787 Ga0496110_0124136 3300048913 Bacteria 2329
788 Ga0496110_0704378 3300048913 Bacteria 911
789 Ga0496111_0269007 3300048914 Bacteria 1264
790 Ga0496112_0006640 3300048915 Bacteria 10187
791 Ga0496112_0021486 3300048915 Bacteria 6138
792 Ga0496112_0024056 3300048915 Bacteria 5829
793 Ga0496112_0024929 3300048915 Bacteria 5738
794 Ga0496112_0045630 3300048915 Bacteria 4296
795 Ga0496112_0073876 3300048915 Bacteria 3370
796 Ga0496113_0000492 3300048916 Bacteria 19434
797 Ga0496113_0010699 3300048916 Bacteria 6077
798 Ga0496113_0012678 3300048916 Bacteria 5673
799 Ga0496113_0091366 3300048916 Bacteria 2346
800 Ga0496113_0145899 3300048916 Unclassified 1864
801 Ga0496113_0298566 3300048916 Bacteria 1290
802 Ga0496114_0122992 3300048917 Bacteria 2233
803 Ga0496115_0006074 3300048918 Bacteria 8819
804 Ga0496115_0066762 3300048918 Bacteria 2908
805 Ga0496115_0157868 3300048918 Bacteria 1874
806 Ga0496115_0260274 3300048918 Bacteria 1427
807 Ga0496115_0295096 3300048918 Bacteria 1329
808 Ga0501299_012852 3300049522 Bacteria 1436
809 Ga0501031_0072156 3300049568 Bacteria 2248
810 Ga0501031_0218929 3300049568 Bacteria 1240
811 Ga0501033_0022885 3300049570 Bacteria 4711
812 Ga0501034_0000957 3300049571 Bacteria 41717
813 Ga0501034_0055200 3300049571 Bacteria 3998
814 Ga0501034_0480952 3300049571 Bacteria 1157
815 Ga0501038_0101522 3300049574 Bacteria 2395
816 Ga0501039_0153523 3300049575 Bacteria 1809
817 Ga0501040_0022534 3300049576 Bacteria 4216
818 Ga0501040_0117647 3300049576 Bacteria 1863
819 Ga0501041_0083736 3300049577 Bacteria 1966
820 Ga0501041_0223242 3300049577 Bacteria 1182
821 Ga0501042_0014238 3300049578 Bacteria 5426
822 Ga0501047_0121336 3300049581 Bacteria 2496
823 Ga0501048_0017270 3300049582 Bacteria 5317
824 Ga0501067_0000453 3300049583 Bacteria 22520
825 Ga0501067_0001802 3300049583 Bacteria 11766
826 Ga0501068_0000075 3300049584 Bacteria 39857
827 Ga0501068_0005590 3300049584 Bacteria 6883
828 Ga0501069_0002978 3300049585 Bacteria 8715
829 Ga0501069_0268203 3300049585 Bacteria 997
830 Ga0501070_0008992 3300049586 Bacteria 8450
831 Ga0501070_0026705 3300049586 Bacteria 4843
832 Ga0501070_0151386 3300049586 Bacteria 1914
833 Ga0501071_0000967 3300049587 Bacteria 15682
834 Ga0501071_0047000 3300049587 Bacteria 3100
835 Ga0501071_0114431 3300049587 Bacteria 1995
836 Ga0501072_0016690 3300049588 Bacteria 5640
837 Ga0501072_0020820 3300049588 Bacteria 5083
838 Ga0501072_0026953 3300049588 Bacteria 4485
839 Ga0501073_0003828 3300049589 Bacteria 11286
840 Ga0501073_0019153 3300049589 Bacteria 4945
841 Ga0501073_0036228 3300049589 Bacteria 3506
842 Ga0501074_0001534 3300049590 Bacteria 15646
843 Ga0501074_0091364 3300049590 Bacteria 2180
844 Ga0501075_0043154 3300049591 Bacteria 3382
845 Ga0501075_0046772 3300049591 Bacteria 3251
846 Ga0501076_0081973 3300049592 Bacteria 2590
847 Ga0501076_0110801 3300049592 Bacteria 2219
848 Ga0501233_012323 3300049668 Unclassified 1714
849 Ga0501079_0012422 3300049741 Bacteria 6498
850 Ga0501079_0082989 3300049741 Bacteria 2479
851 Ga0501079_0208789 3300049741 Bacteria 1525
852 Ga0501080_0004190 3300049742 Bacteria 12788
853 Ga0501080_0016832 3300049742 Bacteria 6752
854 Ga0501080_0250998 3300049742 Bacteria 1613
855 Ga0501080_0335368 3300049742 Bacteria 1367
856 Ga0501081_0024595 3300049743 Bacteria 4045
857 Ga0501083_0000108 3300049744 Bacteria 55825
858 Ga0501083_0031202 3300049744 Bacteria 3657
859 Ga0501272_007402 3300049769 Bacteria 1189
860 Ga0501044_0014220 3300049823 Bacteria 8595
861 Ga0501045_0059288 3300049824 Bacteria 2804
862 Ga0501045_0084553 3300049824 Bacteria 2341
863 nmdc:mga05p37_178900_c1 3300050507 Bacteria 2582
864 nmdc:mga05p37_5420_c1 3300050507 Bacteria 14992
865 nmdc:mga09592_123453_c1 3300050508 Bacteria 2225
866 nmdc:mga09592_134165_c1 3300050508 Bacteria 2132
867 nmdc:mga09592_22329_c1 3300050508 Bacteria 5222
868 nmdc:mga09592_45648_c1 3300050508 Bacteria 3691
869 nmdc:mga0qj67_200900_c1 3300050509 Bacteria 1620
870 nmdc:mga0qj67_59801_c1 3300050509 Bacteria 3023
871 nmdc:mga06r32_11427_c1 3300050510 Bacteria 7997
872 nmdc:mga06r32_224927_c1 3300050510 Bacteria 1865
873 nmdc:mga06r32_311453_c1 3300050510 Bacteria 1560
874 nmdc:mga06r32_407790_c1 3300050510 Bacteria 1341
875 nmdc:mga08y16_251475_c1 3300050511 Bacteria 1826
876 nmdc:mga0n895_109914_c1 3300050512 Bacteria 2772
877 nmdc:mga0n895_266248_c1 3300050512 Bacteria 1739
878 nmdc:mga0n895_343913_c1 3300050512 Bacteria 1511
879 nmdc:mga0n895_83127_c1 3300050512 Bacteria 3193
880 nmdc:mga0n895_90271_c1 3300050512 Bacteria 3066
881 nmdc:mga0rr50_145565_c1 3300050513 Bacteria 1910
882 nmdc:mga0rr50_31027_c1 3300050513 Bacteria 3790
883 nmdc:mga0rr50_39004_c1 3300050513 Bacteria 3442
884 nmdc:mga0rr50_8641_c1 3300050513 Bacteria 6349
885 nmdc:mga08x19_140852_c1 3300050514 Unclassified 1629
886 nmdc:mga08x19_33053_c1 3300050514 Bacteria 3263
887 nmdc:mga0a205_57315_c1 3300050515 Bacteria 3762
888 Ga0495601_0018077 3300053077 Bacteria 4286
889 Ga0495612_0000535 3300053078 Bacteria 15281
890 Ga0495595_0013459 3300053084 Bacteria 3457
891 Ga0495595_0035179 3300053084 Bacteria 2269
892 Ga0495619_0009945 3300053085 Bacteria 5990
893 Ga0501084_0001381 3300054114 Bacteria 19208
894 Ga0501084_0033416 3300054114 Bacteria 4303
895 Ga0501084_0247418 3300054114 Bacteria 1505
896 Ga0501084_0399722 3300054114 Unclassified 1161
897 Ga0590075_019322 3300059424 Bacteria 1690
898 Ga0501082_0028150 3300060353 Bacteria 4842
899 Ga0501082_0100055 3300060353 Bacteria 2507
900 Ga0530510_0079687 3300061734 Bacteria 2382
901 Ga0207645_10040504
902 MBSR1b_contig_8577748
903 MBSR1b_contig_8722026
904 JGI25406J46586_10003355
905 Ga0065715_10002333
906 Ga0065715_10089503
907 Ga0065715_10090989
908 Ga0065707_10191026
909 Ga0070658_10011273
910 Ga0070658_10043599
911 Ga0070658_10135764
912 Ga0070676_10003376
913 Ga0070676_10009490
914 Ga0070676_10032310
915 Ga0070676_10045529
916 Ga0070683_100002685
917 Ga0070683_100008944
918 Ga0070683_100013557
919 Ga0070683_100028453
920 Ga0070683_100033449
921 Ga0070683_100049546
922 Ga0070683_100055897
923 Ga0070683_100147755
924 Ga0070683_100199202
925 Ga0070683_100209431
926 Ga0070683_100350691
927 Ga0070683_100420592
928 Ga0070683_100751778
929 Ga0070690_100115424
930 Ga0070690_100118653
931 Ga0070690_100207317
932 Ga0070670_100019709
933 Ga0070670_100150417
934 Ga0070670_100270426
935 Ga0070670_100387013
936 Ga0070680_100001576
937 Ga0070680_100002007
938 Ga0070680_100003449
939 Ga0070680_100004265
940 Ga0070680_100010037
941 Ga0070680_100018513
942 Ga0070680_100030167
943 Ga0070680_100041594
944 Ga0070680_100065488
945 Ga0070680_100133834
946 Ga0070680_100314068
947 Ga0070682_100001764
948 Ga0070682_100003131
949 Ga0070682_100004688
950 Ga0070682_100004795
951 Ga0068868_100004512
952 Ga0068868_100021662
953 Ga0068868_100089634
954 Ga0068868_100163108
955 Ga0068868_100193724
956 Ga0070660_100061858
957 Ga0070660_100237794
958 Ga0070691_10037607
959 Ga0070691_10101453
960 Ga0070691_10110246
961 Ga0070661_100000287
962 Ga0070661_100079613
963 Ga0070661_100203907
964 Ga0070661_100222626
965 Ga0070661_100261708
966 Ga0070661_100315920
967 Ga0070692_10040969
968 Ga0070668_100129861
969 Ga0070669_100001817
970 Ga0070675_100021685
971 Ga0070675_100024935
972 Ga0070675_100113334
973 Ga0070675_100264318
974 Ga0070675_100633891
975 Ga0070671_100023711
976 Ga0070671_100157583
977 Ga0070671_100295859
978 Ga0070674_100220947
979 Ga0070674_100337982
980 Ga0070673_100019114
981 Ga0070673_100033087
982 Ga0070673_100166875
983 Ga0070673_100324384
984 Ga0070673_100347235
985 Ga0070688_100022562
986 Ga0070688_100159960
987 Ga0070659_100000726
988 Ga0070667_100051656
989 Ga0070667_100119380
990 Ga0070667_100515717
991 Ga0070709_10032261
992 Ga0070709_10081591
993 Ga0070714_100260846
994 Ga0070713_100032226
995 Ga0070710_10019174
996 Ga0070710_10357180
997 Ga0070711_100000573
998 Ga0070711_100336977
999 Ga0070705_100002147
1000 Ga0070705_100111299
1001 Ga0070705_100132815
1002 Ga0070700_100061191
1003 Ga0070700_100202962
1004 Ga0070694_100076861
1005 Ga0070708_100000086
1006 Ga0070708_100000265
1007 Ga0070708_100004934
1008 Ga0070708_100009641
1009 Ga0070708_100230064
1010 Ga0070662_100015423
1011 Ga0070662_100043224
1012 Ga0070662_100065520
1013 Ga0070681_10000220
1014 Ga0070681_10000222
1015 Ga0070681_10002241
1016 Ga0070681_10002413
1017 Ga0070681_10002965
1018 Ga0070681_10005036
1019 Ga0070681_10017250
1020 Ga0070681_10048544
1021 Ga0070681_10063535
1022 Ga0070681_10129048
1023 Ga0070681_10224813
1024 Ga0070681_10316256
1025 Ga0070681_10470510
1026 Ga0070681_10528827
1027 Ga0070681_10602560
1028 Ga0068867_100204592
1029 Ga0070685_10107159
1030 Ga0070706_100004404
1031 Ga0070706_100300115
1032 Ga0070707_100006707
1033 Ga0070707_100063386
1034 Ga0070707_100174318
1035 Ga0070707_100239922
1036 Ga0070698_100009208
1037 Ga0070698_100011989
1038 Ga0070698_100025546
1039 Ga0070698_100034953
1040 Ga0070698_100067803
1041 Ga0070698_100318426
1042 Ga0070699_100006343
1043 Ga0070699_100006480
1044 Ga0070699_100129617
1045 Ga0070699_100165735
1046 Ga0070699_100340361
1047 Ga0070699_100428433
1048 Ga0070679_100000984
1049 Ga0070679_100006040
1050 Ga0070679_100007847
1051 Ga0070679_100011171
1052 Ga0070679_100011933
1053 Ga0070679_100013182
1054 Ga0070679_100014269
1055 Ga0070679_100045190
1056 Ga0070679_100112086
1057 Ga0070679_100195077
1058 Ga0070679_100432740
1059 Ga0070679_100459566
1060 Ga0070684_100001391
1061 Ga0070684_100003297
1062 Ga0070684_100007869
1063 Ga0070684_100010607
1064 Ga0070684_100026612
1065 Ga0070684_100035629
1066 Ga0070684_100066367
1067 Ga0070684_100112463
1068 Ga0070684_100122656
1069 Ga0070684_100160091
1070 Ga0070684_100231890
1071 Ga0070697_100007220
1072 Ga0070697_100130528
1073 Ga0068853_100103354
1074 Ga0068853_100134613
1075 Ga0068853_100471017
1076 Ga0070672_100031158
1077 Ga0070672_100070705
1078 Ga0070672_100119791
1079 Ga0070672_100134450
1080 Ga0070672_100550353
1081 Ga0070686_100018883
1082 Ga0070686_100022681
1083 Ga0070686_100069410
1084 Ga0070686_100153810
1085 Ga0070695_100024342
1086 Ga0070695_100265714
1087 Ga0070696_100001801
1088 Ga0070696_100004106
1089 Ga0070696_100027347
1090 Ga0070696_100036662
1091 Ga0070696_100056487
1092 Ga0070696_100155338
1093 Ga0070696_100159863
1094 Ga0070693_100001903
1095 Ga0070693_100010051
1096 Ga0070693_100147402
1097 Ga0070693_100223524
1098 Ga0070665_100030097
1099 Ga0070665_100554189
1100 Ga0070704_100004573
1101 Ga0070704_100086269
1102 Ga0070704_100136675
1103 Ga0070704_100411052
1104 Ga0068855_100002450
1105 Ga0068855_100007670
1106 Ga0068855_100007956
1107 Ga0068855_100364208
1108 Ga0070664_100003703
1109 Ga0070664_100037137
1110 Ga0070664_100043369
1111 Ga0070664_100125451
1112 Ga0070664_100317633
1113 Ga0068857_100024116
1114 Ga0068857_100057308
1115 Ga0068857_100119313
1116 Ga0068857_100260973
1117 Ga0068857_100740257
1118 Ga0068854_100006008
1119 Ga0068854_100033243
1120 Ga0068856_100040030
1121 Ga0068856_100040068
1122 Ga0068856_100097252
1123 Ga0068856_100147134
1124 Ga0068856_100282394
1125 Ga0070702_100000691
1126 Ga0068852_100026584
1127 Ga0068852_100106759
1128 Ga0068852_100217903
1129 Ga0068852_100428853
1130 Ga0068852_100458880
1131 Ga0068859_100024452
1132 Ga0068859_100068050
1133 Ga0068859_100178683
1134 Ga0068864_100005316
1135 Ga0068864_100069272
1136 Ga0068864_100183949
1137 Ga0068864_100262631
1138 Ga0068864_100320367
1139 Ga0068866_10014928
1140 Ga0068861_100119282
1141 Ga0068870_10073553
1142 Ga0068870_10127289
1143 Ga0068863_100014116
1144 Ga0068858_100220870
1145 Ga0068860_100028935
1146 Ga0068860_100274034
1147 Ga0081539_10000103
1148 Ga0070712_100004579
1149 Ga0070712_100091150
1150 Ga0070712_100391486
1151 Ga0097621_100019555
1152 Ga0097621_100275108
1153 Ga0097621_100705800
1154 Ga0068871_100005554
1155 Ga0068871_100231875
1156 Ga0075428_100054118
1157 Ga0075430_100001593
1158 Ga0075430_100070681
1159 Ga0075431_100004530
1160 Ga0075431_100012338
1161 Ga0075431_100275657
1162 Ga0075431_100459785
1163 Ga0075431_100644036
1164 Ga0075433_10099460
1165 Ga0075433_10170445
1166 Ga0075433_10182148
1167 Ga0075433_10412333
1168 Ga0075434_100015921
1169 Ga0075434_100042070
1170 Ga0075434_100076798
1171 Ga0075434_100162440
1172 Ga0075434_100239953
1173 Ga0075429_100025902
1174 Ga0075429_100087690
1175 Ga0075429_100136827
1176 Ga0075429_100301596
1177 Ga0068865_100036733
1178 Ga0075436_100078813
1179 Ga0097620_100024453
1180 Ga0097620_100068054
1181 Ga0097620_100178681
1182 Ga0075435_100158298
1183 Ga0075435_100667052
1184 Ga0105240_10033173
1185 Ga0105240_10087486
1186 Ga0105240_10185389
1187 Ga0105240_10502289
1188 Ga0105240_10504745
1189 Ga0105245_10098951
1190 Ga0105245_10147516
1191 Ga0105245_10270911
1192 Ga0105245_10714072
1193 Ga0114129_10000112
1194 Ga0114129_10112082
1195 Ga0114129_10195490
1196 Ga0105241_10000025
1197 Ga0105241_10076288
1198 Ga0105242_10030108
1199 Ga0105242_10437139
1200 Ga0105248_10007306
1201 Ga0105248_10018583
1202 Ga0105248_10027527
1203 Ga0105248_10108984
1204 Ga0105248_10111389
1205 Ga0105248_10246262
1206 Ga0105248_10246450
1207 Ga0105248_10263826
1208 Ga0105248_10283322
1209 Ga0105248_10331439
1210 Ga0105237_10057918
1211 Ga0105238_10041781
1212 Ga0105238_10090522
1213 Ga0105238_10115923
1214 Ga0105238_10133724
1215 Ga0105238_10190032
1216 Ga0105239_10024821
1217 Ga0105239_10248196
1218 Ga0105239_10320384
1219 Ga0105239_10596340
1220 Ga0105246_10011927
1221 Ga0157373_10027315
1222 Ga0157373_10168014
1223 Ga0157371_10066892
1224 Ga0157370_10001352
1225 Ga0157370_10005925
1226 Ga0157370_10013219
1227 Ga0157370_10018592
1228 Ga0157370_10027402
1229 Ga0157370_10053294
1230 Ga0157370_10231685
1231 Ga0157370_10293634
1232 Ga0157370_10312114
1233 Ga0157369_10015693
1234 Ga0157369_10019452
1235 Ga0157369_10046069
1236 Ga0157369_10091519
1237 Ga0157369_10155065
1238 Ga0157369_10298898
1239 Ga0157369_10373419
1240 Ga0157369_10383206
1241 Ga0157369_10415373
1242 Ga0157374_10005425
1243 Ga0157374_10245632
1244 Ga0157374_10452867
1245 Ga0157374_10542284
1246 Ga0157378_10014992
1247 Ga0157378_10354917
1248 Ga0163162_10312917
1249 Ga0163162_10656637
1250 Ga0157372_10001141
1251 Ga0157372_10002494
1252 Ga0157372_10010939
1253 Ga0157372_10020943
1254 Ga0157372_10025682
1255 Ga0157372_10037081
1256 Ga0157372_10037712
1257 Ga0157372_10076985
1258 Ga0157372_10133392
1259 Ga0157372_10287816
1260 Ga0157372_10534200
1261 Ga0157375_10101001
1262 Ga0157375_10332345
1263 Ga0157375_10340355
1264 Ga0157375_10429316
1265 Ga0163163_10032617
1266 Ga0163163_10106850
1267 Ga0157380_10441823
1268 Ga0157377_10002606
1269 Ga0157377_10243495
1270 Ga0157379_10072366
1271 Ga0157376_10004937
1272 Ga0157376_10310131
1273 Ga0157376_10642470
1274 Ga0163161_10129706
1275 Ga0213876_10012247
1276 Ga0213876_10018827
1277 Ga0207697_10021929
1278 Ga0207656_10211214
1279 Ga0207692_10015845
1280 Ga0207642_10114033
1281 Ga0207642_10120176
1282 Ga0207680_10186319
1283 Ga0207699_10025053
1284 Ga0207699_10193989
1285 Ga0207645_10002673
1286 Ga0207645_10020443
1287 Ga0207645_10102609
1288 Ga0207645_10129199
1289 Ga0207645_10269577
1290 Ga0207643_10002623
1291 Ga0207705_10095688
1292 Ga0207705_10148903
1293 Ga0207684_10006258
1294 Ga0207654_10000187
1295 Ga0207654_10010629
1296 Ga0207707_10000368
1297 Ga0207707_10001363
1298 Ga0207707_10005124
1299 Ga0207707_10012116
1300 Ga0207707_10012350
1301 Ga0207707_10017280
1302 Ga0207707_10032210
1303 Ga0207707_10149111
1304 Ga0207707_10242503
1305 Ga0207695_10003984
1306 Ga0207695_10008659
1307 Ga0207695_10074608
1308 Ga0207695_10114946
1309 Ga0207695_10180479
1310 Ga0207695_10428058
1311 Ga0207671_10319938
1312 Ga0207693_10068255
1313 Ga0207663_10114551
1314 Ga0207660_10000017
1315 Ga0207660_10001873
1316 Ga0207660_10003526
1317 Ga0207660_10024415
1318 Ga0207660_10057991
1319 Ga0207660_10075291
1320 Ga0207660_10193876
1321 Ga0207660_10268900
1322 Ga0207657_10001418
1323 Ga0207657_10122439
1324 Ga0207649_10005528
1325 Ga0207649_10008516
1326 Ga0207649_10054331
1327 Ga0207649_10068687
1328 Ga0207649_10254648
1329 Ga0207649_10444524
1330 Ga0207652_10001054
1331 Ga0207652_10001788
1332 Ga0207652_10003275
1333 Ga0207652_10004889
1334 Ga0207652_10009093
1335 Ga0207652_10020987
1336 Ga0207652_10024228
1337 Ga0207652_10063070
1338 Ga0207652_10083471
1339 Ga0207652_10102650
1340 Ga0207652_10130098
1341 Ga0207652_10187870
1342 Ga0207652_10262297
1343 Ga0207646_10004898
1344 Ga0207646_10095221
1345 Ga0207646_10105317
1346 Ga0207646_10115346
1347 Ga0207646_10420135
1348 Ga0207681_10002709
1349 Ga0207681_10097333
1350 Ga0207681_10163979
1351 Ga0207694_10026154
1352 Ga0207694_10387344
1353 Ga0207650_10067152
1354 Ga0207650_10248310
1355 Ga0207650_10248678
1356 Ga0207659_10002341
1357 Ga0207659_10146946
1358 Ga0207659_10227955
1359 Ga0207687_10011236
1360 Ga0207687_10241763
1361 Ga0207700_10046694
1362 Ga0207644_10003159
1363 Ga0207644_10046632
1364 Ga0207644_10193639
1365 Ga0207690_10003915
1366 Ga0207690_10075772
1367 Ga0207706_10006158
1368 Ga0207706_10026811
1369 Ga0207706_10100785
1370 Ga0207706_10103361
1371 Ga0207670_10069292
1372 Ga0207670_10155814
1373 Ga0207669_10175865
1374 Ga0207669_10194362
1375 Ga0207704_10227271
1376 Ga0207704_10260147
1377 Ga0207704_10292518
1378 Ga0207665_10004059
1379 Ga0207691_10004269
1380 Ga0207691_10020319
1381 Ga0207691_10053003
1382 Ga0207691_10362227
1383 Ga0207711_10104699
1384 Ga0207711_10142004
1385 Ga0207711_10316602
1386 Ga0207689_10057011
1387 Ga0207661_10001891
1388 Ga0207661_10003915
1389 Ga0207661_10005970
1390 Ga0207661_10013955
1391 Ga0207661_10016323
1392 Ga0207661_10034924
1393 Ga0207661_10042016
1394 Ga0207661_10050451
1395 Ga0207661_10113479
1396 Ga0207661_10309416
1397 Ga0207661_10322825
1398 Ga0207679_10003199
1399 Ga0207679_10012060
1400 Ga0207679_10024789
1401 Ga0207679_10063573
1402 Ga0207679_10078560
1403 Ga0207679_10123912
1404 Ga0207679_10214160
1405 Ga0207679_10336618
1406 Ga0207679_10548062
1407 Ga0207667_10042532
1408 Ga0207667_10116538
1409 Ga0207667_10191728
1410 Ga0207667_10325594
1411 Ga0207651_10040421
1412 Ga0207651_10068593
1413 Ga0207712_10102785
1414 Ga0207640_10017641
1415 Ga0207640_10143155
1416 Ga0207658_10140867
1417 Ga0207658_10195977
1418 Ga0207658_10402931
1419 Ga0207677_10073456
1420 Ga0207677_10080759
1421 Ga0207677_10270174
1422 Ga0207677_10278175
1423 Ga0207677_10538064
1424 Ga0207703_10218123
1425 Ga0207639_10080223
1426 Ga0207639_10177203
1427 Ga0207639_10228202
1428 Ga0207639_10543122
1429 Ga0207678_10000466
1430 Ga0207708_10053219
1431 Ga0207708_10489049
1432 Ga0207702_10013208
1433 Ga0207702_10031500
1434 Ga0207702_10111092
1435 Ga0207702_10305196
1436 Ga0207641_10009005
1437 Ga0207641_10220896
1438 Ga0207641_10557659
1439 Ga0207648_10082367
1440 Ga0207648_10413923
1441 Ga0207648_10479460
1442 Ga0207676_10001153
1443 Ga0207676_10006811
1444 Ga0207676_10101402
1445 Ga0207676_10171817
1446 Ga0207676_10241831
1447 Ga0207676_10287679
1448 Ga0207674_10002099
1449 Ga0207674_10004722
1450 Ga0207674_10035393
1451 Ga0207674_10067120
1452 Ga0207674_10146449
1453 Ga0207674_10288708
1454 Ga0207674_10552274
1455 Ga0207675_100146194
1456 Ga0207683_10398817
1457 Ga0207698_10018067
1458 Ga0207698_10020884
1459 Ga0207698_10077814
1460 Ga0207698_10147249
1461 Ga0207698_10160640
1462 Ga0209999_1020629
1463 Ga0268266_10446022
1464 Ga0268265_10238249
1465 Ga0268264_10022770
1466 Ga0268264_10073534
1467 Ga0265332_10040118
1468 Ga0307408_100010569
1469 Ga0307408_100046915
1470 Ga0307408_100083768
1471 Ga0307408_100188659
1472 Ga0265314_10040777
1473 Ga0307405_10055910
1474 Ga0307413_10010373
1475 Ga0307413_10037090
1476 Ga0307413_10058437
1477 Ga0307413_10122045
1478 Ga0307413_10219150
1479 Ga0307413_10379900
1480 Ga0307410_10006805
1481 Ga0307410_10012461
1482 Ga0307410_10019809
1483 Ga0307410_10044530
1484 Ga0307410_10071378
1485 Ga0307410_10087066
1486 Ga0307406_10038928
1487 Ga0307406_10089294
1488 Ga0307406_10294783
1489 Ga0307407_10005350
1490 Ga0307407_10118180
1491 Ga0307407_10165353
1492 Ga0307407_10275771
1493 Ga0307412_10119100
1494 Ga0307409_100075687
1495 Ga0307409_100105813
1496 Ga0307409_100281794
1497 Ga0307409_100487448
1498 Ga0307416_100003807
1499 Ga0307416_100009633
1500 Ga0307416_100266086
1501 Ga0307416_100325661
1502 Ga0307416_100559515
1503 Ga0307414_10018396
1504 Ga0307414_10079457
1505 Ga0307414_10163243
1506 Ga0307414_10360504
1507 Ga0307411_10000833
1508 Ga0307411_10099038
1509 Ga0307411_10130647
1510 Ga0307411_10144973
1511 Ga0307411_10177965
1512 Ga0307415_100000666
1513 Ga0307415_100064386
1514 Ga0307415_100161485
1515 Ga0373934_0000219
1516 Ga0373934_0006580
1517 Ga0373934_0090785
1518 Ga0373940_0009659
1519 Ga0373940_0066383
1520 Ga0373953_0002688
1521 Ga0373956_0000144
1522 Ga0373957_0024527
1523 Ga0373960_0056080
1524 Ga0373943_0049466
1525 Ga0373943_0072244
1526 Ga0373946_0026180
1527 Ga0373955_0006033
1528 Ga0373955_0018797
1529 Ga0373942_0083868
1530 Ga0373961_0013347
1531 Ga0373924_0018874
1532 Ga0373931_0004853
1533 Ga0373931_0043732
1534 Ga0373931_0186046
1535 Ga0373927_0026479
1536 Ga0373933_0000353
1537 Ga0373933_0054996
1538 Ga0373947_0004333
1539 Ga0373937_0000450
1540 Ga0373937_0002043
1541 Ga0373937_0050445
1542 Ga0373937_0127956
1543 Ga0373937_0349729
1544 Ga0395905_0565114
1545 Ga0436364_0054570
1546 Ga0436365_0252582
1547 Ga0436365_1557839
1548 Ga0451577_0009949
1549 Ga0451577_0015744
1550 Ga0451577_0238817
1551 Ga0451577_0456373
1552 Ga0453683_0093778
1553 Ga0453684_0000886
1554 Ga0453684_0523607
1555 Ga0451576_0033383
1556 Ga0451576_0116722
1557 Ga0451576_0128697
1558 Ga0451576_0203755
1559 Ga0451576_0286316
1560 Ga0451576_0584020
1561 Ga0466967_0103003
1562 Ga0466967_0538678
1563 Ga0495592_0013907
1564 Ga0495592_0087487
1565 Ga0495629_0015582
1566 Ga0495629_0056564
1567 Ga0495629_0220787
1568 Ga0495651_0000050
1569 Ga0495651_0025817
1570 Ga0495651_0053696
1571 Ga0495653_0000195
1572 Ga0495653_0095493
1573 Ga0495580_0003045
1574 Ga0495580_0012371
1575 Ga0495580_0107200
1576 Ga0495582_0037184
1577 Ga0495664_0009814
1578 Ga0495664_0058141
1579 Ga0495664_0091181
1580 Ga0495594_0041291
1581 Ga0495594_0077916
1582 Ga0495594_0091903
1583 Ga0495594_0190496
1584 Ga0495596_0026082
1585 Ga0495608_0000787
1586 Ga0495608_0029218
1587 Ga0495618_0043324
1588 Ga0495618_0178414
1589 Ga0495628_0001915
1590 Ga0495628_0149579
1591 Ga0495628_0179696
1592 Ga0495630_0006626
1593 Ga0495630_0045996
1594 Ga0495630_0077455
1595 Ga0495630_0080633
1596 Ga0495652_0001266
1597 Ga0495652_0008501
1598 Ga0495665_0131133
1599 Ga0495640_0080318
1600 Ga0495586_0026611
1601 Ga0495586_0036756
1602 Ga0495587_0000114
1603 Ga0495587_0001632
1604 Ga0495587_0027313
1605 Ga0495587_0035035
1606 Ga0495621_0009244
1607 Ga0495645_0000144
1608 Ga0495645_0032745
1609 Ga0495645_0086982
1610 Ga0495645_0111844
1611 Ga0495667_0000241
1612 Ga0495667_0014810
1613 Ga0495667_0119000
1614 Ga0495656_0160301
1615 Ga0495634_0057536
1616 Ga0495635_0002069
1617 Ga0495635_0078130
1618 Ga0495588_0005185
1619 Ga0495657_0000210
1620 Ga0495657_0083356
1621 Ga0495599_0000436
1622 Ga0495599_0001286
1623 Ga0495599_0016850
1624 Ga0495599_0049223
1625 Ga0495599_0193968
1626 Ga0495623_0000305
1627 Ga0495623_0019522
1628 Ga0495623_0054750
1629 Ga0495646_0023136
1630 Ga0495647_0010808
1631 Ga0495658_0011573
1632 Ga0495613_0047595
1633 Ga0495613_0167812
1634 Ga0495613_0269959
1635 Ga0495600_0000023
1636 Ga0495600_0112076
1637 Ga0495581_0009214
1638 Ga0495581_0294948
1639 Ga0495604_0000251
1640 Ga0495604_0121543
1641 Ga0495604_0125005
1642 Ga0495674_0000339
1643 Ga0495674_0041034
1644 Ga0495674_0154712
1645 Ga0495674_0168286
1646 Ga0495672_0016711
1647 Ga0495680_0001928
1648 Ga0495680_0124103
1649 Ga0495675_0002320
1650 Ga0495675_0007433
1651 Ga0495675_0034890
1652 Ga0495675_0127476
1653 Ga0495675_0168140
1654 Ga0495685_033067
1655 Ga0495684_0000037
1656 Ga0495684_0016428
1657 Ga0495684_0085104
1658 Ga0495684_0253110
1659 Ga0495593_0071857
1660 Ga0495602_0047876
1661 Ga0495614_0001483
1662 Ga0496100_0019149
1663 Ga0496101_0041757
1664 Ga0496102_0007849
1665 Ga0496102_0048232
1666 Ga0496102_0585678
1667 Ga0496104_0011908
1668 Ga0496104_0025131
1669 Ga0496105_0072177
1670 Ga0496105_0122411
1671 Ga0496105_0495709
1672 Ga0496106_0005482
1673 Ga0496106_0226435
1674 Ga0496106_0381394
1675 Ga0496106_0643478
1676 Ga0496107_0195716
1677 Ga0496107_0200975
1678 Ga0496108_0006558
1679 Ga0496108_0016052
1680 Ga0496108_0016217
1681 Ga0496109_0002800
1682 Ga0496109_0006454
1683 Ga0496109_0041970
1684 Ga0496109_0292472
1685 Ga0496110_0012160
1686 Ga0496110_0058329
1687 Ga0496110_0124136
1688 Ga0496110_0704378
1689 Ga0496111_0269007
1690 Ga0496112_0006640
1691 Ga0496112_0021486
1692 Ga0496112_0024056
1693 Ga0496112_0024929
1694 Ga0496112_0045630
1695 Ga0496112_0073876
1696 Ga0496113_0000492
1697 Ga0496113_0010699
1698 Ga0496113_0012678
1699 Ga0496113_0091366
1700 Ga0496113_0145899
1701 Ga0496113_0298566
1702 Ga0496114_0122992
1703 Ga0496115_0006074
1704 Ga0496115_0066762
1705 Ga0496115_0157868
1706 Ga0496115_0260274
1707 Ga0496115_0295096
1708 Ga0501299_012852
1709 Ga0501031_0072156
1710 Ga0501031_0218929
1711 Ga0501033_0022885
1712 Ga0501034_0000957
1713 Ga0501034_0055200
1714 Ga0501034_0480952
1715 Ga0501038_0101522
1716 Ga0501039_0153523
1717 Ga0501040_0022534
1718 Ga0501040_0117647
1719 Ga0501041_0083736
1720 Ga0501041_0223242
1721 Ga0501042_0014238
1722 Ga0501047_0121336
1723 Ga0501048_0017270
1724 Ga0501067_0000453
1725 Ga0501067_0001802
1726 Ga0501068_0000075
1727 Ga0501068_0005590
1728 Ga0501069_0002978
1729 Ga0501069_0268203
1730 Ga0501070_0008992
1731 Ga0501070_0026705
1732 Ga0501070_0151386
1733 Ga0501071_0000967
1734 Ga0501071_0047000
1735 Ga0501071_0114431
1736 Ga0501072_0016690
1737 Ga0501072_0020820
1738 Ga0501072_0026953
1739 Ga0501073_0003828
1740 Ga0501073_0019153
1741 Ga0501073_0036228
1742 Ga0501074_0001534
1743 Ga0501074_0091364
1744 Ga0501075_0043154
1745 Ga0501075_0046772
1746 Ga0501076_0081973
1747 Ga0501076_0110801
1748 Ga0501233_012323
1749 Ga0501079_0012422
1750 Ga0501079_0082989
1751 Ga0501079_0208789
1752 Ga0501080_0004190
1753 Ga0501080_0016832
1754 Ga0501080_0250998
1755 Ga0501080_0335368
1756 Ga0501081_0024595
1757 Ga0501083_0000108
1758 Ga0501083_0031202
1759 Ga0501272_007402
1760 Ga0501044_0014220
1761 Ga0501045_0059288
1762 Ga0501045_0084553
1763 nmdc:mga05p37_178900_c1
1764 nmdc:mga05p37_5420_c1
1765 nmdc:mga09592_123453_c1
1766 nmdc:mga09592_134165_c1
1767 nmdc:mga09592_22329_c1
1768 nmdc:mga09592_45648_c1
1769 nmdc:mga0qj67_200900_c1
1770 nmdc:mga0qj67_59801_c1
1771 nmdc:mga06r32_11427_c1
1772 nmdc:mga06r32_224927_c1
1773 nmdc:mga06r32_311453_c1
1774 nmdc:mga06r32_407790_c1
1775 nmdc:mga08y16_251475_c1
1776 nmdc:mga0n895_109914_c1
1777 nmdc:mga0n895_266248_c1
1778 nmdc:mga0n895_343913_c1
1779 nmdc:mga0n895_83127_c1
1780 nmdc:mga0n895_90271_c1
1781 nmdc:mga0rr50_145565_c1
1782 nmdc:mga0rr50_31027_c1
1783 nmdc:mga0rr50_39004_c1
1784 nmdc:mga0rr50_8641_c1
1785 nmdc:mga08x19_140852_c1
1786 nmdc:mga08x19_33053_c1
1787 nmdc:mga0a205_57315_c1
1788 Ga0495601_0018077
1789 Ga0495612_0000535
1790 Ga0495595_0013459
1791 Ga0495595_0035179
1792 Ga0495619_0009945
1793 Ga0501084_0001381
1794 Ga0501084_0033416
1795 Ga0501084_0247418
1796 Ga0501084_0399722
1797 Ga0590075_019322
1798 Ga0501082_0028150
1799 Ga0501082_0100055
1800 Ga0530510_0079687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

1

271

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9183 2 275
7an5-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.912 2 275
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9119 2 275
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.911 2 275
7an9-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9085 2 275
ID Description Score Start End Superfamily
2nxoD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9237 2 273 3.40.190.10
2i6eA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9147 2 259 3.40.190.10
2nxoD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9028 2 273 3.40.190.10
2i6eA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8916 2 259 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7829 1 264 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W0JXV2-F1-model_v4 Menaquinone biosynthesis protein 0.9773 46 275 GO:0009234
GO:0016829
AF-A0A7W0JXV2-F1-model_v4 Menaquinone biosynthesis protein 0.9731 46 275 GO:0009234
GO:0016829
AF-A0A2V7LZM9-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.9643 1 275 GO:0009234
GO:0016836
AF-A0A2V7GFZ3-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.9547 1 275 GO:0009234
GO:0016836
AF-A0A2V7LZM9-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.954 1 275 GO:0009234
GO:0016836

Map