F485058

General Info

Members Datasets Scaffolds Average Seq Length
897 343 896 324

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_37429_c1|nmdc:mga0qj67_37429_c1_2382_3512
Length 376
Sequence LASIADLPTPQRLTAIRDQLTPLIESADPGALAEQAGALELEMGAPGFWDDQERAQQVSSEHARVTRRLEQMRSLEADVDDLEGLAELAAEDASIAEXXXXQLAAVEARLSDLELERLFSGRYDRGDALVAVNAGAGGTDAQDWAEMVLRMEMRWAERRGFKVELLEVSEGEEAGIKSATFRVSGENAYGLYSAEKGVHRLVRLSPFDSANRRQTSFAGVEVSPVIEDAGEVEIDADDLQVDTYRASGAGGQHVNKTDSAVRITHRPSGIVVQCQNERSQTQNRETAMKMLRSKLVELRERERAEELARERGDAQDVNFGSQIRSYVLHPYTMVKDHRTNFEVGNAQGVLEGDLDGFIRAELLRAAGRSAGAGGVK

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.89
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0.78
Rhizoplane 9.03
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008039 3300000549 Bacteria 1291
2 JGI24738J21930_10008605 3300002075 Bacteria 2318
3 JGI25406J46586_10014128 3300003203 Bacteria 3403
4 JGI25406J46586_10016276 3300003203 Bacteria 3104
5 JGI25407J50210_10005129 3300003373 Bacteria 3211
6 JGI25407J50210_10013832 3300003373 Bacteria 2076
7 JGI25407J50210_10014324 3300003373 Bacteria 2044
8 Ga0070658_10064661 3300005327 Bacteria 2984
9 Ga0070658_10245389 3300005327 Bacteria 1519
10 Ga0070683_100001429 3300005329 Bacteria 18327
11 Ga0070683_100006385 3300005329 Bacteria 9886
12 Ga0070683_100008554 3300005329 Bacteria 8698
13 Ga0070683_100030210 3300005329 Bacteria 4914
14 Ga0070670_100090285 3300005331 Bacteria 2633
15 Ga0068869_100066940 3300005334 Bacteria 2648
16 Ga0070666_10029341 3300005335 Bacteria 3615
17 Ga0070680_100081060 3300005336 Bacteria 2677
18 Ga0070680_100101413 3300005336 Bacteria 2389
19 Ga0070680_100143896 3300005336 Bacteria 2000
20 Ga0070680_100301560 3300005336 Bacteria 1359
21 Ga0070682_100000045 3300005337 Bacteria 131960
22 Ga0070682_100002116 3300005337 Bacteria 11030
23 Ga0070682_100014100 3300005337 Bacteria 4614
24 Ga0070682_100063203 3300005337 Bacteria 2346
25 Ga0070682_100080129 3300005337 Bacteria 2110
26 Ga0070682_100080676 3300005337 Bacteria 2104
27 Ga0070682_100212589 3300005337 Bacteria 1371
28 Ga0068868_100005956 3300005338 Bacteria 8599
29 Ga0068868_100025245 3300005338 Bacteria 4517
30 Ga0070660_100001878 3300005339 Bacteria 14467
31 Ga0070660_100002874 3300005339 Bacteria 11862
32 Ga0070660_100044156 3300005339 Bacteria 3407
33 Ga0070661_100000023 3300005344 Bacteria 123104
34 Ga0070661_100029830 3300005344 Bacteria 3938
35 Ga0070661_100036846 3300005344 Bacteria 3555
36 Ga0070692_10016243 3300005345 Bacteria 3540
37 Ga0070668_100015307 3300005347 Bacteria 5731
38 Ga0070668_100116183 3300005347 Bacteria 2133
39 Ga0070675_100000053 3300005354 Bacteria 70601
40 Ga0070675_100195855 3300005354 Bacteria 1752
41 Ga0070674_100000082 3300005356 Bacteria 44418
42 Ga0070674_100070535 3300005356 Bacteria 2469
43 Ga0070674_100158725 3300005356 Bacteria 1714
44 Ga0070688_100000300 3300005365 Bacteria 25290
45 Ga0070688_100000630 3300005365 Bacteria 17586
46 Ga0070688_100060783 3300005365 Bacteria 2387
47 Ga0070659_100006539 3300005366 Bacteria 8417
48 Ga0070659_100024338 3300005366 Bacteria 4641
49 Ga0070659_100037986 3300005366 Bacteria 3754
50 Ga0070667_100000695 3300005367 Bacteria 32405
51 Ga0070713_100000009 3300005436 Bacteria 153056
52 Ga0070713_100160693 3300005436 Bacteria 2005
53 Ga0070711_100092307 3300005439 Bacteria 2184
54 Ga0070711_100247965 3300005439 Bacteria 1395
55 Ga0070705_100054509 3300005440 Bacteria 2346
56 Ga0070700_100080988 3300005441 Bacteria 2096
57 Ga0070700_100272372 3300005441 Bacteria 1224
58 Ga0070663_100023142 3300005455 Bacteria 4161
59 Ga0070678_100007927 3300005456 Bacteria 6325
60 Ga0070662_100000016 3300005457 Bacteria 105820
61 Ga0070662_100068086 3300005457 Bacteria 2616
62 Ga0070662_100093451 3300005457 Bacteria 2263
63 Ga0070681_10010625 3300005458 Bacteria 9099
64 Ga0070681_10013721 3300005458 Bacteria 8066
65 Ga0070681_10019078 3300005458 Bacteria 6863
66 Ga0070681_10028864 3300005458 Bacteria 5574
67 Ga0070681_10056580 3300005458 Bacteria 3903
68 Ga0070681_10105644 3300005458 Bacteria 2758
69 Ga0068867_100006031 3300005459 Bacteria 8588
70 Ga0068867_100054845 3300005459 Bacteria 2945
71 Ga0070685_10000282 3300005466 Bacteria 32605
72 Ga0070685_10000320 3300005466 Bacteria 29816
73 Ga0070707_100229613 3300005468 Bacteria 1807
74 Ga0070679_100000312 3300005530 Bacteria 41159
75 Ga0070679_100014166 3300005530 Bacteria 7650
76 Ga0070679_100031669 3300005530 Bacteria 5227
77 Ga0070679_100033291 3300005530 Bacteria 5103
78 Ga0070679_100068574 3300005530 Bacteria 3538
79 Ga0070684_100011922 3300005535 Bacteria 6942
80 Ga0070684_100023464 3300005535 Bacteria 5161
81 Ga0070684_100024068 3300005535 Bacteria 5104
82 Ga0070684_100024149 3300005535 Bacteria 5096
83 Ga0070684_100025949 3300005535 Bacteria 4930
84 Ga0070684_100038133 3300005535 Bacteria 4126
85 Ga0070684_100091076 3300005535 Bacteria 2712
86 Ga0070684_100138659 3300005535 Bacteria 2198
87 Ga0070697_100097586 3300005536 Bacteria 2438
88 Ga0068853_100002766 3300005539 Bacteria 13247
89 Ga0070686_100242430 3300005544 Bacteria 1313
90 Ga0070693_100006705 3300005547 Bacteria 5592
91 Ga0070693_100169542 3300005547 Bacteria 1397
92 Ga0070665_100000244 3300005548 Bacteria 90284
93 Ga0070665_100005026 3300005548 Bacteria 13720
94 Ga0070665_100017879 3300005548 Bacteria 7118
95 Ga0070665_100223482 3300005548 Bacteria 1884
96 Ga0070665_100279050 3300005548 Bacteria 1672
97 Ga0070704_100028529 3300005549 Bacteria 3715
98 Ga0070704_100148947 3300005549 Bacteria 1837
99 Ga0068855_100046966 3300005563 Bacteria 5103
100 Ga0068855_100204032 3300005563 Bacteria 2225
101 Ga0070664_100128239 3300005564 Bacteria 2227
102 Ga0070664_100272162 3300005564 Bacteria 1526
103 Ga0068857_100058998 3300005577 Bacteria 3408
104 Ga0068854_100000031 3300005578 Bacteria 107298
105 Ga0068856_100001194 3300005614 Bacteria 27371
106 Ga0068856_100026366 3300005614 Bacteria 5667
107 Ga0068856_100043149 3300005614 Bacteria 4437
108 Ga0068856_100173482 3300005614 Bacteria 2168
109 Ga0068856_100184340 3300005614 Bacteria 2101
110 Ga0070702_100010129 3300005615 Bacteria 4633
111 Ga0068852_100000296 3300005616 Bacteria 33429
112 Ga0068852_100006184 3300005616 Bacteria 8632
113 Ga0068852_100044814 3300005616 Bacteria 3760
114 Ga0068852_100239073 3300005616 Bacteria 1734
115 Ga0068864_100000045 3300005618 Bacteria 154739
116 Ga0068864_100058920 3300005618 Bacteria 3321
117 Ga0068866_10000001 3300005718 Bacteria 519680
118 Ga0068866_10005928 3300005718 Bacteria 5080
119 Ga0068861_100002566 3300005719 Bacteria 11872
120 Ga0068851_10000656 3300005834 Bacteria 14770
121 Ga0068851_10019515 3300005834 Bacteria 3275
122 Ga0068863_100000021 3300005841 Bacteria 198088
123 Ga0068863_100024278 3300005841 Bacteria 5782
124 Ga0068863_100339780 3300005841 Bacteria 1461
125 Ga0068858_100000267 3300005842 Bacteria 55818
126 Ga0068858_100001207 3300005842 Bacteria 26780
127 Ga0068860_100130464 3300005843 Bacteria 2411
128 Ga0068862_100008832 3300005844 Bacteria 8345
129 Ga0081455_10003252 3300005937 Bacteria 18813
130 Ga0081455_10027049 3300005937 Bacteria 5261
131 Ga0081455_10028011 3300005937 Bacteria 5152
132 Ga0081455_10055109 3300005937 Bacteria 3383
133 Ga0081455_10057361 3300005937 Bacteria 3301
134 Ga0081455_10149621 3300005937 Bacteria 1801
135 Ga0081538_10000219 3300005981 Bacteria 64491
136 Ga0081538_10000241 3300005981 Bacteria 61996
137 Ga0081538_10002025 3300005981 Bacteria 20274
138 Ga0081538_10003073 3300005981 Bacteria 15877
139 Ga0081538_10003315 3300005981 Bacteria 15262
140 Ga0081538_10004594 3300005981 Bacteria 12692
141 Ga0081538_10011818 3300005981 Bacteria 7047
142 Ga0081538_10016142 3300005981 Bacteria 5740
143 Ga0081538_10021887 3300005981 Bacteria 4649
144 Ga0081538_10046933 3300005981 Bacteria 2656
145 Ga0081538_10047697 3300005981 Bacteria 2624
146 Ga0081538_10077193 3300005981 Bacteria 1795
147 Ga0081540_1002225 3300005983 Bacteria 15996
148 Ga0081539_10001668 3300005985 Bacteria 35937
149 Ga0081539_10001929 3300005985 Bacteria 31957
150 Ga0081539_10002491 3300005985 Bacteria 25867
151 Ga0081539_10009624 3300005985 Bacteria 8021
152 Ga0081539_10017082 3300005985 Bacteria 5122
153 Ga0075364_10188149 3300006051 Bacteria 1398
154 Ga0070715_10000001 3300006163 Bacteria 693690
155 Ga0070716_100135735 3300006173 Bacteria 1562
156 Ga0070716_100217633 3300006173 Bacteria 1281
157 Ga0070716_100224153 3300006173 Bacteria 1265
158 Ga0070716_100263271 3300006173 Bacteria 1181
159 Ga0070712_100001071 3300006175 Bacteria 16531
160 Ga0070712_100003981 3300006175 Bacteria 9083
161 Ga0070712_100056677 3300006175 Bacteria 2749
162 Ga0070712_100186842 3300006175 Bacteria 1618
163 Ga0070712_100343399 3300006175 Bacteria 1220
164 Ga0097621_100365845 3300006237 Bacteria 1286
165 Ga0075428_100023575 3300006844 Bacteria 6813
166 Ga0075428_100047387 3300006844 Bacteria 4721
167 Ga0075430_100000824 3300006846 Bacteria 24215
168 Ga0075431_100000747 3300006847 Bacteria 28086
169 Ga0075431_100002897 3300006847 Bacteria 16590
170 Ga0075431_100230163 3300006847 Bacteria 1889
171 Ga0075431_100257275 3300006847 Bacteria 1772
172 Ga0075433_10001485 3300006852 Bacteria 17324
173 Ga0075433_10015865 3300006852 Bacteria 6193
174 Ga0075433_10018515 3300006852 Bacteria 5792
175 Ga0075434_100034518 3300006871 Bacteria 4995
176 Ga0075434_100137545 3300006871 Bacteria 2462
177 Ga0068865_100000104 3300006881 Bacteria 43423
178 Ga0068865_100034775 3300006881 Bacteria 3383
179 Ga0075436_100228362 3300006914 Bacteria 1322
180 Ga0079104_1000337 3300006946 Bacteria 57374
181 Ga0079104_1005865 3300006946 Bacteria 4790
182 Ga0079104_1028242 3300006946 Bacteria 1427
183 Ga0105240_10031253 3300009093 Bacteria 6907
184 Ga0105240_10324663 3300009093 Bacteria 1753
185 Ga0111539_10044466 3300009094 Bacteria 5320
186 Ga0111539_10065301 3300009094 Bacteria 4301
187 Ga0111539_10078234 3300009094 Bacteria 3891
188 Ga0111539_10102572 3300009094 Bacteria 3358
189 Ga0105245_10000236 3300009098 Bacteria 52639
190 Ga0105245_10000545 3300009098 Bacteria 34359
191 Ga0105245_10002692 3300009098 Bacteria 15989
192 Ga0105245_10006569 3300009098 Bacteria 10206
193 Ga0105245_10042529 3300009098 Bacteria 4054
194 Ga0105245_10108988 3300009098 Bacteria 2573
195 Ga0105245_10240515 3300009098 Bacteria 1754
196 Ga0105245_10247711 3300009098 Bacteria 1730
197 Ga0105245_10282589 3300009098 Bacteria 1623
198 Ga0105247_10054722 3300009101 Bacteria 2462
199 Ga0105247_10067293 3300009101 Bacteria 2231
200 Ga0114129_10014103 3300009147 Bacteria 11384
201 Ga0114129_10124004 3300009147 Bacteria 3553
202 Ga0114129_10215708 3300009147 Bacteria 2592
203 Ga0114129_10411207 3300009147 Bacteria 1781
204 Ga0114129_10765283 3300009147 Bacteria 1235
205 Ga0105243_10014354 3300009148 Bacteria 5995
206 Ga0105243_10046579 3300009148 Bacteria 3412
207 Ga0105243_10086529 3300009148 Bacteria 2571
208 Ga0105243_10297599 3300009148 Bacteria 1461
209 Ga0105242_10000194 3300009176 Bacteria 47231
210 Ga0105242_10000819 3300009176 Bacteria 24165
211 Ga0105242_10132675 3300009176 Bacteria 2152
212 Ga0105242_10193474 3300009176 Bacteria 1802
213 Ga0105238_10000011 3300009551 Bacteria 261080
214 Ga0105238_10040063 3300009551 Bacteria 4749
215 Ga0105238_10081390 3300009551 Bacteria 3228
216 Ga0105249_10148229 3300009553 Bacteria 2256
217 Ga0105249_10183328 3300009553 Bacteria 2038
218 Ga0105239_10130675 3300010375 Bacteria 2793
219 Ga0105239_10351710 3300010375 Bacteria 1664
220 Ga0105239_10374451 3300010375 Bacteria 1609
221 Ga0105239_10392819 3300010375 Bacteria 1569
222 Ga0157342_1005311 3300012507 Bacteria 1180
223 Ga0157373_10093096 3300013100 Bacteria 2123
224 Ga0157371_10005434 3300013102 Bacteria 10742
225 Ga0157371_10049109 3300013102 Bacteria 2998
226 Ga0157371_10050500 3300013102 Bacteria 2956
227 Ga0157370_10014865 3300013104 Bacteria 7942
228 Ga0157370_10069784 3300013104 Bacteria 3318
229 Ga0157370_10140814 3300013104 Bacteria 2247
230 Ga0157370_10146104 3300013104 Bacteria 2202
231 Ga0157370_10160855 3300013104 Bacteria 2089
232 Ga0157370_10286935 3300013104 Bacteria 1520
233 Ga0157369_10001239 3300013105 Bacteria 31838
234 Ga0157369_10003551 3300013105 Bacteria 18519
235 Ga0157369_10033166 3300013105 Bacteria 5677
236 Ga0157369_10193773 3300013105 Bacteria 2135
237 Ga0157369_10195655 3300013105 Bacteria 2123
238 Ga0157369_10342026 3300013105 Bacteria 1554
239 Ga0157374_10001108 3300013296 Bacteria 23187
240 Ga0157374_10451073 3300013296 Bacteria 1287
241 Ga0157378_10289166 3300013297 Bacteria 1582
242 Ga0163162_10044877 3300013306 Bacteria 4428
243 Ga0157372_10000409 3300013307 Bacteria 47021
244 Ga0157372_10031427 3300013307 Bacteria 5813
245 Ga0157372_10035008 3300013307 Bacteria 5525
246 Ga0157372_10068938 3300013307 Bacteria 3977
247 Ga0157372_10080269 3300013307 Bacteria 3690
248 Ga0157372_10100239 3300013307 Bacteria 3305
249 Ga0157372_10176247 3300013307 Bacteria 2474
250 Ga0157372_10478890 3300013307 Bacteria 1451
251 Ga0157375_10106522 3300013308 Bacteria 2895
252 Ga0157380_10000059 3300014326 Bacteria 62280
253 Ga0157380_10002264 3300014326 Bacteria 12942
254 Ga0182008_10083110 3300014497 Bacteria 1576
255 Ga0157379_10023085 3300014968 Bacteria 5516
256 Ga0157376_10176393 3300014969 Bacteria 1950
257 Ga0157376_10212168 3300014969 Bacteria 1788
258 Ga0206356_10112548 3300020070 Bacteria 1605
259 Ga0206356_10303627 3300020070 Bacteria 2994
260 Ga0206356_10601656 3300020070 Bacteria 5581
261 Ga0206351_10463088 3300020077 Bacteria 1645
262 Ga0206350_10365630 3300020080 Bacteria 1364
263 Ga0206353_11406144 3300020082 Bacteria 1778
264 Ga0206353_11805222 3300020082 Bacteria 1480
265 Ga0213874_10000607 3300021377 Bacteria 7219
266 Ga0213876_10004540 3300021384 Bacteria 7752
267 Ga0213876_10005317 3300021384 Bacteria 7087
268 Ga0213876_10007254 3300021384 Bacteria 6040
269 Ga0213875_10000199 3300021388 Bacteria 61479
270 Ga0213875_10015454 3300021388 Bacteria 3714
271 Ga0224712_10009509 3300022467 Bacteria 2933
272 Ga0207656_10002957 3300025321 Bacteria 5800
273 Ga0207656_10102513 3300025321 Bacteria 1313
274 Ga0207642_10000007 3300025899 Bacteria 226017
275 Ga0207642_10024114 3300025899 Bacteria 2442
276 Ga0207642_10040399 3300025899 Bacteria 2035
277 Ga0207642_10041359 3300025899 Bacteria 2017
278 Ga0207680_10010826 3300025903 Bacteria 4580
279 Ga0207685_10000011 3300025905 Bacteria 213430
280 Ga0207643_10147964 3300025908 Bacteria 1406
281 Ga0207705_10112357 3300025909 Bacteria 2014
282 Ga0207707_10018013 3300025912 Bacteria 6153
283 Ga0207707_10023261 3300025912 Bacteria 5421
284 Ga0207707_10068277 3300025912 Bacteria 3097
285 Ga0207707_10333648 3300025912 Bacteria 1308
286 Ga0207695_10268436 3300025913 Bacteria 1602
287 Ga0207693_10000677 3300025915 Bacteria 30611
288 Ga0207693_10001903 3300025915 Bacteria 18266
289 Ga0207693_10002622 3300025915 Bacteria 15629
290 Ga0207693_10258315 3300025915 Bacteria 1366
291 Ga0207663_10229404 3300025916 Bacteria 1356
292 Ga0207660_10027356 3300025917 Bacteria 3890
293 Ga0207660_10064247 3300025917 Bacteria 2649
294 Ga0207660_10065864 3300025917 Bacteria 2619
295 Ga0207662_10055643 3300025918 Bacteria 2361
296 Ga0207662_10124173 3300025918 Bacteria 1621
297 Ga0207657_10004630 3300025919 Bacteria 14532
298 Ga0207657_10006016 3300025919 Bacteria 12624
299 Ga0207657_10011291 3300025919 Bacteria 8871
300 Ga0207657_10036543 3300025919 Bacteria 4395
301 Ga0207657_10043544 3300025919 Bacteria 3953
302 Ga0207657_10058586 3300025919 Bacteria 3313
303 Ga0207649_10000063 3300025920 Bacteria 96360
304 Ga0207649_10077206 3300025920 Bacteria 2145
305 Ga0207652_10000483 3300025921 Bacteria 40881
306 Ga0207652_10040831 3300025921 Bacteria 3941
307 Ga0207652_10110598 3300025921 Bacteria 2436
308 Ga0207652_10125620 3300025921 Bacteria 2285
309 Ga0207652_10131242 3300025921 Bacteria 2235
310 Ga0207652_10169370 3300025921 Bacteria 1959
311 Ga0207652_10368781 3300025921 Bacteria 1296
312 Ga0207681_10279254 3300025923 Bacteria 1314
313 Ga0207694_10000004 3300025924 Bacteria 967075
314 Ga0207694_10051979 3300025924 Bacteria 3176
315 Ga0207650_10024224 3300025925 Bacteria 4312
316 Ga0207659_10000010 3300025926 Bacteria 286639
317 Ga0207659_10227067 3300025926 Bacteria 1504
318 Ga0207687_10000007 3300025927 Bacteria 604185
319 Ga0207687_10000247 3300025927 Bacteria 36785
320 Ga0207687_10004769 3300025927 Bacteria 9019
321 Ga0207687_10034822 3300025927 Bacteria 3422
322 Ga0207700_10000025 3300025928 Bacteria 147429
323 Ga0207700_10003610 3300025928 Bacteria 9015
324 Ga0207700_10021302 3300025928 Bacteria 4423
325 Ga0207664_10000060 3300025929 Bacteria 116764
326 Ga0207664_10020656 3300025929 Bacteria 4886
327 Ga0207664_10100265 3300025929 Bacteria 2391
328 Ga0207664_10123464 3300025929 Bacteria 2171
329 Ga0207644_10175626 3300025931 Bacteria 1676
330 Ga0207644_10238498 3300025931 Bacteria 1447
331 Ga0207690_10000117 3300025932 Bacteria 65570
332 Ga0207690_10001648 3300025932 Bacteria 13799
333 Ga0207690_10048283 3300025932 Bacteria 2829
334 Ga0207690_10050488 3300025932 Bacteria 2777
335 Ga0207690_10379369 3300025932 Bacteria 1123
336 Ga0207706_10000068 3300025933 Bacteria 105795
337 Ga0207706_10040857 3300025933 Bacteria 4111
338 Ga0207686_10000033 3300025934 Bacteria 143602
339 Ga0207686_10000428 3300025934 Bacteria 28669
340 Ga0207686_10254242 3300025934 Bacteria 1285
341 Ga0207709_10233345 3300025935 Bacteria 1334
342 Ga0207669_10000012 3300025937 Bacteria 138242
343 Ga0207704_10000146 3300025938 Bacteria 37894
344 Ga0207665_10047824 3300025939 Bacteria 2869
345 Ga0207665_10182238 3300025939 Bacteria 1521
346 Ga0207665_10209651 3300025939 Bacteria 1423
347 Ga0207691_10001039 3300025940 Bacteria 27535
348 Ga0207711_10000020 3300025941 Bacteria 363325
349 Ga0207661_10000492 3300025944 Bacteria 25390
350 Ga0207661_10008086 3300025944 Bacteria 7501
351 Ga0207661_10009162 3300025944 Bacteria 7097
352 Ga0207661_10009503 3300025944 Bacteria 6977
353 Ga0207661_10027150 3300025944 Bacteria 4370
354 Ga0207661_10029153 3300025944 Bacteria 4235
355 Ga0207661_10037197 3300025944 Bacteria 3805
356 Ga0207661_10188469 3300025944 Bacteria 1807
357 Ga0207679_10115103 3300025945 Bacteria 2130
358 Ga0207667_10150188 3300025949 Bacteria 2398
359 Ga0207712_10020852 3300025961 Bacteria 4298
360 Ga0207712_10070266 3300025961 Bacteria 2515
361 Ga0207712_10160173 3300025961 Bacteria 1748
362 Ga0207640_10000015 3300025981 Bacteria 215411
363 Ga0207640_10188590 3300025981 Bacteria 1552
364 Ga0207658_10025449 3300025986 Bacteria 4144
365 Ga0207677_10019123 3300026023 Bacteria 4129
366 Ga0207703_10000040 3300026035 Bacteria 168191
367 Ga0207703_10001815 3300026035 Bacteria 19030
368 Ga0207639_10005404 3300026041 Bacteria 8640
369 Ga0207639_10047900 3300026041 Bacteria 3233
370 Ga0207678_10012342 3300026067 Bacteria 7500
371 Ga0207678_10170749 3300026067 Bacteria 1857
372 Ga0207708_10109055 3300026075 Bacteria 2148
373 Ga0207702_10000607 3300026078 Bacteria 39638
374 Ga0207702_10017650 3300026078 Bacteria 5905
375 Ga0207702_10088937 3300026078 Bacteria 2700
376 Ga0207702_10185986 3300026078 Bacteria 1916
377 Ga0207702_10214928 3300026078 Bacteria 1789
378 Ga0207702_10389868 3300026078 Bacteria 1341
379 Ga0207641_10007104 3300026088 Bacteria 9351
380 Ga0207641_10275188 3300026088 Bacteria 1581
381 Ga0207648_10007855 3300026089 Bacteria 10409
382 Ga0207676_10000016 3300026095 Bacteria 311561
383 Ga0207674_10014502 3300026116 Bacteria 8702
384 Ga0207674_10116495 3300026116 Bacteria 2643
385 Ga0207675_100002174 3300026118 Bacteria 19495
386 Ga0207675_100096249 3300026118 Bacteria 2786
387 Ga0207675_100466808 3300026118 Bacteria 1253
388 Ga0207683_10022220 3300026121 Bacteria 5444
389 Ga0207683_10055774 3300026121 Bacteria 3465
390 Ga0207698_10000012 3300026142 Bacteria 260061
391 Ga0207698_10018265 3300026142 Bacteria 4774
392 Ga0209281_1000131 3300027111 Bacteria 190072
393 Ga0209281_1000502 3300027111 Bacteria 51906
394 Ga0209281_1004136 3300027111 Bacteria 4445
395 Ga0209281_1013085 3300027111 Bacteria 1801
396 Ga0207428_10020123 3300027907 Bacteria 5676
397 Ga0207428_10041096 3300027907 Bacteria 3745
398 Ga0207428_10055546 3300027907 Bacteria 3148
399 Ga0207428_10214585 3300027907 Bacteria 1445
400 Ga0268266_10000020 3300028379 Bacteria 527065
401 Ga0268266_10055957 3300028379 Bacteria 3392
402 Ga0268265_10000555 3300028380 Bacteria 38092
403 Ga0268264_10006502 3300028381 Bacteria 9842
404 Ga0265337_1000002 3300028556 Bacteria 139247
405 Ga0265326_10000007 3300028558 Bacteria 223057
406 Ga0265326_10000024 3300028558 Bacteria 112928
407 Ga0265319_1000116 3300028563 Bacteria 60553
408 Ga0265334_10000078 3300028573 Bacteria 70145
409 Ga0265318_10017106 3300028577 Bacteria 2982
410 Ga0265322_10000001 3300028654 Bacteria 543854
411 Ga0265336_10003815 3300028666 Bacteria 5812
412 Ga0265338_10016842 3300028800 Bacteria 7918
413 Ga0265338_10098748 3300028800 Bacteria 2387
414 Ga0265324_10000309 3300029957 Bacteria 35875
415 Ga0265324_10003299 3300029957 Bacteria 7754
416 Ga0265328_10001155 3300031239 Bacteria 12164
417 Ga0265320_10000002 3300031240 Bacteria 542875
418 Ga0265329_10014821 3300031242 Bacteria 2742
419 Ga0265331_10005257 3300031250 Bacteria 7837
420 Ga0265327_10000011 3300031251 Bacteria 543807
421 Ga0265314_10000058 3300031711 Bacteria 167476
422 Ga0307405_10119453 3300031731 Bacteria 1801
423 Ga0307413_10045649 3300031824 Bacteria 2599
424 Ga0307410_10054203 3300031852 Bacteria 2717
425 Ga0307407_10015214 3300031903 Bacteria 3794
426 Ga0307407_10119466 3300031903 Bacteria 1668
427 Ga0307409_100015871 3300031995 Bacteria 4962
428 Ga0307409_100033327 3300031995 Bacteria 3747
429 Ga0307409_100090481 3300031995 Bacteria 2505
430 Ga0307409_100172243 3300031995 Bacteria 1906
431 Ga0307409_100188824 3300031995 Bacteria 1832
432 Ga0307416_100010497 3300032002 Bacteria 6120
433 Ga0307411_10231509 3300032005 Bacteria 1440
434 Ga0307415_100000109 3300032126 Bacteria 35202
435 Ga0307415_100020877 3300032126 Bacteria 4010
436 Ga0307415_100121081 3300032126 Bacteria 1962
437 Ga0307415_100177466 3300032126 Bacteria 1668
438 Ga0307415_100357145 3300032126 Bacteria 1232
439 Ga0373956_0111322 3300035119 Bacteria 1275
440 Ga0373943_0000450 3300035170 Bacteria 17418
441 Ga0373946_0004358 3300035171 Bacteria 5066
442 Ga0373927_0022758 3300035695 Bacteria 4104
443 Ga0373933_0023238 3300035724 Bacteria 3540
444 Ga0373947_0002176 3300035725 Bacteria 11907
445 Ga0373937_0011597 3300036401 Bacteria 7740
446 Ga0373937_0168677 3300036401 Bacteria 2053
447 Ga0373937_0334799 3300036401 Bacteria 1433
448 Ga0373925_0003354 3300037068 Bacteria 12426
449 Ga0395899_0019528 3300037312 Bacteria 5147
450 Ga0395899_0040871 3300037312 Bacteria 3467
451 Ga0395899_0075426 3300037312 Bacteria 2463
452 Ga0395900_0017631 3300037418 Bacteria 7286
453 Ga0395900_0022240 3300037418 Bacteria 6487
454 Ga0395900_0068406 3300037418 Bacteria 3649
455 Ga0395900_0257804 3300037418 Bacteria 1743
456 Ga0395900_0452587 3300037418 Bacteria 1240
457 Ga0395900_0462972 3300037418 Bacteria 1222
458 Ga0395898_0002496 3300037466 Bacteria 21639
459 Ga0395898_0018707 3300037466 Bacteria 7062
460 Ga0395898_0031362 3300037466 Bacteria 5311
461 Ga0395898_0042172 3300037466 Bacteria 4504
462 Ga0395898_0053265 3300037466 Bacteria 3952
463 Ga0395898_0053394 3300037466 Bacteria 3947
464 Ga0395898_0075926 3300037466 Bacteria 3245
465 Ga0395898_0105247 3300037466 Bacteria 2705
466 Ga0395898_0535496 3300037466 Bacteria 1113
467 Ga0395905_0010080 3300037471 Bacteria 9210
468 Ga0395905_0071433 3300037471 Bacteria 3254
469 Ga0395905_0168995 3300037471 Bacteria 2054
470 Ga0395905_0172870 3300037471 Bacteria 2029
471 Ga0436364_0457216 3300037853 Bacteria 5287
472 Ga0436364_0527107 3300037853 Bacteria 72365
473 Ga0436364_1168514 3300037853 Bacteria 10945
474 Ga0395901_0014107 3300038443 Bacteria 8134
475 Ga0395901_0018370 3300038443 Bacteria 7139
476 Ga0395901_0026219 3300038443 Bacteria 5983
477 Ga0395901_0077464 3300038443 Bacteria 3470
478 Ga0395901_0095660 3300038443 Bacteria 3112
479 Ga0395901_0129283 3300038443 Bacteria 2654
480 Ga0395901_0148255 3300038443 Bacteria 2465
481 Ga0395901_0232358 3300038443 Bacteria 1925
482 Ga0395901_0254951 3300038443 Bacteria 1827
483 Ga0395901_0472338 3300038443 Bacteria 1280
484 Ga0395901_0577279 3300038443 Bacteria 1136
485 Ga0436365_0344023 3300039437 Bacteria 9173
486 Ga0436365_0494891 3300039437 Bacteria 2465
487 Ga0436365_0823300 3300039437 Bacteria 7865
488 Ga0436365_1182882 3300039437 Bacteria 1153
489 Ga0436365_1248745 3300039437 Bacteria 2014
490 Ga0436365_1574649 3300039437 Bacteria 17677
491 Ga0436363_0675171 3300039450 Bacteria 25439
492 Ga0451798_0735618 3300041458 Bacteria 1408
493 Ga0451833_0016179 3300041491 Bacteria 1621
494 Ga0451853_0128655 3300041512 Bacteria 2159
495 Ga0466965_0098246 3300044683 Bacteria 1495
496 Ga0466966_0087254 3300044684 Bacteria 1939
497 Ga0466961_0009994 3300044693 Bacteria 6047
498 Ga0466961_0019451 3300044693 Bacteria 4367
499 Ga0466961_0122770 3300044693 Bacteria 1630
500 Ga0466963_0000023 3300044694 Bacteria 52546
501 Ga0466963_0005370 3300044694 Bacteria 7500
502 Ga0466963_0025380 3300044694 Bacteria 3779
503 Ga0466963_0061539 3300044694 Bacteria 2510
504 Ga0466963_0073596 3300044694 Bacteria 2303
505 Ga0466963_0118600 3300044694 Bacteria 1820
506 Ga0466964_0018912 3300044706 Bacteria 2646
507 Ga0466964_0057309 3300044706 Bacteria 1612
508 Ga0466971_0001268 3300044719 Bacteria 10525
509 Ga0466971_0013005 3300044719 Bacteria 3651
510 Ga0466971_0124073 3300044719 Bacteria 1196
511 Ga0466968_0009508 3300044735 Bacteria 3740
512 Ga0466957_0000566 3300044842 Bacteria 18671
513 Ga0466957_0088050 3300044842 Bacteria 1942
514 Ga0466960_0024390 3300044901 Bacteria 2728
515 Ga0466960_0064375 3300044901 Bacteria 1808
516 Ga0466960_0095012 3300044901 Bacteria 1526
517 Ga0466959_0001055 3300045049 Bacteria 16508
518 Ga0466959_0052484 3300045049 Bacteria 2985
519 Ga0466959_0137177 3300045049 Bacteria 1731
520 Ga0466959_0156171 3300045049 Bacteria 1606
521 Ga0466958_0002895 3300045836 Bacteria 8759
522 Ga0466958_0006736 3300045836 Bacteria 6273
523 Ga0466958_0027368 3300045836 Bacteria 3375
524 Ga0466958_0080234 3300045836 Bacteria 2007
525 Ga0466967_0000027 3300045976 Bacteria 64265
526 Ga0466967_0004155 3300045976 Bacteria 9685
527 Ga0466967_0007145 3300045976 Bacteria 8015
528 Ga0466967_0010564 3300045976 Bacteria 6934
529 Ga0466967_0010911 3300045976 Bacteria 6847
530 Ga0466967_0013454 3300045976 Bacteria 6324
531 Ga0466967_0016955 3300045976 Bacteria 5762
532 Ga0466967_0027982 3300045976 Bacteria 4698
533 Ga0466967_0061995 3300045976 Bacteria 3318
534 Ga0466967_0064480 3300045976 Bacteria 3258
535 Ga0466967_0066201 3300045976 Bacteria 3218
536 Ga0466967_0180119 3300045976 Bacteria 1993
537 Ga0466967_0210347 3300045976 Bacteria 1844
538 Ga0466967_0211313 3300045976 Bacteria 1840
539 Ga0466967_0226742 3300045976 Bacteria 1778
540 Ga0466967_0506817 3300045976 Bacteria 1185
541 Ga0466967_0624440 3300045976 Bacteria 1064
542 Ga0495592_0000036 3300046454 Bacteria 125461
543 Ga0495603_0000097 3300046455 Bacteria 40321
544 Ga0495603_0007864 3300046455 Bacteria 6429
545 Ga0495603_0012162 3300046455 Bacteria 5212
546 Ga0495629_0009397 3300046459 Bacteria 7153
547 Ga0495629_0024338 3300046459 Bacteria 4310
548 Ga0495629_0081278 3300046459 Bacteria 2262
549 Ga0495638_0065726 3300046460 Bacteria 2231
550 Ga0495641_0000003 3300046461 Bacteria 242879
551 Ga0495651_0003583 3300046462 Bacteria 11916
552 Ga0495651_0117342 3300046462 Bacteria 1959
553 Ga0495653_0038949 3300046463 Bacteria 3727
554 Ga0495653_0073344 3300046463 Bacteria 2554
555 Ga0495653_0107237 3300046463 Bacteria 2013
556 Ga0495653_0135719 3300046463 Bacteria 1736
557 Ga0495580_0200013 3300046472 Bacteria 1377
558 Ga0495582_0000029 3300046473 Bacteria 77919
559 Ga0495582_0000066 3300046473 Bacteria 53920
560 Ga0495582_0201094 3300046473 Bacteria 1138
561 Ga0495639_0001185 3300046475 Bacteria 11777
562 Ga0495662_0000650 3300046476 Bacteria 16301
563 Ga0495662_0000694 3300046476 Bacteria 15948
564 Ga0495662_0034097 3300046476 Bacteria 2458
565 Ga0495664_0000007 3300046477 Bacteria 386710
566 Ga0495594_0000003 3300046499 Bacteria 199267
567 Ga0495594_0076609 3300046499 Bacteria 1865
568 Ga0495596_0031416 3300046500 Bacteria 2121
569 Ga0495608_0000031 3300046511 Bacteria 145255
570 Ga0495608_0010826 3300046511 Bacteria 6357
571 Ga0495608_0017412 3300046511 Bacteria 4969
572 Ga0495608_0124169 3300046511 Bacteria 1654
573 Ga0495610_0028993 3300046512 Bacteria 2921
574 Ga0495620_0000210 3300046515 Bacteria 44013
575 Ga0495620_0099892 3300046515 Bacteria 1158
576 Ga0495628_0000144 3300046516 Bacteria 61254
577 Ga0495628_0002459 3300046516 Bacteria 16708
578 Ga0495628_0010479 3300046516 Bacteria 7873
579 Ga0495628_0017322 3300046516 Bacteria 5999
580 Ga0495628_0268967 3300046516 Bacteria 1268
581 Ga0495630_0005219 3300046517 Bacteria 9153
582 Ga0495630_0018710 3300046517 Bacteria 5089
583 Ga0495630_0042919 3300046517 Bacteria 3377
584 Ga0495630_0098599 3300046517 Bacteria 2210
585 Ga0495644_0007172 3300046523 Bacteria 4306
586 Ga0495652_0018945 3300046529 Bacteria 6133
587 Ga0495652_0049582 3300046529 Bacteria 3594
588 Ga0495652_0050844 3300046529 Bacteria 3542
589 Ga0495665_0000252 3300046531 Bacteria 26953
590 Ga0495640_0012743 3300046533 Bacteria 6419
591 Ga0495640_0051398 3300046533 Bacteria 2833
592 Ga0495640_0104286 3300046533 Bacteria 1858
593 Ga0495586_0007791 3300046535 Bacteria 5710
594 Ga0495586_0064936 3300046535 Bacteria 1989
595 Ga0495587_0005378 3300046536 Bacteria 8376
596 Ga0495587_0023376 3300046536 Bacteria 3798
597 Ga0495587_0033470 3300046536 Bacteria 3103
598 Ga0495645_0004644 3300046543 Bacteria 9373
599 Ga0495645_0028397 3300046543 Bacteria 4065
600 Ga0495622_0000714 3300046557 Bacteria 18760
601 Ga0495667_0000032 3300046559 Bacteria 143493
602 Ga0495667_0000751 3300046559 Bacteria 20850
603 Ga0495667_0006812 3300046559 Bacteria 7759
604 Ga0495667_0014712 3300046559 Bacteria 5288
605 Ga0495667_0037733 3300046559 Bacteria 3220
606 Ga0495667_0085538 3300046559 Bacteria 2047
607 Ga0495656_0000241 3300046615 Bacteria 19365
608 Ga0495634_0027184 3300046642 Bacteria 3982
609 Ga0495634_0031253 3300046642 Bacteria 3668
610 Ga0495634_0053650 3300046642 Bacteria 2700
611 Ga0495634_0088730 3300046642 Bacteria 2011
612 Ga0495635_0000016 3300046663 Bacteria 214088
613 Ga0495635_0008147 3300046663 Bacteria 7320
614 Ga0495635_0047428 3300046663 Bacteria 2962
615 Ga0495635_0082131 3300046663 Bacteria 2205
616 Ga0495657_0000024 3300046675 Bacteria 145255
617 Ga0495657_0009618 3300046675 Bacteria 7321
618 Ga0495657_0053616 3300046675 Bacteria 2698
619 Ga0495657_0124448 3300046675 Bacteria 1621
620 Ga0495599_0048369 3300046678 Bacteria 2666
621 Ga0495623_0132179 3300046679 Bacteria 1493
622 Ga0495646_0013457 3300046680 Bacteria 5200
623 Ga0495646_0076361 3300046680 Bacteria 1962
624 Ga0495647_0000025 3300046681 Bacteria 65184
625 Ga0495658_0000026 3300046683 Bacteria 77681
626 Ga0495658_0005678 3300046683 Bacteria 6130
627 Ga0495669_0000260 3300046684 Bacteria 30549
628 Ga0495613_0000073 3300046689 Bacteria 98688
629 Ga0495613_0000152 3300046689 Bacteria 68384
630 Ga0495613_0004101 3300046689 Bacteria 10892
631 Ga0495613_0059131 3300046689 Bacteria 2810
632 Ga0495624_0000009 3300046690 Bacteria 145026
633 Ga0495624_0006961 3300046690 Bacteria 7976
634 Ga0495600_0015949 3300046809 Bacteria 4760
635 Ga0495600_0018385 3300046809 Bacteria 4452
636 Ga0495600_0041962 3300046809 Bacteria 2982
637 Ga0495600_0047287 3300046809 Bacteria 2806
638 Ga0495581_0002805 3300047315 Bacteria 9949
639 Ga0495581_0114745 3300047315 Bacteria 1567
640 Ga0495604_0000019 3300047317 Bacteria 175064
641 Ga0495604_0000985 3300047317 Bacteria 23770
642 Ga0495604_0009430 3300047317 Bacteria 7719
643 Ga0495604_0041144 3300047317 Bacteria 3625
644 Ga0495674_0008594 3300047319 Bacteria 9721
645 Ga0495674_0010971 3300047319 Bacteria 8560
646 Ga0495674_0165465 3300047319 Bacteria 1848
647 Ga0495674_0186670 3300047319 Bacteria 1725
648 Ga0495672_0003817 3300047320 Bacteria 12682
649 Ga0495676_0002041 3300047321 Bacteria 17764
650 Ga0495680_0000317 3300047322 Bacteria 53949
651 Ga0495680_0000647 3300047322 Bacteria 39030
652 Ga0495680_0004252 3300047322 Bacteria 13751
653 Ga0495680_0005066 3300047322 Bacteria 12439
654 Ga0495680_0012179 3300047322 Bacteria 7587
655 Ga0495680_0034820 3300047322 Bacteria 4062
656 Ga0495675_0000428 3300047444 Bacteria 28143
657 Ga0495685_034437 3300047447 Bacteria 1740
658 Ga0495684_0002738 3300047471 Bacteria 13936
659 Ga0495684_0006287 3300047471 Bacteria 9231
660 Ga0495684_0053340 3300047471 Bacteria 3085
661 Ga0495593_0001836 3300047673 Bacteria 12644
662 Ga0495602_0001790 3300048088 Bacteria 21477
663 Ga0495602_0059786 3300048088 Bacteria 3324
664 Ga0495614_0019808 3300048089 Bacteria 2911
665 Ga0496100_0000018 3300048903 Bacteria 162451
666 Ga0496100_0016785 3300048903 Bacteria 4306
667 Ga0496100_0037106 3300048903 Bacteria 3078
668 Ga0496101_0000221 3300048904 Bacteria 42499
669 Ga0496101_0004996 3300048904 Bacteria 8422
670 Ga0496101_0009188 3300048904 Bacteria 6487
671 Ga0496101_0024859 3300048904 Bacteria 4151
672 Ga0496101_0088697 3300048904 Bacteria 2298
673 Ga0496101_0094853 3300048904 Bacteria 2225
674 Ga0496102_0000146 3300048905 Bacteria 96361
675 Ga0496102_0008457 3300048905 Bacteria 8823
676 Ga0496102_0299530 3300048905 Bacteria 1515
677 Ga0496103_0000008 3300048906 Bacteria 340474
678 Ga0496103_0006820 3300048906 Bacteria 6815
679 Ga0496103_0112031 3300048906 Bacteria 1734
680 Ga0496104_0000001 3300048907 Bacteria 711867
681 Ga0496104_0000004 3300048907 Bacteria 641830
682 Ga0496104_0004466 3300048907 Bacteria 12184
683 Ga0496104_0126464 3300048907 Bacteria 2454
684 Ga0496104_0538909 3300048907 Bacteria 1078
685 Ga0496105_0000001 3300048908 Bacteria 1328178
686 Ga0496105_0001569 3300048908 Bacteria 16195
687 Ga0496105_0014782 3300048908 Bacteria 6214
688 Ga0496105_0019941 3300048908 Bacteria 5412
689 Ga0496105_0144081 3300048908 Bacteria 1960
690 Ga0496106_0000018 3300048909 Bacteria 175028
691 Ga0496106_0000149 3300048909 Bacteria 51656
692 Ga0496106_0004661 3300048909 Bacteria 10163
693 Ga0496106_0047208 3300048909 Bacteria 3240
694 Ga0496106_0130396 3300048909 Bacteria 1971
695 Ga0496107_0000006 3300048910 Bacteria 258746
696 Ga0496107_0001394 3300048910 Bacteria 14913
697 Ga0496107_0005792 3300048910 Bacteria 8456
698 Ga0496107_0028637 3300048910 Bacteria 3959
699 Ga0496107_0037613 3300048910 Bacteria 3473
700 Ga0496107_0043697 3300048910 Bacteria 3220
701 Ga0496108_0036583 3300048911 Bacteria 4085
702 Ga0496108_0059129 3300048911 Bacteria 3223
703 Ga0496108_0099543 3300048911 Bacteria 2478
704 Ga0496109_0000028 3300048912 Bacteria 168138
705 Ga0496109_0005575 3300048912 Bacteria 10537
706 Ga0496109_0007622 3300048912 Bacteria 9177
707 Ga0496109_0023298 3300048912 Bacteria 5494
708 Ga0496109_0222627 3300048912 Bacteria 1774
709 Ga0496110_0002884 3300048913 Bacteria 12998
710 Ga0496110_0006813 3300048913 Bacteria 9086
711 Ga0496110_0046655 3300048913 Bacteria 3791
712 Ga0496110_0096919 3300048913 Bacteria 2643
713 Ga0496110_0151465 3300048913 Bacteria 2100
714 Ga0496110_0321171 3300048913 Bacteria 1410
715 Ga0496111_0000021 3300048914 Bacteria 67813
716 Ga0496111_0003320 3300048914 Bacteria 9950
717 Ga0496111_0011955 3300048914 Bacteria 5867
718 Ga0496111_0014669 3300048914 Bacteria 5358
719 Ga0496111_0096713 3300048914 Bacteria 2167
720 Ga0496111_0183989 3300048914 Bacteria 1553
721 Ga0496112_0000003 3300048915 Bacteria 660147
722 Ga0496112_0001614 3300048915 Bacteria 17446
723 Ga0496112_0109544 3300048915 Bacteria 2732
724 Ga0496112_0212348 3300048915 Bacteria 1892
725 Ga0496112_0253016 3300048915 Bacteria 1712
726 Ga0496112_0301760 3300048915 Bacteria 1547
727 Ga0496113_0000029 3300048916 Bacteria 61873
728 Ga0496113_0020403 3300048916 Bacteria 4658
729 Ga0496113_0062447 3300048916 Bacteria 2813
730 Ga0496113_0072702 3300048916 Bacteria 2618
731 Ga0496113_0089276 3300048916 Bacteria 2372
732 Ga0496114_0000014 3300048917 Bacteria 297902
733 Ga0496114_0001831 3300048917 Bacteria 16108
734 Ga0496114_0026518 3300048917 Bacteria 4744
735 Ga0496114_0148873 3300048917 Bacteria 2030
736 Ga0496114_0156407 3300048917 Bacteria 1979
737 Ga0496115_0000003 3300048918 Bacteria 354994
738 Ga0496115_0000581 3300048918 Bacteria 28187
739 Ga0496115_0001725 3300048918 Bacteria 15676
740 Ga0496115_0002312 3300048918 Bacteria 13653
741 Ga0496115_0005472 3300048918 Bacteria 9241
742 Ga0496115_0049967 3300048918 Bacteria 3349
743 Ga0496115_0056458 3300048918 Bacteria 3156
744 Ga0496115_0123722 3300048918 Bacteria 2129
745 Ga0496117_0020230 3300048920 Bacteria 5433
746 Ga0496118_0005186 3300048921 Bacteria 14915
747 Ga0496120_0020129 3300048923 Bacteria 4250
748 Ga0496121_0052505 3300048924 Bacteria 3423
749 Ga0496121_0101167 3300048924 Bacteria 2223
750 Ga0496122_0033730 3300048925 Bacteria 4204
751 Ga0496126_0000108 3300048929 Bacteria 197529
752 Ga0496126_0049736 3300048929 Bacteria 3825
753 Ga0501031_0000434 3300049568 Bacteria 24055
754 Ga0501031_0029713 3300049568 Bacteria 3566
755 Ga0501031_0214164 3300049568 Bacteria 1255
756 Ga0501032_0000899 3300049569 Bacteria 24104
757 Ga0501032_0022440 3300049569 Bacteria 4374
758 Ga0501033_0001140 3300049570 Bacteria 24003
759 Ga0501034_0124121 3300049571 Bacteria 2567
760 Ga0501036_0029623 3300049572 Bacteria 4623
761 Ga0501036_0136395 3300049572 Bacteria 2071
762 Ga0501037_0000774 3300049573 Bacteria 24049
763 Ga0501037_0026648 3300049573 Bacteria 4271
764 Ga0501037_0301482 3300049573 Bacteria 1113
765 Ga0501038_0001146 3300049574 Bacteria 24003
766 Ga0501038_0037491 3300049574 Bacteria 4250
767 Ga0501039_0098643 3300049575 Bacteria 2279
768 Ga0501039_0098657 3300049575 Bacteria 2279
769 Ga0501039_0161109 3300049575 Bacteria 1763
770 Ga0501040_0001638 3300049576 Bacteria 14279
771 Ga0501041_0177508 3300049577 Bacteria 1333
772 Ga0501042_0037517 3300049578 Bacteria 3439
773 Ga0501042_0080269 3300049578 Bacteria 2337
774 Ga0501042_0112800 3300049578 Bacteria 1957
775 Ga0501043_0001082 3300049579 Bacteria 23968
776 Ga0501043_0003201 3300049579 Bacteria 13542
777 Ga0501046_0000447 3300049580 Bacteria 41432
778 Ga0501046_0044376 3300049580 Bacteria 3536
779 Ga0501046_0152886 3300049580 Bacteria 1740
780 Ga0501047_0001335 3300049581 Bacteria 24206
781 Ga0501047_0007455 3300049581 Bacteria 10299
782 Ga0501047_0038927 3300049581 Bacteria 4599
783 Ga0501048_0000734 3300049582 Bacteria 24021
784 Ga0501048_0081483 3300049582 Bacteria 2283
785 Ga0501067_0000348 3300049583 Bacteria 25209
786 Ga0501067_0012878 3300049583 Bacteria 4632
787 Ga0501067_0052936 3300049583 Bacteria 2249
788 Ga0501067_0059253 3300049583 Bacteria 2119
789 Ga0501067_0069396 3300049583 Bacteria 1951
790 Ga0501069_0007590 3300049585 Bacteria 5693
791 Ga0501069_0029114 3300049585 Bacteria 3030
792 Ga0501069_0038721 3300049585 Bacteria 2632
793 Ga0501069_0078624 3300049585 Bacteria 1855
794 Ga0501070_0001137 3300049586 Bacteria 23887
795 Ga0501070_0158987 3300049586 Bacteria 1863
796 Ga0501071_0008414 3300049587 Bacteria 6821
797 Ga0501071_0070366 3300049587 Bacteria 2548
798 Ga0501071_0104050 3300049587 Bacteria 2095
799 Ga0501071_0126080 3300049587 Bacteria 1900
800 Ga0501072_0001313 3300049588 Bacteria 18633
801 Ga0501072_0108814 3300049588 Bacteria 2205
802 Ga0501072_0134549 3300049588 Bacteria 1971
803 Ga0501072_0148604 3300049588 Bacteria 1868
804 Ga0501073_0038032 3300049589 Bacteria 3415
805 Ga0501073_0049364 3300049589 Bacteria 2951
806 Ga0501074_0019804 3300049590 Bacteria 4887
807 Ga0501074_0030021 3300049590 Bacteria 3939
808 Ga0501074_0038770 3300049590 Bacteria 3451
809 Ga0501074_0146388 3300049590 Bacteria 1689
810 Ga0501074_0147057 3300049590 Bacteria 1685
811 Ga0501075_0000392 3300049591 Bacteria 25374
812 Ga0501075_0019774 3300049591 Bacteria 4888
813 Ga0501075_0068979 3300049591 Bacteria 2672
814 Ga0501075_0181602 3300049591 Bacteria 1605
815 Ga0501075_0290189 3300049591 Bacteria 1246
816 Ga0501076_0001177 3300049592 Bacteria 17330
817 Ga0501076_0022538 3300049592 Bacteria 4840
818 Ga0501076_0142235 3300049592 Bacteria 1950
819 Ga0501076_0233089 3300049592 Bacteria 1505
820 Ga0501077_0041582 3300049593 Bacteria 2925
821 Ga0501077_0082185 3300049593 Bacteria 2041
822 Ga0501077_0083695 3300049593 Bacteria 2022
823 Ga0501079_0008992 3300049741 Bacteria 7564
824 Ga0501079_0017085 3300049741 Bacteria 5541
825 Ga0501079_0048229 3300049741 Bacteria 3287
826 Ga0501079_0185868 3300049741 Bacteria 1622
827 Ga0501080_0050087 3300049742 Bacteria 3888
828 Ga0501080_0060002 3300049742 Bacteria 3540
829 Ga0501080_0153800 3300049742 Bacteria 2125
830 Ga0501080_0245961 3300049742 Bacteria 1631
831 Ga0501081_0003995 3300049743 Bacteria 9452
832 Ga0501081_0054341 3300049743 Bacteria 2767
833 Ga0501083_0008535 3300049744 Bacteria 7233
834 Ga0501083_0023660 3300049744 Bacteria 4259
835 Ga0501035_0002398 3300049822 Bacteria 18377
836 Ga0501044_0003241 3300049823 Bacteria 18299
837 Ga0501044_0036460 3300049823 Bacteria 5145
838 Ga0501044_0049171 3300049823 Bacteria 4353
839 Ga0501044_0167828 3300049823 Bacteria 2168
840 Ga0501045_0013972 3300049824 Bacteria 5683
841 Ga0501045_0060787 3300049824 Bacteria 2770
842 Ga0501045_0214013 3300049824 Bacteria 1435
843 nmdc:mga05p37_105614_c1 3300050507 Bacteria 3464
844 nmdc:mga05p37_144872_c1 3300050507 Bacteria 2909
845 nmdc:mga05p37_170780_c1 3300050507 Bacteria 2652
846 nmdc:mga05p37_71033_c2 3300050507 Bacteria 4064
847 nmdc:mga09592_69165_c1 3300050508 Bacteria 2995
848 nmdc:mga0qj67_1444_c1 3300050509 Bacteria 16634
849 nmdc:mga0qj67_37429_c1 3300050509 Bacteria 3801
850 nmdc:mga06r32_13083_c1 3300050510 Bacteria 7510
851 nmdc:mga06r32_2689_c1 3300050510 Bacteria 15905
852 nmdc:mga08y16_143200_c1 3300050511 Bacteria 2485
853 nmdc:mga08y16_26286_c1 3300050511 Bacteria 6137
854 nmdc:mga08y16_9951_c1 3300050511 Bacteria 9982
855 nmdc:mga0n895_128747_c1 3300050512 Bacteria 2556
856 nmdc:mga0n895_47389_c1 3300050512 Bacteria 4202
857 nmdc:mga08x19_101069_c1 3300050514 Bacteria 1913
858 nmdc:mga0a205_1916_c1 3300050515 Bacteria 18075
859 nmdc:mga0a205_38052_c1 3300050515 Bacteria 4627
860 nmdc:mga0a205_87386_c1 3300050515 Bacteria 3012
861 Ga0495601_0002204 3300053077 Bacteria 10967
862 Ga0495601_0108345 3300053077 Bacteria 1797
863 Ga0495601_0139636 3300053077 Bacteria 1580
864 Ga0495612_0001555 3300053078 Bacteria 9456
865 Ga0495612_0015066 3300053078 Bacteria 3101
866 Ga0495655_0000001 3300053083 Bacteria 419518
867 Ga0495655_0001262 3300053083 Bacteria 3908
868 Ga0495655_0005518 3300053083 Bacteria 2240
869 Ga0495595_0000014 3300053084 Bacteria 145255
870 Ga0495595_0002816 3300053084 Bacteria 6842
871 Ga0495619_0000055 3300053085 Bacteria 95570
872 Ga0495619_0000147 3300053085 Bacteria 51947
873 Ga0495619_0000534 3300053085 Bacteria 25127
874 Ga0495619_0003046 3300053085 Bacteria 10884
875 Ga0495619_0058131 3300053085 Bacteria 2566
876 Ga0495619_0063950 3300053085 Bacteria 2452
877 Ga0495619_0146912 3300053085 Bacteria 1626
878 Ga0495619_0280505 3300053085 Bacteria 1154
879 Ga0500556_0000593 3300053104 Bacteria 23858
880 Ga0500614_000026 3300053123 Bacteria 35584
881 Ga0500628_000017 3300053129 Bacteria 90481
882 Ga0500616_0004992 3300053153 Bacteria 9198
883 Ga0501084_0007832 3300054114 Bacteria 8791
884 Ga0501084_0285733 3300054114 Bacteria 1393
885 Ga0501082_0039672 3300060353 Bacteria 4062
886 Ga0501082_0048052 3300060353 Bacteria 3677
887 Ga0501082_0051874 3300060353 Bacteria 3535
888 Ga0501082_0235564 3300060353 Bacteria 1593
889 Ga0466962_0003841 3300061719 Bacteria 7179
890 Ga0466962_0004523 3300061719 Bacteria 6670
891 Ga0466962_0038804 3300061719 Bacteria 2281
892 Ga0530510_0003223 3300061734 Bacteria 11205
893 Ga0530510_0013546 3300061734 Bacteria 5736
894 Ga0530510_0069871 3300061734 Bacteria 2548
895 Ga0530510_0099208 3300061734 Bacteria 2129
896 Ga0530510_0179866 3300061734 Bacteria 1568

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100097586 Ga0070697_1000975861 289
2 3300037853 Ga0436364_1168514 Ga0436364_1168514_2938_3975 291
3 3300038443 Ga0395901_0129283 Ga0395901_0129283_1559_2596 291
4 3300005983 Ga0081540_1002225 Ga0081540_10022258 294
5 3300047471 Ga0495684_0053340 Ga0495684_0053340_1746_2753 294
6 3300006946 Ga0079104_1000337 Ga0079104_100033723 295
7 3300027111 Ga0209281_1000131 Ga0209281_100013121 295
8 3300037466 Ga0395898_0075926 Ga0395898_0075926_784_1827 295
9 3300038443 Ga0395901_0095660 Ga0395901_0095660_428_1471 295
10 3300046529 Ga0495652_0050844 Ga0495652_0050844_2457_3467 295
11 3300037418 Ga0395900_0257804 Ga0395900_0257804_181_1218 296
12 3300049580 Ga0501046_0044376 Ga0501046_0044376_1405_2442 296
13 3300049583 Ga0501067_0059253 Ga0501067_0059253_736_1773 296
14 3300049591 Ga0501075_0068979 Ga0501075_0068979_1111_2148 296
15 3300049592 Ga0501076_0022538 Ga0501076_0022538_973_2010 296
16 3300049824 Ga0501045_0214013 Ga0501045_0214013_210_1247 296
17 3300060353 Ga0501082_0039672 Ga0501082_0039672_1808_2845 296
18 3300061734 Ga0530510_0179866 Ga0530510_0179866_262_1299 296
19 3300048903 Ga0496100_0016785 Ga0496100_0016785_3011_4054 297
20 3300048904 Ga0496101_0024859 Ga0496101_0024859_212_1255 297
21 3300048909 Ga0496106_0130396 Ga0496106_0130396_274_1317 297
22 3300048910 Ga0496107_0005792 Ga0496107_0005792_6602_7645 297
23 3300048918 Ga0496115_0049967 Ga0496115_0049967_947_1990 297
24 3300039437 Ga0436365_0494891 Ga0436365_0494891_231_1229 298
25 3300047320 Ga0495672_0003817 Ga0495672_0003817_11581_12552 298
26 3300005937 Ga0081455_10057361 Ga0081455_100573613 299
27 3300006946 Ga0079104_1028242 Ga0079104_10282422 299
28 3300013296 Ga0157374_10001108 Ga0157374_100011084 299
29 3300027111 Ga0209281_1000502 Ga0209281_10005029 299
30 3300046517 Ga0495630_0018710 Ga0495630_0018710_4022_5062 299
31 3300046517 Ga0495630_0098599 Ga0495630_0098599_10_1002 299
32 3300046535 Ga0495586_0064936 Ga0495586_0064936_559_1599 299
33 3300046642 Ga0495634_0088730 Ga0495634_0088730_684_1724 299
34 3300046689 Ga0495613_0059131 Ga0495613_0059131_732_1772 299
35 3300049587 Ga0501071_0104050 Ga0501071_0104050_200_1234 299
36 3300049588 Ga0501072_0134549 Ga0501072_0134549_453_1487 299
37 3300005347 Ga0070668_100015307 Ga0070668_1000153075 300
38 3300005440 Ga0070705_100054509 Ga0070705_1000545091 300
39 3300005457 Ga0070662_100068086 Ga0070662_1000680862 300
40 3300005468 Ga0070707_100229613 Ga0070707_1002296132 300
41 3300005719 Ga0068861_100002566 Ga0068861_1000025666 300
42 3300005937 Ga0081455_10055109 Ga0081455_100551094 300
43 3300009098 Ga0105245_10002692 Ga0105245_1000269216 300
44 3300009553 Ga0105249_10183328 Ga0105249_101833282 300
45 3300010375 Ga0105239_10130675 Ga0105239_101306752 300
46 3300013306 Ga0163162_10044877 Ga0163162_100448772 300
47 3300025933 Ga0207706_10040857 Ga0207706_100408573 300
48 3300025961 Ga0207712_10070266 Ga0207712_100702662 300
49 3300026118 Ga0207675_100002174 Ga0207675_1000021743 300
50 3300028556 Ga0265337_1000002 Ga0265337_100000216 300
51 3300028558 Ga0265326_10000007 Ga0265326_1000000775 300
52 3300028654 Ga0265322_10000001 Ga0265322_10000001230 300
53 3300029957 Ga0265324_10000309 Ga0265324_1000030938 300
54 3300031239 Ga0265328_10001155 Ga0265328_1000115510 300
55 3300031240 Ga0265320_10000002 Ga0265320_10000002229 300
56 3300031242 Ga0265329_10014821 Ga0265329_100148213 300
57 3300031250 Ga0265331_10005257 Ga0265331_100052574 300
58 3300031251 Ga0265327_10000011 Ga0265327_10000011229 300
59 3300031711 Ga0265314_10000058 Ga0265314_10000058136 300
60 3300031995 Ga0307409_100015871 Ga0307409_1000158712 301
61 3300031995 Ga0307409_100188824 Ga0307409_1001888242 301
62 3300032126 Ga0307415_100121081 Ga0307415_1001210812 301
63 3300045976 Ga0466967_0506817 Ga0466967_0506817_29_1072 301
64 3300005616 Ga0068852_100000296 Ga0068852_10000029618 302
65 3300006175 Ga0070712_100343399 Ga0070712_1003433992 302
66 3300006847 Ga0075431_100000747 Ga0075431_10000074726 302
67 3300006871 Ga0075434_100034518 Ga0075434_1000345182 302
68 3300009094 Ga0111539_10078234 Ga0111539_100782343 302
69 3300009147 Ga0114129_10124004 Ga0114129_101240043 302
70 3300009147 Ga0114129_10411207 Ga0114129_104112072 302
71 3300026142 Ga0207698_10000012 Ga0207698_10000012105 302
72 3300027907 Ga0207428_10055546 Ga0207428_100555463 302
73 3300031903 Ga0307407_10015214 Ga0307407_100152142 302
74 3300037466 Ga0395898_0018707 Ga0395898_0018707_4964_5998 302
75 3300038443 Ga0395901_0077464 Ga0395901_0077464_536_1531 302
76 3300044694 Ga0466963_0005370 Ga0466963_0005370_2361_3404 302
77 3300046559 Ga0495667_0000032 Ga0495667_0000032_81345_82334 302
78 3300047322 Ga0495680_0000647 Ga0495680_0000647_8252_9244 302
79 3300047322 Ga0495680_0005066 Ga0495680_0005066_572_1561 302
80 3300048918 Ga0496115_0000581 Ga0496115_0000581_16742_17749 302
81 3300049572 Ga0501036_0136395 Ga0501036_0136395_754_1752 302
82 3300049576 Ga0501040_0001638 Ga0501040_0001638_1789_2787 302
83 3300049577 Ga0501041_0177508 Ga0501041_0177508_210_1208 302
84 3300049578 Ga0501042_0080269 Ga0501042_0080269_970_1968 302
85 3300049580 Ga0501046_0152886 Ga0501046_0152886_646_1644 302
86 3300049582 Ga0501048_0081483 Ga0501048_0081483_135_1133 302
87 3300049587 Ga0501071_0008414 Ga0501071_0008414_4689_5687 302
88 3300049588 Ga0501072_0001313 Ga0501072_0001313_16934_17932 302
89 3300049590 Ga0501074_0147057 Ga0501074_0147057_157_1155 302
90 3300049591 Ga0501075_0019774 Ga0501075_0019774_2134_3132 302
91 3300049592 Ga0501076_0001177 Ga0501076_0001177_14453_15451 302
92 3300049593 Ga0501077_0041582 Ga0501077_0041582_1417_2415 302
93 3300049741 Ga0501079_0008992 Ga0501079_0008992_1741_2739 302
94 3300049742 Ga0501080_0060002 Ga0501080_0060002_1893_2891 302
95 3300049743 Ga0501081_0003995 Ga0501081_0003995_1147_2145 302
96 3300049824 Ga0501045_0060787 Ga0501045_0060787_798_1796 302
97 3300050507 nmdc:mga05p37_105614_c1 nmdc:mga05p37_105614_c1_2320_3303 302
98 3300050510 nmdc:mga06r32_2689_c1 nmdc:mga06r32_2689_c1_13355_14338 302
99 3300050511 nmdc:mga08y16_26286_c1 nmdc:mga08y16_26286_c1_4005_4988 302
100 3300050512 nmdc:mga0n895_47389_c1 nmdc:mga0n895_47389_c1_173_1156 302
101 3300050515 nmdc:mga0a205_87386_c1 nmdc:mga0a205_87386_c1_1008_1991 302
102 3300054114 Ga0501084_0007832 Ga0501084_0007832_6550_7548 302
103 3300061734 Ga0530510_0003223 Ga0530510_0003223_3517_4515 302
104 3300005329 Ga0070683_100008554 Ga0070683_1000085548 303
105 3300005337 Ga0070682_100212589 Ga0070682_1002125891 303
106 3300005441 Ga0070700_100272372 Ga0070700_1002723721 303
107 3300025944 Ga0207661_10000492 Ga0207661_1000049214 303
108 3300046473 Ga0495582_0201094 Ga0495582_0201094_124_1095 303
109 3300046515 Ga0495620_0000210 Ga0495620_0000210_30521_31510 303
110 3300048911 Ga0496108_0099543 Ga0496108_0099543_1557_2468 303
111 3300048915 Ga0496112_0001614 Ga0496112_0001614_16259_17239 303
112 3300048918 Ga0496115_0002312 Ga0496115_0002312_148_1137 303
113 3300005981 Ga0081538_10077193 Ga0081538_100771932 304
114 3300005985 Ga0081539_10017082 Ga0081539_100170825 304
115 3300025929 Ga0207664_10020656 Ga0207664_100206563 304
116 3300031731 Ga0307405_10119453 Ga0307405_101194532 304
117 3300032126 Ga0307415_100000109 Ga0307415_10000010914 304
118 3300044683 Ga0466965_0098246 Ga0466965_0098246_440_1462 304
119 3300046455 Ga0495603_0012162 Ga0495603_0012162_1108_2088 304
120 3300046543 Ga0495645_0004644 Ga0495645_0004644_3442_4434 304
121 3300048916 Ga0496113_0089276 Ga0496113_0089276_1310_2290 304
122 3300005548 Ga0070665_100223482 Ga0070665_1002234822 305
123 3300005937 Ga0081455_10027049 Ga0081455_100270494 305
124 3300006844 Ga0075428_100023575 Ga0075428_1000235752 305
125 3300006847 Ga0075431_100257275 Ga0075431_1002572752 305
126 3300009553 Ga0105249_10148229 Ga0105249_101482293 305
127 3300025915 Ga0207693_10258315 Ga0207693_102583152 305
128 3300037466 Ga0395898_0535496 Ga0395898_0535496_93_1085 305
129 3300045836 Ga0466958_0080234 Ga0466958_0080234_151_1188 305
130 3300045976 Ga0466967_0624440 Ga0466967_0624440_17_1039 305
131 3300046463 Ga0495653_0107237 Ga0495653_0107237_229_1218 305
132 3300048907 Ga0496104_0000004 Ga0496104_0000004_88748_89737 305
133 3300048908 Ga0496105_0000001 Ga0496105_0000001_552094_553083 305
134 3300048923 Ga0496120_0020129 Ga0496120_0020129_1986_2975 305
135 3300061719 Ga0466962_0038804 Ga0466962_0038804_243_1280 305
136 3300003203 JGI25406J46586_10014128 JGI25406J46586_100141282 306
137 3300005344 Ga0070661_100000023 Ga0070661_100000023138 306
138 3300005365 Ga0070688_100000300 Ga0070688_10000030015 306
139 3300005365 Ga0070688_100000630 Ga0070688_1000006304 306
140 3300005436 Ga0070713_100000009 Ga0070713_10000000976 306
141 3300005466 Ga0070685_10000282 Ga0070685_1000028216 306
142 3300005466 Ga0070685_10000320 Ga0070685_1000032014 306
143 3300005563 Ga0068855_100204032 Ga0068855_1002040323 306
144 3300005841 Ga0068863_100000021 Ga0068863_10000002197 306
145 3300005981 Ga0081538_10002025 Ga0081538_1000202513 306
146 3300005985 Ga0081539_10002491 Ga0081539_1000249121 306
147 3300006237 Ga0097621_100365845 Ga0097621_1003658452 306
148 3300006881 Ga0068865_100000104 Ga0068865_10000010449 306
149 3300006946 Ga0079104_1005865 Ga0079104_10058653 306
150 3300009098 Ga0105245_10000545 Ga0105245_1000054520 306
151 3300013104 Ga0157370_10286935 Ga0157370_102869352 306
152 3300013105 Ga0157369_10001239 Ga0157369_1000123910 306
153 3300013307 Ga0157372_10080269 Ga0157372_100802692 306
154 3300014326 Ga0157380_10000059 Ga0157380_100000598 306
155 3300022467 Ga0224712_10009509 Ga0224712_100095093 306
156 3300025920 Ga0207649_10000063 Ga0207649_10000063112 306
157 3300025924 Ga0207694_10051979 Ga0207694_100519793 306
158 3300025927 Ga0207687_10000007 Ga0207687_10000007258 306
159 3300025928 Ga0207700_10000025 Ga0207700_1000002577 306
160 3300025938 Ga0207704_10000146 Ga0207704_1000014636 306
161 3300025944 Ga0207661_10188469 Ga0207661_101884692 306
162 3300025949 Ga0207667_10150188 Ga0207667_101501882 306
163 3300026078 Ga0207702_10185986 Ga0207702_101859862 306
164 3300026088 Ga0207641_10007104 Ga0207641_100071044 306
165 3300027111 Ga0209281_1013085 Ga0209281_10130852 306
166 3300031824 Ga0307413_10045649 Ga0307413_100456493 306
167 3300031852 Ga0307410_10054203 Ga0307410_100542032 306
168 3300031903 Ga0307407_10119466 Ga0307407_101194663 306
169 3300031995 Ga0307409_100172243 Ga0307409_1001722432 306
170 3300032005 Ga0307411_10231509 Ga0307411_102315092 306
171 3300046455 Ga0495603_0000097 Ga0495603_0000097_2506_3492 306
172 3300046511 Ga0495608_0000031 Ga0495608_0000031_138377_139366 306
173 3300046535 Ga0495586_0007791 Ga0495586_0007791_1159_2148 306
174 3300046559 Ga0495667_0085538 Ga0495667_0085538_980_1969 306
175 3300046675 Ga0495657_0000024 Ga0495657_0000024_138377_139366 306
176 3300046689 Ga0495613_0000073 Ga0495613_0000073_9733_10722 306
177 3300047317 Ga0495604_0000985 Ga0495604_0000985_17422_18411 306
178 3300047444 Ga0495675_0000428 Ga0495675_0000428_5890_6879 306
179 3300053077 Ga0495601_0002204 Ga0495601_0002204_9736_10725 306
180 3300053084 Ga0495595_0000014 Ga0495595_0000014_5890_6879 306
181 3300053085 Ga0495619_0000147 Ga0495619_0000147_5890_6879 306
182 3300005327 Ga0070658_10064661 Ga0070658_100646613 307
183 3300005339 Ga0070660_100001878 Ga0070660_10000187815 307
184 3300005354 Ga0070675_100000053 Ga0070675_10000005365 307
185 3300005564 Ga0070664_100128239 Ga0070664_1001282392 307
186 3300005981 Ga0081538_10004594 Ga0081538_1000459411 307
187 3300005981 Ga0081538_10016142 Ga0081538_100161426 307
188 3300006173 Ga0070716_100217633 Ga0070716_1002176332 307
189 3300009094 Ga0111539_10065301 Ga0111539_100653015 307
190 3300009147 Ga0114129_10215708 Ga0114129_102157083 307
191 3300013102 Ga0157371_10005434 Ga0157371_100054349 307
192 3300014968 Ga0157379_10023085 Ga0157379_100230855 307
193 3300020070 Ga0206356_10601656 Ga0206356_106016564 307
194 3300025926 Ga0207659_10000010 Ga0207659_10000010234 307
195 3300025928 Ga0207700_10003610 Ga0207700_100036104 307
196 3300025932 Ga0207690_10001648 Ga0207690_100016486 307
197 3300025945 Ga0207679_10115103 Ga0207679_101151031 307
198 3300025961 Ga0207712_10160173 Ga0207712_101601732 307
199 3300032126 Ga0307415_100020877 Ga0307415_1000208773 307
200 3300046500 Ga0495596_0031416 Ga0495596_0031416_17_943 307
201 3300046512 Ga0495610_0028993 Ga0495610_0028993_792_1781 307
202 3300046690 Ga0495624_0000009 Ga0495624_0000009_139698_140687 307
203 3300050507 nmdc:mga05p37_144872_c1 nmdc:mga05p37_144872_c1_1431_2414 307
204 3300002075 JGI24738J21930_10008605 JGI24738J21930_100086052 308
205 3300003373 JGI25407J50210_10005129 JGI25407J50210_100051292 308
206 3300005334 Ga0068869_100066940 Ga0068869_1000669402 308
207 3300005336 Ga0070680_100301560 Ga0070680_1003015602 308
208 3300005337 Ga0070682_100080129 Ga0070682_1000801291 308
209 3300005338 Ga0068868_100005956 Ga0068868_10000595610 308
210 3300005344 Ga0070661_100029830 Ga0070661_1000298302 308
211 3300005354 Ga0070675_100195855 Ga0070675_1001958552 308
212 3300005356 Ga0070674_100070535 Ga0070674_1000705352 308
213 3300005366 Ga0070659_100024338 Ga0070659_1000243383 308
214 3300005459 Ga0068867_100054845 Ga0068867_1000548453 308
215 3300005535 Ga0070684_100024068 Ga0070684_1000240684 308
216 3300005563 Ga0068855_100046966 Ga0068855_1000469664 308
217 3300005616 Ga0068852_100044814 Ga0068852_1000448144 308
218 3300005834 Ga0068851_10019515 Ga0068851_100195153 308
219 3300005981 Ga0081538_10003315 Ga0081538_100033152 308
220 3300006881 Ga0068865_100034775 Ga0068865_1000347752 308
221 3300009098 Ga0105245_10042529 Ga0105245_100425292 308
222 3300009148 Ga0105243_10046579 Ga0105243_100465792 308
223 3300009551 Ga0105238_10040063 Ga0105238_100400632 308
224 3300013102 Ga0157371_10049109 Ga0157371_100491093 308
225 3300013105 Ga0157369_10342026 Ga0157369_103420262 308
226 3300013307 Ga0157372_10068938 Ga0157372_100689381 308
227 3300013307 Ga0157372_10478890 Ga0157372_104788902 308
228 3300025321 Ga0207656_10102513 Ga0207656_101025131 308
229 3300025899 Ga0207642_10040399 Ga0207642_100403992 308
230 3300025918 Ga0207662_10055643 Ga0207662_100556432 308
231 3300025919 Ga0207657_10006016 Ga0207657_100060163 308
232 3300025932 Ga0207690_10379369 Ga0207690_103793691 308
233 3300025935 Ga0207709_10233345 Ga0207709_102333451 308
234 3300025941 Ga0207711_10000020 Ga0207711_10000020103 308
235 3300025944 Ga0207661_10027150 Ga0207661_100271502 308
236 3300025981 Ga0207640_10188590 Ga0207640_101885901 308
237 3300048929 Ga0496126_0000108 Ga0496126_0000108_167454_168425 308
238 3300049568 Ga0501031_0214164 Ga0501031_0214164_217_1236 308
239 3300049575 Ga0501039_0098657 Ga0501039_0098657_13_1011 308
240 3300049575 Ga0501039_0161109 Ga0501039_0161109_418_1437 308
241 3300049588 Ga0501072_0108814 Ga0501072_0108814_40_1059 308
242 3300049591 Ga0501075_0290189 Ga0501075_0290189_36_1055 308
243 3300060353 Ga0501082_0235564 Ga0501082_0235564_292_1311 308
244 3300003373 JGI25407J50210_10014324 JGI25407J50210_100143242 309
245 3300005842 Ga0068858_100000267 Ga0068858_10000026741 309
246 3300005981 Ga0081538_10003073 Ga0081538_100030737 309
247 3300005981 Ga0081538_10021887 Ga0081538_100218872 309
248 3300005985 Ga0081539_10001929 Ga0081539_100019293 309
249 3300025931 Ga0207644_10175626 Ga0207644_101756262 309
250 3300026035 Ga0207703_10000040 Ga0207703_10000040109 309
251 3300026118 Ga0207675_100466808 Ga0207675_1004668082 309
252 3300028577 Ga0265318_10017106 Ga0265318_100171063 309
253 3300028800 Ga0265338_10016842 Ga0265338_100168424 309
254 3300045049 Ga0466959_0156171 Ga0466959_0156171_420_1403 309
255 3300046679 Ga0495623_0132179 Ga0495623_0132179_210_1199 309
256 3300046681 Ga0495647_0000025 Ga0495647_0000025_47577_48566 309
257 3300047317 Ga0495604_0000019 Ga0495604_0000019_60473_61462 309
258 3300048909 Ga0496106_0000149 Ga0496106_0000149_50357_51346 309
259 3300048915 Ga0496112_0000003 Ga0496112_0000003_130735_131724 309
260 3300053083 Ga0495655_0005518 Ga0495655_0005518_653_1750 309
261 3300005329 Ga0070683_100030210 Ga0070683_1000302103 310
262 3300005455 Ga0070663_100023142 Ga0070663_1000231426 310
263 3300005530 Ga0070679_100014166 Ga0070679_1000141661 310
264 3300005535 Ga0070684_100025949 Ga0070684_1000259493 310
265 3300005614 Ga0068856_100184340 Ga0068856_1001843403 310
266 3300005981 Ga0081538_10047697 Ga0081538_100476972 310
267 3300006175 Ga0070712_100001071 Ga0070712_1000010719 310
268 3300006852 Ga0075433_10015865 Ga0075433_100158655 310
269 3300014969 Ga0157376_10176393 Ga0157376_101763932 310
270 3300020080 Ga0206350_10365630 Ga0206350_103656301 310
271 3300025915 Ga0207693_10002622 Ga0207693_100026228 310
272 3300025921 Ga0207652_10125620 Ga0207652_101256201 310
273 3300025944 Ga0207661_10009162 Ga0207661_100091621 310
274 3300025944 Ga0207661_10009503 Ga0207661_100095038 310
275 3300026067 Ga0207678_10012342 Ga0207678_1001234210 310
276 3300026078 Ga0207702_10088937 Ga0207702_100889372 310
277 3300048905 Ga0496102_0299530 Ga0496102_0299530_16_957 310
278 3300049585 Ga0501069_0007590 Ga0501069_0007590_389_1378 310
279 3300049587 Ga0501071_0070366 Ga0501071_0070366_133_1122 310
280 3300049590 Ga0501074_0030021 Ga0501074_0030021_348_1337 310
281 3300049591 Ga0501075_0181602 Ga0501075_0181602_547_1545 310
282 3300049593 Ga0501077_0083695 Ga0501077_0083695_364_1362 310
283 3300049742 Ga0501080_0050087 Ga0501080_0050087_2787_3776 310
284 3300049823 Ga0501044_0049171 Ga0501044_0049171_250_1239 310
285 3300050515 nmdc:mga0a205_38052_c1 nmdc:mga0a205_38052_c1_23_1006 310
286 3300005327 Ga0070658_10245389 Ga0070658_102453892 311
287 3300005937 Ga0081455_10028011 Ga0081455_100280114 311
288 3300006051 Ga0075364_10188149 Ga0075364_101881493 311
289 3300006173 Ga0070716_100263271 Ga0070716_1002632712 311
290 3300006914 Ga0075436_100228362 Ga0075436_1002283621 311
291 3300013296 Ga0157374_10451073 Ga0157374_104510731 311
292 3300025908 Ga0207643_10147964 Ga0207643_101479641 311
293 3300037312 Ga0395899_0040871 Ga0395899_0040871_713_1702 311
294 3300037418 Ga0395900_0068406 Ga0395900_0068406_897_1886 311
295 3300037466 Ga0395898_0031362 Ga0395898_0031362_489_1478 311
296 3300037471 Ga0395905_0071433 Ga0395905_0071433_1808_2797 311
297 3300038443 Ga0395901_0148255 Ga0395901_0148255_1092_2081 311
298 3300045976 Ga0466967_0000027 Ga0466967_0000027_24050_25039 311
299 3300005549 Ga0070704_100148947 Ga0070704_1001489472 312
300 3300006871 Ga0075434_100137545 Ga0075434_1001375451 312
301 3300037418 Ga0395900_0017631 Ga0395900_0017631_5588_6571 312
302 3300037466 Ga0395898_0053394 Ga0395898_0053394_2008_2991 312
303 3300044694 Ga0466963_0061539 Ga0466963_0061539_181_1158 312
304 3300046516 Ga0495628_0002459 Ga0495628_0002459_7561_8553 312
305 3300046523 Ga0495644_0007172 Ga0495644_0007172_1833_2822 312
306 3300046678 Ga0495599_0048369 Ga0495599_0048369_1363_2355 312
307 3300049581 Ga0501047_0038927 Ga0501047_0038927_1207_2196 312
308 3300049583 Ga0501067_0000348 Ga0501067_0000348_7328_8371 312
309 3300061734 Ga0530510_0013546 Ga0530510_0013546_2225_3268 312
310 3300003203 JGI25406J46586_10016276 JGI25406J46586_100162763 313
311 3300005618 Ga0068864_100000045 Ga0068864_10000004542 313
312 3300005985 Ga0081539_10001668 Ga0081539_1000166818 313
313 3300025939 Ga0207665_10182238 Ga0207665_101822382 313
314 3300026095 Ga0207676_10000016 Ga0207676_10000016121 313
315 3300028381 Ga0268264_10006502 Ga0268264_100065029 313
316 3300036401 Ga0373937_0334799 Ga0373937_0334799_242_1225 313
317 3300045976 Ga0466967_0211313 Ga0466967_0211313_733_1743 313
318 3300046454 Ga0495592_0000036 Ga0495592_0000036_57569_58561 313
319 3300046642 Ga0495634_0027184 Ga0495634_0027184_2184_3167 313
320 3300046642 Ga0495634_0053650 Ga0495634_0053650_955_1944 313
321 3300046663 Ga0495635_0000016 Ga0495635_0000016_59382_60368 313
322 3300046689 Ga0495613_0000152 Ga0495613_0000152_80_1066 313
323 3300047319 Ga0495674_0186670 Ga0495674_0186670_523_1506 313
324 3300047447 Ga0495685_034437 Ga0495685_034437_169_1155 313
325 3300049592 Ga0501076_0142235 Ga0501076_0142235_473_1477 313
326 3300005337 Ga0070682_100000045 Ga0070682_10000004516 314
327 3300005356 Ga0070674_100158725 Ga0070674_1001587251 314
328 3300005365 Ga0070688_100060783 Ga0070688_1000607832 314
329 3300005439 Ga0070711_100247965 Ga0070711_1002479651 314
330 3300005456 Ga0070678_100007927 Ga0070678_1000079272 314
331 3300005549 Ga0070704_100028529 Ga0070704_1000285293 314
332 3300005578 Ga0068854_100000031 Ga0068854_10000003187 314
333 3300005834 Ga0068851_10000656 Ga0068851_1000065619 314
334 3300006173 Ga0070716_100224153 Ga0070716_1002241532 314
335 3300006175 Ga0070712_100056677 Ga0070712_1000566775 314
336 3300009098 Ga0105245_10000236 Ga0105245_1000023620 314
337 3300009098 Ga0105245_10006569 Ga0105245_100065694 314
338 3300009101 Ga0105247_10067293 Ga0105247_100672933 314
339 3300009148 Ga0105243_10297599 Ga0105243_102975992 314
340 3300009176 Ga0105242_10132675 Ga0105242_101326752 314
341 3300013297 Ga0157378_10289166 Ga0157378_102891662 314
342 3300013307 Ga0157372_10000409 Ga0157372_1000040916 314
343 3300013308 Ga0157375_10106522 Ga0157375_101065222 314
344 3300014969 Ga0157376_10212168 Ga0157376_102121681 314
345 3300020082 Ga0206353_11406144 Ga0206353_114061441 314
346 3300025321 Ga0207656_10002957 Ga0207656_100029576 314
347 3300025915 Ga0207693_10000677 Ga0207693_1000067727 314
348 3300025916 Ga0207663_10229404 Ga0207663_102294041 314
349 3300025926 Ga0207659_10227067 Ga0207659_102270672 314
350 3300025927 Ga0207687_10004769 Ga0207687_100047694 314
351 3300025927 Ga0207687_10034822 Ga0207687_100348222 314
352 3300025929 Ga0207664_10123464 Ga0207664_101234642 314
353 3300025934 Ga0207686_10254242 Ga0207686_102542422 314
354 3300025981 Ga0207640_10000015 Ga0207640_10000015129 314
355 3300026023 Ga0207677_10019123 Ga0207677_100191234 314
356 3300026121 Ga0207683_10022220 Ga0207683_100222205 314
357 3300045049 Ga0466959_0137177 Ga0466959_0137177_675_1658 314
358 3300046476 Ga0495662_0000650 Ga0495662_0000650_7232_8218 314
359 3300046516 Ga0495628_0000144 Ga0495628_0000144_2388_3377 314
360 3300046543 Ga0495645_0028397 Ga0495645_0028397_2896_3900 314
361 3300047315 Ga0495581_0114745 Ga0495581_0114745_238_1218 314
362 3300048088 Ga0495602_0001790 Ga0495602_0001790_15770_16759 314
363 3300048903 Ga0496100_0037106 Ga0496100_0037106_999_1979 314
364 3300048904 Ga0496101_0094853 Ga0496101_0094853_936_1916 314
365 3300048905 Ga0496102_0008457 Ga0496102_0008457_6409_7389 314
366 3300048906 Ga0496103_0006820 Ga0496103_0006820_2076_3056 314
367 3300048907 Ga0496104_0126464 Ga0496104_0126464_662_1642 314
368 3300048908 Ga0496105_0014782 Ga0496105_0014782_4066_5046 314
369 3300048909 Ga0496106_0047208 Ga0496106_0047208_1501_2481 314
370 3300048910 Ga0496107_0001394 Ga0496107_0001394_12692_13672 314
371 3300048912 Ga0496109_0000028 Ga0496109_0000028_32408_33397 314
372 3300048912 Ga0496109_0222627 Ga0496109_0222627_316_1296 314
373 3300048913 Ga0496110_0006813 Ga0496110_0006813_304_1284 314
374 3300048914 Ga0496111_0003320 Ga0496111_0003320_402_1382 314
375 3300048915 Ga0496112_0253016 Ga0496112_0253016_239_1219 314
376 3300048917 Ga0496114_0156407 Ga0496114_0156407_298_1278 314
377 3300048918 Ga0496115_0123722 Ga0496115_0123722_859_1839 314
378 3300053077 Ga0495601_0139636 Ga0495601_0139636_199_1203 314
379 3300053085 Ga0495619_0000055 Ga0495619_0000055_52718_53707 314
380 3300005614 Ga0068856_100001194 Ga0068856_10000119433 315
381 3300005937 Ga0081455_10003252 Ga0081455_1000325213 315
382 3300006852 Ga0075433_10001485 Ga0075433_1000148514 315
383 3300013104 Ga0157370_10140814 Ga0157370_101408142 315
384 3300026078 Ga0207702_10000607 Ga0207702_1000060714 315
385 3300048916 Ga0496113_0000029 Ga0496113_0000029_42615_43604 315
386 3300048920 Ga0496117_0020230 Ga0496117_0020230_1897_2886 315
387 3300048921 Ga0496118_0005186 Ga0496118_0005186_11305_12294 315
388 3300048924 Ga0496121_0101167 Ga0496121_0101167_64_1053 315
389 3300049568 Ga0501031_0000434 Ga0501031_0000434_858_1847 315
390 3300049568 Ga0501031_0029713 Ga0501031_0029713_1387_2385 315
391 3300049569 Ga0501032_0000899 Ga0501032_0000899_22247_23236 315
392 3300049570 Ga0501033_0001140 Ga0501033_0001140_22256_23245 315
393 3300049571 Ga0501034_0124121 Ga0501034_0124121_979_1968 315
394 3300049572 Ga0501036_0029623 Ga0501036_0029623_657_1646 315
395 3300049573 Ga0501037_0000774 Ga0501037_0000774_665_1654 315
396 3300049574 Ga0501038_0001146 Ga0501038_0001146_773_1762 315
397 3300049575 Ga0501039_0098643 Ga0501039_0098643_732_1721 315
398 3300049579 Ga0501043_0001082 Ga0501043_0001082_22245_23234 315
399 3300049580 Ga0501046_0000447 Ga0501046_0000447_22243_23232 315
400 3300049581 Ga0501047_0001335 Ga0501047_0001335_22403_23392 315
401 3300049582 Ga0501048_0000734 Ga0501048_0000734_22229_23218 315
402 3300049585 Ga0501069_0038721 Ga0501069_0038721_585_1574 315
403 3300049586 Ga0501070_0001137 Ga0501070_0001137_22234_23223 315
404 3300049589 Ga0501073_0049364 Ga0501073_0049364_606_1595 315
405 3300049590 Ga0501074_0038770 Ga0501074_0038770_1863_2852 315
406 3300049741 Ga0501079_0017085 Ga0501079_0017085_653_1642 315
407 3300049744 Ga0501083_0023660 Ga0501083_0023660_2680_3669 315
408 3300049822 Ga0501035_0002398 Ga0501035_0002398_763_1752 315
409 3300049823 Ga0501044_0003241 Ga0501044_0003241_707_1696 315
410 3300049823 Ga0501044_0167828 Ga0501044_0167828_486_1475 315
411 3300049824 Ga0501045_0013972 Ga0501045_0013972_3951_4940 315
412 3300050515 nmdc:mga0a205_1916_c1 nmdc:mga0a205_1916_c1_13257_14282 315
413 3300060353 Ga0501082_0051874 Ga0501082_0051874_2526_3515 315
414 3300005347 Ga0070668_100116183 Ga0070668_1001161831 316
415 3300005367 Ga0070667_100000695 Ga0070667_10000069518 316
416 3300005548 Ga0070665_100279050 Ga0070665_1002790502 316
417 3300005841 Ga0068863_100339780 Ga0068863_1003397802 316
418 3300005844 Ga0068862_100008832 Ga0068862_1000088327 316
419 3300006163 Ga0070715_10000001 Ga0070715_10000001201 316
420 3300013100 Ga0157373_10093096 Ga0157373_100930962 316
421 3300025905 Ga0207685_10000011 Ga0207685_10000011201 316
422 3300025961 Ga0207712_10020852 Ga0207712_100208524 316
423 3300025986 Ga0207658_10025449 Ga0207658_100254491 316
424 3300026088 Ga0207641_10275188 Ga0207641_102751882 316
425 3300026121 Ga0207683_10055774 Ga0207683_100557745 316
426 3300027111 Ga0209281_1004136 Ga0209281_10041363 316
427 3300028380 Ga0268265_10000555 Ga0268265_1000055516 316
428 3300041512 Ga0451853_0128655 Ga0451853_0128655_1124_2131 316
429 3300046455 Ga0495603_0007864 Ga0495603_0007864_3386_4375 316
430 3300046476 Ga0495662_0034097 Ga0495662_0034097_1268_2257 316
431 3300005331 Ga0070670_100090285 Ga0070670_1000902853 317
432 3300005336 Ga0070680_100081060 Ga0070680_1000810603 317
433 3300005344 Ga0070661_100036846 Ga0070661_1000368463 317
434 3300005458 Ga0070681_10010625 Ga0070681_100106256 317
435 3300005530 Ga0070679_100033291 Ga0070679_1000332912 317
436 3300005535 Ga0070684_100038133 Ga0070684_1000381333 317
437 3300005614 Ga0068856_100173482 Ga0068856_1001734822 317
438 3300005843 Ga0068860_100130464 Ga0068860_1001304642 317
439 3300005981 Ga0081538_10046933 Ga0081538_100469333 317
440 3300010375 Ga0105239_10374451 Ga0105239_103744512 317
441 3300013307 Ga0157372_10035008 Ga0157372_100350084 317
442 3300013307 Ga0157372_10100239 Ga0157372_101002393 317
443 3300014326 Ga0157380_10002264 Ga0157380_100022646 317
444 3300025909 Ga0207705_10112357 Ga0207705_101123572 317
445 3300025912 Ga0207707_10023261 Ga0207707_100232612 317
446 3300025917 Ga0207660_10027356 Ga0207660_100273563 317
447 3300025921 Ga0207652_10110598 Ga0207652_101105983 317
448 3300025925 Ga0207650_10024224 Ga0207650_100242244 317
449 3300025931 Ga0207644_10238498 Ga0207644_102384982 317
450 3300026067 Ga0207678_10170749 Ga0207678_101707492 317
451 3300026078 Ga0207702_10389868 Ga0207702_103898682 317
452 3300026118 Ga0207675_100096249 Ga0207675_1000962493 317
453 3300037312 Ga0395899_0019528 Ga0395899_0019528_1169_2203 317
454 3300037418 Ga0395900_0022240 Ga0395900_0022240_4653_5687 317
455 3300037466 Ga0395898_0105247 Ga0395898_0105247_869_1903 317
456 3300037471 Ga0395905_0010080 Ga0395905_0010080_3806_4840 317
457 3300038443 Ga0395901_0014107 Ga0395901_0014107_4963_5997 317
458 3300049586 Ga0501070_0158987 Ga0501070_0158987_311_1300 317
459 3300005335 Ga0070666_10029341 Ga0070666_100293414 318
460 3300005544 Ga0070686_100242430 Ga0070686_1002424301 318
461 3300009094 Ga0111539_10044466 Ga0111539_100444665 318
462 3300009147 Ga0114129_10014103 Ga0114129_100141039 318
463 3300025903 Ga0207680_10010826 Ga0207680_100108261 318
464 3300027907 Ga0207428_10020123 Ga0207428_100201233 318
465 3300032002 Ga0307416_100010497 Ga0307416_1000104973 318
466 3300032126 Ga0307415_100357145 Ga0307415_1003571451 318
467 3300037466 Ga0395898_0053265 Ga0395898_0053265_2272_3255 318
468 3300038443 Ga0395901_0018370 Ga0395901_0018370_4351_5334 318
469 3300046536 Ga0495587_0005378 Ga0495587_0005378_6123_7112 318
470 3300049591 Ga0501075_0000392 Ga0501075_0000392_17984_18973 318
471 3300050507 nmdc:mga05p37_170780_c1 nmdc:mga05p37_170780_c1_208_1194 318
472 3300050511 nmdc:mga08y16_9951_c1 nmdc:mga08y16_9951_c1_2992_3978 318
473 3300010375 Ga0105239_10351710 Ga0105239_103517101 319
474 3300025899 Ga0207642_10024114 Ga0207642_100241143 319
475 3300025927 Ga0207687_10000247 Ga0207687_1000024726 319
476 3300032126 Ga0307415_100177466 Ga0307415_1001774662 319
477 3300047322 Ga0495680_0000317 Ga0495680_0000317_48350_49339 319
478 3300048918 Ga0496115_0000003 Ga0496115_0000003_289335_290324 319
479 3300049583 Ga0501067_0052936 Ga0501067_0052936_143_1129 319
480 3300053085 Ga0495619_0146912 Ga0495619_0146912_276_1262 319
481 iso_pu_bacteria 8007375930 8007378304 319
482 3300009551 Ga0105238_10000011 Ga0105238_1000001117 320
483 3300025924 Ga0207694_10000004 Ga0207694_10000004604 320
484 3300048907 Ga0496104_0000001 Ga0496104_0000001_569349_570341 320
485 3300048908 Ga0496105_0019941 Ga0496105_0019941_1148_2137 320
486 3300048910 Ga0496107_0037613 Ga0496107_0037613_627_1616 320
487 3300048913 Ga0496110_0002884 Ga0496110_0002884_650_1642 320
488 3300048914 Ga0496111_0000021 Ga0496111_0000021_18906_19898 320
489 3300048924 Ga0496121_0052505 Ga0496121_0052505_1419_2408 320
490 3300048929 Ga0496126_0049736 Ga0496126_0049736_1569_2558 320
491 3300005356 Ga0070674_100000082 Ga0070674_10000008242 321
492 3300005548 Ga0070665_100005026 Ga0070665_10000502615 321
493 3300005718 Ga0068866_10000001 Ga0068866_10000001227 321
494 3300025899 Ga0207642_10000007 Ga0207642_100000076 321
495 3300025937 Ga0207669_10000012 Ga0207669_1000001247 321
496 3300028379 Ga0268266_10055957 Ga0268266_100559572 321
497 3300050507 nmdc:mga05p37_71033_c2 nmdc:mga05p37_71033_c2_688_1680 321
498 3300053078 Ga0495612_0001555 Ga0495612_0001555_5486_6475 321
499 3300005329 Ga0070683_100006385 Ga0070683_1000063854 322
500 3300005457 Ga0070662_100000016 Ga0070662_10000001664 322
501 3300005535 Ga0070684_100024149 Ga0070684_1000241495 322
502 3300005548 Ga0070665_100000244 Ga0070665_10000024446 322
503 3300005842 Ga0068858_100001207 Ga0068858_10000120719 322
504 3300025933 Ga0207706_10000068 Ga0207706_1000006865 322
505 3300025944 Ga0207661_10008086 Ga0207661_100080867 322
506 3300026035 Ga0207703_10001815 Ga0207703_1000181510 322
507 3300028379 Ga0268266_10000020 Ga0268266_1000002044 322
508 3300037418 Ga0395900_0452587 Ga0395900_0452587_66_1076 322
509 3300037471 Ga0395905_0168995 Ga0395905_0168995_234_1271 322
510 3300038443 Ga0395901_0026219 Ga0395901_0026219_2953_3990 322
511 3300005337 Ga0070682_100002116 Ga0070682_1000021162 323
512 3300009098 Ga0105245_10108988 Ga0105245_101089883 323
513 3300025918 Ga0207662_10124173 Ga0207662_101241732 323
514 3300036401 Ga0373937_0168677 Ga0373937_0168677_392_1426 323
515 3300038443 Ga0395901_0254951 Ga0395901_0254951_564_1553 323
516 3300041458 Ga0451798_0735618 Ga0451798_0735618_202_1230 323
517 3300044694 Ga0466963_0000023 Ga0466963_0000023_50761_51750 323
518 3300048903 Ga0496100_0000018 Ga0496100_0000018_27630_28619 323
519 3300048904 Ga0496101_0000221 Ga0496101_0000221_37291_38280 323
520 3300048909 Ga0496106_0000018 Ga0496106_0000018_169823_170812 323
521 3300048910 Ga0496107_0000006 Ga0496107_0000006_96553_97542 323
522 3300006852 Ga0075433_10018515 Ga0075433_100185152 324
523 3300044719 Ga0466971_0124073 Ga0466971_0124073_35_1144 324
524 3300045976 Ga0466967_0180119 Ga0466967_0180119_576_1685 324
525 3300005336 Ga0070680_100101413 Ga0070680_1001014131 325
526 3300005336 Ga0070680_100143896 Ga0070680_1001438961 325
527 3300005337 Ga0070682_100014100 Ga0070682_1000141001 325
528 3300005337 Ga0070682_100080676 Ga0070682_1000806761 325
529 3300005339 Ga0070660_100002874 Ga0070660_1000028747 325
530 3300005436 Ga0070713_100160693 Ga0070713_1001606932 325
531 3300005439 Ga0070711_100092307 Ga0070711_1000923072 325
532 3300005457 Ga0070662_100093451 Ga0070662_1000934511 325
533 3300005458 Ga0070681_10013721 Ga0070681_100137214 325
534 3300005458 Ga0070681_10056580 Ga0070681_100565801 325
535 3300005530 Ga0070679_100031669 Ga0070679_1000316694 325
536 3300005535 Ga0070684_100023464 Ga0070684_1000234644 325
537 3300005535 Ga0070684_100091076 Ga0070684_1000910762 325
538 3300005548 Ga0070665_100017879 Ga0070665_1000178794 325
539 3300005577 Ga0068857_100058998 Ga0068857_1000589982 325
540 3300005614 Ga0068856_100043149 Ga0068856_1000431494 325
541 3300005616 Ga0068852_100239073 Ga0068852_1002390733 325
542 3300006175 Ga0070712_100003981 Ga0070712_1000039819 325
543 3300006175 Ga0070712_100186842 Ga0070712_1001868423 325
544 3300006847 Ga0075431_100230163 Ga0075431_1002301632 325
545 3300009098 Ga0105245_10240515 Ga0105245_102405152 325
546 3300009098 Ga0105245_10247711 Ga0105245_102477112 325
547 3300009098 Ga0105245_10282589 Ga0105245_102825892 325
548 3300009148 Ga0105243_10014354 Ga0105243_100143547 325
549 3300009551 Ga0105238_10081390 Ga0105238_100813902 325
550 3300010375 Ga0105239_10392819 Ga0105239_103928192 325
551 3300013102 Ga0157371_10050500 Ga0157371_100505002 325
552 3300013104 Ga0157370_10069784 Ga0157370_100697842 325
553 3300013104 Ga0157370_10160855 Ga0157370_101608551 325
554 3300013105 Ga0157369_10003551 Ga0157369_1000355113 325
555 3300013105 Ga0157369_10033166 Ga0157369_100331664 325
556 3300013105 Ga0157369_10193773 Ga0157369_101937732 325
557 3300013105 Ga0157369_10195655 Ga0157369_101956552 325
558 3300013307 Ga0157372_10031427 Ga0157372_100314274 325
559 3300013307 Ga0157372_10176247 Ga0157372_101762472 325
560 3300014497 Ga0182008_10083110 Ga0182008_100831102 325
561 3300020070 Ga0206356_10112548 Ga0206356_101125482 325
562 3300020070 Ga0206356_10303627 Ga0206356_103036271 325
563 3300020077 Ga0206351_10463088 Ga0206351_104630882 325
564 3300021377 Ga0213874_10000607 Ga0213874_100006076 325
565 3300021384 Ga0213876_10004540 Ga0213876_100045406 325
566 3300021384 Ga0213876_10007254 Ga0213876_100072544 325
567 3300021388 Ga0213875_10000199 Ga0213875_1000019929 325
568 3300025912 Ga0207707_10333648 Ga0207707_103336482 325
569 3300025915 Ga0207693_10001903 Ga0207693_1000190312 325
570 3300025917 Ga0207660_10064247 Ga0207660_100642472 325
571 3300025919 Ga0207657_10004630 Ga0207657_100046306 325
572 3300025919 Ga0207657_10011291 Ga0207657_100112916 325
573 3300025919 Ga0207657_10058586 Ga0207657_100585862 325
574 3300025920 Ga0207649_10077206 Ga0207649_100772062 325
575 3300025921 Ga0207652_10169370 Ga0207652_101693702 325
576 3300025921 Ga0207652_10368781 Ga0207652_103687812 325
577 3300025928 Ga0207700_10021302 Ga0207700_100213023 325
578 3300025929 Ga0207664_10100265 Ga0207664_101002652 325
579 3300025932 Ga0207690_10050488 Ga0207690_100504882 325
580 3300025939 Ga0207665_10209651 Ga0207665_102096512 325
581 3300025944 Ga0207661_10029153 Ga0207661_100291532 325
582 3300026078 Ga0207702_10214928 Ga0207702_102149283 325
583 3300026116 Ga0207674_10014502 Ga0207674_100145021 325
584 3300035119 Ga0373956_0111322 Ga0373956_0111322_199_1176 325
585 3300035170 Ga0373943_0000450 Ga0373943_0000450_12247_13233 325
586 3300035171 Ga0373946_0004358 Ga0373946_0004358_1532_2518 325
587 3300035695 Ga0373927_0022758 Ga0373927_0022758_2594_3580 325
588 3300035724 Ga0373933_0023238 Ga0373933_0023238_1203_2258 325
589 3300035725 Ga0373947_0002176 Ga0373947_0002176_8622_9608 325
590 3300036401 Ga0373937_0011597 Ga0373937_0011597_3559_4536 325
591 3300037068 Ga0373925_0003354 Ga0373925_0003354_6535_7521 325
592 3300037312 Ga0395899_0075426 Ga0395899_0075426_265_1305 325
593 3300037418 Ga0395900_0462972 Ga0395900_0462972_114_1154 325
594 3300037466 Ga0395898_0002496 Ga0395898_0002496_17865_18914 325
595 3300037466 Ga0395898_0042172 Ga0395898_0042172_2919_3905 325
596 3300037471 Ga0395905_0172870 Ga0395905_0172870_136_1122 325
597 3300037853 Ga0436364_0527107 Ga0436364_0527107_47787_48764 325
598 3300038443 Ga0395901_0577279 Ga0395901_0577279_50_1036 325
599 3300039437 Ga0436365_0344023 Ga0436365_0344023_4114_5112 325
600 3300039437 Ga0436365_0823300 Ga0436365_0823300_4178_5176 325
601 3300039437 Ga0436365_1182882 Ga0436365_1182882_105_1091 325
602 3300039437 Ga0436365_1248745 Ga0436365_1248745_578_1555 325
603 3300039450 Ga0436363_0675171 Ga0436363_0675171_22135_23133 325
604 3300044684 Ga0466966_0087254 Ga0466966_0087254_740_1780 325
605 3300044693 Ga0466961_0009994 Ga0466961_0009994_1869_2912 325
606 3300044693 Ga0466961_0019451 Ga0466961_0019451_1704_2681 325
607 3300044693 Ga0466961_0122770 Ga0466961_0122770_277_1320 325
608 3300044694 Ga0466963_0073596 Ga0466963_0073596_301_1344 325
609 3300044694 Ga0466963_0118600 Ga0466963_0118600_463_1506 325
610 3300044706 Ga0466964_0018912 Ga0466964_0018912_198_1241 325
611 3300044706 Ga0466964_0057309 Ga0466964_0057309_479_1522 325
612 3300044719 Ga0466971_0001268 Ga0466971_0001268_8862_9905 325
613 3300044735 Ga0466968_0009508 Ga0466968_0009508_555_1598 325
614 3300044842 Ga0466957_0000566 Ga0466957_0000566_3526_4569 325
615 3300044901 Ga0466960_0024390 Ga0466960_0024390_714_1757 325
616 3300045049 Ga0466959_0001055 Ga0466959_0001055_5256_6299 325
617 3300045049 Ga0466959_0052484 Ga0466959_0052484_686_1663 325
618 3300045836 Ga0466958_0002895 Ga0466958_0002895_7663_8706 325
619 3300045836 Ga0466958_0006736 Ga0466958_0006736_4150_5127 325
620 3300045976 Ga0466967_0004155 Ga0466967_0004155_7186_8229 325
621 3300045976 Ga0466967_0010911 Ga0466967_0010911_4531_5574 325
622 3300045976 Ga0466967_0061995 Ga0466967_0061995_2057_3100 325
623 3300045976 Ga0466967_0210347 Ga0466967_0210347_429_1472 325
624 3300045976 Ga0466967_0226742 Ga0466967_0226742_236_1273 325
625 3300046459 Ga0495629_0024338 Ga0495629_0024338_3176_4162 325
626 3300046459 Ga0495629_0081278 Ga0495629_0081278_774_1817 325
627 3300046462 Ga0495651_0003583 Ga0495651_0003583_9917_10972 325
628 3300046462 Ga0495651_0117342 Ga0495651_0117342_91_1134 325
629 3300046463 Ga0495653_0038949 Ga0495653_0038949_1248_2303 325
630 3300046463 Ga0495653_0073344 Ga0495653_0073344_977_2020 325
631 3300046463 Ga0495653_0135719 Ga0495653_0135719_581_1567 325
632 3300046472 Ga0495580_0200013 Ga0495580_0200013_138_1124 325
633 3300046473 Ga0495582_0000066 Ga0495582_0000066_30937_31923 325
634 3300046475 Ga0495639_0001185 Ga0495639_0001185_4288_5274 325
635 3300046476 Ga0495662_0000694 Ga0495662_0000694_10049_11035 325
636 3300046499 Ga0495594_0076609 Ga0495594_0076609_557_1543 325
637 3300046511 Ga0495608_0010826 Ga0495608_0010826_979_2034 325
638 3300046511 Ga0495608_0017412 Ga0495608_0017412_2103_3089 325
639 3300046516 Ga0495628_0010479 Ga0495628_0010479_5759_6814 325
640 3300046516 Ga0495628_0017322 Ga0495628_0017322_2235_3278 325
641 3300046516 Ga0495628_0268967 Ga0495628_0268967_240_1226 325
642 3300046517 Ga0495630_0005219 Ga0495630_0005219_664_1650 325
643 3300046517 Ga0495630_0042919 Ga0495630_0042919_1105_2148 325
644 3300046529 Ga0495652_0018945 Ga0495652_0018945_3917_4903 325
645 3300046529 Ga0495652_0049582 Ga0495652_0049582_1642_2685 325
646 3300046531 Ga0495665_0000252 Ga0495665_0000252_23868_24854 325
647 3300046533 Ga0495640_0012743 Ga0495640_0012743_4354_5397 325
648 3300046533 Ga0495640_0051398 Ga0495640_0051398_1395_2450 325
649 3300046533 Ga0495640_0104286 Ga0495640_0104286_221_1207 325
650 3300046536 Ga0495587_0023376 Ga0495587_0023376_1541_2596 325
651 3300046536 Ga0495587_0033470 Ga0495587_0033470_980_1966 325
652 3300046559 Ga0495667_0000751 Ga0495667_0000751_17519_18574 325
653 3300046559 Ga0495667_0006812 Ga0495667_0006812_260_1303 325
654 3300046559 Ga0495667_0014712 Ga0495667_0014712_1940_2926 325
655 3300046559 Ga0495667_0037733 Ga0495667_0037733_780_1766 325
656 3300046642 Ga0495634_0031253 Ga0495634_0031253_1256_2242 325
657 3300046663 Ga0495635_0008147 Ga0495635_0008147_1814_2800 325
658 3300046663 Ga0495635_0047428 Ga0495635_0047428_978_2033 325
659 3300046663 Ga0495635_0082131 Ga0495635_0082131_696_1739 325
660 3300046675 Ga0495657_0009618 Ga0495657_0009618_2760_3815 325
661 3300046675 Ga0495657_0053616 Ga0495657_0053616_805_1791 325
662 3300046675 Ga0495657_0124448 Ga0495657_0124448_29_1072 325
663 3300046680 Ga0495646_0013457 Ga0495646_0013457_1953_3008 325
664 3300046680 Ga0495646_0076361 Ga0495646_0076361_177_1163 325
665 3300046683 Ga0495658_0005678 Ga0495658_0005678_3158_4144 325
666 3300046689 Ga0495613_0004101 Ga0495613_0004101_6500_7486 325
667 3300046690 Ga0495624_0006961 Ga0495624_0006961_139_1125 325
668 3300046809 Ga0495600_0015949 Ga0495600_0015949_1391_2368 325
669 3300046809 Ga0495600_0018385 Ga0495600_0018385_2007_2993 325
670 3300046809 Ga0495600_0047287 Ga0495600_0047287_851_1906 325
671 3300047315 Ga0495581_0002805 Ga0495581_0002805_3759_4745 325
672 3300047317 Ga0495604_0009430 Ga0495604_0009430_1995_3050 325
673 3300047317 Ga0495604_0041144 Ga0495604_0041144_1781_2767 325
674 3300047319 Ga0495674_0008594 Ga0495674_0008594_6195_7238 325
675 3300047319 Ga0495674_0010971 Ga0495674_0010971_931_1986 325
676 3300047319 Ga0495674_0165465 Ga0495674_0165465_150_1136 325
677 3300047321 Ga0495676_0002041 Ga0495676_0002041_6502_7488 325
678 3300047322 Ga0495680_0004252 Ga0495680_0004252_6966_8009 325
679 3300047322 Ga0495680_0012179 Ga0495680_0012179_4595_5581 325
680 3300047471 Ga0495684_0002738 Ga0495684_0002738_2083_3138 325
681 3300047471 Ga0495684_0006287 Ga0495684_0006287_878_1864 325
682 3300047673 Ga0495593_0001836 Ga0495593_0001836_4180_5166 325
683 3300048088 Ga0495602_0059786 Ga0495602_0059786_373_1428 325
684 3300048089 Ga0495614_0019808 Ga0495614_0019808_227_1213 325
685 3300048904 Ga0496101_0009188 Ga0496101_0009188_4223_5266 325
686 3300048907 Ga0496104_0004466 Ga0496104_0004466_9207_10250 325
687 3300048907 Ga0496104_0538909 Ga0496104_0538909_56_1039 325
688 3300048908 Ga0496105_0001569 Ga0496105_0001569_10174_11217 325
689 3300048908 Ga0496105_0144081 Ga0496105_0144081_300_1277 325
690 3300048909 Ga0496106_0004661 Ga0496106_0004661_7097_8140 325
691 3300048910 Ga0496107_0028637 Ga0496107_0028637_1974_3017 325
692 3300048911 Ga0496108_0036583 Ga0496108_0036583_2637_3680 325
693 3300048912 Ga0496109_0007622 Ga0496109_0007622_4077_5120 325
694 3300048913 Ga0496110_0046655 Ga0496110_0046655_2213_3256 325
695 3300048913 Ga0496110_0096919 Ga0496110_0096919_1418_2416 325
696 3300048913 Ga0496110_0321171 Ga0496110_0321171_356_1396 325
697 3300048914 Ga0496111_0011955 Ga0496111_0011955_4150_5193 325
698 3300048914 Ga0496111_0014669 Ga0496111_0014669_2368_3402 325
699 3300048915 Ga0496112_0109544 Ga0496112_0109544_668_1702 325
700 3300048916 Ga0496113_0020403 Ga0496113_0020403_1904_2959 325
701 3300048916 Ga0496113_0062447 Ga0496113_0062447_928_1971 325
702 3300048916 Ga0496113_0072702 Ga0496113_0072702_425_1459 325
703 3300048917 Ga0496114_0001831 Ga0496114_0001831_9570_10613 325
704 3300048917 Ga0496114_0148873 Ga0496114_0148873_608_1594 325
705 3300048918 Ga0496115_0001725 Ga0496115_0001725_7245_8288 325
706 3300048918 Ga0496115_0056458 Ga0496115_0056458_668_1654 325
707 3300049581 Ga0501047_0007455 Ga0501047_0007455_4643_5692 325
708 3300049583 Ga0501067_0069396 Ga0501067_0069396_509_1552 325
709 3300049585 Ga0501069_0078624 Ga0501069_0078624_38_1087 325
710 3300049588 Ga0501072_0148604 Ga0501072_0148604_744_1781 325
711 3300049590 Ga0501074_0019804 Ga0501074_0019804_2611_3660 325
712 3300049593 Ga0501077_0082185 Ga0501077_0082185_266_1306 325
713 3300049741 Ga0501079_0185868 Ga0501079_0185868_592_1572 325
714 3300049742 Ga0501080_0153800 Ga0501080_0153800_479_1528 325
715 3300049743 Ga0501081_0054341 Ga0501081_0054341_959_1996 325
716 3300050512 nmdc:mga0n895_128747_c1 nmdc:mga0n895_128747_c1_389_1432 325
717 3300050514 nmdc:mga08x19_101069_c1 nmdc:mga08x19_101069_c1_842_1885 325
718 3300053077 Ga0495601_0108345 Ga0495601_0108345_253_1239 325
719 3300053078 Ga0495612_0015066 Ga0495612_0015066_1870_2925 325
720 3300053084 Ga0495595_0002816 Ga0495595_0002816_3385_4440 325
721 3300053085 Ga0495619_0003046 Ga0495619_0003046_8599_9576 325
722 3300053085 Ga0495619_0058131 Ga0495619_0058131_1090_2076 325
723 3300053085 Ga0495619_0063950 Ga0495619_0063950_1305_2342 325
724 3300053085 Ga0495619_0280505 Ga0495619_0280505_149_1135 325
725 3300054114 Ga0501084_0285733 Ga0501084_0285733_22_1008 325
726 3300061719 Ga0466962_0004523 Ga0466962_0004523_3771_4814 325
727 3300061734 Ga0530510_0069871 Ga0530510_0069871_603_1640 325
728 3300005339 Ga0070660_100044156 Ga0070660_1000441563 326
729 3300005345 Ga0070692_10016243 Ga0070692_100162432 326
730 3300005366 Ga0070659_100006539 Ga0070659_1000065395 326
731 3300005458 Ga0070681_10105644 Ga0070681_101056442 326
732 3300005564 Ga0070664_100272162 Ga0070664_1002721622 326
733 3300009093 Ga0105240_10031253 Ga0105240_100312533 326
734 3300025919 Ga0207657_10036543 Ga0207657_100365433 326
735 3300025923 Ga0207681_10279254 Ga0207681_102792542 326
736 3300025929 Ga0207664_10000060 Ga0207664_1000006070 326
737 3300025932 Ga0207690_10000117 Ga0207690_1000011713 326
738 3300028558 Ga0265326_10000024 Ga0265326_1000002434 326
739 3300028563 Ga0265319_1000116 Ga0265319_100011614 326
740 3300028573 Ga0265334_10000078 Ga0265334_1000007836 326
741 3300028666 Ga0265336_10003815 Ga0265336_100038153 326
742 3300028800 Ga0265338_10098748 Ga0265338_100987482 326
743 3300029957 Ga0265324_10003299 Ga0265324_100032996 326
744 3300048904 Ga0496101_0004996 Ga0496101_0004996_44_1159 326
745 3300048912 Ga0496109_0023298 Ga0496109_0023298_1968_3083 326
746 3300048925 Ga0496122_0033730 Ga0496122_0033730_2467_3450 326
747 3300021388 Ga0213875_10015454 Ga0213875_100154545 327
748 3300037853 Ga0436364_0457216 Ga0436364_0457216_2951_3949 327
749 3300038443 Ga0395901_0232358 Ga0395901_0232358_160_1143 327
750 3300045836 Ga0466958_0027368 Ga0466958_0027368_2275_3258 327
751 3300049569 Ga0501032_0022440 Ga0501032_0022440_2859_3965 327
752 3300049573 Ga0501037_0026648 Ga0501037_0026648_2214_3320 327
753 3300049574 Ga0501038_0037491 Ga0501038_0037491_2336_3442 327
754 3300049578 Ga0501042_0037517 Ga0501042_0037517_2163_3269 327
755 3300049579 Ga0501043_0003201 Ga0501043_0003201_6441_7547 327
756 3300049583 Ga0501067_0012878 Ga0501067_0012878_3320_4426 327
757 3300049585 Ga0501069_0029114 Ga0501069_0029114_1340_2446 327
758 3300049589 Ga0501073_0038032 Ga0501073_0038032_514_1620 327
759 3300049741 Ga0501079_0048229 Ga0501079_0048229_795_1901 327
760 3300049744 Ga0501083_0008535 Ga0501083_0008535_246_1352 327
761 3300049823 Ga0501044_0036460 Ga0501044_0036460_1632_2738 327
762 3300053104 Ga0500556_0000593 Ga0500556_0000593_6626_7741 327
763 3300053153 Ga0500616_0004992 Ga0500616_0004992_231_1346 327
764 3300060353 Ga0501082_0048052 Ga0501082_0048052_1083_2189 327
765 3300005337 Ga0070682_100063203 Ga0070682_1000632031 328
766 3300005338 Ga0068868_100025245 Ga0068868_1000252454 328
767 3300005458 Ga0070681_10019078 Ga0070681_100190784 328
768 3300005459 Ga0068867_100006031 Ga0068867_1000060315 328
769 3300005530 Ga0070679_100000312 Ga0070679_10000031217 328
770 3300005530 Ga0070679_100068574 Ga0070679_1000685742 328
771 3300005539 Ga0068853_100002766 Ga0068853_10000276611 328
772 3300005547 Ga0070693_100006705 Ga0070693_1000067056 328
773 3300005614 Ga0068856_100026366 Ga0068856_1000263663 328
774 3300005615 Ga0070702_100010129 Ga0070702_1000101295 328
775 3300005618 Ga0068864_100058920 Ga0068864_1000589202 328
776 3300005718 Ga0068866_10005928 Ga0068866_100059283 328
777 3300005841 Ga0068863_100024278 Ga0068863_1000242782 328
778 3300005937 Ga0081455_10149621 Ga0081455_101496212 328
779 3300005985 Ga0081539_10009624 Ga0081539_100096244 328
780 3300006173 Ga0070716_100135735 Ga0070716_1001357352 328
781 3300009093 Ga0105240_10324663 Ga0105240_103246632 328
782 3300009101 Ga0105247_10054722 Ga0105247_100547222 328
783 3300009147 Ga0114129_10765283 Ga0114129_107652831 328
784 3300009148 Ga0105243_10086529 Ga0105243_100865292 328
785 3300009176 Ga0105242_10000194 Ga0105242_1000019435 328
786 3300009176 Ga0105242_10000819 Ga0105242_1000081910 328
787 3300009176 Ga0105242_10193474 Ga0105242_101934742 328
788 3300012507 Ga0157342_1005311 Ga0157342_10053111 328
789 3300013104 Ga0157370_10014865 Ga0157370_100148654 328
790 3300025899 Ga0207642_10041359 Ga0207642_100413592 328
791 3300025912 Ga0207707_10018013 Ga0207707_100180134 328
792 3300025913 Ga0207695_10268436 Ga0207695_102684362 328
793 3300025921 Ga0207652_10000483 Ga0207652_1000048317 328
794 3300025921 Ga0207652_10131242 Ga0207652_101312422 328
795 3300025934 Ga0207686_10000033 Ga0207686_10000033124 328
796 3300025934 Ga0207686_10000428 Ga0207686_1000042823 328
797 3300025939 Ga0207665_10047824 Ga0207665_100478242 328
798 3300025940 Ga0207691_10001039 Ga0207691_1000103924 328
799 3300026041 Ga0207639_10005404 Ga0207639_100054049 328
800 3300026078 Ga0207702_10017650 Ga0207702_100176505 328
801 3300026089 Ga0207648_10007855 Ga0207648_100078556 328
802 3300041491 Ga0451833_0016179 Ga0451833_0016179_569_1558 328
803 3300044901 Ga0466960_0064375 Ga0466960_0064375_603_1592 328
804 3300045976 Ga0466967_0013454 Ga0466967_0013454_4935_5957 328
805 3300046459 Ga0495629_0009397 Ga0495629_0009397_5033_6022 328
806 3300046460 Ga0495638_0065726 Ga0495638_0065726_1168_2157 328
807 3300046461 Ga0495641_0000003 Ga0495641_0000003_221470_222462 328
808 3300046473 Ga0495582_0000029 Ga0495582_0000029_29472_30461 328
809 3300046499 Ga0495594_0000003 Ga0495594_0000003_72000_72989 328
810 3300046557 Ga0495622_0000714 Ga0495622_0000714_13466_14455 328
811 3300046615 Ga0495656_0000241 Ga0495656_0000241_564_1553 328
812 3300046683 Ga0495658_0000026 Ga0495658_0000026_47482_48471 328
813 3300046684 Ga0495669_0000260 Ga0495669_0000260_103_1095 328
814 3300047322 Ga0495680_0034820 Ga0495680_0034820_959_1948 328
815 3300048904 Ga0496101_0088697 Ga0496101_0088697_118_1104 328
816 3300048905 Ga0496102_0000146 Ga0496102_0000146_4321_5310 328
817 3300048906 Ga0496103_0000008 Ga0496103_0000008_323840_324829 328
818 3300048906 Ga0496103_0112031 Ga0496103_0112031_244_1230 328
819 3300048910 Ga0496107_0043697 Ga0496107_0043697_1819_2805 328
820 3300048911 Ga0496108_0059129 Ga0496108_0059129_2202_3188 328
821 3300048912 Ga0496109_0005575 Ga0496109_0005575_1015_2142 328
822 3300048913 Ga0496110_0151465 Ga0496110_0151465_743_1729 328
823 3300048914 Ga0496111_0096713 Ga0496111_0096713_55_1044 328
824 3300048914 Ga0496111_0183989 Ga0496111_0183989_103_1089 328
825 3300048915 Ga0496112_0212348 Ga0496112_0212348_640_1626 328
826 3300048915 Ga0496112_0301760 Ga0496112_0301760_109_1113 328
827 3300048917 Ga0496114_0000014 Ga0496114_0000014_148601_149590 328
828 3300048917 Ga0496114_0026518 Ga0496114_0026518_681_1670 328
829 3300048918 Ga0496115_0005472 Ga0496115_0005472_6203_7192 328
830 3300049578 Ga0501042_0112800 Ga0501042_0112800_369_1358 328
831 3300049590 Ga0501074_0146388 Ga0501074_0146388_24_1127 328
832 3300049742 Ga0501080_0245961 Ga0501080_0245961_390_1493 328
833 3300053083 Ga0495655_0000001 Ga0495655_0000001_87825_88814 328
834 3300053083 Ga0495655_0001262 Ga0495655_0001262_2118_3107 328
835 3300053085 Ga0495619_0000534 Ga0495619_0000534_3357_4346 328
836 3300053123 Ga0500614_000026 Ga0500614_000026_12389_13381 328
837 3300053129 Ga0500628_000017 Ga0500628_000017_8453_9442 328
838 3300003373 JGI25407J50210_10013832 JGI25407J50210_100138321 329
839 3300005441 Ga0070700_100080988 Ga0070700_1000809882 329
840 3300005981 Ga0081538_10000219 Ga0081538_100002192 329
841 3300005981 Ga0081538_10000241 Ga0081538_1000024145 329
842 3300005981 Ga0081538_10011818 Ga0081538_100118183 329
843 3300006844 Ga0075428_100047387 Ga0075428_1000473874 329
844 3300006846 Ga0075430_100000824 Ga0075430_1000008246 329
845 3300006847 Ga0075431_100002897 Ga0075431_1000028976 329
846 3300009094 Ga0111539_10102572 Ga0111539_101025723 329
847 3300026075 Ga0207708_10109055 Ga0207708_101090552 329
848 3300027907 Ga0207428_10041096 Ga0207428_100410962 329
849 3300027907 Ga0207428_10214585 Ga0207428_102145852 329
850 3300031995 Ga0307409_100090481 Ga0307409_1000904812 329
851 3300038443 Ga0395901_0472338 Ga0395901_0472338_129_1127 329
852 3300044694 Ga0466963_0025380 Ga0466963_0025380_851_1840 329
853 3300044719 Ga0466971_0013005 Ga0466971_0013005_1140_2129 329
854 3300044842 Ga0466957_0088050 Ga0466957_0088050_126_1115 329
855 3300045976 Ga0466967_0007145 Ga0466967_0007145_5582_6571 329
856 3300045976 Ga0466967_0010564 Ga0466967_0010564_3475_4464 329
857 3300045976 Ga0466967_0016955 Ga0466967_0016955_3909_4898 329
858 3300045976 Ga0466967_0027982 Ga0466967_0027982_1646_2635 329
859 3300045976 Ga0466967_0064480 Ga0466967_0064480_111_1100 329
860 3300045976 Ga0466967_0066201 Ga0466967_0066201_2014_3003 329
861 3300046477 Ga0495664_0000007 Ga0495664_0000007_274858_275847 329
862 3300046511 Ga0495608_0124169 Ga0495608_0124169_179_1168 329
863 3300046515 Ga0495620_0099892 Ga0495620_0099892_156_1148 329
864 3300046809 Ga0495600_0041962 Ga0495600_0041962_1484_2473 329
865 3300049573 Ga0501037_0301482 Ga0501037_0301482_89_1084 329
866 3300049587 Ga0501071_0126080 Ga0501071_0126080_68_1063 329
867 3300049592 Ga0501076_0233089 Ga0501076_0233089_61_1056 329
868 3300050508 nmdc:mga09592_69165_c1 nmdc:mga09592_69165_c1_746_1735 329
869 3300050509 nmdc:mga0qj67_1444_c1 nmdc:mga0qj67_1444_c1_5467_6456 329
870 3300050509 nmdc:mga0qj67_37429_c1 nmdc:mga0qj67_37429_c1_2382_3512 329
871 3300050510 nmdc:mga06r32_13083_c1 nmdc:mga06r32_13083_c1_1317_2306 329
872 3300050511 nmdc:mga08y16_143200_c1 nmdc:mga08y16_143200_c1_1352_2347 329
873 3300061734 Ga0530510_0099208 Ga0530510_0099208_898_1893 329
874 3300005329 Ga0070683_100001429 Ga0070683_1000014297 330
875 3300005366 Ga0070659_100037986 Ga0070659_1000379862 330
876 3300005458 Ga0070681_10028864 Ga0070681_100288642 330
877 3300005535 Ga0070684_100011922 Ga0070684_1000119225 330
878 3300005535 Ga0070684_100138659 Ga0070684_1001386592 330
879 3300005547 Ga0070693_100169542 Ga0070693_1001695422 330
880 3300005616 Ga0068852_100006184 Ga0068852_1000061843 330
881 3300013104 Ga0157370_10146104 Ga0157370_101461042 330
882 3300020082 Ga0206353_11805222 Ga0206353_118052222 330
883 3300021384 Ga0213876_10005317 Ga0213876_100053172 330
884 3300025912 Ga0207707_10068277 Ga0207707_100682772 330
885 3300025917 Ga0207660_10065864 Ga0207660_100658642 330
886 3300025919 Ga0207657_10043544 Ga0207657_100435442 330
887 3300025921 Ga0207652_10040831 Ga0207652_100408313 330
888 3300025932 Ga0207690_10048283 Ga0207690_100482832 330
889 3300025944 Ga0207661_10037197 Ga0207661_100371972 330
890 3300026041 Ga0207639_10047900 Ga0207639_100479002 330
891 3300026116 Ga0207674_10116495 Ga0207674_101164952 330
892 3300026142 Ga0207698_10018265 Ga0207698_100182652 330
893 3300031995 Ga0307409_100033327 Ga0307409_1000333273 330
894 3300039437 Ga0436365_1574649 Ga0436365_1574649_11340_12365 330
895 3300044901 Ga0466960_0095012 Ga0466960_0095012_169_1161 330
896 3300000549 LJQas_1008039 LJQas_10080391 331
897 3300061719 Ga0466962_0003841 Ga0466962_0003841_5129_6550 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03462

PCRF

PCRF domain

32

220

0.97

PF00472

RF-1

RF-1 domain

227

338

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4j-assembly1.cif.gz_v structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9609 86 184
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9045 79 186
6boh-assembly2.cif.gz_OC antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.8818 79 186
6b4v-assembly1.cif.gz_JA antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.8753 79 330
5o2r-assembly1.cif.gz_v cryo-em structure of the proline-rich antimicrobial peptide api137 bound to the terminating ribosome 0.8743 86 325
ID Description Score Start End Superfamily
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.984 83 184 3.30.70.1660
af_A0A1D6IEG8_11_112_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9651 83 184 3.30.70.1660
1gqeA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9646 84 325 3.30.70.1660
af_P30775_152_262_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9625 84 186 3.30.70.1660
af_Q54RE7_180_291_3.30.70.1660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9496 82 193 3.30.70.1660
ID Description Score Start End GO Terms
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9864 76 177 GO:0006415
AF-X1A613-F1-model_v4 Peptide chain release factor domain-containing protein 0.9496 76 177 GO:0006415
AF-A0A1V5PSR0-F1-model_v4 Peptide chain release factor 2 (RF-2) 0.9448 21 324 GO:0005737
GO:0016149
AF-K1SNK6-F1-model_v4 Peptide chain release factor 2 0.9448 30 152 GO:0006415
AF-A0A1Y2CA51-F1-model_v4 PCRF-domain-containing protein 0.9424 16 184 GO:0006415

Feature Viewer

pLDDT pTM Quality
87.98 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map