F485058
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 343 | 896 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_37429_c1|nmdc:mga0qj67_37429_c1_2382_3512 |
| Length | 376 |
| Sequence | LASIADLPTPQRLTAIRDQLTPLIESADPGALAEQAGALELEMGAPGFWDDQERAQQVSSEHARVTRRLEQMRSLEADVDDLEGLAELAAEDASIAEXXXXQLAAVEARLSDLELERLFSGRYDRGDALVAVNAGAGGTDAQDWAEMVLRMEMRWAERRGFKVELLEVSEGEEAGIKSATFRVSGENAYGLYSAEKGVHRLVRLSPFDSANRRQTSFAGVEVSPVIEDAGEVEIDADDLQVDTYRASGAGGQHVNKTDSAVRITHRPSGIVVQCQNERSQTQNRETAMKMLRSKLVELRERERAEELARERGDAQDVNFGSQIRSYVLHPYTMVKDHRTNFEVGNAQGVLEGDLDGFIRAELLRAAGRSAGAGGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 337 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 343 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0.78 |
| Rhizoplane | 9.03 |
| Rhizosphere | 86.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1008039 | 3300000549 | Bacteria | 1291 |
| 2 | JGI24738J21930_10008605 | 3300002075 | Bacteria | 2318 |
| 3 | JGI25406J46586_10014128 | 3300003203 | Bacteria | 3403 |
| 4 | JGI25406J46586_10016276 | 3300003203 | Bacteria | 3104 |
| 5 | JGI25407J50210_10005129 | 3300003373 | Bacteria | 3211 |
| 6 | JGI25407J50210_10013832 | 3300003373 | Bacteria | 2076 |
| 7 | JGI25407J50210_10014324 | 3300003373 | Bacteria | 2044 |
| 8 | Ga0070658_10064661 | 3300005327 | Bacteria | 2984 |
| 9 | Ga0070658_10245389 | 3300005327 | Bacteria | 1519 |
| 10 | Ga0070683_100001429 | 3300005329 | Bacteria | 18327 |
| 11 | Ga0070683_100006385 | 3300005329 | Bacteria | 9886 |
| 12 | Ga0070683_100008554 | 3300005329 | Bacteria | 8698 |
| 13 | Ga0070683_100030210 | 3300005329 | Bacteria | 4914 |
| 14 | Ga0070670_100090285 | 3300005331 | Bacteria | 2633 |
| 15 | Ga0068869_100066940 | 3300005334 | Bacteria | 2648 |
| 16 | Ga0070666_10029341 | 3300005335 | Bacteria | 3615 |
| 17 | Ga0070680_100081060 | 3300005336 | Bacteria | 2677 |
| 18 | Ga0070680_100101413 | 3300005336 | Bacteria | 2389 |
| 19 | Ga0070680_100143896 | 3300005336 | Bacteria | 2000 |
| 20 | Ga0070680_100301560 | 3300005336 | Bacteria | 1359 |
| 21 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 22 | Ga0070682_100002116 | 3300005337 | Bacteria | 11030 |
| 23 | Ga0070682_100014100 | 3300005337 | Bacteria | 4614 |
| 24 | Ga0070682_100063203 | 3300005337 | Bacteria | 2346 |
| 25 | Ga0070682_100080129 | 3300005337 | Bacteria | 2110 |
| 26 | Ga0070682_100080676 | 3300005337 | Bacteria | 2104 |
| 27 | Ga0070682_100212589 | 3300005337 | Bacteria | 1371 |
| 28 | Ga0068868_100005956 | 3300005338 | Bacteria | 8599 |
| 29 | Ga0068868_100025245 | 3300005338 | Bacteria | 4517 |
| 30 | Ga0070660_100001878 | 3300005339 | Bacteria | 14467 |
| 31 | Ga0070660_100002874 | 3300005339 | Bacteria | 11862 |
| 32 | Ga0070660_100044156 | 3300005339 | Bacteria | 3407 |
| 33 | Ga0070661_100000023 | 3300005344 | Bacteria | 123104 |
| 34 | Ga0070661_100029830 | 3300005344 | Bacteria | 3938 |
| 35 | Ga0070661_100036846 | 3300005344 | Bacteria | 3555 |
| 36 | Ga0070692_10016243 | 3300005345 | Bacteria | 3540 |
| 37 | Ga0070668_100015307 | 3300005347 | Bacteria | 5731 |
| 38 | Ga0070668_100116183 | 3300005347 | Bacteria | 2133 |
| 39 | Ga0070675_100000053 | 3300005354 | Bacteria | 70601 |
| 40 | Ga0070675_100195855 | 3300005354 | Bacteria | 1752 |
| 41 | Ga0070674_100000082 | 3300005356 | Bacteria | 44418 |
| 42 | Ga0070674_100070535 | 3300005356 | Bacteria | 2469 |
| 43 | Ga0070674_100158725 | 3300005356 | Bacteria | 1714 |
| 44 | Ga0070688_100000300 | 3300005365 | Bacteria | 25290 |
| 45 | Ga0070688_100000630 | 3300005365 | Bacteria | 17586 |
| 46 | Ga0070688_100060783 | 3300005365 | Bacteria | 2387 |
| 47 | Ga0070659_100006539 | 3300005366 | Bacteria | 8417 |
| 48 | Ga0070659_100024338 | 3300005366 | Bacteria | 4641 |
| 49 | Ga0070659_100037986 | 3300005366 | Bacteria | 3754 |
| 50 | Ga0070667_100000695 | 3300005367 | Bacteria | 32405 |
| 51 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 52 | Ga0070713_100160693 | 3300005436 | Bacteria | 2005 |
| 53 | Ga0070711_100092307 | 3300005439 | Bacteria | 2184 |
| 54 | Ga0070711_100247965 | 3300005439 | Bacteria | 1395 |
| 55 | Ga0070705_100054509 | 3300005440 | Bacteria | 2346 |
| 56 | Ga0070700_100080988 | 3300005441 | Bacteria | 2096 |
| 57 | Ga0070700_100272372 | 3300005441 | Bacteria | 1224 |
| 58 | Ga0070663_100023142 | 3300005455 | Bacteria | 4161 |
| 59 | Ga0070678_100007927 | 3300005456 | Bacteria | 6325 |
| 60 | Ga0070662_100000016 | 3300005457 | Bacteria | 105820 |
| 61 | Ga0070662_100068086 | 3300005457 | Bacteria | 2616 |
| 62 | Ga0070662_100093451 | 3300005457 | Bacteria | 2263 |
| 63 | Ga0070681_10010625 | 3300005458 | Bacteria | 9099 |
| 64 | Ga0070681_10013721 | 3300005458 | Bacteria | 8066 |
| 65 | Ga0070681_10019078 | 3300005458 | Bacteria | 6863 |
| 66 | Ga0070681_10028864 | 3300005458 | Bacteria | 5574 |
| 67 | Ga0070681_10056580 | 3300005458 | Bacteria | 3903 |
| 68 | Ga0070681_10105644 | 3300005458 | Bacteria | 2758 |
| 69 | Ga0068867_100006031 | 3300005459 | Bacteria | 8588 |
| 70 | Ga0068867_100054845 | 3300005459 | Bacteria | 2945 |
| 71 | Ga0070685_10000282 | 3300005466 | Bacteria | 32605 |
| 72 | Ga0070685_10000320 | 3300005466 | Bacteria | 29816 |
| 73 | Ga0070707_100229613 | 3300005468 | Bacteria | 1807 |
| 74 | Ga0070679_100000312 | 3300005530 | Bacteria | 41159 |
| 75 | Ga0070679_100014166 | 3300005530 | Bacteria | 7650 |
| 76 | Ga0070679_100031669 | 3300005530 | Bacteria | 5227 |
| 77 | Ga0070679_100033291 | 3300005530 | Bacteria | 5103 |
| 78 | Ga0070679_100068574 | 3300005530 | Bacteria | 3538 |
| 79 | Ga0070684_100011922 | 3300005535 | Bacteria | 6942 |
| 80 | Ga0070684_100023464 | 3300005535 | Bacteria | 5161 |
| 81 | Ga0070684_100024068 | 3300005535 | Bacteria | 5104 |
| 82 | Ga0070684_100024149 | 3300005535 | Bacteria | 5096 |
| 83 | Ga0070684_100025949 | 3300005535 | Bacteria | 4930 |
| 84 | Ga0070684_100038133 | 3300005535 | Bacteria | 4126 |
| 85 | Ga0070684_100091076 | 3300005535 | Bacteria | 2712 |
| 86 | Ga0070684_100138659 | 3300005535 | Bacteria | 2198 |
| 87 | Ga0070697_100097586 | 3300005536 | Bacteria | 2438 |
| 88 | Ga0068853_100002766 | 3300005539 | Bacteria | 13247 |
| 89 | Ga0070686_100242430 | 3300005544 | Bacteria | 1313 |
| 90 | Ga0070693_100006705 | 3300005547 | Bacteria | 5592 |
| 91 | Ga0070693_100169542 | 3300005547 | Bacteria | 1397 |
| 92 | Ga0070665_100000244 | 3300005548 | Bacteria | 90284 |
| 93 | Ga0070665_100005026 | 3300005548 | Bacteria | 13720 |
| 94 | Ga0070665_100017879 | 3300005548 | Bacteria | 7118 |
| 95 | Ga0070665_100223482 | 3300005548 | Bacteria | 1884 |
| 96 | Ga0070665_100279050 | 3300005548 | Bacteria | 1672 |
| 97 | Ga0070704_100028529 | 3300005549 | Bacteria | 3715 |
| 98 | Ga0070704_100148947 | 3300005549 | Bacteria | 1837 |
| 99 | Ga0068855_100046966 | 3300005563 | Bacteria | 5103 |
| 100 | Ga0068855_100204032 | 3300005563 | Bacteria | 2225 |
| 101 | Ga0070664_100128239 | 3300005564 | Bacteria | 2227 |
| 102 | Ga0070664_100272162 | 3300005564 | Bacteria | 1526 |
| 103 | Ga0068857_100058998 | 3300005577 | Bacteria | 3408 |
| 104 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 105 | Ga0068856_100001194 | 3300005614 | Bacteria | 27371 |
| 106 | Ga0068856_100026366 | 3300005614 | Bacteria | 5667 |
| 107 | Ga0068856_100043149 | 3300005614 | Bacteria | 4437 |
| 108 | Ga0068856_100173482 | 3300005614 | Bacteria | 2168 |
| 109 | Ga0068856_100184340 | 3300005614 | Bacteria | 2101 |
| 110 | Ga0070702_100010129 | 3300005615 | Bacteria | 4633 |
| 111 | Ga0068852_100000296 | 3300005616 | Bacteria | 33429 |
| 112 | Ga0068852_100006184 | 3300005616 | Bacteria | 8632 |
| 113 | Ga0068852_100044814 | 3300005616 | Bacteria | 3760 |
| 114 | Ga0068852_100239073 | 3300005616 | Bacteria | 1734 |
| 115 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 116 | Ga0068864_100058920 | 3300005618 | Bacteria | 3321 |
| 117 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 118 | Ga0068866_10005928 | 3300005718 | Bacteria | 5080 |
| 119 | Ga0068861_100002566 | 3300005719 | Bacteria | 11872 |
| 120 | Ga0068851_10000656 | 3300005834 | Bacteria | 14770 |
| 121 | Ga0068851_10019515 | 3300005834 | Bacteria | 3275 |
| 122 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 123 | Ga0068863_100024278 | 3300005841 | Bacteria | 5782 |
| 124 | Ga0068863_100339780 | 3300005841 | Bacteria | 1461 |
| 125 | Ga0068858_100000267 | 3300005842 | Bacteria | 55818 |
| 126 | Ga0068858_100001207 | 3300005842 | Bacteria | 26780 |
| 127 | Ga0068860_100130464 | 3300005843 | Bacteria | 2411 |
| 128 | Ga0068862_100008832 | 3300005844 | Bacteria | 8345 |
| 129 | Ga0081455_10003252 | 3300005937 | Bacteria | 18813 |
| 130 | Ga0081455_10027049 | 3300005937 | Bacteria | 5261 |
| 131 | Ga0081455_10028011 | 3300005937 | Bacteria | 5152 |
| 132 | Ga0081455_10055109 | 3300005937 | Bacteria | 3383 |
| 133 | Ga0081455_10057361 | 3300005937 | Bacteria | 3301 |
| 134 | Ga0081455_10149621 | 3300005937 | Bacteria | 1801 |
| 135 | Ga0081538_10000219 | 3300005981 | Bacteria | 64491 |
| 136 | Ga0081538_10000241 | 3300005981 | Bacteria | 61996 |
| 137 | Ga0081538_10002025 | 3300005981 | Bacteria | 20274 |
| 138 | Ga0081538_10003073 | 3300005981 | Bacteria | 15877 |
| 139 | Ga0081538_10003315 | 3300005981 | Bacteria | 15262 |
| 140 | Ga0081538_10004594 | 3300005981 | Bacteria | 12692 |
| 141 | Ga0081538_10011818 | 3300005981 | Bacteria | 7047 |
| 142 | Ga0081538_10016142 | 3300005981 | Bacteria | 5740 |
| 143 | Ga0081538_10021887 | 3300005981 | Bacteria | 4649 |
| 144 | Ga0081538_10046933 | 3300005981 | Bacteria | 2656 |
| 145 | Ga0081538_10047697 | 3300005981 | Bacteria | 2624 |
| 146 | Ga0081538_10077193 | 3300005981 | Bacteria | 1795 |
| 147 | Ga0081540_1002225 | 3300005983 | Bacteria | 15996 |
| 148 | Ga0081539_10001668 | 3300005985 | Bacteria | 35937 |
| 149 | Ga0081539_10001929 | 3300005985 | Bacteria | 31957 |
| 150 | Ga0081539_10002491 | 3300005985 | Bacteria | 25867 |
| 151 | Ga0081539_10009624 | 3300005985 | Bacteria | 8021 |
| 152 | Ga0081539_10017082 | 3300005985 | Bacteria | 5122 |
| 153 | Ga0075364_10188149 | 3300006051 | Bacteria | 1398 |
| 154 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 155 | Ga0070716_100135735 | 3300006173 | Bacteria | 1562 |
| 156 | Ga0070716_100217633 | 3300006173 | Bacteria | 1281 |
| 157 | Ga0070716_100224153 | 3300006173 | Bacteria | 1265 |
| 158 | Ga0070716_100263271 | 3300006173 | Bacteria | 1181 |
| 159 | Ga0070712_100001071 | 3300006175 | Bacteria | 16531 |
| 160 | Ga0070712_100003981 | 3300006175 | Bacteria | 9083 |
| 161 | Ga0070712_100056677 | 3300006175 | Bacteria | 2749 |
| 162 | Ga0070712_100186842 | 3300006175 | Bacteria | 1618 |
| 163 | Ga0070712_100343399 | 3300006175 | Bacteria | 1220 |
| 164 | Ga0097621_100365845 | 3300006237 | Bacteria | 1286 |
| 165 | Ga0075428_100023575 | 3300006844 | Bacteria | 6813 |
| 166 | Ga0075428_100047387 | 3300006844 | Bacteria | 4721 |
| 167 | Ga0075430_100000824 | 3300006846 | Bacteria | 24215 |
| 168 | Ga0075431_100000747 | 3300006847 | Bacteria | 28086 |
| 169 | Ga0075431_100002897 | 3300006847 | Bacteria | 16590 |
| 170 | Ga0075431_100230163 | 3300006847 | Bacteria | 1889 |
| 171 | Ga0075431_100257275 | 3300006847 | Bacteria | 1772 |
| 172 | Ga0075433_10001485 | 3300006852 | Bacteria | 17324 |
| 173 | Ga0075433_10015865 | 3300006852 | Bacteria | 6193 |
| 174 | Ga0075433_10018515 | 3300006852 | Bacteria | 5792 |
| 175 | Ga0075434_100034518 | 3300006871 | Bacteria | 4995 |
| 176 | Ga0075434_100137545 | 3300006871 | Bacteria | 2462 |
| 177 | Ga0068865_100000104 | 3300006881 | Bacteria | 43423 |
| 178 | Ga0068865_100034775 | 3300006881 | Bacteria | 3383 |
| 179 | Ga0075436_100228362 | 3300006914 | Bacteria | 1322 |
| 180 | Ga0079104_1000337 | 3300006946 | Bacteria | 57374 |
| 181 | Ga0079104_1005865 | 3300006946 | Bacteria | 4790 |
| 182 | Ga0079104_1028242 | 3300006946 | Bacteria | 1427 |
| 183 | Ga0105240_10031253 | 3300009093 | Bacteria | 6907 |
| 184 | Ga0105240_10324663 | 3300009093 | Bacteria | 1753 |
| 185 | Ga0111539_10044466 | 3300009094 | Bacteria | 5320 |
| 186 | Ga0111539_10065301 | 3300009094 | Bacteria | 4301 |
| 187 | Ga0111539_10078234 | 3300009094 | Bacteria | 3891 |
| 188 | Ga0111539_10102572 | 3300009094 | Bacteria | 3358 |
| 189 | Ga0105245_10000236 | 3300009098 | Bacteria | 52639 |
| 190 | Ga0105245_10000545 | 3300009098 | Bacteria | 34359 |
| 191 | Ga0105245_10002692 | 3300009098 | Bacteria | 15989 |
| 192 | Ga0105245_10006569 | 3300009098 | Bacteria | 10206 |
| 193 | Ga0105245_10042529 | 3300009098 | Bacteria | 4054 |
| 194 | Ga0105245_10108988 | 3300009098 | Bacteria | 2573 |
| 195 | Ga0105245_10240515 | 3300009098 | Bacteria | 1754 |
| 196 | Ga0105245_10247711 | 3300009098 | Bacteria | 1730 |
| 197 | Ga0105245_10282589 | 3300009098 | Bacteria | 1623 |
| 198 | Ga0105247_10054722 | 3300009101 | Bacteria | 2462 |
| 199 | Ga0105247_10067293 | 3300009101 | Bacteria | 2231 |
| 200 | Ga0114129_10014103 | 3300009147 | Bacteria | 11384 |
| 201 | Ga0114129_10124004 | 3300009147 | Bacteria | 3553 |
| 202 | Ga0114129_10215708 | 3300009147 | Bacteria | 2592 |
| 203 | Ga0114129_10411207 | 3300009147 | Bacteria | 1781 |
| 204 | Ga0114129_10765283 | 3300009147 | Bacteria | 1235 |
| 205 | Ga0105243_10014354 | 3300009148 | Bacteria | 5995 |
| 206 | Ga0105243_10046579 | 3300009148 | Bacteria | 3412 |
| 207 | Ga0105243_10086529 | 3300009148 | Bacteria | 2571 |
| 208 | Ga0105243_10297599 | 3300009148 | Bacteria | 1461 |
| 209 | Ga0105242_10000194 | 3300009176 | Bacteria | 47231 |
| 210 | Ga0105242_10000819 | 3300009176 | Bacteria | 24165 |
| 211 | Ga0105242_10132675 | 3300009176 | Bacteria | 2152 |
| 212 | Ga0105242_10193474 | 3300009176 | Bacteria | 1802 |
| 213 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 214 | Ga0105238_10040063 | 3300009551 | Bacteria | 4749 |
| 215 | Ga0105238_10081390 | 3300009551 | Bacteria | 3228 |
| 216 | Ga0105249_10148229 | 3300009553 | Bacteria | 2256 |
| 217 | Ga0105249_10183328 | 3300009553 | Bacteria | 2038 |
| 218 | Ga0105239_10130675 | 3300010375 | Bacteria | 2793 |
| 219 | Ga0105239_10351710 | 3300010375 | Bacteria | 1664 |
| 220 | Ga0105239_10374451 | 3300010375 | Bacteria | 1609 |
| 221 | Ga0105239_10392819 | 3300010375 | Bacteria | 1569 |
| 222 | Ga0157342_1005311 | 3300012507 | Bacteria | 1180 |
| 223 | Ga0157373_10093096 | 3300013100 | Bacteria | 2123 |
| 224 | Ga0157371_10005434 | 3300013102 | Bacteria | 10742 |
| 225 | Ga0157371_10049109 | 3300013102 | Bacteria | 2998 |
| 226 | Ga0157371_10050500 | 3300013102 | Bacteria | 2956 |
| 227 | Ga0157370_10014865 | 3300013104 | Bacteria | 7942 |
| 228 | Ga0157370_10069784 | 3300013104 | Bacteria | 3318 |
| 229 | Ga0157370_10140814 | 3300013104 | Bacteria | 2247 |
| 230 | Ga0157370_10146104 | 3300013104 | Bacteria | 2202 |
| 231 | Ga0157370_10160855 | 3300013104 | Bacteria | 2089 |
| 232 | Ga0157370_10286935 | 3300013104 | Bacteria | 1520 |
| 233 | Ga0157369_10001239 | 3300013105 | Bacteria | 31838 |
| 234 | Ga0157369_10003551 | 3300013105 | Bacteria | 18519 |
| 235 | Ga0157369_10033166 | 3300013105 | Bacteria | 5677 |
| 236 | Ga0157369_10193773 | 3300013105 | Bacteria | 2135 |
| 237 | Ga0157369_10195655 | 3300013105 | Bacteria | 2123 |
| 238 | Ga0157369_10342026 | 3300013105 | Bacteria | 1554 |
| 239 | Ga0157374_10001108 | 3300013296 | Bacteria | 23187 |
| 240 | Ga0157374_10451073 | 3300013296 | Bacteria | 1287 |
| 241 | Ga0157378_10289166 | 3300013297 | Bacteria | 1582 |
| 242 | Ga0163162_10044877 | 3300013306 | Bacteria | 4428 |
| 243 | Ga0157372_10000409 | 3300013307 | Bacteria | 47021 |
| 244 | Ga0157372_10031427 | 3300013307 | Bacteria | 5813 |
| 245 | Ga0157372_10035008 | 3300013307 | Bacteria | 5525 |
| 246 | Ga0157372_10068938 | 3300013307 | Bacteria | 3977 |
| 247 | Ga0157372_10080269 | 3300013307 | Bacteria | 3690 |
| 248 | Ga0157372_10100239 | 3300013307 | Bacteria | 3305 |
| 249 | Ga0157372_10176247 | 3300013307 | Bacteria | 2474 |
| 250 | Ga0157372_10478890 | 3300013307 | Bacteria | 1451 |
| 251 | Ga0157375_10106522 | 3300013308 | Bacteria | 2895 |
| 252 | Ga0157380_10000059 | 3300014326 | Bacteria | 62280 |
| 253 | Ga0157380_10002264 | 3300014326 | Bacteria | 12942 |
| 254 | Ga0182008_10083110 | 3300014497 | Bacteria | 1576 |
| 255 | Ga0157379_10023085 | 3300014968 | Bacteria | 5516 |
| 256 | Ga0157376_10176393 | 3300014969 | Bacteria | 1950 |
| 257 | Ga0157376_10212168 | 3300014969 | Bacteria | 1788 |
| 258 | Ga0206356_10112548 | 3300020070 | Bacteria | 1605 |
| 259 | Ga0206356_10303627 | 3300020070 | Bacteria | 2994 |
| 260 | Ga0206356_10601656 | 3300020070 | Bacteria | 5581 |
| 261 | Ga0206351_10463088 | 3300020077 | Bacteria | 1645 |
| 262 | Ga0206350_10365630 | 3300020080 | Bacteria | 1364 |
| 263 | Ga0206353_11406144 | 3300020082 | Bacteria | 1778 |
| 264 | Ga0206353_11805222 | 3300020082 | Bacteria | 1480 |
| 265 | Ga0213874_10000607 | 3300021377 | Bacteria | 7219 |
| 266 | Ga0213876_10004540 | 3300021384 | Bacteria | 7752 |
| 267 | Ga0213876_10005317 | 3300021384 | Bacteria | 7087 |
| 268 | Ga0213876_10007254 | 3300021384 | Bacteria | 6040 |
| 269 | Ga0213875_10000199 | 3300021388 | Bacteria | 61479 |
| 270 | Ga0213875_10015454 | 3300021388 | Bacteria | 3714 |
| 271 | Ga0224712_10009509 | 3300022467 | Bacteria | 2933 |
| 272 | Ga0207656_10002957 | 3300025321 | Bacteria | 5800 |
| 273 | Ga0207656_10102513 | 3300025321 | Bacteria | 1313 |
| 274 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 275 | Ga0207642_10024114 | 3300025899 | Bacteria | 2442 |
| 276 | Ga0207642_10040399 | 3300025899 | Bacteria | 2035 |
| 277 | Ga0207642_10041359 | 3300025899 | Bacteria | 2017 |
| 278 | Ga0207680_10010826 | 3300025903 | Bacteria | 4580 |
| 279 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 280 | Ga0207643_10147964 | 3300025908 | Bacteria | 1406 |
| 281 | Ga0207705_10112357 | 3300025909 | Bacteria | 2014 |
| 282 | Ga0207707_10018013 | 3300025912 | Bacteria | 6153 |
| 283 | Ga0207707_10023261 | 3300025912 | Bacteria | 5421 |
| 284 | Ga0207707_10068277 | 3300025912 | Bacteria | 3097 |
| 285 | Ga0207707_10333648 | 3300025912 | Bacteria | 1308 |
| 286 | Ga0207695_10268436 | 3300025913 | Bacteria | 1602 |
| 287 | Ga0207693_10000677 | 3300025915 | Bacteria | 30611 |
| 288 | Ga0207693_10001903 | 3300025915 | Bacteria | 18266 |
| 289 | Ga0207693_10002622 | 3300025915 | Bacteria | 15629 |
| 290 | Ga0207693_10258315 | 3300025915 | Bacteria | 1366 |
| 291 | Ga0207663_10229404 | 3300025916 | Bacteria | 1356 |
| 292 | Ga0207660_10027356 | 3300025917 | Bacteria | 3890 |
| 293 | Ga0207660_10064247 | 3300025917 | Bacteria | 2649 |
| 294 | Ga0207660_10065864 | 3300025917 | Bacteria | 2619 |
| 295 | Ga0207662_10055643 | 3300025918 | Bacteria | 2361 |
| 296 | Ga0207662_10124173 | 3300025918 | Bacteria | 1621 |
| 297 | Ga0207657_10004630 | 3300025919 | Bacteria | 14532 |
| 298 | Ga0207657_10006016 | 3300025919 | Bacteria | 12624 |
| 299 | Ga0207657_10011291 | 3300025919 | Bacteria | 8871 |
| 300 | Ga0207657_10036543 | 3300025919 | Bacteria | 4395 |
| 301 | Ga0207657_10043544 | 3300025919 | Bacteria | 3953 |
| 302 | Ga0207657_10058586 | 3300025919 | Bacteria | 3313 |
| 303 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 304 | Ga0207649_10077206 | 3300025920 | Bacteria | 2145 |
| 305 | Ga0207652_10000483 | 3300025921 | Bacteria | 40881 |
| 306 | Ga0207652_10040831 | 3300025921 | Bacteria | 3941 |
| 307 | Ga0207652_10110598 | 3300025921 | Bacteria | 2436 |
| 308 | Ga0207652_10125620 | 3300025921 | Bacteria | 2285 |
| 309 | Ga0207652_10131242 | 3300025921 | Bacteria | 2235 |
| 310 | Ga0207652_10169370 | 3300025921 | Bacteria | 1959 |
| 311 | Ga0207652_10368781 | 3300025921 | Bacteria | 1296 |
| 312 | Ga0207681_10279254 | 3300025923 | Bacteria | 1314 |
| 313 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 314 | Ga0207694_10051979 | 3300025924 | Bacteria | 3176 |
| 315 | Ga0207650_10024224 | 3300025925 | Bacteria | 4312 |
| 316 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 317 | Ga0207659_10227067 | 3300025926 | Bacteria | 1504 |
| 318 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 319 | Ga0207687_10000247 | 3300025927 | Bacteria | 36785 |
| 320 | Ga0207687_10004769 | 3300025927 | Bacteria | 9019 |
| 321 | Ga0207687_10034822 | 3300025927 | Bacteria | 3422 |
| 322 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 323 | Ga0207700_10003610 | 3300025928 | Bacteria | 9015 |
| 324 | Ga0207700_10021302 | 3300025928 | Bacteria | 4423 |
| 325 | Ga0207664_10000060 | 3300025929 | Bacteria | 116764 |
| 326 | Ga0207664_10020656 | 3300025929 | Bacteria | 4886 |
| 327 | Ga0207664_10100265 | 3300025929 | Bacteria | 2391 |
| 328 | Ga0207664_10123464 | 3300025929 | Bacteria | 2171 |
| 329 | Ga0207644_10175626 | 3300025931 | Bacteria | 1676 |
| 330 | Ga0207644_10238498 | 3300025931 | Bacteria | 1447 |
| 331 | Ga0207690_10000117 | 3300025932 | Bacteria | 65570 |
| 332 | Ga0207690_10001648 | 3300025932 | Bacteria | 13799 |
| 333 | Ga0207690_10048283 | 3300025932 | Bacteria | 2829 |
| 334 | Ga0207690_10050488 | 3300025932 | Bacteria | 2777 |
| 335 | Ga0207690_10379369 | 3300025932 | Bacteria | 1123 |
| 336 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 337 | Ga0207706_10040857 | 3300025933 | Bacteria | 4111 |
| 338 | Ga0207686_10000033 | 3300025934 | Bacteria | 143602 |
| 339 | Ga0207686_10000428 | 3300025934 | Bacteria | 28669 |
| 340 | Ga0207686_10254242 | 3300025934 | Bacteria | 1285 |
| 341 | Ga0207709_10233345 | 3300025935 | Bacteria | 1334 |
| 342 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 343 | Ga0207704_10000146 | 3300025938 | Bacteria | 37894 |
| 344 | Ga0207665_10047824 | 3300025939 | Bacteria | 2869 |
| 345 | Ga0207665_10182238 | 3300025939 | Bacteria | 1521 |
| 346 | Ga0207665_10209651 | 3300025939 | Bacteria | 1423 |
| 347 | Ga0207691_10001039 | 3300025940 | Bacteria | 27535 |
| 348 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 349 | Ga0207661_10000492 | 3300025944 | Bacteria | 25390 |
| 350 | Ga0207661_10008086 | 3300025944 | Bacteria | 7501 |
| 351 | Ga0207661_10009162 | 3300025944 | Bacteria | 7097 |
| 352 | Ga0207661_10009503 | 3300025944 | Bacteria | 6977 |
| 353 | Ga0207661_10027150 | 3300025944 | Bacteria | 4370 |
| 354 | Ga0207661_10029153 | 3300025944 | Bacteria | 4235 |
| 355 | Ga0207661_10037197 | 3300025944 | Bacteria | 3805 |
| 356 | Ga0207661_10188469 | 3300025944 | Bacteria | 1807 |
| 357 | Ga0207679_10115103 | 3300025945 | Bacteria | 2130 |
| 358 | Ga0207667_10150188 | 3300025949 | Bacteria | 2398 |
| 359 | Ga0207712_10020852 | 3300025961 | Bacteria | 4298 |
| 360 | Ga0207712_10070266 | 3300025961 | Bacteria | 2515 |
| 361 | Ga0207712_10160173 | 3300025961 | Bacteria | 1748 |
| 362 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 363 | Ga0207640_10188590 | 3300025981 | Bacteria | 1552 |
| 364 | Ga0207658_10025449 | 3300025986 | Bacteria | 4144 |
| 365 | Ga0207677_10019123 | 3300026023 | Bacteria | 4129 |
| 366 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 367 | Ga0207703_10001815 | 3300026035 | Bacteria | 19030 |
| 368 | Ga0207639_10005404 | 3300026041 | Bacteria | 8640 |
| 369 | Ga0207639_10047900 | 3300026041 | Bacteria | 3233 |
| 370 | Ga0207678_10012342 | 3300026067 | Bacteria | 7500 |
| 371 | Ga0207678_10170749 | 3300026067 | Bacteria | 1857 |
| 372 | Ga0207708_10109055 | 3300026075 | Bacteria | 2148 |
| 373 | Ga0207702_10000607 | 3300026078 | Bacteria | 39638 |
| 374 | Ga0207702_10017650 | 3300026078 | Bacteria | 5905 |
| 375 | Ga0207702_10088937 | 3300026078 | Bacteria | 2700 |
| 376 | Ga0207702_10185986 | 3300026078 | Bacteria | 1916 |
| 377 | Ga0207702_10214928 | 3300026078 | Bacteria | 1789 |
| 378 | Ga0207702_10389868 | 3300026078 | Bacteria | 1341 |
| 379 | Ga0207641_10007104 | 3300026088 | Bacteria | 9351 |
| 380 | Ga0207641_10275188 | 3300026088 | Bacteria | 1581 |
| 381 | Ga0207648_10007855 | 3300026089 | Bacteria | 10409 |
| 382 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 383 | Ga0207674_10014502 | 3300026116 | Bacteria | 8702 |
| 384 | Ga0207674_10116495 | 3300026116 | Bacteria | 2643 |
| 385 | Ga0207675_100002174 | 3300026118 | Bacteria | 19495 |
| 386 | Ga0207675_100096249 | 3300026118 | Bacteria | 2786 |
| 387 | Ga0207675_100466808 | 3300026118 | Bacteria | 1253 |
| 388 | Ga0207683_10022220 | 3300026121 | Bacteria | 5444 |
| 389 | Ga0207683_10055774 | 3300026121 | Bacteria | 3465 |
| 390 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 391 | Ga0207698_10018265 | 3300026142 | Bacteria | 4774 |
| 392 | Ga0209281_1000131 | 3300027111 | Bacteria | 190072 |
| 393 | Ga0209281_1000502 | 3300027111 | Bacteria | 51906 |
| 394 | Ga0209281_1004136 | 3300027111 | Bacteria | 4445 |
| 395 | Ga0209281_1013085 | 3300027111 | Bacteria | 1801 |
| 396 | Ga0207428_10020123 | 3300027907 | Bacteria | 5676 |
| 397 | Ga0207428_10041096 | 3300027907 | Bacteria | 3745 |
| 398 | Ga0207428_10055546 | 3300027907 | Bacteria | 3148 |
| 399 | Ga0207428_10214585 | 3300027907 | Bacteria | 1445 |
| 400 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 401 | Ga0268266_10055957 | 3300028379 | Bacteria | 3392 |
| 402 | Ga0268265_10000555 | 3300028380 | Bacteria | 38092 |
| 403 | Ga0268264_10006502 | 3300028381 | Bacteria | 9842 |
| 404 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 405 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 406 | Ga0265326_10000024 | 3300028558 | Bacteria | 112928 |
| 407 | Ga0265319_1000116 | 3300028563 | Bacteria | 60553 |
| 408 | Ga0265334_10000078 | 3300028573 | Bacteria | 70145 |
| 409 | Ga0265318_10017106 | 3300028577 | Bacteria | 2982 |
| 410 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 411 | Ga0265336_10003815 | 3300028666 | Bacteria | 5812 |
| 412 | Ga0265338_10016842 | 3300028800 | Bacteria | 7918 |
| 413 | Ga0265338_10098748 | 3300028800 | Bacteria | 2387 |
| 414 | Ga0265324_10000309 | 3300029957 | Bacteria | 35875 |
| 415 | Ga0265324_10003299 | 3300029957 | Bacteria | 7754 |
| 416 | Ga0265328_10001155 | 3300031239 | Bacteria | 12164 |
| 417 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 418 | Ga0265329_10014821 | 3300031242 | Bacteria | 2742 |
| 419 | Ga0265331_10005257 | 3300031250 | Bacteria | 7837 |
| 420 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 421 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 422 | Ga0307405_10119453 | 3300031731 | Bacteria | 1801 |
| 423 | Ga0307413_10045649 | 3300031824 | Bacteria | 2599 |
| 424 | Ga0307410_10054203 | 3300031852 | Bacteria | 2717 |
| 425 | Ga0307407_10015214 | 3300031903 | Bacteria | 3794 |
| 426 | Ga0307407_10119466 | 3300031903 | Bacteria | 1668 |
| 427 | Ga0307409_100015871 | 3300031995 | Bacteria | 4962 |
| 428 | Ga0307409_100033327 | 3300031995 | Bacteria | 3747 |
| 429 | Ga0307409_100090481 | 3300031995 | Bacteria | 2505 |
| 430 | Ga0307409_100172243 | 3300031995 | Bacteria | 1906 |
| 431 | Ga0307409_100188824 | 3300031995 | Bacteria | 1832 |
| 432 | Ga0307416_100010497 | 3300032002 | Bacteria | 6120 |
| 433 | Ga0307411_10231509 | 3300032005 | Bacteria | 1440 |
| 434 | Ga0307415_100000109 | 3300032126 | Bacteria | 35202 |
| 435 | Ga0307415_100020877 | 3300032126 | Bacteria | 4010 |
| 436 | Ga0307415_100121081 | 3300032126 | Bacteria | 1962 |
| 437 | Ga0307415_100177466 | 3300032126 | Bacteria | 1668 |
| 438 | Ga0307415_100357145 | 3300032126 | Bacteria | 1232 |
| 439 | Ga0373956_0111322 | 3300035119 | Bacteria | 1275 |
| 440 | Ga0373943_0000450 | 3300035170 | Bacteria | 17418 |
| 441 | Ga0373946_0004358 | 3300035171 | Bacteria | 5066 |
| 442 | Ga0373927_0022758 | 3300035695 | Bacteria | 4104 |
| 443 | Ga0373933_0023238 | 3300035724 | Bacteria | 3540 |
| 444 | Ga0373947_0002176 | 3300035725 | Bacteria | 11907 |
| 445 | Ga0373937_0011597 | 3300036401 | Bacteria | 7740 |
| 446 | Ga0373937_0168677 | 3300036401 | Bacteria | 2053 |
| 447 | Ga0373937_0334799 | 3300036401 | Bacteria | 1433 |
| 448 | Ga0373925_0003354 | 3300037068 | Bacteria | 12426 |
| 449 | Ga0395899_0019528 | 3300037312 | Bacteria | 5147 |
| 450 | Ga0395899_0040871 | 3300037312 | Bacteria | 3467 |
| 451 | Ga0395899_0075426 | 3300037312 | Bacteria | 2463 |
| 452 | Ga0395900_0017631 | 3300037418 | Bacteria | 7286 |
| 453 | Ga0395900_0022240 | 3300037418 | Bacteria | 6487 |
| 454 | Ga0395900_0068406 | 3300037418 | Bacteria | 3649 |
| 455 | Ga0395900_0257804 | 3300037418 | Bacteria | 1743 |
| 456 | Ga0395900_0452587 | 3300037418 | Bacteria | 1240 |
| 457 | Ga0395900_0462972 | 3300037418 | Bacteria | 1222 |
| 458 | Ga0395898_0002496 | 3300037466 | Bacteria | 21639 |
| 459 | Ga0395898_0018707 | 3300037466 | Bacteria | 7062 |
| 460 | Ga0395898_0031362 | 3300037466 | Bacteria | 5311 |
| 461 | Ga0395898_0042172 | 3300037466 | Bacteria | 4504 |
| 462 | Ga0395898_0053265 | 3300037466 | Bacteria | 3952 |
| 463 | Ga0395898_0053394 | 3300037466 | Bacteria | 3947 |
| 464 | Ga0395898_0075926 | 3300037466 | Bacteria | 3245 |
| 465 | Ga0395898_0105247 | 3300037466 | Bacteria | 2705 |
| 466 | Ga0395898_0535496 | 3300037466 | Bacteria | 1113 |
| 467 | Ga0395905_0010080 | 3300037471 | Bacteria | 9210 |
| 468 | Ga0395905_0071433 | 3300037471 | Bacteria | 3254 |
| 469 | Ga0395905_0168995 | 3300037471 | Bacteria | 2054 |
| 470 | Ga0395905_0172870 | 3300037471 | Bacteria | 2029 |
| 471 | Ga0436364_0457216 | 3300037853 | Bacteria | 5287 |
| 472 | Ga0436364_0527107 | 3300037853 | Bacteria | 72365 |
| 473 | Ga0436364_1168514 | 3300037853 | Bacteria | 10945 |
| 474 | Ga0395901_0014107 | 3300038443 | Bacteria | 8134 |
| 475 | Ga0395901_0018370 | 3300038443 | Bacteria | 7139 |
| 476 | Ga0395901_0026219 | 3300038443 | Bacteria | 5983 |
| 477 | Ga0395901_0077464 | 3300038443 | Bacteria | 3470 |
| 478 | Ga0395901_0095660 | 3300038443 | Bacteria | 3112 |
| 479 | Ga0395901_0129283 | 3300038443 | Bacteria | 2654 |
| 480 | Ga0395901_0148255 | 3300038443 | Bacteria | 2465 |
| 481 | Ga0395901_0232358 | 3300038443 | Bacteria | 1925 |
| 482 | Ga0395901_0254951 | 3300038443 | Bacteria | 1827 |
| 483 | Ga0395901_0472338 | 3300038443 | Bacteria | 1280 |
| 484 | Ga0395901_0577279 | 3300038443 | Bacteria | 1136 |
| 485 | Ga0436365_0344023 | 3300039437 | Bacteria | 9173 |
| 486 | Ga0436365_0494891 | 3300039437 | Bacteria | 2465 |
| 487 | Ga0436365_0823300 | 3300039437 | Bacteria | 7865 |
| 488 | Ga0436365_1182882 | 3300039437 | Bacteria | 1153 |
| 489 | Ga0436365_1248745 | 3300039437 | Bacteria | 2014 |
| 490 | Ga0436365_1574649 | 3300039437 | Bacteria | 17677 |
| 491 | Ga0436363_0675171 | 3300039450 | Bacteria | 25439 |
| 492 | Ga0451798_0735618 | 3300041458 | Bacteria | 1408 |
| 493 | Ga0451833_0016179 | 3300041491 | Bacteria | 1621 |
| 494 | Ga0451853_0128655 | 3300041512 | Bacteria | 2159 |
| 495 | Ga0466965_0098246 | 3300044683 | Bacteria | 1495 |
| 496 | Ga0466966_0087254 | 3300044684 | Bacteria | 1939 |
| 497 | Ga0466961_0009994 | 3300044693 | Bacteria | 6047 |
| 498 | Ga0466961_0019451 | 3300044693 | Bacteria | 4367 |
| 499 | Ga0466961_0122770 | 3300044693 | Bacteria | 1630 |
| 500 | Ga0466963_0000023 | 3300044694 | Bacteria | 52546 |
| 501 | Ga0466963_0005370 | 3300044694 | Bacteria | 7500 |
| 502 | Ga0466963_0025380 | 3300044694 | Bacteria | 3779 |
| 503 | Ga0466963_0061539 | 3300044694 | Bacteria | 2510 |
| 504 | Ga0466963_0073596 | 3300044694 | Bacteria | 2303 |
| 505 | Ga0466963_0118600 | 3300044694 | Bacteria | 1820 |
| 506 | Ga0466964_0018912 | 3300044706 | Bacteria | 2646 |
| 507 | Ga0466964_0057309 | 3300044706 | Bacteria | 1612 |
| 508 | Ga0466971_0001268 | 3300044719 | Bacteria | 10525 |
| 509 | Ga0466971_0013005 | 3300044719 | Bacteria | 3651 |
| 510 | Ga0466971_0124073 | 3300044719 | Bacteria | 1196 |
| 511 | Ga0466968_0009508 | 3300044735 | Bacteria | 3740 |
| 512 | Ga0466957_0000566 | 3300044842 | Bacteria | 18671 |
| 513 | Ga0466957_0088050 | 3300044842 | Bacteria | 1942 |
| 514 | Ga0466960_0024390 | 3300044901 | Bacteria | 2728 |
| 515 | Ga0466960_0064375 | 3300044901 | Bacteria | 1808 |
| 516 | Ga0466960_0095012 | 3300044901 | Bacteria | 1526 |
| 517 | Ga0466959_0001055 | 3300045049 | Bacteria | 16508 |
| 518 | Ga0466959_0052484 | 3300045049 | Bacteria | 2985 |
| 519 | Ga0466959_0137177 | 3300045049 | Bacteria | 1731 |
| 520 | Ga0466959_0156171 | 3300045049 | Bacteria | 1606 |
| 521 | Ga0466958_0002895 | 3300045836 | Bacteria | 8759 |
| 522 | Ga0466958_0006736 | 3300045836 | Bacteria | 6273 |
| 523 | Ga0466958_0027368 | 3300045836 | Bacteria | 3375 |
| 524 | Ga0466958_0080234 | 3300045836 | Bacteria | 2007 |
| 525 | Ga0466967_0000027 | 3300045976 | Bacteria | 64265 |
| 526 | Ga0466967_0004155 | 3300045976 | Bacteria | 9685 |
| 527 | Ga0466967_0007145 | 3300045976 | Bacteria | 8015 |
| 528 | Ga0466967_0010564 | 3300045976 | Bacteria | 6934 |
| 529 | Ga0466967_0010911 | 3300045976 | Bacteria | 6847 |
| 530 | Ga0466967_0013454 | 3300045976 | Bacteria | 6324 |
| 531 | Ga0466967_0016955 | 3300045976 | Bacteria | 5762 |
| 532 | Ga0466967_0027982 | 3300045976 | Bacteria | 4698 |
| 533 | Ga0466967_0061995 | 3300045976 | Bacteria | 3318 |
| 534 | Ga0466967_0064480 | 3300045976 | Bacteria | 3258 |
| 535 | Ga0466967_0066201 | 3300045976 | Bacteria | 3218 |
| 536 | Ga0466967_0180119 | 3300045976 | Bacteria | 1993 |
| 537 | Ga0466967_0210347 | 3300045976 | Bacteria | 1844 |
| 538 | Ga0466967_0211313 | 3300045976 | Bacteria | 1840 |
| 539 | Ga0466967_0226742 | 3300045976 | Bacteria | 1778 |
| 540 | Ga0466967_0506817 | 3300045976 | Bacteria | 1185 |
| 541 | Ga0466967_0624440 | 3300045976 | Bacteria | 1064 |
| 542 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 543 | Ga0495603_0000097 | 3300046455 | Bacteria | 40321 |
| 544 | Ga0495603_0007864 | 3300046455 | Bacteria | 6429 |
| 545 | Ga0495603_0012162 | 3300046455 | Bacteria | 5212 |
| 546 | Ga0495629_0009397 | 3300046459 | Bacteria | 7153 |
| 547 | Ga0495629_0024338 | 3300046459 | Bacteria | 4310 |
| 548 | Ga0495629_0081278 | 3300046459 | Bacteria | 2262 |
| 549 | Ga0495638_0065726 | 3300046460 | Bacteria | 2231 |
| 550 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 551 | Ga0495651_0003583 | 3300046462 | Bacteria | 11916 |
| 552 | Ga0495651_0117342 | 3300046462 | Bacteria | 1959 |
| 553 | Ga0495653_0038949 | 3300046463 | Bacteria | 3727 |
| 554 | Ga0495653_0073344 | 3300046463 | Bacteria | 2554 |
| 555 | Ga0495653_0107237 | 3300046463 | Bacteria | 2013 |
| 556 | Ga0495653_0135719 | 3300046463 | Bacteria | 1736 |
| 557 | Ga0495580_0200013 | 3300046472 | Bacteria | 1377 |
| 558 | Ga0495582_0000029 | 3300046473 | Bacteria | 77919 |
| 559 | Ga0495582_0000066 | 3300046473 | Bacteria | 53920 |
| 560 | Ga0495582_0201094 | 3300046473 | Bacteria | 1138 |
| 561 | Ga0495639_0001185 | 3300046475 | Bacteria | 11777 |
| 562 | Ga0495662_0000650 | 3300046476 | Bacteria | 16301 |
| 563 | Ga0495662_0000694 | 3300046476 | Bacteria | 15948 |
| 564 | Ga0495662_0034097 | 3300046476 | Bacteria | 2458 |
| 565 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 566 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 567 | Ga0495594_0076609 | 3300046499 | Bacteria | 1865 |
| 568 | Ga0495596_0031416 | 3300046500 | Bacteria | 2121 |
| 569 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 570 | Ga0495608_0010826 | 3300046511 | Bacteria | 6357 |
| 571 | Ga0495608_0017412 | 3300046511 | Bacteria | 4969 |
| 572 | Ga0495608_0124169 | 3300046511 | Bacteria | 1654 |
| 573 | Ga0495610_0028993 | 3300046512 | Bacteria | 2921 |
| 574 | Ga0495620_0000210 | 3300046515 | Bacteria | 44013 |
| 575 | Ga0495620_0099892 | 3300046515 | Bacteria | 1158 |
| 576 | Ga0495628_0000144 | 3300046516 | Bacteria | 61254 |
| 577 | Ga0495628_0002459 | 3300046516 | Bacteria | 16708 |
| 578 | Ga0495628_0010479 | 3300046516 | Bacteria | 7873 |
| 579 | Ga0495628_0017322 | 3300046516 | Bacteria | 5999 |
| 580 | Ga0495628_0268967 | 3300046516 | Bacteria | 1268 |
| 581 | Ga0495630_0005219 | 3300046517 | Bacteria | 9153 |
| 582 | Ga0495630_0018710 | 3300046517 | Bacteria | 5089 |
| 583 | Ga0495630_0042919 | 3300046517 | Bacteria | 3377 |
| 584 | Ga0495630_0098599 | 3300046517 | Bacteria | 2210 |
| 585 | Ga0495644_0007172 | 3300046523 | Bacteria | 4306 |
| 586 | Ga0495652_0018945 | 3300046529 | Bacteria | 6133 |
| 587 | Ga0495652_0049582 | 3300046529 | Bacteria | 3594 |
| 588 | Ga0495652_0050844 | 3300046529 | Bacteria | 3542 |
| 589 | Ga0495665_0000252 | 3300046531 | Bacteria | 26953 |
| 590 | Ga0495640_0012743 | 3300046533 | Bacteria | 6419 |
| 591 | Ga0495640_0051398 | 3300046533 | Bacteria | 2833 |
| 592 | Ga0495640_0104286 | 3300046533 | Bacteria | 1858 |
| 593 | Ga0495586_0007791 | 3300046535 | Bacteria | 5710 |
| 594 | Ga0495586_0064936 | 3300046535 | Bacteria | 1989 |
| 595 | Ga0495587_0005378 | 3300046536 | Bacteria | 8376 |
| 596 | Ga0495587_0023376 | 3300046536 | Bacteria | 3798 |
| 597 | Ga0495587_0033470 | 3300046536 | Bacteria | 3103 |
| 598 | Ga0495645_0004644 | 3300046543 | Bacteria | 9373 |
| 599 | Ga0495645_0028397 | 3300046543 | Bacteria | 4065 |
| 600 | Ga0495622_0000714 | 3300046557 | Bacteria | 18760 |
| 601 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 602 | Ga0495667_0000751 | 3300046559 | Bacteria | 20850 |
| 603 | Ga0495667_0006812 | 3300046559 | Bacteria | 7759 |
| 604 | Ga0495667_0014712 | 3300046559 | Bacteria | 5288 |
| 605 | Ga0495667_0037733 | 3300046559 | Bacteria | 3220 |
| 606 | Ga0495667_0085538 | 3300046559 | Bacteria | 2047 |
| 607 | Ga0495656_0000241 | 3300046615 | Bacteria | 19365 |
| 608 | Ga0495634_0027184 | 3300046642 | Bacteria | 3982 |
| 609 | Ga0495634_0031253 | 3300046642 | Bacteria | 3668 |
| 610 | Ga0495634_0053650 | 3300046642 | Bacteria | 2700 |
| 611 | Ga0495634_0088730 | 3300046642 | Bacteria | 2011 |
| 612 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 613 | Ga0495635_0008147 | 3300046663 | Bacteria | 7320 |
| 614 | Ga0495635_0047428 | 3300046663 | Bacteria | 2962 |
| 615 | Ga0495635_0082131 | 3300046663 | Bacteria | 2205 |
| 616 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 617 | Ga0495657_0009618 | 3300046675 | Bacteria | 7321 |
| 618 | Ga0495657_0053616 | 3300046675 | Bacteria | 2698 |
| 619 | Ga0495657_0124448 | 3300046675 | Bacteria | 1621 |
| 620 | Ga0495599_0048369 | 3300046678 | Bacteria | 2666 |
| 621 | Ga0495623_0132179 | 3300046679 | Bacteria | 1493 |
| 622 | Ga0495646_0013457 | 3300046680 | Bacteria | 5200 |
| 623 | Ga0495646_0076361 | 3300046680 | Bacteria | 1962 |
| 624 | Ga0495647_0000025 | 3300046681 | Bacteria | 65184 |
| 625 | Ga0495658_0000026 | 3300046683 | Bacteria | 77681 |
| 626 | Ga0495658_0005678 | 3300046683 | Bacteria | 6130 |
| 627 | Ga0495669_0000260 | 3300046684 | Bacteria | 30549 |
| 628 | Ga0495613_0000073 | 3300046689 | Bacteria | 98688 |
| 629 | Ga0495613_0000152 | 3300046689 | Bacteria | 68384 |
| 630 | Ga0495613_0004101 | 3300046689 | Bacteria | 10892 |
| 631 | Ga0495613_0059131 | 3300046689 | Bacteria | 2810 |
| 632 | Ga0495624_0000009 | 3300046690 | Bacteria | 145026 |
| 633 | Ga0495624_0006961 | 3300046690 | Bacteria | 7976 |
| 634 | Ga0495600_0015949 | 3300046809 | Bacteria | 4760 |
| 635 | Ga0495600_0018385 | 3300046809 | Bacteria | 4452 |
| 636 | Ga0495600_0041962 | 3300046809 | Bacteria | 2982 |
| 637 | Ga0495600_0047287 | 3300046809 | Bacteria | 2806 |
| 638 | Ga0495581_0002805 | 3300047315 | Bacteria | 9949 |
| 639 | Ga0495581_0114745 | 3300047315 | Bacteria | 1567 |
| 640 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 641 | Ga0495604_0000985 | 3300047317 | Bacteria | 23770 |
| 642 | Ga0495604_0009430 | 3300047317 | Bacteria | 7719 |
| 643 | Ga0495604_0041144 | 3300047317 | Bacteria | 3625 |
| 644 | Ga0495674_0008594 | 3300047319 | Bacteria | 9721 |
| 645 | Ga0495674_0010971 | 3300047319 | Bacteria | 8560 |
| 646 | Ga0495674_0165465 | 3300047319 | Bacteria | 1848 |
| 647 | Ga0495674_0186670 | 3300047319 | Bacteria | 1725 |
| 648 | Ga0495672_0003817 | 3300047320 | Bacteria | 12682 |
| 649 | Ga0495676_0002041 | 3300047321 | Bacteria | 17764 |
| 650 | Ga0495680_0000317 | 3300047322 | Bacteria | 53949 |
| 651 | Ga0495680_0000647 | 3300047322 | Bacteria | 39030 |
| 652 | Ga0495680_0004252 | 3300047322 | Bacteria | 13751 |
| 653 | Ga0495680_0005066 | 3300047322 | Bacteria | 12439 |
| 654 | Ga0495680_0012179 | 3300047322 | Bacteria | 7587 |
| 655 | Ga0495680_0034820 | 3300047322 | Bacteria | 4062 |
| 656 | Ga0495675_0000428 | 3300047444 | Bacteria | 28143 |
| 657 | Ga0495685_034437 | 3300047447 | Bacteria | 1740 |
| 658 | Ga0495684_0002738 | 3300047471 | Bacteria | 13936 |
| 659 | Ga0495684_0006287 | 3300047471 | Bacteria | 9231 |
| 660 | Ga0495684_0053340 | 3300047471 | Bacteria | 3085 |
| 661 | Ga0495593_0001836 | 3300047673 | Bacteria | 12644 |
| 662 | Ga0495602_0001790 | 3300048088 | Bacteria | 21477 |
| 663 | Ga0495602_0059786 | 3300048088 | Bacteria | 3324 |
| 664 | Ga0495614_0019808 | 3300048089 | Bacteria | 2911 |
| 665 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 666 | Ga0496100_0016785 | 3300048903 | Bacteria | 4306 |
| 667 | Ga0496100_0037106 | 3300048903 | Bacteria | 3078 |
| 668 | Ga0496101_0000221 | 3300048904 | Bacteria | 42499 |
| 669 | Ga0496101_0004996 | 3300048904 | Bacteria | 8422 |
| 670 | Ga0496101_0009188 | 3300048904 | Bacteria | 6487 |
| 671 | Ga0496101_0024859 | 3300048904 | Bacteria | 4151 |
| 672 | Ga0496101_0088697 | 3300048904 | Bacteria | 2298 |
| 673 | Ga0496101_0094853 | 3300048904 | Bacteria | 2225 |
| 674 | Ga0496102_0000146 | 3300048905 | Bacteria | 96361 |
| 675 | Ga0496102_0008457 | 3300048905 | Bacteria | 8823 |
| 676 | Ga0496102_0299530 | 3300048905 | Bacteria | 1515 |
| 677 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 678 | Ga0496103_0006820 | 3300048906 | Bacteria | 6815 |
| 679 | Ga0496103_0112031 | 3300048906 | Bacteria | 1734 |
| 680 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 681 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 682 | Ga0496104_0004466 | 3300048907 | Bacteria | 12184 |
| 683 | Ga0496104_0126464 | 3300048907 | Bacteria | 2454 |
| 684 | Ga0496104_0538909 | 3300048907 | Bacteria | 1078 |
| 685 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 686 | Ga0496105_0001569 | 3300048908 | Bacteria | 16195 |
| 687 | Ga0496105_0014782 | 3300048908 | Bacteria | 6214 |
| 688 | Ga0496105_0019941 | 3300048908 | Bacteria | 5412 |
| 689 | Ga0496105_0144081 | 3300048908 | Bacteria | 1960 |
| 690 | Ga0496106_0000018 | 3300048909 | Bacteria | 175028 |
| 691 | Ga0496106_0000149 | 3300048909 | Bacteria | 51656 |
| 692 | Ga0496106_0004661 | 3300048909 | Bacteria | 10163 |
| 693 | Ga0496106_0047208 | 3300048909 | Bacteria | 3240 |
| 694 | Ga0496106_0130396 | 3300048909 | Bacteria | 1971 |
| 695 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 696 | Ga0496107_0001394 | 3300048910 | Bacteria | 14913 |
| 697 | Ga0496107_0005792 | 3300048910 | Bacteria | 8456 |
| 698 | Ga0496107_0028637 | 3300048910 | Bacteria | 3959 |
| 699 | Ga0496107_0037613 | 3300048910 | Bacteria | 3473 |
| 700 | Ga0496107_0043697 | 3300048910 | Bacteria | 3220 |
| 701 | Ga0496108_0036583 | 3300048911 | Bacteria | 4085 |
| 702 | Ga0496108_0059129 | 3300048911 | Bacteria | 3223 |
| 703 | Ga0496108_0099543 | 3300048911 | Bacteria | 2478 |
| 704 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 705 | Ga0496109_0005575 | 3300048912 | Bacteria | 10537 |
| 706 | Ga0496109_0007622 | 3300048912 | Bacteria | 9177 |
| 707 | Ga0496109_0023298 | 3300048912 | Bacteria | 5494 |
| 708 | Ga0496109_0222627 | 3300048912 | Bacteria | 1774 |
| 709 | Ga0496110_0002884 | 3300048913 | Bacteria | 12998 |
| 710 | Ga0496110_0006813 | 3300048913 | Bacteria | 9086 |
| 711 | Ga0496110_0046655 | 3300048913 | Bacteria | 3791 |
| 712 | Ga0496110_0096919 | 3300048913 | Bacteria | 2643 |
| 713 | Ga0496110_0151465 | 3300048913 | Bacteria | 2100 |
| 714 | Ga0496110_0321171 | 3300048913 | Bacteria | 1410 |
| 715 | Ga0496111_0000021 | 3300048914 | Bacteria | 67813 |
| 716 | Ga0496111_0003320 | 3300048914 | Bacteria | 9950 |
| 717 | Ga0496111_0011955 | 3300048914 | Bacteria | 5867 |
| 718 | Ga0496111_0014669 | 3300048914 | Bacteria | 5358 |
| 719 | Ga0496111_0096713 | 3300048914 | Bacteria | 2167 |
| 720 | Ga0496111_0183989 | 3300048914 | Bacteria | 1553 |
| 721 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 722 | Ga0496112_0001614 | 3300048915 | Bacteria | 17446 |
| 723 | Ga0496112_0109544 | 3300048915 | Bacteria | 2732 |
| 724 | Ga0496112_0212348 | 3300048915 | Bacteria | 1892 |
| 725 | Ga0496112_0253016 | 3300048915 | Bacteria | 1712 |
| 726 | Ga0496112_0301760 | 3300048915 | Bacteria | 1547 |
| 727 | Ga0496113_0000029 | 3300048916 | Bacteria | 61873 |
| 728 | Ga0496113_0020403 | 3300048916 | Bacteria | 4658 |
| 729 | Ga0496113_0062447 | 3300048916 | Bacteria | 2813 |
| 730 | Ga0496113_0072702 | 3300048916 | Bacteria | 2618 |
| 731 | Ga0496113_0089276 | 3300048916 | Bacteria | 2372 |
| 732 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 733 | Ga0496114_0001831 | 3300048917 | Bacteria | 16108 |
| 734 | Ga0496114_0026518 | 3300048917 | Bacteria | 4744 |
| 735 | Ga0496114_0148873 | 3300048917 | Bacteria | 2030 |
| 736 | Ga0496114_0156407 | 3300048917 | Bacteria | 1979 |
| 737 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 738 | Ga0496115_0000581 | 3300048918 | Bacteria | 28187 |
| 739 | Ga0496115_0001725 | 3300048918 | Bacteria | 15676 |
| 740 | Ga0496115_0002312 | 3300048918 | Bacteria | 13653 |
| 741 | Ga0496115_0005472 | 3300048918 | Bacteria | 9241 |
| 742 | Ga0496115_0049967 | 3300048918 | Bacteria | 3349 |
| 743 | Ga0496115_0056458 | 3300048918 | Bacteria | 3156 |
| 744 | Ga0496115_0123722 | 3300048918 | Bacteria | 2129 |
| 745 | Ga0496117_0020230 | 3300048920 | Bacteria | 5433 |
| 746 | Ga0496118_0005186 | 3300048921 | Bacteria | 14915 |
| 747 | Ga0496120_0020129 | 3300048923 | Bacteria | 4250 |
| 748 | Ga0496121_0052505 | 3300048924 | Bacteria | 3423 |
| 749 | Ga0496121_0101167 | 3300048924 | Bacteria | 2223 |
| 750 | Ga0496122_0033730 | 3300048925 | Bacteria | 4204 |
| 751 | Ga0496126_0000108 | 3300048929 | Bacteria | 197529 |
| 752 | Ga0496126_0049736 | 3300048929 | Bacteria | 3825 |
| 753 | Ga0501031_0000434 | 3300049568 | Bacteria | 24055 |
| 754 | Ga0501031_0029713 | 3300049568 | Bacteria | 3566 |
| 755 | Ga0501031_0214164 | 3300049568 | Bacteria | 1255 |
| 756 | Ga0501032_0000899 | 3300049569 | Bacteria | 24104 |
| 757 | Ga0501032_0022440 | 3300049569 | Bacteria | 4374 |
| 758 | Ga0501033_0001140 | 3300049570 | Bacteria | 24003 |
| 759 | Ga0501034_0124121 | 3300049571 | Bacteria | 2567 |
| 760 | Ga0501036_0029623 | 3300049572 | Bacteria | 4623 |
| 761 | Ga0501036_0136395 | 3300049572 | Bacteria | 2071 |
| 762 | Ga0501037_0000774 | 3300049573 | Bacteria | 24049 |
| 763 | Ga0501037_0026648 | 3300049573 | Bacteria | 4271 |
| 764 | Ga0501037_0301482 | 3300049573 | Bacteria | 1113 |
| 765 | Ga0501038_0001146 | 3300049574 | Bacteria | 24003 |
| 766 | Ga0501038_0037491 | 3300049574 | Bacteria | 4250 |
| 767 | Ga0501039_0098643 | 3300049575 | Bacteria | 2279 |
| 768 | Ga0501039_0098657 | 3300049575 | Bacteria | 2279 |
| 769 | Ga0501039_0161109 | 3300049575 | Bacteria | 1763 |
| 770 | Ga0501040_0001638 | 3300049576 | Bacteria | 14279 |
| 771 | Ga0501041_0177508 | 3300049577 | Bacteria | 1333 |
| 772 | Ga0501042_0037517 | 3300049578 | Bacteria | 3439 |
| 773 | Ga0501042_0080269 | 3300049578 | Bacteria | 2337 |
| 774 | Ga0501042_0112800 | 3300049578 | Bacteria | 1957 |
| 775 | Ga0501043_0001082 | 3300049579 | Bacteria | 23968 |
| 776 | Ga0501043_0003201 | 3300049579 | Bacteria | 13542 |
| 777 | Ga0501046_0000447 | 3300049580 | Bacteria | 41432 |
| 778 | Ga0501046_0044376 | 3300049580 | Bacteria | 3536 |
| 779 | Ga0501046_0152886 | 3300049580 | Bacteria | 1740 |
| 780 | Ga0501047_0001335 | 3300049581 | Bacteria | 24206 |
| 781 | Ga0501047_0007455 | 3300049581 | Bacteria | 10299 |
| 782 | Ga0501047_0038927 | 3300049581 | Bacteria | 4599 |
| 783 | Ga0501048_0000734 | 3300049582 | Bacteria | 24021 |
| 784 | Ga0501048_0081483 | 3300049582 | Bacteria | 2283 |
| 785 | Ga0501067_0000348 | 3300049583 | Bacteria | 25209 |
| 786 | Ga0501067_0012878 | 3300049583 | Bacteria | 4632 |
| 787 | Ga0501067_0052936 | 3300049583 | Bacteria | 2249 |
| 788 | Ga0501067_0059253 | 3300049583 | Bacteria | 2119 |
| 789 | Ga0501067_0069396 | 3300049583 | Bacteria | 1951 |
| 790 | Ga0501069_0007590 | 3300049585 | Bacteria | 5693 |
| 791 | Ga0501069_0029114 | 3300049585 | Bacteria | 3030 |
| 792 | Ga0501069_0038721 | 3300049585 | Bacteria | 2632 |
| 793 | Ga0501069_0078624 | 3300049585 | Bacteria | 1855 |
| 794 | Ga0501070_0001137 | 3300049586 | Bacteria | 23887 |
| 795 | Ga0501070_0158987 | 3300049586 | Bacteria | 1863 |
| 796 | Ga0501071_0008414 | 3300049587 | Bacteria | 6821 |
| 797 | Ga0501071_0070366 | 3300049587 | Bacteria | 2548 |
| 798 | Ga0501071_0104050 | 3300049587 | Bacteria | 2095 |
| 799 | Ga0501071_0126080 | 3300049587 | Bacteria | 1900 |
| 800 | Ga0501072_0001313 | 3300049588 | Bacteria | 18633 |
| 801 | Ga0501072_0108814 | 3300049588 | Bacteria | 2205 |
| 802 | Ga0501072_0134549 | 3300049588 | Bacteria | 1971 |
| 803 | Ga0501072_0148604 | 3300049588 | Bacteria | 1868 |
| 804 | Ga0501073_0038032 | 3300049589 | Bacteria | 3415 |
| 805 | Ga0501073_0049364 | 3300049589 | Bacteria | 2951 |
| 806 | Ga0501074_0019804 | 3300049590 | Bacteria | 4887 |
| 807 | Ga0501074_0030021 | 3300049590 | Bacteria | 3939 |
| 808 | Ga0501074_0038770 | 3300049590 | Bacteria | 3451 |
| 809 | Ga0501074_0146388 | 3300049590 | Bacteria | 1689 |
| 810 | Ga0501074_0147057 | 3300049590 | Bacteria | 1685 |
| 811 | Ga0501075_0000392 | 3300049591 | Bacteria | 25374 |
| 812 | Ga0501075_0019774 | 3300049591 | Bacteria | 4888 |
| 813 | Ga0501075_0068979 | 3300049591 | Bacteria | 2672 |
| 814 | Ga0501075_0181602 | 3300049591 | Bacteria | 1605 |
| 815 | Ga0501075_0290189 | 3300049591 | Bacteria | 1246 |
| 816 | Ga0501076_0001177 | 3300049592 | Bacteria | 17330 |
| 817 | Ga0501076_0022538 | 3300049592 | Bacteria | 4840 |
| 818 | Ga0501076_0142235 | 3300049592 | Bacteria | 1950 |
| 819 | Ga0501076_0233089 | 3300049592 | Bacteria | 1505 |
| 820 | Ga0501077_0041582 | 3300049593 | Bacteria | 2925 |
| 821 | Ga0501077_0082185 | 3300049593 | Bacteria | 2041 |
| 822 | Ga0501077_0083695 | 3300049593 | Bacteria | 2022 |
| 823 | Ga0501079_0008992 | 3300049741 | Bacteria | 7564 |
| 824 | Ga0501079_0017085 | 3300049741 | Bacteria | 5541 |
| 825 | Ga0501079_0048229 | 3300049741 | Bacteria | 3287 |
| 826 | Ga0501079_0185868 | 3300049741 | Bacteria | 1622 |
| 827 | Ga0501080_0050087 | 3300049742 | Bacteria | 3888 |
| 828 | Ga0501080_0060002 | 3300049742 | Bacteria | 3540 |
| 829 | Ga0501080_0153800 | 3300049742 | Bacteria | 2125 |
| 830 | Ga0501080_0245961 | 3300049742 | Bacteria | 1631 |
| 831 | Ga0501081_0003995 | 3300049743 | Bacteria | 9452 |
| 832 | Ga0501081_0054341 | 3300049743 | Bacteria | 2767 |
| 833 | Ga0501083_0008535 | 3300049744 | Bacteria | 7233 |
| 834 | Ga0501083_0023660 | 3300049744 | Bacteria | 4259 |
| 835 | Ga0501035_0002398 | 3300049822 | Bacteria | 18377 |
| 836 | Ga0501044_0003241 | 3300049823 | Bacteria | 18299 |
| 837 | Ga0501044_0036460 | 3300049823 | Bacteria | 5145 |
| 838 | Ga0501044_0049171 | 3300049823 | Bacteria | 4353 |
| 839 | Ga0501044_0167828 | 3300049823 | Bacteria | 2168 |
| 840 | Ga0501045_0013972 | 3300049824 | Bacteria | 5683 |
| 841 | Ga0501045_0060787 | 3300049824 | Bacteria | 2770 |
| 842 | Ga0501045_0214013 | 3300049824 | Bacteria | 1435 |
| 843 | nmdc:mga05p37_105614_c1 | 3300050507 | Bacteria | 3464 |
| 844 | nmdc:mga05p37_144872_c1 | 3300050507 | Bacteria | 2909 |
| 845 | nmdc:mga05p37_170780_c1 | 3300050507 | Bacteria | 2652 |
| 846 | nmdc:mga05p37_71033_c2 | 3300050507 | Bacteria | 4064 |
| 847 | nmdc:mga09592_69165_c1 | 3300050508 | Bacteria | 2995 |
| 848 | nmdc:mga0qj67_1444_c1 | 3300050509 | Bacteria | 16634 |
| 849 | nmdc:mga0qj67_37429_c1 | 3300050509 | Bacteria | 3801 |
| 850 | nmdc:mga06r32_13083_c1 | 3300050510 | Bacteria | 7510 |
| 851 | nmdc:mga06r32_2689_c1 | 3300050510 | Bacteria | 15905 |
| 852 | nmdc:mga08y16_143200_c1 | 3300050511 | Bacteria | 2485 |
| 853 | nmdc:mga08y16_26286_c1 | 3300050511 | Bacteria | 6137 |
| 854 | nmdc:mga08y16_9951_c1 | 3300050511 | Bacteria | 9982 |
| 855 | nmdc:mga0n895_128747_c1 | 3300050512 | Bacteria | 2556 |
| 856 | nmdc:mga0n895_47389_c1 | 3300050512 | Bacteria | 4202 |
| 857 | nmdc:mga08x19_101069_c1 | 3300050514 | Bacteria | 1913 |
| 858 | nmdc:mga0a205_1916_c1 | 3300050515 | Bacteria | 18075 |
| 859 | nmdc:mga0a205_38052_c1 | 3300050515 | Bacteria | 4627 |
| 860 | nmdc:mga0a205_87386_c1 | 3300050515 | Bacteria | 3012 |
| 861 | Ga0495601_0002204 | 3300053077 | Bacteria | 10967 |
| 862 | Ga0495601_0108345 | 3300053077 | Bacteria | 1797 |
| 863 | Ga0495601_0139636 | 3300053077 | Bacteria | 1580 |
| 864 | Ga0495612_0001555 | 3300053078 | Bacteria | 9456 |
| 865 | Ga0495612_0015066 | 3300053078 | Bacteria | 3101 |
| 866 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 867 | Ga0495655_0001262 | 3300053083 | Bacteria | 3908 |
| 868 | Ga0495655_0005518 | 3300053083 | Bacteria | 2240 |
| 869 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 870 | Ga0495595_0002816 | 3300053084 | Bacteria | 6842 |
| 871 | Ga0495619_0000055 | 3300053085 | Bacteria | 95570 |
| 872 | Ga0495619_0000147 | 3300053085 | Bacteria | 51947 |
| 873 | Ga0495619_0000534 | 3300053085 | Bacteria | 25127 |
| 874 | Ga0495619_0003046 | 3300053085 | Bacteria | 10884 |
| 875 | Ga0495619_0058131 | 3300053085 | Bacteria | 2566 |
| 876 | Ga0495619_0063950 | 3300053085 | Bacteria | 2452 |
| 877 | Ga0495619_0146912 | 3300053085 | Bacteria | 1626 |
| 878 | Ga0495619_0280505 | 3300053085 | Bacteria | 1154 |
| 879 | Ga0500556_0000593 | 3300053104 | Bacteria | 23858 |
| 880 | Ga0500614_000026 | 3300053123 | Bacteria | 35584 |
| 881 | Ga0500628_000017 | 3300053129 | Bacteria | 90481 |
| 882 | Ga0500616_0004992 | 3300053153 | Bacteria | 9198 |
| 883 | Ga0501084_0007832 | 3300054114 | Bacteria | 8791 |
| 884 | Ga0501084_0285733 | 3300054114 | Bacteria | 1393 |
| 885 | Ga0501082_0039672 | 3300060353 | Bacteria | 4062 |
| 886 | Ga0501082_0048052 | 3300060353 | Bacteria | 3677 |
| 887 | Ga0501082_0051874 | 3300060353 | Bacteria | 3535 |
| 888 | Ga0501082_0235564 | 3300060353 | Bacteria | 1593 |
| 889 | Ga0466962_0003841 | 3300061719 | Bacteria | 7179 |
| 890 | Ga0466962_0004523 | 3300061719 | Bacteria | 6670 |
| 891 | Ga0466962_0038804 | 3300061719 | Bacteria | 2281 |
| 892 | Ga0530510_0003223 | 3300061734 | Bacteria | 11205 |
| 893 | Ga0530510_0013546 | 3300061734 | Bacteria | 5736 |
| 894 | Ga0530510_0069871 | 3300061734 | Bacteria | 2548 |
| 895 | Ga0530510_0099208 | 3300061734 | Bacteria | 2129 |
| 896 | Ga0530510_0179866 | 3300061734 | Bacteria | 1568 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100097586 | Ga0070697_1000975861 | 289 |
| 2 | 3300037853 | Ga0436364_1168514 | Ga0436364_1168514_2938_3975 | 291 |
| 3 | 3300038443 | Ga0395901_0129283 | Ga0395901_0129283_1559_2596 | 291 |
| 4 | 3300005983 | Ga0081540_1002225 | Ga0081540_10022258 | 294 |
| 5 | 3300047471 | Ga0495684_0053340 | Ga0495684_0053340_1746_2753 | 294 |
| 6 | 3300006946 | Ga0079104_1000337 | Ga0079104_100033723 | 295 |
| 7 | 3300027111 | Ga0209281_1000131 | Ga0209281_100013121 | 295 |
| 8 | 3300037466 | Ga0395898_0075926 | Ga0395898_0075926_784_1827 | 295 |
| 9 | 3300038443 | Ga0395901_0095660 | Ga0395901_0095660_428_1471 | 295 |
| 10 | 3300046529 | Ga0495652_0050844 | Ga0495652_0050844_2457_3467 | 295 |
| 11 | 3300037418 | Ga0395900_0257804 | Ga0395900_0257804_181_1218 | 296 |
| 12 | 3300049580 | Ga0501046_0044376 | Ga0501046_0044376_1405_2442 | 296 |
| 13 | 3300049583 | Ga0501067_0059253 | Ga0501067_0059253_736_1773 | 296 |
| 14 | 3300049591 | Ga0501075_0068979 | Ga0501075_0068979_1111_2148 | 296 |
| 15 | 3300049592 | Ga0501076_0022538 | Ga0501076_0022538_973_2010 | 296 |
| 16 | 3300049824 | Ga0501045_0214013 | Ga0501045_0214013_210_1247 | 296 |
| 17 | 3300060353 | Ga0501082_0039672 | Ga0501082_0039672_1808_2845 | 296 |
| 18 | 3300061734 | Ga0530510_0179866 | Ga0530510_0179866_262_1299 | 296 |
| 19 | 3300048903 | Ga0496100_0016785 | Ga0496100_0016785_3011_4054 | 297 |
| 20 | 3300048904 | Ga0496101_0024859 | Ga0496101_0024859_212_1255 | 297 |
| 21 | 3300048909 | Ga0496106_0130396 | Ga0496106_0130396_274_1317 | 297 |
| 22 | 3300048910 | Ga0496107_0005792 | Ga0496107_0005792_6602_7645 | 297 |
| 23 | 3300048918 | Ga0496115_0049967 | Ga0496115_0049967_947_1990 | 297 |
| 24 | 3300039437 | Ga0436365_0494891 | Ga0436365_0494891_231_1229 | 298 |
| 25 | 3300047320 | Ga0495672_0003817 | Ga0495672_0003817_11581_12552 | 298 |
| 26 | 3300005937 | Ga0081455_10057361 | Ga0081455_100573613 | 299 |
| 27 | 3300006946 | Ga0079104_1028242 | Ga0079104_10282422 | 299 |
| 28 | 3300013296 | Ga0157374_10001108 | Ga0157374_100011084 | 299 |
| 29 | 3300027111 | Ga0209281_1000502 | Ga0209281_10005029 | 299 |
| 30 | 3300046517 | Ga0495630_0018710 | Ga0495630_0018710_4022_5062 | 299 |
| 31 | 3300046517 | Ga0495630_0098599 | Ga0495630_0098599_10_1002 | 299 |
| 32 | 3300046535 | Ga0495586_0064936 | Ga0495586_0064936_559_1599 | 299 |
| 33 | 3300046642 | Ga0495634_0088730 | Ga0495634_0088730_684_1724 | 299 |
| 34 | 3300046689 | Ga0495613_0059131 | Ga0495613_0059131_732_1772 | 299 |
| 35 | 3300049587 | Ga0501071_0104050 | Ga0501071_0104050_200_1234 | 299 |
| 36 | 3300049588 | Ga0501072_0134549 | Ga0501072_0134549_453_1487 | 299 |
| 37 | 3300005347 | Ga0070668_100015307 | Ga0070668_1000153075 | 300 |
| 38 | 3300005440 | Ga0070705_100054509 | Ga0070705_1000545091 | 300 |
| 39 | 3300005457 | Ga0070662_100068086 | Ga0070662_1000680862 | 300 |
| 40 | 3300005468 | Ga0070707_100229613 | Ga0070707_1002296132 | 300 |
| 41 | 3300005719 | Ga0068861_100002566 | Ga0068861_1000025666 | 300 |
| 42 | 3300005937 | Ga0081455_10055109 | Ga0081455_100551094 | 300 |
| 43 | 3300009098 | Ga0105245_10002692 | Ga0105245_1000269216 | 300 |
| 44 | 3300009553 | Ga0105249_10183328 | Ga0105249_101833282 | 300 |
| 45 | 3300010375 | Ga0105239_10130675 | Ga0105239_101306752 | 300 |
| 46 | 3300013306 | Ga0163162_10044877 | Ga0163162_100448772 | 300 |
| 47 | 3300025933 | Ga0207706_10040857 | Ga0207706_100408573 | 300 |
| 48 | 3300025961 | Ga0207712_10070266 | Ga0207712_100702662 | 300 |
| 49 | 3300026118 | Ga0207675_100002174 | Ga0207675_1000021743 | 300 |
| 50 | 3300028556 | Ga0265337_1000002 | Ga0265337_100000216 | 300 |
| 51 | 3300028558 | Ga0265326_10000007 | Ga0265326_1000000775 | 300 |
| 52 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001230 | 300 |
| 53 | 3300029957 | Ga0265324_10000309 | Ga0265324_1000030938 | 300 |
| 54 | 3300031239 | Ga0265328_10001155 | Ga0265328_1000115510 | 300 |
| 55 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002229 | 300 |
| 56 | 3300031242 | Ga0265329_10014821 | Ga0265329_100148213 | 300 |
| 57 | 3300031250 | Ga0265331_10005257 | Ga0265331_100052574 | 300 |
| 58 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011229 | 300 |
| 59 | 3300031711 | Ga0265314_10000058 | Ga0265314_10000058136 | 300 |
| 60 | 3300031995 | Ga0307409_100015871 | Ga0307409_1000158712 | 301 |
| 61 | 3300031995 | Ga0307409_100188824 | Ga0307409_1001888242 | 301 |
| 62 | 3300032126 | Ga0307415_100121081 | Ga0307415_1001210812 | 301 |
| 63 | 3300045976 | Ga0466967_0506817 | Ga0466967_0506817_29_1072 | 301 |
| 64 | 3300005616 | Ga0068852_100000296 | Ga0068852_10000029618 | 302 |
| 65 | 3300006175 | Ga0070712_100343399 | Ga0070712_1003433992 | 302 |
| 66 | 3300006847 | Ga0075431_100000747 | Ga0075431_10000074726 | 302 |
| 67 | 3300006871 | Ga0075434_100034518 | Ga0075434_1000345182 | 302 |
| 68 | 3300009094 | Ga0111539_10078234 | Ga0111539_100782343 | 302 |
| 69 | 3300009147 | Ga0114129_10124004 | Ga0114129_101240043 | 302 |
| 70 | 3300009147 | Ga0114129_10411207 | Ga0114129_104112072 | 302 |
| 71 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012105 | 302 |
| 72 | 3300027907 | Ga0207428_10055546 | Ga0207428_100555463 | 302 |
| 73 | 3300031903 | Ga0307407_10015214 | Ga0307407_100152142 | 302 |
| 74 | 3300037466 | Ga0395898_0018707 | Ga0395898_0018707_4964_5998 | 302 |
| 75 | 3300038443 | Ga0395901_0077464 | Ga0395901_0077464_536_1531 | 302 |
| 76 | 3300044694 | Ga0466963_0005370 | Ga0466963_0005370_2361_3404 | 302 |
| 77 | 3300046559 | Ga0495667_0000032 | Ga0495667_0000032_81345_82334 | 302 |
| 78 | 3300047322 | Ga0495680_0000647 | Ga0495680_0000647_8252_9244 | 302 |
| 79 | 3300047322 | Ga0495680_0005066 | Ga0495680_0005066_572_1561 | 302 |
| 80 | 3300048918 | Ga0496115_0000581 | Ga0496115_0000581_16742_17749 | 302 |
| 81 | 3300049572 | Ga0501036_0136395 | Ga0501036_0136395_754_1752 | 302 |
| 82 | 3300049576 | Ga0501040_0001638 | Ga0501040_0001638_1789_2787 | 302 |
| 83 | 3300049577 | Ga0501041_0177508 | Ga0501041_0177508_210_1208 | 302 |
| 84 | 3300049578 | Ga0501042_0080269 | Ga0501042_0080269_970_1968 | 302 |
| 85 | 3300049580 | Ga0501046_0152886 | Ga0501046_0152886_646_1644 | 302 |
| 86 | 3300049582 | Ga0501048_0081483 | Ga0501048_0081483_135_1133 | 302 |
| 87 | 3300049587 | Ga0501071_0008414 | Ga0501071_0008414_4689_5687 | 302 |
| 88 | 3300049588 | Ga0501072_0001313 | Ga0501072_0001313_16934_17932 | 302 |
| 89 | 3300049590 | Ga0501074_0147057 | Ga0501074_0147057_157_1155 | 302 |
| 90 | 3300049591 | Ga0501075_0019774 | Ga0501075_0019774_2134_3132 | 302 |
| 91 | 3300049592 | Ga0501076_0001177 | Ga0501076_0001177_14453_15451 | 302 |
| 92 | 3300049593 | Ga0501077_0041582 | Ga0501077_0041582_1417_2415 | 302 |
| 93 | 3300049741 | Ga0501079_0008992 | Ga0501079_0008992_1741_2739 | 302 |
| 94 | 3300049742 | Ga0501080_0060002 | Ga0501080_0060002_1893_2891 | 302 |
| 95 | 3300049743 | Ga0501081_0003995 | Ga0501081_0003995_1147_2145 | 302 |
| 96 | 3300049824 | Ga0501045_0060787 | Ga0501045_0060787_798_1796 | 302 |
| 97 | 3300050507 | nmdc:mga05p37_105614_c1 | nmdc:mga05p37_105614_c1_2320_3303 | 302 |
| 98 | 3300050510 | nmdc:mga06r32_2689_c1 | nmdc:mga06r32_2689_c1_13355_14338 | 302 |
| 99 | 3300050511 | nmdc:mga08y16_26286_c1 | nmdc:mga08y16_26286_c1_4005_4988 | 302 |
| 100 | 3300050512 | nmdc:mga0n895_47389_c1 | nmdc:mga0n895_47389_c1_173_1156 | 302 |
| 101 | 3300050515 | nmdc:mga0a205_87386_c1 | nmdc:mga0a205_87386_c1_1008_1991 | 302 |
| 102 | 3300054114 | Ga0501084_0007832 | Ga0501084_0007832_6550_7548 | 302 |
| 103 | 3300061734 | Ga0530510_0003223 | Ga0530510_0003223_3517_4515 | 302 |
| 104 | 3300005329 | Ga0070683_100008554 | Ga0070683_1000085548 | 303 |
| 105 | 3300005337 | Ga0070682_100212589 | Ga0070682_1002125891 | 303 |
| 106 | 3300005441 | Ga0070700_100272372 | Ga0070700_1002723721 | 303 |
| 107 | 3300025944 | Ga0207661_10000492 | Ga0207661_1000049214 | 303 |
| 108 | 3300046473 | Ga0495582_0201094 | Ga0495582_0201094_124_1095 | 303 |
| 109 | 3300046515 | Ga0495620_0000210 | Ga0495620_0000210_30521_31510 | 303 |
| 110 | 3300048911 | Ga0496108_0099543 | Ga0496108_0099543_1557_2468 | 303 |
| 111 | 3300048915 | Ga0496112_0001614 | Ga0496112_0001614_16259_17239 | 303 |
| 112 | 3300048918 | Ga0496115_0002312 | Ga0496115_0002312_148_1137 | 303 |
| 113 | 3300005981 | Ga0081538_10077193 | Ga0081538_100771932 | 304 |
| 114 | 3300005985 | Ga0081539_10017082 | Ga0081539_100170825 | 304 |
| 115 | 3300025929 | Ga0207664_10020656 | Ga0207664_100206563 | 304 |
| 116 | 3300031731 | Ga0307405_10119453 | Ga0307405_101194532 | 304 |
| 117 | 3300032126 | Ga0307415_100000109 | Ga0307415_10000010914 | 304 |
| 118 | 3300044683 | Ga0466965_0098246 | Ga0466965_0098246_440_1462 | 304 |
| 119 | 3300046455 | Ga0495603_0012162 | Ga0495603_0012162_1108_2088 | 304 |
| 120 | 3300046543 | Ga0495645_0004644 | Ga0495645_0004644_3442_4434 | 304 |
| 121 | 3300048916 | Ga0496113_0089276 | Ga0496113_0089276_1310_2290 | 304 |
| 122 | 3300005548 | Ga0070665_100223482 | Ga0070665_1002234822 | 305 |
| 123 | 3300005937 | Ga0081455_10027049 | Ga0081455_100270494 | 305 |
| 124 | 3300006844 | Ga0075428_100023575 | Ga0075428_1000235752 | 305 |
| 125 | 3300006847 | Ga0075431_100257275 | Ga0075431_1002572752 | 305 |
| 126 | 3300009553 | Ga0105249_10148229 | Ga0105249_101482293 | 305 |
| 127 | 3300025915 | Ga0207693_10258315 | Ga0207693_102583152 | 305 |
| 128 | 3300037466 | Ga0395898_0535496 | Ga0395898_0535496_93_1085 | 305 |
| 129 | 3300045836 | Ga0466958_0080234 | Ga0466958_0080234_151_1188 | 305 |
| 130 | 3300045976 | Ga0466967_0624440 | Ga0466967_0624440_17_1039 | 305 |
| 131 | 3300046463 | Ga0495653_0107237 | Ga0495653_0107237_229_1218 | 305 |
| 132 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_88748_89737 | 305 |
| 133 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_552094_553083 | 305 |
| 134 | 3300048923 | Ga0496120_0020129 | Ga0496120_0020129_1986_2975 | 305 |
| 135 | 3300061719 | Ga0466962_0038804 | Ga0466962_0038804_243_1280 | 305 |
| 136 | 3300003203 | JGI25406J46586_10014128 | JGI25406J46586_100141282 | 306 |
| 137 | 3300005344 | Ga0070661_100000023 | Ga0070661_100000023138 | 306 |
| 138 | 3300005365 | Ga0070688_100000300 | Ga0070688_10000030015 | 306 |
| 139 | 3300005365 | Ga0070688_100000630 | Ga0070688_1000006304 | 306 |
| 140 | 3300005436 | Ga0070713_100000009 | Ga0070713_10000000976 | 306 |
| 141 | 3300005466 | Ga0070685_10000282 | Ga0070685_1000028216 | 306 |
| 142 | 3300005466 | Ga0070685_10000320 | Ga0070685_1000032014 | 306 |
| 143 | 3300005563 | Ga0068855_100204032 | Ga0068855_1002040323 | 306 |
| 144 | 3300005841 | Ga0068863_100000021 | Ga0068863_10000002197 | 306 |
| 145 | 3300005981 | Ga0081538_10002025 | Ga0081538_1000202513 | 306 |
| 146 | 3300005985 | Ga0081539_10002491 | Ga0081539_1000249121 | 306 |
| 147 | 3300006237 | Ga0097621_100365845 | Ga0097621_1003658452 | 306 |
| 148 | 3300006881 | Ga0068865_100000104 | Ga0068865_10000010449 | 306 |
| 149 | 3300006946 | Ga0079104_1005865 | Ga0079104_10058653 | 306 |
| 150 | 3300009098 | Ga0105245_10000545 | Ga0105245_1000054520 | 306 |
| 151 | 3300013104 | Ga0157370_10286935 | Ga0157370_102869352 | 306 |
| 152 | 3300013105 | Ga0157369_10001239 | Ga0157369_1000123910 | 306 |
| 153 | 3300013307 | Ga0157372_10080269 | Ga0157372_100802692 | 306 |
| 154 | 3300014326 | Ga0157380_10000059 | Ga0157380_100000598 | 306 |
| 155 | 3300022467 | Ga0224712_10009509 | Ga0224712_100095093 | 306 |
| 156 | 3300025920 | Ga0207649_10000063 | Ga0207649_10000063112 | 306 |
| 157 | 3300025924 | Ga0207694_10051979 | Ga0207694_100519793 | 306 |
| 158 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007258 | 306 |
| 159 | 3300025928 | Ga0207700_10000025 | Ga0207700_1000002577 | 306 |
| 160 | 3300025938 | Ga0207704_10000146 | Ga0207704_1000014636 | 306 |
| 161 | 3300025944 | Ga0207661_10188469 | Ga0207661_101884692 | 306 |
| 162 | 3300025949 | Ga0207667_10150188 | Ga0207667_101501882 | 306 |
| 163 | 3300026078 | Ga0207702_10185986 | Ga0207702_101859862 | 306 |
| 164 | 3300026088 | Ga0207641_10007104 | Ga0207641_100071044 | 306 |
| 165 | 3300027111 | Ga0209281_1013085 | Ga0209281_10130852 | 306 |
| 166 | 3300031824 | Ga0307413_10045649 | Ga0307413_100456493 | 306 |
| 167 | 3300031852 | Ga0307410_10054203 | Ga0307410_100542032 | 306 |
| 168 | 3300031903 | Ga0307407_10119466 | Ga0307407_101194663 | 306 |
| 169 | 3300031995 | Ga0307409_100172243 | Ga0307409_1001722432 | 306 |
| 170 | 3300032005 | Ga0307411_10231509 | Ga0307411_102315092 | 306 |
| 171 | 3300046455 | Ga0495603_0000097 | Ga0495603_0000097_2506_3492 | 306 |
| 172 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_138377_139366 | 306 |
| 173 | 3300046535 | Ga0495586_0007791 | Ga0495586_0007791_1159_2148 | 306 |
| 174 | 3300046559 | Ga0495667_0085538 | Ga0495667_0085538_980_1969 | 306 |
| 175 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_138377_139366 | 306 |
| 176 | 3300046689 | Ga0495613_0000073 | Ga0495613_0000073_9733_10722 | 306 |
| 177 | 3300047317 | Ga0495604_0000985 | Ga0495604_0000985_17422_18411 | 306 |
| 178 | 3300047444 | Ga0495675_0000428 | Ga0495675_0000428_5890_6879 | 306 |
| 179 | 3300053077 | Ga0495601_0002204 | Ga0495601_0002204_9736_10725 | 306 |
| 180 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_5890_6879 | 306 |
| 181 | 3300053085 | Ga0495619_0000147 | Ga0495619_0000147_5890_6879 | 306 |
| 182 | 3300005327 | Ga0070658_10064661 | Ga0070658_100646613 | 307 |
| 183 | 3300005339 | Ga0070660_100001878 | Ga0070660_10000187815 | 307 |
| 184 | 3300005354 | Ga0070675_100000053 | Ga0070675_10000005365 | 307 |
| 185 | 3300005564 | Ga0070664_100128239 | Ga0070664_1001282392 | 307 |
| 186 | 3300005981 | Ga0081538_10004594 | Ga0081538_1000459411 | 307 |
| 187 | 3300005981 | Ga0081538_10016142 | Ga0081538_100161426 | 307 |
| 188 | 3300006173 | Ga0070716_100217633 | Ga0070716_1002176332 | 307 |
| 189 | 3300009094 | Ga0111539_10065301 | Ga0111539_100653015 | 307 |
| 190 | 3300009147 | Ga0114129_10215708 | Ga0114129_102157083 | 307 |
| 191 | 3300013102 | Ga0157371_10005434 | Ga0157371_100054349 | 307 |
| 192 | 3300014968 | Ga0157379_10023085 | Ga0157379_100230855 | 307 |
| 193 | 3300020070 | Ga0206356_10601656 | Ga0206356_106016564 | 307 |
| 194 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010234 | 307 |
| 195 | 3300025928 | Ga0207700_10003610 | Ga0207700_100036104 | 307 |
| 196 | 3300025932 | Ga0207690_10001648 | Ga0207690_100016486 | 307 |
| 197 | 3300025945 | Ga0207679_10115103 | Ga0207679_101151031 | 307 |
| 198 | 3300025961 | Ga0207712_10160173 | Ga0207712_101601732 | 307 |
| 199 | 3300032126 | Ga0307415_100020877 | Ga0307415_1000208773 | 307 |
| 200 | 3300046500 | Ga0495596_0031416 | Ga0495596_0031416_17_943 | 307 |
| 201 | 3300046512 | Ga0495610_0028993 | Ga0495610_0028993_792_1781 | 307 |
| 202 | 3300046690 | Ga0495624_0000009 | Ga0495624_0000009_139698_140687 | 307 |
| 203 | 3300050507 | nmdc:mga05p37_144872_c1 | nmdc:mga05p37_144872_c1_1431_2414 | 307 |
| 204 | 3300002075 | JGI24738J21930_10008605 | JGI24738J21930_100086052 | 308 |
| 205 | 3300003373 | JGI25407J50210_10005129 | JGI25407J50210_100051292 | 308 |
| 206 | 3300005334 | Ga0068869_100066940 | Ga0068869_1000669402 | 308 |
| 207 | 3300005336 | Ga0070680_100301560 | Ga0070680_1003015602 | 308 |
| 208 | 3300005337 | Ga0070682_100080129 | Ga0070682_1000801291 | 308 |
| 209 | 3300005338 | Ga0068868_100005956 | Ga0068868_10000595610 | 308 |
| 210 | 3300005344 | Ga0070661_100029830 | Ga0070661_1000298302 | 308 |
| 211 | 3300005354 | Ga0070675_100195855 | Ga0070675_1001958552 | 308 |
| 212 | 3300005356 | Ga0070674_100070535 | Ga0070674_1000705352 | 308 |
| 213 | 3300005366 | Ga0070659_100024338 | Ga0070659_1000243383 | 308 |
| 214 | 3300005459 | Ga0068867_100054845 | Ga0068867_1000548453 | 308 |
| 215 | 3300005535 | Ga0070684_100024068 | Ga0070684_1000240684 | 308 |
| 216 | 3300005563 | Ga0068855_100046966 | Ga0068855_1000469664 | 308 |
| 217 | 3300005616 | Ga0068852_100044814 | Ga0068852_1000448144 | 308 |
| 218 | 3300005834 | Ga0068851_10019515 | Ga0068851_100195153 | 308 |
| 219 | 3300005981 | Ga0081538_10003315 | Ga0081538_100033152 | 308 |
| 220 | 3300006881 | Ga0068865_100034775 | Ga0068865_1000347752 | 308 |
| 221 | 3300009098 | Ga0105245_10042529 | Ga0105245_100425292 | 308 |
| 222 | 3300009148 | Ga0105243_10046579 | Ga0105243_100465792 | 308 |
| 223 | 3300009551 | Ga0105238_10040063 | Ga0105238_100400632 | 308 |
| 224 | 3300013102 | Ga0157371_10049109 | Ga0157371_100491093 | 308 |
| 225 | 3300013105 | Ga0157369_10342026 | Ga0157369_103420262 | 308 |
| 226 | 3300013307 | Ga0157372_10068938 | Ga0157372_100689381 | 308 |
| 227 | 3300013307 | Ga0157372_10478890 | Ga0157372_104788902 | 308 |
| 228 | 3300025321 | Ga0207656_10102513 | Ga0207656_101025131 | 308 |
| 229 | 3300025899 | Ga0207642_10040399 | Ga0207642_100403992 | 308 |
| 230 | 3300025918 | Ga0207662_10055643 | Ga0207662_100556432 | 308 |
| 231 | 3300025919 | Ga0207657_10006016 | Ga0207657_100060163 | 308 |
| 232 | 3300025932 | Ga0207690_10379369 | Ga0207690_103793691 | 308 |
| 233 | 3300025935 | Ga0207709_10233345 | Ga0207709_102333451 | 308 |
| 234 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020103 | 308 |
| 235 | 3300025944 | Ga0207661_10027150 | Ga0207661_100271502 | 308 |
| 236 | 3300025981 | Ga0207640_10188590 | Ga0207640_101885901 | 308 |
| 237 | 3300048929 | Ga0496126_0000108 | Ga0496126_0000108_167454_168425 | 308 |
| 238 | 3300049568 | Ga0501031_0214164 | Ga0501031_0214164_217_1236 | 308 |
| 239 | 3300049575 | Ga0501039_0098657 | Ga0501039_0098657_13_1011 | 308 |
| 240 | 3300049575 | Ga0501039_0161109 | Ga0501039_0161109_418_1437 | 308 |
| 241 | 3300049588 | Ga0501072_0108814 | Ga0501072_0108814_40_1059 | 308 |
| 242 | 3300049591 | Ga0501075_0290189 | Ga0501075_0290189_36_1055 | 308 |
| 243 | 3300060353 | Ga0501082_0235564 | Ga0501082_0235564_292_1311 | 308 |
| 244 | 3300003373 | JGI25407J50210_10014324 | JGI25407J50210_100143242 | 309 |
| 245 | 3300005842 | Ga0068858_100000267 | Ga0068858_10000026741 | 309 |
| 246 | 3300005981 | Ga0081538_10003073 | Ga0081538_100030737 | 309 |
| 247 | 3300005981 | Ga0081538_10021887 | Ga0081538_100218872 | 309 |
| 248 | 3300005985 | Ga0081539_10001929 | Ga0081539_100019293 | 309 |
| 249 | 3300025931 | Ga0207644_10175626 | Ga0207644_101756262 | 309 |
| 250 | 3300026035 | Ga0207703_10000040 | Ga0207703_10000040109 | 309 |
| 251 | 3300026118 | Ga0207675_100466808 | Ga0207675_1004668082 | 309 |
| 252 | 3300028577 | Ga0265318_10017106 | Ga0265318_100171063 | 309 |
| 253 | 3300028800 | Ga0265338_10016842 | Ga0265338_100168424 | 309 |
| 254 | 3300045049 | Ga0466959_0156171 | Ga0466959_0156171_420_1403 | 309 |
| 255 | 3300046679 | Ga0495623_0132179 | Ga0495623_0132179_210_1199 | 309 |
| 256 | 3300046681 | Ga0495647_0000025 | Ga0495647_0000025_47577_48566 | 309 |
| 257 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_60473_61462 | 309 |
| 258 | 3300048909 | Ga0496106_0000149 | Ga0496106_0000149_50357_51346 | 309 |
| 259 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_130735_131724 | 309 |
| 260 | 3300053083 | Ga0495655_0005518 | Ga0495655_0005518_653_1750 | 309 |
| 261 | 3300005329 | Ga0070683_100030210 | Ga0070683_1000302103 | 310 |
| 262 | 3300005455 | Ga0070663_100023142 | Ga0070663_1000231426 | 310 |
| 263 | 3300005530 | Ga0070679_100014166 | Ga0070679_1000141661 | 310 |
| 264 | 3300005535 | Ga0070684_100025949 | Ga0070684_1000259493 | 310 |
| 265 | 3300005614 | Ga0068856_100184340 | Ga0068856_1001843403 | 310 |
| 266 | 3300005981 | Ga0081538_10047697 | Ga0081538_100476972 | 310 |
| 267 | 3300006175 | Ga0070712_100001071 | Ga0070712_1000010719 | 310 |
| 268 | 3300006852 | Ga0075433_10015865 | Ga0075433_100158655 | 310 |
| 269 | 3300014969 | Ga0157376_10176393 | Ga0157376_101763932 | 310 |
| 270 | 3300020080 | Ga0206350_10365630 | Ga0206350_103656301 | 310 |
| 271 | 3300025915 | Ga0207693_10002622 | Ga0207693_100026228 | 310 |
| 272 | 3300025921 | Ga0207652_10125620 | Ga0207652_101256201 | 310 |
| 273 | 3300025944 | Ga0207661_10009162 | Ga0207661_100091621 | 310 |
| 274 | 3300025944 | Ga0207661_10009503 | Ga0207661_100095038 | 310 |
| 275 | 3300026067 | Ga0207678_10012342 | Ga0207678_1001234210 | 310 |
| 276 | 3300026078 | Ga0207702_10088937 | Ga0207702_100889372 | 310 |
| 277 | 3300048905 | Ga0496102_0299530 | Ga0496102_0299530_16_957 | 310 |
| 278 | 3300049585 | Ga0501069_0007590 | Ga0501069_0007590_389_1378 | 310 |
| 279 | 3300049587 | Ga0501071_0070366 | Ga0501071_0070366_133_1122 | 310 |
| 280 | 3300049590 | Ga0501074_0030021 | Ga0501074_0030021_348_1337 | 310 |
| 281 | 3300049591 | Ga0501075_0181602 | Ga0501075_0181602_547_1545 | 310 |
| 282 | 3300049593 | Ga0501077_0083695 | Ga0501077_0083695_364_1362 | 310 |
| 283 | 3300049742 | Ga0501080_0050087 | Ga0501080_0050087_2787_3776 | 310 |
| 284 | 3300049823 | Ga0501044_0049171 | Ga0501044_0049171_250_1239 | 310 |
| 285 | 3300050515 | nmdc:mga0a205_38052_c1 | nmdc:mga0a205_38052_c1_23_1006 | 310 |
| 286 | 3300005327 | Ga0070658_10245389 | Ga0070658_102453892 | 311 |
| 287 | 3300005937 | Ga0081455_10028011 | Ga0081455_100280114 | 311 |
| 288 | 3300006051 | Ga0075364_10188149 | Ga0075364_101881493 | 311 |
| 289 | 3300006173 | Ga0070716_100263271 | Ga0070716_1002632712 | 311 |
| 290 | 3300006914 | Ga0075436_100228362 | Ga0075436_1002283621 | 311 |
| 291 | 3300013296 | Ga0157374_10451073 | Ga0157374_104510731 | 311 |
| 292 | 3300025908 | Ga0207643_10147964 | Ga0207643_101479641 | 311 |
| 293 | 3300037312 | Ga0395899_0040871 | Ga0395899_0040871_713_1702 | 311 |
| 294 | 3300037418 | Ga0395900_0068406 | Ga0395900_0068406_897_1886 | 311 |
| 295 | 3300037466 | Ga0395898_0031362 | Ga0395898_0031362_489_1478 | 311 |
| 296 | 3300037471 | Ga0395905_0071433 | Ga0395905_0071433_1808_2797 | 311 |
| 297 | 3300038443 | Ga0395901_0148255 | Ga0395901_0148255_1092_2081 | 311 |
| 298 | 3300045976 | Ga0466967_0000027 | Ga0466967_0000027_24050_25039 | 311 |
| 299 | 3300005549 | Ga0070704_100148947 | Ga0070704_1001489472 | 312 |
| 300 | 3300006871 | Ga0075434_100137545 | Ga0075434_1001375451 | 312 |
| 301 | 3300037418 | Ga0395900_0017631 | Ga0395900_0017631_5588_6571 | 312 |
| 302 | 3300037466 | Ga0395898_0053394 | Ga0395898_0053394_2008_2991 | 312 |
| 303 | 3300044694 | Ga0466963_0061539 | Ga0466963_0061539_181_1158 | 312 |
| 304 | 3300046516 | Ga0495628_0002459 | Ga0495628_0002459_7561_8553 | 312 |
| 305 | 3300046523 | Ga0495644_0007172 | Ga0495644_0007172_1833_2822 | 312 |
| 306 | 3300046678 | Ga0495599_0048369 | Ga0495599_0048369_1363_2355 | 312 |
| 307 | 3300049581 | Ga0501047_0038927 | Ga0501047_0038927_1207_2196 | 312 |
| 308 | 3300049583 | Ga0501067_0000348 | Ga0501067_0000348_7328_8371 | 312 |
| 309 | 3300061734 | Ga0530510_0013546 | Ga0530510_0013546_2225_3268 | 312 |
| 310 | 3300003203 | JGI25406J46586_10016276 | JGI25406J46586_100162763 | 313 |
| 311 | 3300005618 | Ga0068864_100000045 | Ga0068864_10000004542 | 313 |
| 312 | 3300005985 | Ga0081539_10001668 | Ga0081539_1000166818 | 313 |
| 313 | 3300025939 | Ga0207665_10182238 | Ga0207665_101822382 | 313 |
| 314 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016121 | 313 |
| 315 | 3300028381 | Ga0268264_10006502 | Ga0268264_100065029 | 313 |
| 316 | 3300036401 | Ga0373937_0334799 | Ga0373937_0334799_242_1225 | 313 |
| 317 | 3300045976 | Ga0466967_0211313 | Ga0466967_0211313_733_1743 | 313 |
| 318 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_57569_58561 | 313 |
| 319 | 3300046642 | Ga0495634_0027184 | Ga0495634_0027184_2184_3167 | 313 |
| 320 | 3300046642 | Ga0495634_0053650 | Ga0495634_0053650_955_1944 | 313 |
| 321 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_59382_60368 | 313 |
| 322 | 3300046689 | Ga0495613_0000152 | Ga0495613_0000152_80_1066 | 313 |
| 323 | 3300047319 | Ga0495674_0186670 | Ga0495674_0186670_523_1506 | 313 |
| 324 | 3300047447 | Ga0495685_034437 | Ga0495685_034437_169_1155 | 313 |
| 325 | 3300049592 | Ga0501076_0142235 | Ga0501076_0142235_473_1477 | 313 |
| 326 | 3300005337 | Ga0070682_100000045 | Ga0070682_10000004516 | 314 |
| 327 | 3300005356 | Ga0070674_100158725 | Ga0070674_1001587251 | 314 |
| 328 | 3300005365 | Ga0070688_100060783 | Ga0070688_1000607832 | 314 |
| 329 | 3300005439 | Ga0070711_100247965 | Ga0070711_1002479651 | 314 |
| 330 | 3300005456 | Ga0070678_100007927 | Ga0070678_1000079272 | 314 |
| 331 | 3300005549 | Ga0070704_100028529 | Ga0070704_1000285293 | 314 |
| 332 | 3300005578 | Ga0068854_100000031 | Ga0068854_10000003187 | 314 |
| 333 | 3300005834 | Ga0068851_10000656 | Ga0068851_1000065619 | 314 |
| 334 | 3300006173 | Ga0070716_100224153 | Ga0070716_1002241532 | 314 |
| 335 | 3300006175 | Ga0070712_100056677 | Ga0070712_1000566775 | 314 |
| 336 | 3300009098 | Ga0105245_10000236 | Ga0105245_1000023620 | 314 |
| 337 | 3300009098 | Ga0105245_10006569 | Ga0105245_100065694 | 314 |
| 338 | 3300009101 | Ga0105247_10067293 | Ga0105247_100672933 | 314 |
| 339 | 3300009148 | Ga0105243_10297599 | Ga0105243_102975992 | 314 |
| 340 | 3300009176 | Ga0105242_10132675 | Ga0105242_101326752 | 314 |
| 341 | 3300013297 | Ga0157378_10289166 | Ga0157378_102891662 | 314 |
| 342 | 3300013307 | Ga0157372_10000409 | Ga0157372_1000040916 | 314 |
| 343 | 3300013308 | Ga0157375_10106522 | Ga0157375_101065222 | 314 |
| 344 | 3300014969 | Ga0157376_10212168 | Ga0157376_102121681 | 314 |
| 345 | 3300020082 | Ga0206353_11406144 | Ga0206353_114061441 | 314 |
| 346 | 3300025321 | Ga0207656_10002957 | Ga0207656_100029576 | 314 |
| 347 | 3300025915 | Ga0207693_10000677 | Ga0207693_1000067727 | 314 |
| 348 | 3300025916 | Ga0207663_10229404 | Ga0207663_102294041 | 314 |
| 349 | 3300025926 | Ga0207659_10227067 | Ga0207659_102270672 | 314 |
| 350 | 3300025927 | Ga0207687_10004769 | Ga0207687_100047694 | 314 |
| 351 | 3300025927 | Ga0207687_10034822 | Ga0207687_100348222 | 314 |
| 352 | 3300025929 | Ga0207664_10123464 | Ga0207664_101234642 | 314 |
| 353 | 3300025934 | Ga0207686_10254242 | Ga0207686_102542422 | 314 |
| 354 | 3300025981 | Ga0207640_10000015 | Ga0207640_10000015129 | 314 |
| 355 | 3300026023 | Ga0207677_10019123 | Ga0207677_100191234 | 314 |
| 356 | 3300026121 | Ga0207683_10022220 | Ga0207683_100222205 | 314 |
| 357 | 3300045049 | Ga0466959_0137177 | Ga0466959_0137177_675_1658 | 314 |
| 358 | 3300046476 | Ga0495662_0000650 | Ga0495662_0000650_7232_8218 | 314 |
| 359 | 3300046516 | Ga0495628_0000144 | Ga0495628_0000144_2388_3377 | 314 |
| 360 | 3300046543 | Ga0495645_0028397 | Ga0495645_0028397_2896_3900 | 314 |
| 361 | 3300047315 | Ga0495581_0114745 | Ga0495581_0114745_238_1218 | 314 |
| 362 | 3300048088 | Ga0495602_0001790 | Ga0495602_0001790_15770_16759 | 314 |
| 363 | 3300048903 | Ga0496100_0037106 | Ga0496100_0037106_999_1979 | 314 |
| 364 | 3300048904 | Ga0496101_0094853 | Ga0496101_0094853_936_1916 | 314 |
| 365 | 3300048905 | Ga0496102_0008457 | Ga0496102_0008457_6409_7389 | 314 |
| 366 | 3300048906 | Ga0496103_0006820 | Ga0496103_0006820_2076_3056 | 314 |
| 367 | 3300048907 | Ga0496104_0126464 | Ga0496104_0126464_662_1642 | 314 |
| 368 | 3300048908 | Ga0496105_0014782 | Ga0496105_0014782_4066_5046 | 314 |
| 369 | 3300048909 | Ga0496106_0047208 | Ga0496106_0047208_1501_2481 | 314 |
| 370 | 3300048910 | Ga0496107_0001394 | Ga0496107_0001394_12692_13672 | 314 |
| 371 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_32408_33397 | 314 |
| 372 | 3300048912 | Ga0496109_0222627 | Ga0496109_0222627_316_1296 | 314 |
| 373 | 3300048913 | Ga0496110_0006813 | Ga0496110_0006813_304_1284 | 314 |
| 374 | 3300048914 | Ga0496111_0003320 | Ga0496111_0003320_402_1382 | 314 |
| 375 | 3300048915 | Ga0496112_0253016 | Ga0496112_0253016_239_1219 | 314 |
| 376 | 3300048917 | Ga0496114_0156407 | Ga0496114_0156407_298_1278 | 314 |
| 377 | 3300048918 | Ga0496115_0123722 | Ga0496115_0123722_859_1839 | 314 |
| 378 | 3300053077 | Ga0495601_0139636 | Ga0495601_0139636_199_1203 | 314 |
| 379 | 3300053085 | Ga0495619_0000055 | Ga0495619_0000055_52718_53707 | 314 |
| 380 | 3300005614 | Ga0068856_100001194 | Ga0068856_10000119433 | 315 |
| 381 | 3300005937 | Ga0081455_10003252 | Ga0081455_1000325213 | 315 |
| 382 | 3300006852 | Ga0075433_10001485 | Ga0075433_1000148514 | 315 |
| 383 | 3300013104 | Ga0157370_10140814 | Ga0157370_101408142 | 315 |
| 384 | 3300026078 | Ga0207702_10000607 | Ga0207702_1000060714 | 315 |
| 385 | 3300048916 | Ga0496113_0000029 | Ga0496113_0000029_42615_43604 | 315 |
| 386 | 3300048920 | Ga0496117_0020230 | Ga0496117_0020230_1897_2886 | 315 |
| 387 | 3300048921 | Ga0496118_0005186 | Ga0496118_0005186_11305_12294 | 315 |
| 388 | 3300048924 | Ga0496121_0101167 | Ga0496121_0101167_64_1053 | 315 |
| 389 | 3300049568 | Ga0501031_0000434 | Ga0501031_0000434_858_1847 | 315 |
| 390 | 3300049568 | Ga0501031_0029713 | Ga0501031_0029713_1387_2385 | 315 |
| 391 | 3300049569 | Ga0501032_0000899 | Ga0501032_0000899_22247_23236 | 315 |
| 392 | 3300049570 | Ga0501033_0001140 | Ga0501033_0001140_22256_23245 | 315 |
| 393 | 3300049571 | Ga0501034_0124121 | Ga0501034_0124121_979_1968 | 315 |
| 394 | 3300049572 | Ga0501036_0029623 | Ga0501036_0029623_657_1646 | 315 |
| 395 | 3300049573 | Ga0501037_0000774 | Ga0501037_0000774_665_1654 | 315 |
| 396 | 3300049574 | Ga0501038_0001146 | Ga0501038_0001146_773_1762 | 315 |
| 397 | 3300049575 | Ga0501039_0098643 | Ga0501039_0098643_732_1721 | 315 |
| 398 | 3300049579 | Ga0501043_0001082 | Ga0501043_0001082_22245_23234 | 315 |
| 399 | 3300049580 | Ga0501046_0000447 | Ga0501046_0000447_22243_23232 | 315 |
| 400 | 3300049581 | Ga0501047_0001335 | Ga0501047_0001335_22403_23392 | 315 |
| 401 | 3300049582 | Ga0501048_0000734 | Ga0501048_0000734_22229_23218 | 315 |
| 402 | 3300049585 | Ga0501069_0038721 | Ga0501069_0038721_585_1574 | 315 |
| 403 | 3300049586 | Ga0501070_0001137 | Ga0501070_0001137_22234_23223 | 315 |
| 404 | 3300049589 | Ga0501073_0049364 | Ga0501073_0049364_606_1595 | 315 |
| 405 | 3300049590 | Ga0501074_0038770 | Ga0501074_0038770_1863_2852 | 315 |
| 406 | 3300049741 | Ga0501079_0017085 | Ga0501079_0017085_653_1642 | 315 |
| 407 | 3300049744 | Ga0501083_0023660 | Ga0501083_0023660_2680_3669 | 315 |
| 408 | 3300049822 | Ga0501035_0002398 | Ga0501035_0002398_763_1752 | 315 |
| 409 | 3300049823 | Ga0501044_0003241 | Ga0501044_0003241_707_1696 | 315 |
| 410 | 3300049823 | Ga0501044_0167828 | Ga0501044_0167828_486_1475 | 315 |
| 411 | 3300049824 | Ga0501045_0013972 | Ga0501045_0013972_3951_4940 | 315 |
| 412 | 3300050515 | nmdc:mga0a205_1916_c1 | nmdc:mga0a205_1916_c1_13257_14282 | 315 |
| 413 | 3300060353 | Ga0501082_0051874 | Ga0501082_0051874_2526_3515 | 315 |
| 414 | 3300005347 | Ga0070668_100116183 | Ga0070668_1001161831 | 316 |
| 415 | 3300005367 | Ga0070667_100000695 | Ga0070667_10000069518 | 316 |
| 416 | 3300005548 | Ga0070665_100279050 | Ga0070665_1002790502 | 316 |
| 417 | 3300005841 | Ga0068863_100339780 | Ga0068863_1003397802 | 316 |
| 418 | 3300005844 | Ga0068862_100008832 | Ga0068862_1000088327 | 316 |
| 419 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001201 | 316 |
| 420 | 3300013100 | Ga0157373_10093096 | Ga0157373_100930962 | 316 |
| 421 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011201 | 316 |
| 422 | 3300025961 | Ga0207712_10020852 | Ga0207712_100208524 | 316 |
| 423 | 3300025986 | Ga0207658_10025449 | Ga0207658_100254491 | 316 |
| 424 | 3300026088 | Ga0207641_10275188 | Ga0207641_102751882 | 316 |
| 425 | 3300026121 | Ga0207683_10055774 | Ga0207683_100557745 | 316 |
| 426 | 3300027111 | Ga0209281_1004136 | Ga0209281_10041363 | 316 |
| 427 | 3300028380 | Ga0268265_10000555 | Ga0268265_1000055516 | 316 |
| 428 | 3300041512 | Ga0451853_0128655 | Ga0451853_0128655_1124_2131 | 316 |
| 429 | 3300046455 | Ga0495603_0007864 | Ga0495603_0007864_3386_4375 | 316 |
| 430 | 3300046476 | Ga0495662_0034097 | Ga0495662_0034097_1268_2257 | 316 |
| 431 | 3300005331 | Ga0070670_100090285 | Ga0070670_1000902853 | 317 |
| 432 | 3300005336 | Ga0070680_100081060 | Ga0070680_1000810603 | 317 |
| 433 | 3300005344 | Ga0070661_100036846 | Ga0070661_1000368463 | 317 |
| 434 | 3300005458 | Ga0070681_10010625 | Ga0070681_100106256 | 317 |
| 435 | 3300005530 | Ga0070679_100033291 | Ga0070679_1000332912 | 317 |
| 436 | 3300005535 | Ga0070684_100038133 | Ga0070684_1000381333 | 317 |
| 437 | 3300005614 | Ga0068856_100173482 | Ga0068856_1001734822 | 317 |
| 438 | 3300005843 | Ga0068860_100130464 | Ga0068860_1001304642 | 317 |
| 439 | 3300005981 | Ga0081538_10046933 | Ga0081538_100469333 | 317 |
| 440 | 3300010375 | Ga0105239_10374451 | Ga0105239_103744512 | 317 |
| 441 | 3300013307 | Ga0157372_10035008 | Ga0157372_100350084 | 317 |
| 442 | 3300013307 | Ga0157372_10100239 | Ga0157372_101002393 | 317 |
| 443 | 3300014326 | Ga0157380_10002264 | Ga0157380_100022646 | 317 |
| 444 | 3300025909 | Ga0207705_10112357 | Ga0207705_101123572 | 317 |
| 445 | 3300025912 | Ga0207707_10023261 | Ga0207707_100232612 | 317 |
| 446 | 3300025917 | Ga0207660_10027356 | Ga0207660_100273563 | 317 |
| 447 | 3300025921 | Ga0207652_10110598 | Ga0207652_101105983 | 317 |
| 448 | 3300025925 | Ga0207650_10024224 | Ga0207650_100242244 | 317 |
| 449 | 3300025931 | Ga0207644_10238498 | Ga0207644_102384982 | 317 |
| 450 | 3300026067 | Ga0207678_10170749 | Ga0207678_101707492 | 317 |
| 451 | 3300026078 | Ga0207702_10389868 | Ga0207702_103898682 | 317 |
| 452 | 3300026118 | Ga0207675_100096249 | Ga0207675_1000962493 | 317 |
| 453 | 3300037312 | Ga0395899_0019528 | Ga0395899_0019528_1169_2203 | 317 |
| 454 | 3300037418 | Ga0395900_0022240 | Ga0395900_0022240_4653_5687 | 317 |
| 455 | 3300037466 | Ga0395898_0105247 | Ga0395898_0105247_869_1903 | 317 |
| 456 | 3300037471 | Ga0395905_0010080 | Ga0395905_0010080_3806_4840 | 317 |
| 457 | 3300038443 | Ga0395901_0014107 | Ga0395901_0014107_4963_5997 | 317 |
| 458 | 3300049586 | Ga0501070_0158987 | Ga0501070_0158987_311_1300 | 317 |
| 459 | 3300005335 | Ga0070666_10029341 | Ga0070666_100293414 | 318 |
| 460 | 3300005544 | Ga0070686_100242430 | Ga0070686_1002424301 | 318 |
| 461 | 3300009094 | Ga0111539_10044466 | Ga0111539_100444665 | 318 |
| 462 | 3300009147 | Ga0114129_10014103 | Ga0114129_100141039 | 318 |
| 463 | 3300025903 | Ga0207680_10010826 | Ga0207680_100108261 | 318 |
| 464 | 3300027907 | Ga0207428_10020123 | Ga0207428_100201233 | 318 |
| 465 | 3300032002 | Ga0307416_100010497 | Ga0307416_1000104973 | 318 |
| 466 | 3300032126 | Ga0307415_100357145 | Ga0307415_1003571451 | 318 |
| 467 | 3300037466 | Ga0395898_0053265 | Ga0395898_0053265_2272_3255 | 318 |
| 468 | 3300038443 | Ga0395901_0018370 | Ga0395901_0018370_4351_5334 | 318 |
| 469 | 3300046536 | Ga0495587_0005378 | Ga0495587_0005378_6123_7112 | 318 |
| 470 | 3300049591 | Ga0501075_0000392 | Ga0501075_0000392_17984_18973 | 318 |
| 471 | 3300050507 | nmdc:mga05p37_170780_c1 | nmdc:mga05p37_170780_c1_208_1194 | 318 |
| 472 | 3300050511 | nmdc:mga08y16_9951_c1 | nmdc:mga08y16_9951_c1_2992_3978 | 318 |
| 473 | 3300010375 | Ga0105239_10351710 | Ga0105239_103517101 | 319 |
| 474 | 3300025899 | Ga0207642_10024114 | Ga0207642_100241143 | 319 |
| 475 | 3300025927 | Ga0207687_10000247 | Ga0207687_1000024726 | 319 |
| 476 | 3300032126 | Ga0307415_100177466 | Ga0307415_1001774662 | 319 |
| 477 | 3300047322 | Ga0495680_0000317 | Ga0495680_0000317_48350_49339 | 319 |
| 478 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_289335_290324 | 319 |
| 479 | 3300049583 | Ga0501067_0052936 | Ga0501067_0052936_143_1129 | 319 |
| 480 | 3300053085 | Ga0495619_0146912 | Ga0495619_0146912_276_1262 | 319 |
| 481 | iso_pu_bacteria | 8007375930 | 8007378304 | 319 |
| 482 | 3300009551 | Ga0105238_10000011 | Ga0105238_1000001117 | 320 |
| 483 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004604 | 320 |
| 484 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_569349_570341 | 320 |
| 485 | 3300048908 | Ga0496105_0019941 | Ga0496105_0019941_1148_2137 | 320 |
| 486 | 3300048910 | Ga0496107_0037613 | Ga0496107_0037613_627_1616 | 320 |
| 487 | 3300048913 | Ga0496110_0002884 | Ga0496110_0002884_650_1642 | 320 |
| 488 | 3300048914 | Ga0496111_0000021 | Ga0496111_0000021_18906_19898 | 320 |
| 489 | 3300048924 | Ga0496121_0052505 | Ga0496121_0052505_1419_2408 | 320 |
| 490 | 3300048929 | Ga0496126_0049736 | Ga0496126_0049736_1569_2558 | 320 |
| 491 | 3300005356 | Ga0070674_100000082 | Ga0070674_10000008242 | 321 |
| 492 | 3300005548 | Ga0070665_100005026 | Ga0070665_10000502615 | 321 |
| 493 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001227 | 321 |
| 494 | 3300025899 | Ga0207642_10000007 | Ga0207642_100000076 | 321 |
| 495 | 3300025937 | Ga0207669_10000012 | Ga0207669_1000001247 | 321 |
| 496 | 3300028379 | Ga0268266_10055957 | Ga0268266_100559572 | 321 |
| 497 | 3300050507 | nmdc:mga05p37_71033_c2 | nmdc:mga05p37_71033_c2_688_1680 | 321 |
| 498 | 3300053078 | Ga0495612_0001555 | Ga0495612_0001555_5486_6475 | 321 |
| 499 | 3300005329 | Ga0070683_100006385 | Ga0070683_1000063854 | 322 |
| 500 | 3300005457 | Ga0070662_100000016 | Ga0070662_10000001664 | 322 |
| 501 | 3300005535 | Ga0070684_100024149 | Ga0070684_1000241495 | 322 |
| 502 | 3300005548 | Ga0070665_100000244 | Ga0070665_10000024446 | 322 |
| 503 | 3300005842 | Ga0068858_100001207 | Ga0068858_10000120719 | 322 |
| 504 | 3300025933 | Ga0207706_10000068 | Ga0207706_1000006865 | 322 |
| 505 | 3300025944 | Ga0207661_10008086 | Ga0207661_100080867 | 322 |
| 506 | 3300026035 | Ga0207703_10001815 | Ga0207703_1000181510 | 322 |
| 507 | 3300028379 | Ga0268266_10000020 | Ga0268266_1000002044 | 322 |
| 508 | 3300037418 | Ga0395900_0452587 | Ga0395900_0452587_66_1076 | 322 |
| 509 | 3300037471 | Ga0395905_0168995 | Ga0395905_0168995_234_1271 | 322 |
| 510 | 3300038443 | Ga0395901_0026219 | Ga0395901_0026219_2953_3990 | 322 |
| 511 | 3300005337 | Ga0070682_100002116 | Ga0070682_1000021162 | 323 |
| 512 | 3300009098 | Ga0105245_10108988 | Ga0105245_101089883 | 323 |
| 513 | 3300025918 | Ga0207662_10124173 | Ga0207662_101241732 | 323 |
| 514 | 3300036401 | Ga0373937_0168677 | Ga0373937_0168677_392_1426 | 323 |
| 515 | 3300038443 | Ga0395901_0254951 | Ga0395901_0254951_564_1553 | 323 |
| 516 | 3300041458 | Ga0451798_0735618 | Ga0451798_0735618_202_1230 | 323 |
| 517 | 3300044694 | Ga0466963_0000023 | Ga0466963_0000023_50761_51750 | 323 |
| 518 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_27630_28619 | 323 |
| 519 | 3300048904 | Ga0496101_0000221 | Ga0496101_0000221_37291_38280 | 323 |
| 520 | 3300048909 | Ga0496106_0000018 | Ga0496106_0000018_169823_170812 | 323 |
| 521 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_96553_97542 | 323 |
| 522 | 3300006852 | Ga0075433_10018515 | Ga0075433_100185152 | 324 |
| 523 | 3300044719 | Ga0466971_0124073 | Ga0466971_0124073_35_1144 | 324 |
| 524 | 3300045976 | Ga0466967_0180119 | Ga0466967_0180119_576_1685 | 324 |
| 525 | 3300005336 | Ga0070680_100101413 | Ga0070680_1001014131 | 325 |
| 526 | 3300005336 | Ga0070680_100143896 | Ga0070680_1001438961 | 325 |
| 527 | 3300005337 | Ga0070682_100014100 | Ga0070682_1000141001 | 325 |
| 528 | 3300005337 | Ga0070682_100080676 | Ga0070682_1000806761 | 325 |
| 529 | 3300005339 | Ga0070660_100002874 | Ga0070660_1000028747 | 325 |
| 530 | 3300005436 | Ga0070713_100160693 | Ga0070713_1001606932 | 325 |
| 531 | 3300005439 | Ga0070711_100092307 | Ga0070711_1000923072 | 325 |
| 532 | 3300005457 | Ga0070662_100093451 | Ga0070662_1000934511 | 325 |
| 533 | 3300005458 | Ga0070681_10013721 | Ga0070681_100137214 | 325 |
| 534 | 3300005458 | Ga0070681_10056580 | Ga0070681_100565801 | 325 |
| 535 | 3300005530 | Ga0070679_100031669 | Ga0070679_1000316694 | 325 |
| 536 | 3300005535 | Ga0070684_100023464 | Ga0070684_1000234644 | 325 |
| 537 | 3300005535 | Ga0070684_100091076 | Ga0070684_1000910762 | 325 |
| 538 | 3300005548 | Ga0070665_100017879 | Ga0070665_1000178794 | 325 |
| 539 | 3300005577 | Ga0068857_100058998 | Ga0068857_1000589982 | 325 |
| 540 | 3300005614 | Ga0068856_100043149 | Ga0068856_1000431494 | 325 |
| 541 | 3300005616 | Ga0068852_100239073 | Ga0068852_1002390733 | 325 |
| 542 | 3300006175 | Ga0070712_100003981 | Ga0070712_1000039819 | 325 |
| 543 | 3300006175 | Ga0070712_100186842 | Ga0070712_1001868423 | 325 |
| 544 | 3300006847 | Ga0075431_100230163 | Ga0075431_1002301632 | 325 |
| 545 | 3300009098 | Ga0105245_10240515 | Ga0105245_102405152 | 325 |
| 546 | 3300009098 | Ga0105245_10247711 | Ga0105245_102477112 | 325 |
| 547 | 3300009098 | Ga0105245_10282589 | Ga0105245_102825892 | 325 |
| 548 | 3300009148 | Ga0105243_10014354 | Ga0105243_100143547 | 325 |
| 549 | 3300009551 | Ga0105238_10081390 | Ga0105238_100813902 | 325 |
| 550 | 3300010375 | Ga0105239_10392819 | Ga0105239_103928192 | 325 |
| 551 | 3300013102 | Ga0157371_10050500 | Ga0157371_100505002 | 325 |
| 552 | 3300013104 | Ga0157370_10069784 | Ga0157370_100697842 | 325 |
| 553 | 3300013104 | Ga0157370_10160855 | Ga0157370_101608551 | 325 |
| 554 | 3300013105 | Ga0157369_10003551 | Ga0157369_1000355113 | 325 |
| 555 | 3300013105 | Ga0157369_10033166 | Ga0157369_100331664 | 325 |
| 556 | 3300013105 | Ga0157369_10193773 | Ga0157369_101937732 | 325 |
| 557 | 3300013105 | Ga0157369_10195655 | Ga0157369_101956552 | 325 |
| 558 | 3300013307 | Ga0157372_10031427 | Ga0157372_100314274 | 325 |
| 559 | 3300013307 | Ga0157372_10176247 | Ga0157372_101762472 | 325 |
| 560 | 3300014497 | Ga0182008_10083110 | Ga0182008_100831102 | 325 |
| 561 | 3300020070 | Ga0206356_10112548 | Ga0206356_101125482 | 325 |
| 562 | 3300020070 | Ga0206356_10303627 | Ga0206356_103036271 | 325 |
| 563 | 3300020077 | Ga0206351_10463088 | Ga0206351_104630882 | 325 |
| 564 | 3300021377 | Ga0213874_10000607 | Ga0213874_100006076 | 325 |
| 565 | 3300021384 | Ga0213876_10004540 | Ga0213876_100045406 | 325 |
| 566 | 3300021384 | Ga0213876_10007254 | Ga0213876_100072544 | 325 |
| 567 | 3300021388 | Ga0213875_10000199 | Ga0213875_1000019929 | 325 |
| 568 | 3300025912 | Ga0207707_10333648 | Ga0207707_103336482 | 325 |
| 569 | 3300025915 | Ga0207693_10001903 | Ga0207693_1000190312 | 325 |
| 570 | 3300025917 | Ga0207660_10064247 | Ga0207660_100642472 | 325 |
| 571 | 3300025919 | Ga0207657_10004630 | Ga0207657_100046306 | 325 |
| 572 | 3300025919 | Ga0207657_10011291 | Ga0207657_100112916 | 325 |
| 573 | 3300025919 | Ga0207657_10058586 | Ga0207657_100585862 | 325 |
| 574 | 3300025920 | Ga0207649_10077206 | Ga0207649_100772062 | 325 |
| 575 | 3300025921 | Ga0207652_10169370 | Ga0207652_101693702 | 325 |
| 576 | 3300025921 | Ga0207652_10368781 | Ga0207652_103687812 | 325 |
| 577 | 3300025928 | Ga0207700_10021302 | Ga0207700_100213023 | 325 |
| 578 | 3300025929 | Ga0207664_10100265 | Ga0207664_101002652 | 325 |
| 579 | 3300025932 | Ga0207690_10050488 | Ga0207690_100504882 | 325 |
| 580 | 3300025939 | Ga0207665_10209651 | Ga0207665_102096512 | 325 |
| 581 | 3300025944 | Ga0207661_10029153 | Ga0207661_100291532 | 325 |
| 582 | 3300026078 | Ga0207702_10214928 | Ga0207702_102149283 | 325 |
| 583 | 3300026116 | Ga0207674_10014502 | Ga0207674_100145021 | 325 |
| 584 | 3300035119 | Ga0373956_0111322 | Ga0373956_0111322_199_1176 | 325 |
| 585 | 3300035170 | Ga0373943_0000450 | Ga0373943_0000450_12247_13233 | 325 |
| 586 | 3300035171 | Ga0373946_0004358 | Ga0373946_0004358_1532_2518 | 325 |
| 587 | 3300035695 | Ga0373927_0022758 | Ga0373927_0022758_2594_3580 | 325 |
| 588 | 3300035724 | Ga0373933_0023238 | Ga0373933_0023238_1203_2258 | 325 |
| 589 | 3300035725 | Ga0373947_0002176 | Ga0373947_0002176_8622_9608 | 325 |
| 590 | 3300036401 | Ga0373937_0011597 | Ga0373937_0011597_3559_4536 | 325 |
| 591 | 3300037068 | Ga0373925_0003354 | Ga0373925_0003354_6535_7521 | 325 |
| 592 | 3300037312 | Ga0395899_0075426 | Ga0395899_0075426_265_1305 | 325 |
| 593 | 3300037418 | Ga0395900_0462972 | Ga0395900_0462972_114_1154 | 325 |
| 594 | 3300037466 | Ga0395898_0002496 | Ga0395898_0002496_17865_18914 | 325 |
| 595 | 3300037466 | Ga0395898_0042172 | Ga0395898_0042172_2919_3905 | 325 |
| 596 | 3300037471 | Ga0395905_0172870 | Ga0395905_0172870_136_1122 | 325 |
| 597 | 3300037853 | Ga0436364_0527107 | Ga0436364_0527107_47787_48764 | 325 |
| 598 | 3300038443 | Ga0395901_0577279 | Ga0395901_0577279_50_1036 | 325 |
| 599 | 3300039437 | Ga0436365_0344023 | Ga0436365_0344023_4114_5112 | 325 |
| 600 | 3300039437 | Ga0436365_0823300 | Ga0436365_0823300_4178_5176 | 325 |
| 601 | 3300039437 | Ga0436365_1182882 | Ga0436365_1182882_105_1091 | 325 |
| 602 | 3300039437 | Ga0436365_1248745 | Ga0436365_1248745_578_1555 | 325 |
| 603 | 3300039450 | Ga0436363_0675171 | Ga0436363_0675171_22135_23133 | 325 |
| 604 | 3300044684 | Ga0466966_0087254 | Ga0466966_0087254_740_1780 | 325 |
| 605 | 3300044693 | Ga0466961_0009994 | Ga0466961_0009994_1869_2912 | 325 |
| 606 | 3300044693 | Ga0466961_0019451 | Ga0466961_0019451_1704_2681 | 325 |
| 607 | 3300044693 | Ga0466961_0122770 | Ga0466961_0122770_277_1320 | 325 |
| 608 | 3300044694 | Ga0466963_0073596 | Ga0466963_0073596_301_1344 | 325 |
| 609 | 3300044694 | Ga0466963_0118600 | Ga0466963_0118600_463_1506 | 325 |
| 610 | 3300044706 | Ga0466964_0018912 | Ga0466964_0018912_198_1241 | 325 |
| 611 | 3300044706 | Ga0466964_0057309 | Ga0466964_0057309_479_1522 | 325 |
| 612 | 3300044719 | Ga0466971_0001268 | Ga0466971_0001268_8862_9905 | 325 |
| 613 | 3300044735 | Ga0466968_0009508 | Ga0466968_0009508_555_1598 | 325 |
| 614 | 3300044842 | Ga0466957_0000566 | Ga0466957_0000566_3526_4569 | 325 |
| 615 | 3300044901 | Ga0466960_0024390 | Ga0466960_0024390_714_1757 | 325 |
| 616 | 3300045049 | Ga0466959_0001055 | Ga0466959_0001055_5256_6299 | 325 |
| 617 | 3300045049 | Ga0466959_0052484 | Ga0466959_0052484_686_1663 | 325 |
| 618 | 3300045836 | Ga0466958_0002895 | Ga0466958_0002895_7663_8706 | 325 |
| 619 | 3300045836 | Ga0466958_0006736 | Ga0466958_0006736_4150_5127 | 325 |
| 620 | 3300045976 | Ga0466967_0004155 | Ga0466967_0004155_7186_8229 | 325 |
| 621 | 3300045976 | Ga0466967_0010911 | Ga0466967_0010911_4531_5574 | 325 |
| 622 | 3300045976 | Ga0466967_0061995 | Ga0466967_0061995_2057_3100 | 325 |
| 623 | 3300045976 | Ga0466967_0210347 | Ga0466967_0210347_429_1472 | 325 |
| 624 | 3300045976 | Ga0466967_0226742 | Ga0466967_0226742_236_1273 | 325 |
| 625 | 3300046459 | Ga0495629_0024338 | Ga0495629_0024338_3176_4162 | 325 |
| 626 | 3300046459 | Ga0495629_0081278 | Ga0495629_0081278_774_1817 | 325 |
| 627 | 3300046462 | Ga0495651_0003583 | Ga0495651_0003583_9917_10972 | 325 |
| 628 | 3300046462 | Ga0495651_0117342 | Ga0495651_0117342_91_1134 | 325 |
| 629 | 3300046463 | Ga0495653_0038949 | Ga0495653_0038949_1248_2303 | 325 |
| 630 | 3300046463 | Ga0495653_0073344 | Ga0495653_0073344_977_2020 | 325 |
| 631 | 3300046463 | Ga0495653_0135719 | Ga0495653_0135719_581_1567 | 325 |
| 632 | 3300046472 | Ga0495580_0200013 | Ga0495580_0200013_138_1124 | 325 |
| 633 | 3300046473 | Ga0495582_0000066 | Ga0495582_0000066_30937_31923 | 325 |
| 634 | 3300046475 | Ga0495639_0001185 | Ga0495639_0001185_4288_5274 | 325 |
| 635 | 3300046476 | Ga0495662_0000694 | Ga0495662_0000694_10049_11035 | 325 |
| 636 | 3300046499 | Ga0495594_0076609 | Ga0495594_0076609_557_1543 | 325 |
| 637 | 3300046511 | Ga0495608_0010826 | Ga0495608_0010826_979_2034 | 325 |
| 638 | 3300046511 | Ga0495608_0017412 | Ga0495608_0017412_2103_3089 | 325 |
| 639 | 3300046516 | Ga0495628_0010479 | Ga0495628_0010479_5759_6814 | 325 |
| 640 | 3300046516 | Ga0495628_0017322 | Ga0495628_0017322_2235_3278 | 325 |
| 641 | 3300046516 | Ga0495628_0268967 | Ga0495628_0268967_240_1226 | 325 |
| 642 | 3300046517 | Ga0495630_0005219 | Ga0495630_0005219_664_1650 | 325 |
| 643 | 3300046517 | Ga0495630_0042919 | Ga0495630_0042919_1105_2148 | 325 |
| 644 | 3300046529 | Ga0495652_0018945 | Ga0495652_0018945_3917_4903 | 325 |
| 645 | 3300046529 | Ga0495652_0049582 | Ga0495652_0049582_1642_2685 | 325 |
| 646 | 3300046531 | Ga0495665_0000252 | Ga0495665_0000252_23868_24854 | 325 |
| 647 | 3300046533 | Ga0495640_0012743 | Ga0495640_0012743_4354_5397 | 325 |
| 648 | 3300046533 | Ga0495640_0051398 | Ga0495640_0051398_1395_2450 | 325 |
| 649 | 3300046533 | Ga0495640_0104286 | Ga0495640_0104286_221_1207 | 325 |
| 650 | 3300046536 | Ga0495587_0023376 | Ga0495587_0023376_1541_2596 | 325 |
| 651 | 3300046536 | Ga0495587_0033470 | Ga0495587_0033470_980_1966 | 325 |
| 652 | 3300046559 | Ga0495667_0000751 | Ga0495667_0000751_17519_18574 | 325 |
| 653 | 3300046559 | Ga0495667_0006812 | Ga0495667_0006812_260_1303 | 325 |
| 654 | 3300046559 | Ga0495667_0014712 | Ga0495667_0014712_1940_2926 | 325 |
| 655 | 3300046559 | Ga0495667_0037733 | Ga0495667_0037733_780_1766 | 325 |
| 656 | 3300046642 | Ga0495634_0031253 | Ga0495634_0031253_1256_2242 | 325 |
| 657 | 3300046663 | Ga0495635_0008147 | Ga0495635_0008147_1814_2800 | 325 |
| 658 | 3300046663 | Ga0495635_0047428 | Ga0495635_0047428_978_2033 | 325 |
| 659 | 3300046663 | Ga0495635_0082131 | Ga0495635_0082131_696_1739 | 325 |
| 660 | 3300046675 | Ga0495657_0009618 | Ga0495657_0009618_2760_3815 | 325 |
| 661 | 3300046675 | Ga0495657_0053616 | Ga0495657_0053616_805_1791 | 325 |
| 662 | 3300046675 | Ga0495657_0124448 | Ga0495657_0124448_29_1072 | 325 |
| 663 | 3300046680 | Ga0495646_0013457 | Ga0495646_0013457_1953_3008 | 325 |
| 664 | 3300046680 | Ga0495646_0076361 | Ga0495646_0076361_177_1163 | 325 |
| 665 | 3300046683 | Ga0495658_0005678 | Ga0495658_0005678_3158_4144 | 325 |
| 666 | 3300046689 | Ga0495613_0004101 | Ga0495613_0004101_6500_7486 | 325 |
| 667 | 3300046690 | Ga0495624_0006961 | Ga0495624_0006961_139_1125 | 325 |
| 668 | 3300046809 | Ga0495600_0015949 | Ga0495600_0015949_1391_2368 | 325 |
| 669 | 3300046809 | Ga0495600_0018385 | Ga0495600_0018385_2007_2993 | 325 |
| 670 | 3300046809 | Ga0495600_0047287 | Ga0495600_0047287_851_1906 | 325 |
| 671 | 3300047315 | Ga0495581_0002805 | Ga0495581_0002805_3759_4745 | 325 |
| 672 | 3300047317 | Ga0495604_0009430 | Ga0495604_0009430_1995_3050 | 325 |
| 673 | 3300047317 | Ga0495604_0041144 | Ga0495604_0041144_1781_2767 | 325 |
| 674 | 3300047319 | Ga0495674_0008594 | Ga0495674_0008594_6195_7238 | 325 |
| 675 | 3300047319 | Ga0495674_0010971 | Ga0495674_0010971_931_1986 | 325 |
| 676 | 3300047319 | Ga0495674_0165465 | Ga0495674_0165465_150_1136 | 325 |
| 677 | 3300047321 | Ga0495676_0002041 | Ga0495676_0002041_6502_7488 | 325 |
| 678 | 3300047322 | Ga0495680_0004252 | Ga0495680_0004252_6966_8009 | 325 |
| 679 | 3300047322 | Ga0495680_0012179 | Ga0495680_0012179_4595_5581 | 325 |
| 680 | 3300047471 | Ga0495684_0002738 | Ga0495684_0002738_2083_3138 | 325 |
| 681 | 3300047471 | Ga0495684_0006287 | Ga0495684_0006287_878_1864 | 325 |
| 682 | 3300047673 | Ga0495593_0001836 | Ga0495593_0001836_4180_5166 | 325 |
| 683 | 3300048088 | Ga0495602_0059786 | Ga0495602_0059786_373_1428 | 325 |
| 684 | 3300048089 | Ga0495614_0019808 | Ga0495614_0019808_227_1213 | 325 |
| 685 | 3300048904 | Ga0496101_0009188 | Ga0496101_0009188_4223_5266 | 325 |
| 686 | 3300048907 | Ga0496104_0004466 | Ga0496104_0004466_9207_10250 | 325 |
| 687 | 3300048907 | Ga0496104_0538909 | Ga0496104_0538909_56_1039 | 325 |
| 688 | 3300048908 | Ga0496105_0001569 | Ga0496105_0001569_10174_11217 | 325 |
| 689 | 3300048908 | Ga0496105_0144081 | Ga0496105_0144081_300_1277 | 325 |
| 690 | 3300048909 | Ga0496106_0004661 | Ga0496106_0004661_7097_8140 | 325 |
| 691 | 3300048910 | Ga0496107_0028637 | Ga0496107_0028637_1974_3017 | 325 |
| 692 | 3300048911 | Ga0496108_0036583 | Ga0496108_0036583_2637_3680 | 325 |
| 693 | 3300048912 | Ga0496109_0007622 | Ga0496109_0007622_4077_5120 | 325 |
| 694 | 3300048913 | Ga0496110_0046655 | Ga0496110_0046655_2213_3256 | 325 |
| 695 | 3300048913 | Ga0496110_0096919 | Ga0496110_0096919_1418_2416 | 325 |
| 696 | 3300048913 | Ga0496110_0321171 | Ga0496110_0321171_356_1396 | 325 |
| 697 | 3300048914 | Ga0496111_0011955 | Ga0496111_0011955_4150_5193 | 325 |
| 698 | 3300048914 | Ga0496111_0014669 | Ga0496111_0014669_2368_3402 | 325 |
| 699 | 3300048915 | Ga0496112_0109544 | Ga0496112_0109544_668_1702 | 325 |
| 700 | 3300048916 | Ga0496113_0020403 | Ga0496113_0020403_1904_2959 | 325 |
| 701 | 3300048916 | Ga0496113_0062447 | Ga0496113_0062447_928_1971 | 325 |
| 702 | 3300048916 | Ga0496113_0072702 | Ga0496113_0072702_425_1459 | 325 |
| 703 | 3300048917 | Ga0496114_0001831 | Ga0496114_0001831_9570_10613 | 325 |
| 704 | 3300048917 | Ga0496114_0148873 | Ga0496114_0148873_608_1594 | 325 |
| 705 | 3300048918 | Ga0496115_0001725 | Ga0496115_0001725_7245_8288 | 325 |
| 706 | 3300048918 | Ga0496115_0056458 | Ga0496115_0056458_668_1654 | 325 |
| 707 | 3300049581 | Ga0501047_0007455 | Ga0501047_0007455_4643_5692 | 325 |
| 708 | 3300049583 | Ga0501067_0069396 | Ga0501067_0069396_509_1552 | 325 |
| 709 | 3300049585 | Ga0501069_0078624 | Ga0501069_0078624_38_1087 | 325 |
| 710 | 3300049588 | Ga0501072_0148604 | Ga0501072_0148604_744_1781 | 325 |
| 711 | 3300049590 | Ga0501074_0019804 | Ga0501074_0019804_2611_3660 | 325 |
| 712 | 3300049593 | Ga0501077_0082185 | Ga0501077_0082185_266_1306 | 325 |
| 713 | 3300049741 | Ga0501079_0185868 | Ga0501079_0185868_592_1572 | 325 |
| 714 | 3300049742 | Ga0501080_0153800 | Ga0501080_0153800_479_1528 | 325 |
| 715 | 3300049743 | Ga0501081_0054341 | Ga0501081_0054341_959_1996 | 325 |
| 716 | 3300050512 | nmdc:mga0n895_128747_c1 | nmdc:mga0n895_128747_c1_389_1432 | 325 |
| 717 | 3300050514 | nmdc:mga08x19_101069_c1 | nmdc:mga08x19_101069_c1_842_1885 | 325 |
| 718 | 3300053077 | Ga0495601_0108345 | Ga0495601_0108345_253_1239 | 325 |
| 719 | 3300053078 | Ga0495612_0015066 | Ga0495612_0015066_1870_2925 | 325 |
| 720 | 3300053084 | Ga0495595_0002816 | Ga0495595_0002816_3385_4440 | 325 |
| 721 | 3300053085 | Ga0495619_0003046 | Ga0495619_0003046_8599_9576 | 325 |
| 722 | 3300053085 | Ga0495619_0058131 | Ga0495619_0058131_1090_2076 | 325 |
| 723 | 3300053085 | Ga0495619_0063950 | Ga0495619_0063950_1305_2342 | 325 |
| 724 | 3300053085 | Ga0495619_0280505 | Ga0495619_0280505_149_1135 | 325 |
| 725 | 3300054114 | Ga0501084_0285733 | Ga0501084_0285733_22_1008 | 325 |
| 726 | 3300061719 | Ga0466962_0004523 | Ga0466962_0004523_3771_4814 | 325 |
| 727 | 3300061734 | Ga0530510_0069871 | Ga0530510_0069871_603_1640 | 325 |
| 728 | 3300005339 | Ga0070660_100044156 | Ga0070660_1000441563 | 326 |
| 729 | 3300005345 | Ga0070692_10016243 | Ga0070692_100162432 | 326 |
| 730 | 3300005366 | Ga0070659_100006539 | Ga0070659_1000065395 | 326 |
| 731 | 3300005458 | Ga0070681_10105644 | Ga0070681_101056442 | 326 |
| 732 | 3300005564 | Ga0070664_100272162 | Ga0070664_1002721622 | 326 |
| 733 | 3300009093 | Ga0105240_10031253 | Ga0105240_100312533 | 326 |
| 734 | 3300025919 | Ga0207657_10036543 | Ga0207657_100365433 | 326 |
| 735 | 3300025923 | Ga0207681_10279254 | Ga0207681_102792542 | 326 |
| 736 | 3300025929 | Ga0207664_10000060 | Ga0207664_1000006070 | 326 |
| 737 | 3300025932 | Ga0207690_10000117 | Ga0207690_1000011713 | 326 |
| 738 | 3300028558 | Ga0265326_10000024 | Ga0265326_1000002434 | 326 |
| 739 | 3300028563 | Ga0265319_1000116 | Ga0265319_100011614 | 326 |
| 740 | 3300028573 | Ga0265334_10000078 | Ga0265334_1000007836 | 326 |
| 741 | 3300028666 | Ga0265336_10003815 | Ga0265336_100038153 | 326 |
| 742 | 3300028800 | Ga0265338_10098748 | Ga0265338_100987482 | 326 |
| 743 | 3300029957 | Ga0265324_10003299 | Ga0265324_100032996 | 326 |
| 744 | 3300048904 | Ga0496101_0004996 | Ga0496101_0004996_44_1159 | 326 |
| 745 | 3300048912 | Ga0496109_0023298 | Ga0496109_0023298_1968_3083 | 326 |
| 746 | 3300048925 | Ga0496122_0033730 | Ga0496122_0033730_2467_3450 | 326 |
| 747 | 3300021388 | Ga0213875_10015454 | Ga0213875_100154545 | 327 |
| 748 | 3300037853 | Ga0436364_0457216 | Ga0436364_0457216_2951_3949 | 327 |
| 749 | 3300038443 | Ga0395901_0232358 | Ga0395901_0232358_160_1143 | 327 |
| 750 | 3300045836 | Ga0466958_0027368 | Ga0466958_0027368_2275_3258 | 327 |
| 751 | 3300049569 | Ga0501032_0022440 | Ga0501032_0022440_2859_3965 | 327 |
| 752 | 3300049573 | Ga0501037_0026648 | Ga0501037_0026648_2214_3320 | 327 |
| 753 | 3300049574 | Ga0501038_0037491 | Ga0501038_0037491_2336_3442 | 327 |
| 754 | 3300049578 | Ga0501042_0037517 | Ga0501042_0037517_2163_3269 | 327 |
| 755 | 3300049579 | Ga0501043_0003201 | Ga0501043_0003201_6441_7547 | 327 |
| 756 | 3300049583 | Ga0501067_0012878 | Ga0501067_0012878_3320_4426 | 327 |
| 757 | 3300049585 | Ga0501069_0029114 | Ga0501069_0029114_1340_2446 | 327 |
| 758 | 3300049589 | Ga0501073_0038032 | Ga0501073_0038032_514_1620 | 327 |
| 759 | 3300049741 | Ga0501079_0048229 | Ga0501079_0048229_795_1901 | 327 |
| 760 | 3300049744 | Ga0501083_0008535 | Ga0501083_0008535_246_1352 | 327 |
| 761 | 3300049823 | Ga0501044_0036460 | Ga0501044_0036460_1632_2738 | 327 |
| 762 | 3300053104 | Ga0500556_0000593 | Ga0500556_0000593_6626_7741 | 327 |
| 763 | 3300053153 | Ga0500616_0004992 | Ga0500616_0004992_231_1346 | 327 |
| 764 | 3300060353 | Ga0501082_0048052 | Ga0501082_0048052_1083_2189 | 327 |
| 765 | 3300005337 | Ga0070682_100063203 | Ga0070682_1000632031 | 328 |
| 766 | 3300005338 | Ga0068868_100025245 | Ga0068868_1000252454 | 328 |
| 767 | 3300005458 | Ga0070681_10019078 | Ga0070681_100190784 | 328 |
| 768 | 3300005459 | Ga0068867_100006031 | Ga0068867_1000060315 | 328 |
| 769 | 3300005530 | Ga0070679_100000312 | Ga0070679_10000031217 | 328 |
| 770 | 3300005530 | Ga0070679_100068574 | Ga0070679_1000685742 | 328 |
| 771 | 3300005539 | Ga0068853_100002766 | Ga0068853_10000276611 | 328 |
| 772 | 3300005547 | Ga0070693_100006705 | Ga0070693_1000067056 | 328 |
| 773 | 3300005614 | Ga0068856_100026366 | Ga0068856_1000263663 | 328 |
| 774 | 3300005615 | Ga0070702_100010129 | Ga0070702_1000101295 | 328 |
| 775 | 3300005618 | Ga0068864_100058920 | Ga0068864_1000589202 | 328 |
| 776 | 3300005718 | Ga0068866_10005928 | Ga0068866_100059283 | 328 |
| 777 | 3300005841 | Ga0068863_100024278 | Ga0068863_1000242782 | 328 |
| 778 | 3300005937 | Ga0081455_10149621 | Ga0081455_101496212 | 328 |
| 779 | 3300005985 | Ga0081539_10009624 | Ga0081539_100096244 | 328 |
| 780 | 3300006173 | Ga0070716_100135735 | Ga0070716_1001357352 | 328 |
| 781 | 3300009093 | Ga0105240_10324663 | Ga0105240_103246632 | 328 |
| 782 | 3300009101 | Ga0105247_10054722 | Ga0105247_100547222 | 328 |
| 783 | 3300009147 | Ga0114129_10765283 | Ga0114129_107652831 | 328 |
| 784 | 3300009148 | Ga0105243_10086529 | Ga0105243_100865292 | 328 |
| 785 | 3300009176 | Ga0105242_10000194 | Ga0105242_1000019435 | 328 |
| 786 | 3300009176 | Ga0105242_10000819 | Ga0105242_1000081910 | 328 |
| 787 | 3300009176 | Ga0105242_10193474 | Ga0105242_101934742 | 328 |
| 788 | 3300012507 | Ga0157342_1005311 | Ga0157342_10053111 | 328 |
| 789 | 3300013104 | Ga0157370_10014865 | Ga0157370_100148654 | 328 |
| 790 | 3300025899 | Ga0207642_10041359 | Ga0207642_100413592 | 328 |
| 791 | 3300025912 | Ga0207707_10018013 | Ga0207707_100180134 | 328 |
| 792 | 3300025913 | Ga0207695_10268436 | Ga0207695_102684362 | 328 |
| 793 | 3300025921 | Ga0207652_10000483 | Ga0207652_1000048317 | 328 |
| 794 | 3300025921 | Ga0207652_10131242 | Ga0207652_101312422 | 328 |
| 795 | 3300025934 | Ga0207686_10000033 | Ga0207686_10000033124 | 328 |
| 796 | 3300025934 | Ga0207686_10000428 | Ga0207686_1000042823 | 328 |
| 797 | 3300025939 | Ga0207665_10047824 | Ga0207665_100478242 | 328 |
| 798 | 3300025940 | Ga0207691_10001039 | Ga0207691_1000103924 | 328 |
| 799 | 3300026041 | Ga0207639_10005404 | Ga0207639_100054049 | 328 |
| 800 | 3300026078 | Ga0207702_10017650 | Ga0207702_100176505 | 328 |
| 801 | 3300026089 | Ga0207648_10007855 | Ga0207648_100078556 | 328 |
| 802 | 3300041491 | Ga0451833_0016179 | Ga0451833_0016179_569_1558 | 328 |
| 803 | 3300044901 | Ga0466960_0064375 | Ga0466960_0064375_603_1592 | 328 |
| 804 | 3300045976 | Ga0466967_0013454 | Ga0466967_0013454_4935_5957 | 328 |
| 805 | 3300046459 | Ga0495629_0009397 | Ga0495629_0009397_5033_6022 | 328 |
| 806 | 3300046460 | Ga0495638_0065726 | Ga0495638_0065726_1168_2157 | 328 |
| 807 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_221470_222462 | 328 |
| 808 | 3300046473 | Ga0495582_0000029 | Ga0495582_0000029_29472_30461 | 328 |
| 809 | 3300046499 | Ga0495594_0000003 | Ga0495594_0000003_72000_72989 | 328 |
| 810 | 3300046557 | Ga0495622_0000714 | Ga0495622_0000714_13466_14455 | 328 |
| 811 | 3300046615 | Ga0495656_0000241 | Ga0495656_0000241_564_1553 | 328 |
| 812 | 3300046683 | Ga0495658_0000026 | Ga0495658_0000026_47482_48471 | 328 |
| 813 | 3300046684 | Ga0495669_0000260 | Ga0495669_0000260_103_1095 | 328 |
| 814 | 3300047322 | Ga0495680_0034820 | Ga0495680_0034820_959_1948 | 328 |
| 815 | 3300048904 | Ga0496101_0088697 | Ga0496101_0088697_118_1104 | 328 |
| 816 | 3300048905 | Ga0496102_0000146 | Ga0496102_0000146_4321_5310 | 328 |
| 817 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_323840_324829 | 328 |
| 818 | 3300048906 | Ga0496103_0112031 | Ga0496103_0112031_244_1230 | 328 |
| 819 | 3300048910 | Ga0496107_0043697 | Ga0496107_0043697_1819_2805 | 328 |
| 820 | 3300048911 | Ga0496108_0059129 | Ga0496108_0059129_2202_3188 | 328 |
| 821 | 3300048912 | Ga0496109_0005575 | Ga0496109_0005575_1015_2142 | 328 |
| 822 | 3300048913 | Ga0496110_0151465 | Ga0496110_0151465_743_1729 | 328 |
| 823 | 3300048914 | Ga0496111_0096713 | Ga0496111_0096713_55_1044 | 328 |
| 824 | 3300048914 | Ga0496111_0183989 | Ga0496111_0183989_103_1089 | 328 |
| 825 | 3300048915 | Ga0496112_0212348 | Ga0496112_0212348_640_1626 | 328 |
| 826 | 3300048915 | Ga0496112_0301760 | Ga0496112_0301760_109_1113 | 328 |
| 827 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_148601_149590 | 328 |
| 828 | 3300048917 | Ga0496114_0026518 | Ga0496114_0026518_681_1670 | 328 |
| 829 | 3300048918 | Ga0496115_0005472 | Ga0496115_0005472_6203_7192 | 328 |
| 830 | 3300049578 | Ga0501042_0112800 | Ga0501042_0112800_369_1358 | 328 |
| 831 | 3300049590 | Ga0501074_0146388 | Ga0501074_0146388_24_1127 | 328 |
| 832 | 3300049742 | Ga0501080_0245961 | Ga0501080_0245961_390_1493 | 328 |
| 833 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_87825_88814 | 328 |
| 834 | 3300053083 | Ga0495655_0001262 | Ga0495655_0001262_2118_3107 | 328 |
| 835 | 3300053085 | Ga0495619_0000534 | Ga0495619_0000534_3357_4346 | 328 |
| 836 | 3300053123 | Ga0500614_000026 | Ga0500614_000026_12389_13381 | 328 |
| 837 | 3300053129 | Ga0500628_000017 | Ga0500628_000017_8453_9442 | 328 |
| 838 | 3300003373 | JGI25407J50210_10013832 | JGI25407J50210_100138321 | 329 |
| 839 | 3300005441 | Ga0070700_100080988 | Ga0070700_1000809882 | 329 |
| 840 | 3300005981 | Ga0081538_10000219 | Ga0081538_100002192 | 329 |
| 841 | 3300005981 | Ga0081538_10000241 | Ga0081538_1000024145 | 329 |
| 842 | 3300005981 | Ga0081538_10011818 | Ga0081538_100118183 | 329 |
| 843 | 3300006844 | Ga0075428_100047387 | Ga0075428_1000473874 | 329 |
| 844 | 3300006846 | Ga0075430_100000824 | Ga0075430_1000008246 | 329 |
| 845 | 3300006847 | Ga0075431_100002897 | Ga0075431_1000028976 | 329 |
| 846 | 3300009094 | Ga0111539_10102572 | Ga0111539_101025723 | 329 |
| 847 | 3300026075 | Ga0207708_10109055 | Ga0207708_101090552 | 329 |
| 848 | 3300027907 | Ga0207428_10041096 | Ga0207428_100410962 | 329 |
| 849 | 3300027907 | Ga0207428_10214585 | Ga0207428_102145852 | 329 |
| 850 | 3300031995 | Ga0307409_100090481 | Ga0307409_1000904812 | 329 |
| 851 | 3300038443 | Ga0395901_0472338 | Ga0395901_0472338_129_1127 | 329 |
| 852 | 3300044694 | Ga0466963_0025380 | Ga0466963_0025380_851_1840 | 329 |
| 853 | 3300044719 | Ga0466971_0013005 | Ga0466971_0013005_1140_2129 | 329 |
| 854 | 3300044842 | Ga0466957_0088050 | Ga0466957_0088050_126_1115 | 329 |
| 855 | 3300045976 | Ga0466967_0007145 | Ga0466967_0007145_5582_6571 | 329 |
| 856 | 3300045976 | Ga0466967_0010564 | Ga0466967_0010564_3475_4464 | 329 |
| 857 | 3300045976 | Ga0466967_0016955 | Ga0466967_0016955_3909_4898 | 329 |
| 858 | 3300045976 | Ga0466967_0027982 | Ga0466967_0027982_1646_2635 | 329 |
| 859 | 3300045976 | Ga0466967_0064480 | Ga0466967_0064480_111_1100 | 329 |
| 860 | 3300045976 | Ga0466967_0066201 | Ga0466967_0066201_2014_3003 | 329 |
| 861 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_274858_275847 | 329 |
| 862 | 3300046511 | Ga0495608_0124169 | Ga0495608_0124169_179_1168 | 329 |
| 863 | 3300046515 | Ga0495620_0099892 | Ga0495620_0099892_156_1148 | 329 |
| 864 | 3300046809 | Ga0495600_0041962 | Ga0495600_0041962_1484_2473 | 329 |
| 865 | 3300049573 | Ga0501037_0301482 | Ga0501037_0301482_89_1084 | 329 |
| 866 | 3300049587 | Ga0501071_0126080 | Ga0501071_0126080_68_1063 | 329 |
| 867 | 3300049592 | Ga0501076_0233089 | Ga0501076_0233089_61_1056 | 329 |
| 868 | 3300050508 | nmdc:mga09592_69165_c1 | nmdc:mga09592_69165_c1_746_1735 | 329 |
| 869 | 3300050509 | nmdc:mga0qj67_1444_c1 | nmdc:mga0qj67_1444_c1_5467_6456 | 329 |
| 870 | 3300050509 | nmdc:mga0qj67_37429_c1 | nmdc:mga0qj67_37429_c1_2382_3512 | 329 |
| 871 | 3300050510 | nmdc:mga06r32_13083_c1 | nmdc:mga06r32_13083_c1_1317_2306 | 329 |
| 872 | 3300050511 | nmdc:mga08y16_143200_c1 | nmdc:mga08y16_143200_c1_1352_2347 | 329 |
| 873 | 3300061734 | Ga0530510_0099208 | Ga0530510_0099208_898_1893 | 329 |
| 874 | 3300005329 | Ga0070683_100001429 | Ga0070683_1000014297 | 330 |
| 875 | 3300005366 | Ga0070659_100037986 | Ga0070659_1000379862 | 330 |
| 876 | 3300005458 | Ga0070681_10028864 | Ga0070681_100288642 | 330 |
| 877 | 3300005535 | Ga0070684_100011922 | Ga0070684_1000119225 | 330 |
| 878 | 3300005535 | Ga0070684_100138659 | Ga0070684_1001386592 | 330 |
| 879 | 3300005547 | Ga0070693_100169542 | Ga0070693_1001695422 | 330 |
| 880 | 3300005616 | Ga0068852_100006184 | Ga0068852_1000061843 | 330 |
| 881 | 3300013104 | Ga0157370_10146104 | Ga0157370_101461042 | 330 |
| 882 | 3300020082 | Ga0206353_11805222 | Ga0206353_118052222 | 330 |
| 883 | 3300021384 | Ga0213876_10005317 | Ga0213876_100053172 | 330 |
| 884 | 3300025912 | Ga0207707_10068277 | Ga0207707_100682772 | 330 |
| 885 | 3300025917 | Ga0207660_10065864 | Ga0207660_100658642 | 330 |
| 886 | 3300025919 | Ga0207657_10043544 | Ga0207657_100435442 | 330 |
| 887 | 3300025921 | Ga0207652_10040831 | Ga0207652_100408313 | 330 |
| 888 | 3300025932 | Ga0207690_10048283 | Ga0207690_100482832 | 330 |
| 889 | 3300025944 | Ga0207661_10037197 | Ga0207661_100371972 | 330 |
| 890 | 3300026041 | Ga0207639_10047900 | Ga0207639_100479002 | 330 |
| 891 | 3300026116 | Ga0207674_10116495 | Ga0207674_101164952 | 330 |
| 892 | 3300026142 | Ga0207698_10018265 | Ga0207698_100182652 | 330 |
| 893 | 3300031995 | Ga0307409_100033327 | Ga0307409_1000333273 | 330 |
| 894 | 3300039437 | Ga0436365_1574649 | Ga0436365_1574649_11340_12365 | 330 |
| 895 | 3300044901 | Ga0466960_0095012 | Ga0466960_0095012_169_1161 | 330 |
| 896 | 3300000549 | LJQas_1008039 | LJQas_10080391 | 331 |
| 897 | 3300061719 | Ga0466962_0003841 | Ga0466962_0003841_5129_6550 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u4j-assembly1.cif.gz_v | structural basis of co-translational quality control by arfa and rf2 bound to ribosome | 0.9609 | 86 | 184 |
| 6boh-assembly2.cif.gz_OC | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.9045 | 79 | 186 |
| 6boh-assembly2.cif.gz_OC | antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome | 0.8818 | 79 | 186 |
| 6b4v-assembly1.cif.gz_JA | antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome | 0.8753 | 79 | 330 |
| 5o2r-assembly1.cif.gz_v | cryo-em structure of the proline-rich antimicrobial peptide api137 bound to the terminating ribosome | 0.8743 | 86 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6IEG8_11_112_3.30.70.1660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.984 | 83 | 184 | 3.30.70.1660 |
| af_A0A1D6IEG8_11_112_3.30.70.1660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9651 | 83 | 184 | 3.30.70.1660 |
| 1gqeA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9646 | 84 | 325 | 3.30.70.1660 |
| af_P30775_152_262_3.30.70.1660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9625 | 84 | 186 | 3.30.70.1660 |
| af_Q54RE7_180_291_3.30.70.1660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9496 | 82 | 193 | 3.30.70.1660 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1A613-F1-model_v4 | Peptide chain release factor domain-containing protein | 0.9864 | 76 | 177 |
GO:0006415
|
| AF-X1A613-F1-model_v4 | Peptide chain release factor domain-containing protein | 0.9496 | 76 | 177 |
GO:0006415
|
| AF-A0A1V5PSR0-F1-model_v4 | Peptide chain release factor 2 (RF-2) | 0.9448 | 21 | 324 |
GO:0005737
GO:0016149 |
| AF-K1SNK6-F1-model_v4 | Peptide chain release factor 2 | 0.9448 | 30 | 152 |
GO:0006415
|
| AF-A0A1Y2CA51-F1-model_v4 | PCRF-domain-containing protein | 0.9424 | 16 | 184 |
GO:0006415
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar