F485041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 328 | 891 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100153127|Ga0075434_1001531273 |
| Length | 233 |
| Sequence | VVAAAATAAVRVTSTKQPMAAEHTLYCFAQSGNAYKAALMLAVTGSSWAPRFVDYFGGETRTPEYRVINVMGEVPVLEHEGRRLTQSGVILDYLAEKTGQFGPANGEERRDILRWLFFDNHKLTSYTATYRFMRTFVSAPNPAVMEEFRKRAETAWRVLDAHLDGRRSVVGERLTIADLSLVGYLFFDDEIGVDWNDYPHLRDWLARIRALPGWAHPYDLMPGHPLPAKDAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 4 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 251 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 252 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 253 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 254 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 255 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 292 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 303 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 307 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 328 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1 |
| Nodule | 0.11 |
| Rhizoplane | 5.02 |
| Rhizosphere | 92.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10012326 | 3300001991 | Bacteria | 1554 |
| 2 | JGI24749J21850_1023695 | 3300002076 | Bacteria | 872 |
| 3 | JGI24034J26672_10048157 | 3300002239 | Bacteria | 728 |
| 4 | JGI24742J22300_10057369 | 3300002244 | Bacteria | 712 |
| 5 | rootH1_10003216 | 3300003316 | Bacteria | 15917 |
| 6 | rootL2_10002048 | 3300003322 | Bacteria | 12254 |
| 7 | Ga0065712_10006136 | 3300005290 | Bacteria | 3721 |
| 8 | Ga0065715_10139235 | 3300005293 | Unclassified | 1879 |
| 9 | Ga0065715_10446243 | 3300005293 | Bacteria | 809 |
| 10 | Ga0070658_10019632 | 3300005327 | Bacteria | 5411 |
| 11 | Ga0070658_10218595 | 3300005327 | Bacteria | 1611 |
| 12 | Ga0070658_10410322 | 3300005327 | Bacteria | 1164 |
| 13 | Ga0070676_10000712 | 3300005328 | Bacteria | 16253 |
| 14 | Ga0070676_10010963 | 3300005328 | Bacteria | 4924 |
| 15 | Ga0070676_10082019 | 3300005328 | Bacteria | 1958 |
| 16 | Ga0070676_10398702 | 3300005328 | Bacteria | 957 |
| 17 | Ga0070683_100010112 | 3300005329 | Bacteria | 8094 |
| 18 | Ga0070683_100285637 | 3300005329 | Bacteria | 1570 |
| 19 | Ga0070683_100375282 | 3300005329 | Unclassified | 1355 |
| 20 | Ga0070690_100001392 | 3300005330 | Bacteria | 12605 |
| 21 | Ga0070690_100003483 | 3300005330 | Bacteria | 8610 |
| 22 | Ga0070690_100018815 | 3300005330 | Bacteria | 4180 |
| 23 | Ga0070690_100145969 | 3300005330 | Bacteria | 1610 |
| 24 | Ga0070690_100448582 | 3300005330 | Bacteria | 956 |
| 25 | Ga0070670_100028486 | 3300005331 | Bacteria | 4807 |
| 26 | Ga0070670_100046953 | 3300005331 | Bacteria | 3715 |
| 27 | Ga0070670_100059340 | 3300005331 | Bacteria | 3284 |
| 28 | Ga0070670_100103130 | 3300005331 | Bacteria | 2457 |
| 29 | Ga0070670_100151800 | 3300005331 | Bacteria | 2005 |
| 30 | Ga0070670_100205984 | 3300005331 | Bacteria | 1710 |
| 31 | Ga0070670_100269697 | 3300005331 | Bacteria | 1485 |
| 32 | Ga0070677_10030637 | 3300005333 | Bacteria | 2049 |
| 33 | Ga0068869_100000631 | 3300005334 | Bacteria | 19900 |
| 34 | Ga0068869_100001258 | 3300005334 | Bacteria | 14962 |
| 35 | Ga0068869_100008561 | 3300005334 | Bacteria | 6604 |
| 36 | Ga0068869_100210289 | 3300005334 | Bacteria | 1537 |
| 37 | Ga0068869_100274296 | 3300005334 | Bacteria | 1354 |
| 38 | Ga0070666_10001286 | 3300005335 | Bacteria | 15184 |
| 39 | Ga0070666_10013719 | 3300005335 | Bacteria | 5144 |
| 40 | Ga0070680_100599651 | 3300005336 | Unclassified | 945 |
| 41 | Ga0070682_100015068 | 3300005337 | Bacteria | 4476 |
| 42 | Ga0070682_100405908 | 3300005337 | Unclassified | 1032 |
| 43 | Ga0070682_100461479 | 3300005337 | Bacteria | 975 |
| 44 | Ga0068868_100001544 | 3300005338 | Bacteria | 15719 |
| 45 | Ga0068868_100002946 | 3300005338 | Bacteria | 11816 |
| 46 | Ga0068868_100281599 | 3300005338 | Bacteria | 1407 |
| 47 | Ga0068868_100479627 | 3300005338 | Bacteria | 1086 |
| 48 | Ga0070660_100003674 | 3300005339 | Bacteria | 10596 |
| 49 | Ga0070660_100027048 | 3300005339 | Bacteria | 4278 |
| 50 | Ga0070660_100040566 | 3300005339 | Bacteria | 3543 |
| 51 | Ga0070689_100000781 | 3300005340 | Bacteria | 19535 |
| 52 | Ga0070689_100003108 | 3300005340 | Bacteria | 10962 |
| 53 | Ga0070689_100005522 | 3300005340 | Bacteria | 8646 |
| 54 | Ga0070689_100042402 | 3300005340 | Bacteria | 3494 |
| 55 | Ga0070689_100081017 | 3300005340 | Bacteria | 2548 |
| 56 | Ga0070691_10035517 | 3300005341 | Bacteria | 2347 |
| 57 | Ga0070687_100009949 | 3300005343 | Bacteria | 4091 |
| 58 | Ga0070687_100028147 | 3300005343 | Bacteria | 2723 |
| 59 | Ga0070687_100265424 | 3300005343 | Bacteria | 1073 |
| 60 | Ga0070661_100009592 | 3300005344 | Bacteria | 6705 |
| 61 | Ga0070661_100032273 | 3300005344 | Bacteria | 3790 |
| 62 | Ga0070661_100047425 | 3300005344 | Bacteria | 3144 |
| 63 | Ga0070661_100068496 | 3300005344 | Bacteria | 2608 |
| 64 | Ga0070661_100119601 | 3300005344 | Bacteria | 1972 |
| 65 | Ga0070661_100184529 | 3300005344 | Bacteria | 1589 |
| 66 | Ga0070661_100210364 | 3300005344 | Bacteria | 1489 |
| 67 | Ga0070661_100676822 | 3300005344 | Bacteria | 839 |
| 68 | Ga0070692_10010969 | 3300005345 | Bacteria | 4147 |
| 69 | Ga0070692_10077601 | 3300005345 | Bacteria | 1782 |
| 70 | Ga0070668_100001957 | 3300005347 | Bacteria | 15024 |
| 71 | Ga0070668_100005291 | 3300005347 | Bacteria | 9575 |
| 72 | Ga0070668_100065413 | 3300005347 | Bacteria | 2820 |
| 73 | Ga0070668_100130810 | 3300005347 | Bacteria | 2014 |
| 74 | Ga0070668_100427380 | 3300005347 | Unclassified | 1135 |
| 75 | Ga0070669_100001265 | 3300005353 | Bacteria | 18326 |
| 76 | Ga0070669_100078882 | 3300005353 | Bacteria | 2448 |
| 77 | Ga0070669_100082815 | 3300005353 | Bacteria | 2392 |
| 78 | Ga0070675_100018807 | 3300005354 | Bacteria | 5499 |
| 79 | Ga0070675_100133188 | 3300005354 | Bacteria | 2120 |
| 80 | Ga0070675_100182643 | 3300005354 | Bacteria | 1814 |
| 81 | Ga0070675_100242682 | 3300005354 | Bacteria | 1574 |
| 82 | Ga0070675_100510249 | 3300005354 | Unclassified | 1084 |
| 83 | Ga0070675_100524603 | 3300005354 | Bacteria | 1069 |
| 84 | Ga0070671_100012552 | 3300005355 | Bacteria | 6822 |
| 85 | Ga0070671_100018529 | 3300005355 | Bacteria | 5655 |
| 86 | Ga0070671_100023505 | 3300005355 | Bacteria | 5045 |
| 87 | Ga0070671_100122018 | 3300005355 | Bacteria | 2193 |
| 88 | Ga0070671_100126289 | 3300005355 | Bacteria | 2153 |
| 89 | Ga0070671_100355246 | 3300005355 | Bacteria | 1251 |
| 90 | Ga0070674_100071357 | 3300005356 | Bacteria | 2456 |
| 91 | Ga0070674_100197260 | 3300005356 | Bacteria | 1552 |
| 92 | Ga0070674_100229909 | 3300005356 | Bacteria | 1447 |
| 93 | Ga0070674_100341933 | 3300005356 | Bacteria | 1206 |
| 94 | Ga0070673_100012387 | 3300005364 | Bacteria | 5853 |
| 95 | Ga0070673_100956517 | 3300005364 | Unclassified | 796 |
| 96 | Ga0070688_100018907 | 3300005365 | Bacteria | 3984 |
| 97 | Ga0070688_100049737 | 3300005365 | Bacteria | 2609 |
| 98 | Ga0070688_100287089 | 3300005365 | Bacteria | 1184 |
| 99 | Ga0070688_100808024 | 3300005365 | Unclassified | 734 |
| 100 | Ga0070659_100000738 | 3300005366 | Bacteria | 23779 |
| 101 | Ga0070659_100001702 | 3300005366 | Bacteria | 15803 |
| 102 | Ga0070659_100068711 | 3300005366 | Bacteria | 2811 |
| 103 | Ga0070659_100124765 | 3300005366 | Bacteria | 2089 |
| 104 | Ga0070659_100498199 | 3300005366 | Bacteria | 1038 |
| 105 | Ga0070659_100803268 | 3300005366 | Unclassified | 818 |
| 106 | Ga0070667_100000537 | 3300005367 | Bacteria | 37823 |
| 107 | Ga0070667_100001294 | 3300005367 | Bacteria | 22631 |
| 108 | Ga0070667_100006565 | 3300005367 | Bacteria | 9669 |
| 109 | Ga0070667_100188580 | 3300005367 | Bacteria | 1826 |
| 110 | Ga0070709_10001554 | 3300005434 | Bacteria | 12384 |
| 111 | Ga0070709_10023418 | 3300005434 | Bacteria | 3626 |
| 112 | Ga0070709_10126273 | 3300005434 | Bacteria | 1741 |
| 113 | Ga0070709_10727809 | 3300005434 | Bacteria | 774 |
| 114 | Ga0070714_100011182 | 3300005435 | Bacteria | 7116 |
| 115 | Ga0070714_100241805 | 3300005435 | Bacteria | 1666 |
| 116 | Ga0070714_100571301 | 3300005435 | Bacteria | 1084 |
| 117 | Ga0070713_100000093 | 3300005436 | Bacteria | 57164 |
| 118 | Ga0070713_100022947 | 3300005436 | Bacteria | 4831 |
| 119 | Ga0070713_100073880 | 3300005436 | Bacteria | 2887 |
| 120 | Ga0070710_10002620 | 3300005437 | Bacteria | 8549 |
| 121 | Ga0070710_10033776 | 3300005437 | Bacteria | 2780 |
| 122 | Ga0070710_10164745 | 3300005437 | Bacteria | 1377 |
| 123 | Ga0070701_10000512 | 3300005438 | Bacteria | 13327 |
| 124 | Ga0070701_10004791 | 3300005438 | Bacteria | 5530 |
| 125 | Ga0070701_10170488 | 3300005438 | Bacteria | 1267 |
| 126 | Ga0070701_10269498 | 3300005438 | Bacteria | 1035 |
| 127 | Ga0070711_100015980 | 3300005439 | Bacteria | 4758 |
| 128 | Ga0070711_100043941 | 3300005439 | Bacteria | 3030 |
| 129 | Ga0070705_100050350 | 3300005440 | Unclassified | 2423 |
| 130 | Ga0070700_100000680 | 3300005441 | Bacteria | 16817 |
| 131 | Ga0070700_100002925 | 3300005441 | Bacteria | 8758 |
| 132 | Ga0070700_100061027 | 3300005441 | Bacteria | 2378 |
| 133 | Ga0070700_100077251 | 3300005441 | Bacteria | 2140 |
| 134 | Ga0070694_100060463 | 3300005444 | Bacteria | 2584 |
| 135 | Ga0070694_100279301 | 3300005444 | Bacteria | 1273 |
| 136 | Ga0070708_100000235 | 3300005445 | Bacteria | 41417 |
| 137 | Ga0070708_100132795 | 3300005445 | Bacteria | 2305 |
| 138 | Ga0070708_100234089 | 3300005445 | Bacteria | 1724 |
| 139 | Ga0070663_100006029 | 3300005455 | Bacteria | 7256 |
| 140 | Ga0070663_100007958 | 3300005455 | Bacteria | 6495 |
| 141 | Ga0070663_100026121 | 3300005455 | Bacteria | 3951 |
| 142 | Ga0070663_100089174 | 3300005455 | Bacteria | 2282 |
| 143 | Ga0070663_100214383 | 3300005455 | Bacteria | 1509 |
| 144 | Ga0070678_100000115 | 3300005456 | Bacteria | 31495 |
| 145 | Ga0070678_100011176 | 3300005456 | Bacteria | 5528 |
| 146 | Ga0070678_100205014 | 3300005456 | Bacteria | 1630 |
| 147 | Ga0070678_100376935 | 3300005456 | Bacteria | 1226 |
| 148 | Ga0070678_100424961 | 3300005456 | Bacteria | 1159 |
| 149 | Ga0070662_100001899 | 3300005457 | Bacteria | 12825 |
| 150 | Ga0070662_100075514 | 3300005457 | Bacteria | 2496 |
| 151 | Ga0070662_100109767 | 3300005457 | Bacteria | 2100 |
| 152 | Ga0070662_100398670 | 3300005457 | Bacteria | 1135 |
| 153 | Ga0070662_100488439 | 3300005457 | Bacteria | 1026 |
| 154 | Ga0070681_10159048 | 3300005458 | Bacteria | 2183 |
| 155 | Ga0068867_100002089 | 3300005459 | Bacteria | 14000 |
| 156 | Ga0068867_100002384 | 3300005459 | Bacteria | 13215 |
| 157 | Ga0068867_100011849 | 3300005459 | Bacteria | 6159 |
| 158 | Ga0068867_100017076 | 3300005459 | Bacteria | 5156 |
| 159 | Ga0068867_100352997 | 3300005459 | Bacteria | 1228 |
| 160 | Ga0068867_100423508 | 3300005459 | Bacteria | 1128 |
| 161 | Ga0070685_10000280 | 3300005466 | Bacteria | 32659 |
| 162 | Ga0070685_10004000 | 3300005466 | Bacteria | 7446 |
| 163 | Ga0070706_100003250 | 3300005467 | Bacteria | 16066 |
| 164 | Ga0070698_100038927 | 3300005471 | Bacteria | 4898 |
| 165 | Ga0070698_100457357 | 3300005471 | Bacteria | 1212 |
| 166 | Ga0070699_100021973 | 3300005518 | Bacteria | 5497 |
| 167 | Ga0070679_100319854 | 3300005530 | Bacteria | 1501 |
| 168 | Ga0070684_100127045 | 3300005535 | Bacteria | 2297 |
| 169 | Ga0070684_101079181 | 3300005535 | Unclassified | 754 |
| 170 | Ga0068853_100004240 | 3300005539 | Bacteria | 11071 |
| 171 | Ga0068853_100024944 | 3300005539 | Bacteria | 5017 |
| 172 | Ga0068853_100100019 | 3300005539 | Bacteria | 2562 |
| 173 | Ga0068853_100172200 | 3300005539 | Bacteria | 1959 |
| 174 | Ga0068853_100216891 | 3300005539 | Bacteria | 1746 |
| 175 | Ga0068853_100305750 | 3300005539 | Bacteria | 1471 |
| 176 | Ga0068853_100810180 | 3300005539 | Bacteria | 897 |
| 177 | Ga0070672_100000912 | 3300005543 | Bacteria | 17711 |
| 178 | Ga0070672_100025764 | 3300005543 | Bacteria | 4368 |
| 179 | Ga0070672_100031779 | 3300005543 | Bacteria | 3977 |
| 180 | Ga0070672_100150637 | 3300005543 | Bacteria | 1924 |
| 181 | Ga0070686_100000973 | 3300005544 | Bacteria | 16512 |
| 182 | Ga0070686_100052252 | 3300005544 | Unclassified | 2605 |
| 183 | Ga0070686_100059674 | 3300005544 | Bacteria | 2458 |
| 184 | Ga0070686_100207589 | 3300005544 | Bacteria | 1408 |
| 185 | Ga0070695_100393133 | 3300005545 | Bacteria | 1049 |
| 186 | Ga0070696_100014415 | 3300005546 | Bacteria | 5301 |
| 187 | Ga0070696_100023215 | 3300005546 | Bacteria | 4215 |
| 188 | Ga0070696_100192159 | 3300005546 | Bacteria | 1520 |
| 189 | Ga0070693_100204317 | 3300005547 | Bacteria | 1285 |
| 190 | Ga0070665_100010968 | 3300005548 | Bacteria | 9164 |
| 191 | Ga0070665_100022112 | 3300005548 | Bacteria | 6397 |
| 192 | Ga0070665_100258975 | 3300005548 | Bacteria | 1741 |
| 193 | Ga0070665_100276442 | 3300005548 | Unclassified | 1681 |
| 194 | Ga0070704_100013168 | 3300005549 | Bacteria | 5125 |
| 195 | Ga0070704_100110206 | 3300005549 | Bacteria | 2093 |
| 196 | Ga0070704_100176187 | 3300005549 | Bacteria | 1706 |
| 197 | Ga0070704_100605632 | 3300005549 | Bacteria | 963 |
| 198 | Ga0068855_100001097 | 3300005563 | Bacteria | 33624 |
| 199 | Ga0068855_100023399 | 3300005563 | Bacteria | 7399 |
| 200 | Ga0068855_100440046 | 3300005563 | Bacteria | 1424 |
| 201 | Ga0070664_100003001 | 3300005564 | Bacteria | 13649 |
| 202 | Ga0070664_100010765 | 3300005564 | Bacteria | 7416 |
| 203 | Ga0070664_100028505 | 3300005564 | Bacteria | 4645 |
| 204 | Ga0070664_100062529 | 3300005564 | Bacteria | 3174 |
| 205 | Ga0070664_100151426 | 3300005564 | Bacteria | 2048 |
| 206 | Ga0068857_100001800 | 3300005577 | Bacteria | 17243 |
| 207 | Ga0068857_100121668 | 3300005577 | Bacteria | 2350 |
| 208 | Ga0068857_100385254 | 3300005577 | Bacteria | 1302 |
| 209 | Ga0068854_100023280 | 3300005578 | Bacteria | 4229 |
| 210 | Ga0068854_100049838 | 3300005578 | Bacteria | 2994 |
| 211 | Ga0068854_100587588 | 3300005578 | Bacteria | 949 |
| 212 | Ga0068856_100003602 | 3300005614 | Bacteria | 15590 |
| 213 | Ga0068856_100004835 | 3300005614 | Bacteria | 13357 |
| 214 | Ga0068856_100035198 | 3300005614 | Bacteria | 4906 |
| 215 | Ga0068856_100066958 | 3300005614 | Bacteria | 3549 |
| 216 | Ga0068856_100139215 | 3300005614 | Bacteria | 2434 |
| 217 | Ga0070702_100001461 | 3300005615 | Bacteria | 9684 |
| 218 | Ga0070702_100002888 | 3300005615 | Bacteria | 7553 |
| 219 | Ga0070702_100067716 | 3300005615 | Bacteria | 2099 |
| 220 | Ga0070702_100068538 | 3300005615 | Bacteria | 2088 |
| 221 | Ga0070702_100094931 | 3300005615 | Bacteria | 1817 |
| 222 | Ga0070702_100231428 | 3300005615 | Bacteria | 1242 |
| 223 | Ga0070702_100673200 | 3300005615 | Unclassified | 785 |
| 224 | Ga0068852_100023710 | 3300005616 | Bacteria | 4945 |
| 225 | Ga0068852_100125206 | 3300005616 | Bacteria | 2359 |
| 226 | Ga0068852_100135834 | 3300005616 | Bacteria | 2270 |
| 227 | Ga0068852_100322172 | 3300005616 | Bacteria | 1501 |
| 228 | Ga0068859_100000548 | 3300005617 | Bacteria | 37251 |
| 229 | Ga0068859_100003142 | 3300005617 | Bacteria | 16795 |
| 230 | Ga0068859_100007100 | 3300005617 | Bacteria | 11368 |
| 231 | Ga0068859_100024433 | 3300005617 | Bacteria | 6062 |
| 232 | Ga0068859_100050112 | 3300005617 | Bacteria | 4194 |
| 233 | Ga0068859_100217700 | 3300005617 | Bacteria | 1997 |
| 234 | Ga0068859_101148230 | 3300005617 | Bacteria | 855 |
| 235 | Ga0068864_100000759 | 3300005618 | Bacteria | 27157 |
| 236 | Ga0068864_100004336 | 3300005618 | Bacteria | 11650 |
| 237 | Ga0068864_100006912 | 3300005618 | Bacteria | 9305 |
| 238 | Ga0068864_100013541 | 3300005618 | Bacteria | 6762 |
| 239 | Ga0068864_100086324 | 3300005618 | Bacteria | 2760 |
| 240 | Ga0068864_100125126 | 3300005618 | Bacteria | 2303 |
| 241 | Ga0068864_100517332 | 3300005618 | Bacteria | 1150 |
| 242 | Ga0068866_10000632 | 3300005718 | Bacteria | 15998 |
| 243 | Ga0068866_10003761 | 3300005718 | Bacteria | 6218 |
| 244 | Ga0068866_10032069 | 3300005718 | Bacteria | 2537 |
| 245 | Ga0068866_10295129 | 3300005718 | Bacteria | 1010 |
| 246 | Ga0068861_100001692 | 3300005719 | Bacteria | 14152 |
| 247 | Ga0068861_100004985 | 3300005719 | Bacteria | 8946 |
| 248 | Ga0068861_100005833 | 3300005719 | Bacteria | 8361 |
| 249 | Ga0068861_100074737 | 3300005719 | Unclassified | 2636 |
| 250 | Ga0068861_100077602 | 3300005719 | Bacteria | 2591 |
| 251 | Ga0068861_100497862 | 3300005719 | Bacteria | 1101 |
| 252 | Ga0068861_100581050 | 3300005719 | Bacteria | 1025 |
| 253 | Ga0068851_10001169 | 3300005834 | Bacteria | 11384 |
| 254 | Ga0068851_10004676 | 3300005834 | Bacteria | 6186 |
| 255 | Ga0068851_10037191 | 3300005834 | Bacteria | 2440 |
| 256 | Ga0068851_10055432 | 3300005834 | Bacteria | 2019 |
| 257 | Ga0068851_10123578 | 3300005834 | Bacteria | 1393 |
| 258 | Ga0068870_10010668 | 3300005840 | Bacteria | 4228 |
| 259 | Ga0068870_10022434 | 3300005840 | Bacteria | 3102 |
| 260 | Ga0068870_10089571 | 3300005840 | Bacteria | 1717 |
| 261 | Ga0068870_10157105 | 3300005840 | Bacteria | 1345 |
| 262 | Ga0068863_100001304 | 3300005841 | Bacteria | 24887 |
| 263 | Ga0068863_100002477 | 3300005841 | Bacteria | 18351 |
| 264 | Ga0068863_100003845 | 3300005841 | Bacteria | 14849 |
| 265 | Ga0068863_100031144 | 3300005841 | Bacteria | 5093 |
| 266 | Ga0068863_100069978 | 3300005841 | Bacteria | 3318 |
| 267 | Ga0068863_100234342 | 3300005841 | Bacteria | 1771 |
| 268 | Ga0068863_100472998 | 3300005841 | Bacteria | 1232 |
| 269 | Ga0068858_100000652 | 3300005842 | Bacteria | 36211 |
| 270 | Ga0068858_100006770 | 3300005842 | Bacteria | 11150 |
| 271 | Ga0068858_100030416 | 3300005842 | Bacteria | 5013 |
| 272 | Ga0068858_100038945 | 3300005842 | Bacteria | 4409 |
| 273 | Ga0068858_100133876 | 3300005842 | Bacteria | 2325 |
| 274 | Ga0068860_100004322 | 3300005843 | Bacteria | 14523 |
| 275 | Ga0068860_100020811 | 3300005843 | Bacteria | 6356 |
| 276 | Ga0068860_100040991 | 3300005843 | Bacteria | 4424 |
| 277 | Ga0068860_100239423 | 3300005843 | Bacteria | 1765 |
| 278 | Ga0068860_100358405 | 3300005843 | Bacteria | 1436 |
| 279 | Ga0068860_100428198 | 3300005843 | Bacteria | 1313 |
| 280 | Ga0068862_100002384 | 3300005844 | Bacteria | 16717 |
| 281 | Ga0068862_100003241 | 3300005844 | Bacteria | 14082 |
| 282 | Ga0068862_100042079 | 3300005844 | Bacteria | 3890 |
| 283 | Ga0068862_100076173 | 3300005844 | Unclassified | 2903 |
| 284 | Ga0068862_100271715 | 3300005844 | Bacteria | 1550 |
| 285 | Ga0068862_100308854 | 3300005844 | Bacteria | 1457 |
| 286 | Ga0068862_100618267 | 3300005844 | Bacteria | 1042 |
| 287 | Ga0068862_100978901 | 3300005844 | Unclassified | 835 |
| 288 | Ga0081540_1013533 | 3300005983 | Bacteria | 5298 |
| 289 | Ga0081539_10027713 | 3300005985 | Bacteria | 3581 |
| 290 | Ga0075363_100443198 | 3300006048 | Bacteria | 766 |
| 291 | Ga0070715_10000885 | 3300006163 | Bacteria | 8298 |
| 292 | Ga0070712_100005914 | 3300006175 | Bacteria | 7569 |
| 293 | Ga0070712_100038639 | 3300006175 | Bacteria | 3263 |
| 294 | Ga0075366_10029069 | 3300006195 | Bacteria | 3246 |
| 295 | Ga0075366_10088002 | 3300006195 | Bacteria | 1860 |
| 296 | Ga0097621_100002419 | 3300006237 | Bacteria | 12782 |
| 297 | Ga0097621_100002825 | 3300006237 | Bacteria | 11902 |
| 298 | Ga0097621_100020672 | 3300006237 | Bacteria | 5076 |
| 299 | Ga0097621_100265158 | 3300006237 | Bacteria | 1508 |
| 300 | Ga0075370_10173486 | 3300006353 | Bacteria | 1268 |
| 301 | Ga0068871_100001447 | 3300006358 | Bacteria | 15879 |
| 302 | Ga0068871_100005154 | 3300006358 | Bacteria | 9137 |
| 303 | Ga0068871_100108277 | 3300006358 | Bacteria | 2335 |
| 304 | Ga0068871_100183402 | 3300006358 | Bacteria | 1800 |
| 305 | Ga0068871_100441896 | 3300006358 | Bacteria | 1164 |
| 306 | Ga0075428_100002872 | 3300006844 | Bacteria | 18789 |
| 307 | Ga0075428_100063847 | 3300006844 | Bacteria | 4032 |
| 308 | Ga0075431_100001468 | 3300006847 | Bacteria | 21760 |
| 309 | Ga0075434_100056642 | 3300006871 | Bacteria | 3896 |
| 310 | Ga0075434_100153127 | 3300006871 | Bacteria | 2326 |
| 311 | Ga0075434_100159143 | 3300006871 | Unclassified | 2278 |
| 312 | Ga0075434_100360468 | 3300006871 | Bacteria | 1475 |
| 313 | Ga0075434_100578741 | 3300006871 | Bacteria | 1142 |
| 314 | Ga0075429_100030854 | 3300006880 | Bacteria | 4658 |
| 315 | Ga0075429_100093494 | 3300006880 | Bacteria | 2622 |
| 316 | Ga0068865_100000305 | 3300006881 | Bacteria | 27101 |
| 317 | Ga0068865_100006566 | 3300006881 | Bacteria | 7110 |
| 318 | Ga0068865_100053296 | 3300006881 | Bacteria | 2806 |
| 319 | Ga0068865_100085032 | 3300006881 | Bacteria | 2281 |
| 320 | Ga0068865_100096792 | 3300006881 | Bacteria | 2153 |
| 321 | Ga0097620_100000548 | 3300006931 | Bacteria | 37251 |
| 322 | Ga0097620_100003142 | 3300006931 | Bacteria | 16795 |
| 323 | Ga0097620_100007100 | 3300006931 | Bacteria | 11368 |
| 324 | Ga0097620_100024433 | 3300006931 | Bacteria | 6062 |
| 325 | Ga0097620_100050112 | 3300006931 | Bacteria | 4194 |
| 326 | Ga0097620_100217712 | 3300006931 | Bacteria | 1997 |
| 327 | Ga0097620_101148334 | 3300006931 | Bacteria | 855 |
| 328 | Ga0105251_10008897 | 3300009011 | Bacteria | 6010 |
| 329 | Ga0105240_10014974 | 3300009093 | Bacteria | 10566 |
| 330 | Ga0105240_10108406 | 3300009093 | Bacteria | 3365 |
| 331 | Ga0105240_10174218 | 3300009093 | Bacteria | 2545 |
| 332 | Ga0111539_10003134 | 3300009094 | Bacteria | 21872 |
| 333 | Ga0111539_10028863 | 3300009094 | Bacteria | 6766 |
| 334 | Ga0111539_10166724 | 3300009094 | Bacteria | 2575 |
| 335 | Ga0111539_10192785 | 3300009094 | Bacteria | 2377 |
| 336 | Ga0111539_11200814 | 3300009094 | Bacteria | 881 |
| 337 | Ga0105245_10008300 | 3300009098 | Bacteria | 9072 |
| 338 | Ga0105245_10950510 | 3300009098 | Bacteria | 902 |
| 339 | Ga0105247_10010870 | 3300009101 | Bacteria | 5499 |
| 340 | Ga0105247_10042203 | 3300009101 | Bacteria | 2793 |
| 341 | Ga0114129_10001566 | 3300009147 | Bacteria | 31036 |
| 342 | Ga0114129_10103578 | 3300009147 | Bacteria | 3935 |
| 343 | Ga0114129_10988474 | 3300009147 | Bacteria | 1060 |
| 344 | Ga0114129_11331391 | 3300009147 | Bacteria | 889 |
| 345 | Ga0105243_10004538 | 3300009148 | Bacteria | 10971 |
| 346 | Ga0105241_10006534 | 3300009174 | Bacteria | 8593 |
| 347 | Ga0105241_10371043 | 3300009174 | Bacteria | 1248 |
| 348 | Ga0105242_10029601 | 3300009176 | Bacteria | 4368 |
| 349 | Ga0105242_10079223 | 3300009176 | Bacteria | 2744 |
| 350 | Ga0105242_10148426 | 3300009176 | Bacteria | 2042 |
| 351 | Ga0105242_10688935 | 3300009176 | Bacteria | 998 |
| 352 | Ga0105248_10009060 | 3300009177 | Bacteria | 10946 |
| 353 | Ga0105248_10030473 | 3300009177 | Bacteria | 6023 |
| 354 | Ga0105248_10034915 | 3300009177 | Bacteria | 5627 |
| 355 | Ga0105248_10130909 | 3300009177 | Bacteria | 2830 |
| 356 | Ga0105248_10131205 | 3300009177 | Bacteria | 2827 |
| 357 | Ga0105248_10315236 | 3300009177 | Bacteria | 1762 |
| 358 | Ga0105237_10204634 | 3300009545 | Bacteria | 1974 |
| 359 | Ga0105237_10251426 | 3300009545 | Bacteria | 1770 |
| 360 | Ga0105237_10512691 | 3300009545 | Bacteria | 1206 |
| 361 | Ga0105237_11121596 | 3300009545 | Bacteria | 793 |
| 362 | Ga0105238_10007180 | 3300009551 | Bacteria | 11142 |
| 363 | Ga0105238_10071679 | 3300009551 | Bacteria | 3462 |
| 364 | Ga0105249_10009105 | 3300009553 | Bacteria | 8683 |
| 365 | Ga0105249_10092530 | 3300009553 | Unclassified | 2831 |
| 366 | Ga0105249_10232227 | 3300009553 | Bacteria | 1820 |
| 367 | Ga0105249_10300942 | 3300009553 | Bacteria | 1609 |
| 368 | Ga0105249_11021939 | 3300009553 | Unclassified | 896 |
| 369 | Ga0105239_10021898 | 3300010375 | Bacteria | 7046 |
| 370 | Ga0105239_10058956 | 3300010375 | Bacteria | 4214 |
| 371 | Ga0105239_10119122 | 3300010375 | Bacteria | 2930 |
| 372 | Ga0105239_10535735 | 3300010375 | Bacteria | 1333 |
| 373 | Ga0105246_10065155 | 3300011119 | Bacteria | 2547 |
| 374 | Ga0105246_10752466 | 3300011119 | Bacteria | 860 |
| 375 | Ga0157373_10005110 | 3300013100 | Bacteria | 9862 |
| 376 | Ga0157373_10064475 | 3300013100 | Bacteria | 2593 |
| 377 | Ga0157373_10269897 | 3300013100 | Bacteria | 1204 |
| 378 | Ga0157371_10000330 | 3300013102 | Bacteria | 61144 |
| 379 | Ga0157371_10132508 | 3300013102 | Unclassified | 1774 |
| 380 | Ga0157371_10634718 | 3300013102 | Bacteria | 796 |
| 381 | Ga0157370_10027517 | 3300013104 | Bacteria | 5606 |
| 382 | Ga0157370_10063967 | 3300013104 | Bacteria | 3483 |
| 383 | Ga0157369_10017713 | 3300013105 | Bacteria | 8000 |
| 384 | Ga0157369_10161662 | 3300013105 | Bacteria | 2364 |
| 385 | Ga0157369_10232934 | 3300013105 | Bacteria | 1925 |
| 386 | Ga0157369_10366923 | 3300013105 | Bacteria | 1495 |
| 387 | Ga0157369_10496390 | 3300013105 | Bacteria | 1263 |
| 388 | Ga0157374_10000286 | 3300013296 | Bacteria | 46853 |
| 389 | Ga0157374_10002810 | 3300013296 | Bacteria | 14607 |
| 390 | Ga0157374_10040877 | 3300013296 | Bacteria | 4271 |
| 391 | Ga0157374_10158128 | 3300013296 | Bacteria | 2206 |
| 392 | Ga0157374_10236500 | 3300013296 | Bacteria | 1795 |
| 393 | Ga0157374_11005309 | 3300013296 | Bacteria | 853 |
| 394 | Ga0157378_10001140 | 3300013297 | Bacteria | 24155 |
| 395 | Ga0157378_10056612 | 3300013297 | Bacteria | 3494 |
| 396 | Ga0157378_10076042 | 3300013297 | Bacteria | 3024 |
| 397 | Ga0157378_10079153 | 3300013297 | Bacteria | 2967 |
| 398 | Ga0157378_10119157 | 3300013297 | Bacteria | 2431 |
| 399 | Ga0157378_10123996 | 3300013297 | Bacteria | 2385 |
| 400 | Ga0157378_10143688 | 3300013297 | Bacteria | 2218 |
| 401 | Ga0163162_10003799 | 3300013306 | Bacteria | 14485 |
| 402 | Ga0163162_10158951 | 3300013306 | Bacteria | 2381 |
| 403 | Ga0163162_10161614 | 3300013306 | Bacteria | 2362 |
| 404 | Ga0163162_10295960 | 3300013306 | Bacteria | 1750 |
| 405 | Ga0163162_11007096 | 3300013306 | Bacteria | 942 |
| 406 | Ga0163162_11186080 | 3300013306 | Bacteria | 866 |
| 407 | Ga0163162_12018871 | 3300013306 | Bacteria | 661 |
| 408 | Ga0157372_10018145 | 3300013307 | Bacteria | 7565 |
| 409 | Ga0157372_10203107 | 3300013307 | Bacteria | 2296 |
| 410 | Ga0157372_10247440 | 3300013307 | Bacteria | 2069 |
| 411 | Ga0157372_10476525 | 3300013307 | Bacteria | 1455 |
| 412 | Ga0157375_10029021 | 3300013308 | Bacteria | 5196 |
| 413 | Ga0157375_10038446 | 3300013308 | Bacteria | 4595 |
| 414 | Ga0157375_10061001 | 3300013308 | Bacteria | 3742 |
| 415 | Ga0157375_10419192 | 3300013308 | Bacteria | 1505 |
| 416 | Ga0157375_10872079 | 3300013308 | Bacteria | 1045 |
| 417 | Ga0163163_10022213 | 3300014325 | Bacteria | 6003 |
| 418 | Ga0163163_10035753 | 3300014325 | Bacteria | 4821 |
| 419 | Ga0163163_10128168 | 3300014325 | Bacteria | 2576 |
| 420 | Ga0163163_10357665 | 3300014325 | Bacteria | 1516 |
| 421 | Ga0157380_10000449 | 3300014326 | Bacteria | 25167 |
| 422 | Ga0157380_10040064 | 3300014326 | Bacteria | 3646 |
| 423 | Ga0157380_10066986 | 3300014326 | Bacteria | 2890 |
| 424 | Ga0157380_10231317 | 3300014326 | Bacteria | 1660 |
| 425 | Ga0182008_10267819 | 3300014497 | Bacteria | 885 |
| 426 | Ga0157377_10214265 | 3300014745 | Bacteria | 1230 |
| 427 | Ga0157379_10020080 | 3300014968 | Bacteria | 5905 |
| 428 | Ga0157379_10034811 | 3300014968 | Bacteria | 4491 |
| 429 | Ga0157379_10373771 | 3300014968 | Bacteria | 1307 |
| 430 | Ga0157379_11163853 | 3300014968 | Unclassified | 741 |
| 431 | Ga0157376_10008963 | 3300014969 | Bacteria | 7245 |
| 432 | Ga0157376_10136242 | 3300014969 | Bacteria | 2197 |
| 433 | Ga0157376_11057459 | 3300014969 | Bacteria | 836 |
| 434 | Ga0163161_10021490 | 3300017792 | Bacteria | 4534 |
| 435 | Ga0163161_10067580 | 3300017792 | Bacteria | 2610 |
| 436 | Ga0163161_10214259 | 3300017792 | Unclassified | 1489 |
| 437 | Ga0206354_11167538 | 3300020081 | Bacteria | 1647 |
| 438 | Ga0207697_10018755 | 3300025315 | Bacteria | 2835 |
| 439 | Ga0207656_10004890 | 3300025321 | Bacteria | 4702 |
| 440 | Ga0207656_10018064 | 3300025321 | Bacteria | 2770 |
| 441 | Ga0207656_10173677 | 3300025321 | Bacteria | 1031 |
| 442 | Ga0207656_10256049 | 3300025321 | Bacteria | 858 |
| 443 | Ga0207656_10264257 | 3300025321 | Bacteria | 846 |
| 444 | Ga0207713_1024027 | 3300025735 | Bacteria | 2851 |
| 445 | Ga0207682_10001309 | 3300025893 | Bacteria | 11440 |
| 446 | Ga0207692_10119800 | 3300025898 | Bacteria | 1472 |
| 447 | Ga0207692_10148269 | 3300025898 | Bacteria | 1341 |
| 448 | Ga0207642_10000855 | 3300025899 | Bacteria | 9475 |
| 449 | Ga0207642_10149201 | 3300025899 | Bacteria | 1242 |
| 450 | Ga0207710_10019811 | 3300025900 | Bacteria | 2872 |
| 451 | Ga0207710_10261838 | 3300025900 | Bacteria | 867 |
| 452 | Ga0207688_10000064 | 3300025901 | Bacteria | 38683 |
| 453 | Ga0207680_10002662 | 3300025903 | Bacteria | 8352 |
| 454 | Ga0207680_10008244 | 3300025903 | Bacteria | 5108 |
| 455 | Ga0207680_10144850 | 3300025903 | Bacteria | 1578 |
| 456 | Ga0207699_10022518 | 3300025906 | Bacteria | 3415 |
| 457 | Ga0207699_10082855 | 3300025906 | Bacteria | 1993 |
| 458 | Ga0207699_10106843 | 3300025906 | Bacteria | 1787 |
| 459 | Ga0207699_10511103 | 3300025906 | Bacteria | 868 |
| 460 | Ga0207645_10000517 | 3300025907 | Bacteria | 32075 |
| 461 | Ga0207645_10004266 | 3300025907 | Bacteria | 10610 |
| 462 | Ga0207645_10014722 | 3300025907 | Bacteria | 5222 |
| 463 | Ga0207645_10270136 | 3300025907 | Bacteria | 1127 |
| 464 | Ga0207645_10370344 | 3300025907 | Bacteria | 960 |
| 465 | Ga0207643_10000593 | 3300025908 | Bacteria | 22972 |
| 466 | Ga0207643_10034526 | 3300025908 | Bacteria | 2834 |
| 467 | Ga0207643_10037936 | 3300025908 | Bacteria | 2705 |
| 468 | Ga0207643_10061840 | 3300025908 | Bacteria | 2139 |
| 469 | Ga0207643_10079348 | 3300025908 | Bacteria | 1900 |
| 470 | Ga0207705_10065087 | 3300025909 | Bacteria | 2635 |
| 471 | Ga0207705_10290055 | 3300025909 | Bacteria | 1254 |
| 472 | Ga0207684_10020548 | 3300025910 | Bacteria | 5642 |
| 473 | Ga0207654_10012461 | 3300025911 | Bacteria | 4357 |
| 474 | Ga0207707_10001948 | 3300025912 | Bacteria | 18787 |
| 475 | Ga0207707_10177929 | 3300025912 | Bacteria | 1858 |
| 476 | Ga0207695_10006723 | 3300025913 | Bacteria | 14842 |
| 477 | Ga0207695_10191046 | 3300025913 | Bacteria | 1965 |
| 478 | Ga0207671_10139784 | 3300025914 | Bacteria | 1865 |
| 479 | Ga0207671_10330991 | 3300025914 | Bacteria | 1206 |
| 480 | Ga0207693_10003485 | 3300025915 | Bacteria | 13422 |
| 481 | Ga0207693_10043597 | 3300025915 | Bacteria | 3528 |
| 482 | Ga0207663_10013001 | 3300025916 | Bacteria | 4514 |
| 483 | Ga0207660_10007884 | 3300025917 | Bacteria | 6892 |
| 484 | Ga0207662_10004084 | 3300025918 | Bacteria | 7627 |
| 485 | Ga0207662_10022451 | 3300025918 | Bacteria | 3619 |
| 486 | Ga0207662_10046069 | 3300025918 | Bacteria | 2579 |
| 487 | Ga0207657_10000745 | 3300025919 | Bacteria | 34547 |
| 488 | Ga0207657_10000927 | 3300025919 | Bacteria | 31004 |
| 489 | Ga0207657_10033548 | 3300025919 | Bacteria | 4626 |
| 490 | Ga0207657_10061986 | 3300025919 | Bacteria | 3203 |
| 491 | Ga0207649_10046725 | 3300025920 | Bacteria | 2661 |
| 492 | Ga0207649_10063546 | 3300025920 | Bacteria | 2331 |
| 493 | Ga0207649_10131544 | 3300025920 | Bacteria | 1700 |
| 494 | Ga0207649_10235537 | 3300025920 | Bacteria | 1311 |
| 495 | Ga0207652_10013940 | 3300025921 | Bacteria | 6508 |
| 496 | Ga0207652_10169230 | 3300025921 | Bacteria | 1960 |
| 497 | Ga0207652_10178783 | 3300025921 | Bacteria | 1906 |
| 498 | Ga0207652_10218140 | 3300025921 | Bacteria | 1719 |
| 499 | Ga0207681_10007743 | 3300025923 | Bacteria | 6580 |
| 500 | Ga0207681_10083857 | 3300025923 | Bacteria | 2257 |
| 501 | Ga0207681_10155468 | 3300025923 | Bacteria | 1718 |
| 502 | Ga0207681_10725148 | 3300025923 | Bacteria | 827 |
| 503 | Ga0207694_10016717 | 3300025924 | Bacteria | 5546 |
| 504 | Ga0207650_10005701 | 3300025925 | Bacteria | 8500 |
| 505 | Ga0207650_10012515 | 3300025925 | Bacteria | 5856 |
| 506 | Ga0207650_10012972 | 3300025925 | Bacteria | 5761 |
| 507 | Ga0207650_10038721 | 3300025925 | Bacteria | 3483 |
| 508 | Ga0207650_10062656 | 3300025925 | Bacteria | 2779 |
| 509 | Ga0207650_10204871 | 3300025925 | Bacteria | 1582 |
| 510 | Ga0207650_10276376 | 3300025925 | Bacteria | 1366 |
| 511 | Ga0207659_10008481 | 3300025926 | Bacteria | 6383 |
| 512 | Ga0207659_10039126 | 3300025926 | Bacteria | 3304 |
| 513 | Ga0207659_10039639 | 3300025926 | Bacteria | 3287 |
| 514 | Ga0207659_10180953 | 3300025926 | Bacteria | 1670 |
| 515 | Ga0207659_10304532 | 3300025926 | Bacteria | 1310 |
| 516 | Ga0207659_10415873 | 3300025926 | Bacteria | 1127 |
| 517 | Ga0207687_10000800 | 3300025927 | Bacteria | 21246 |
| 518 | Ga0207687_10478042 | 3300025927 | Bacteria | 1037 |
| 519 | Ga0207700_10000073 | 3300025928 | Bacteria | 61784 |
| 520 | Ga0207700_10444260 | 3300025928 | Bacteria | 1142 |
| 521 | Ga0207664_10015163 | 3300025929 | Bacteria | 5585 |
| 522 | Ga0207644_10002067 | 3300025931 | Bacteria | 12998 |
| 523 | Ga0207644_10014673 | 3300025931 | Bacteria | 5249 |
| 524 | Ga0207644_10040602 | 3300025931 | Bacteria | 3289 |
| 525 | Ga0207644_10048940 | 3300025931 | Bacteria | 3025 |
| 526 | Ga0207644_10054154 | 3300025931 | Bacteria | 2888 |
| 527 | Ga0207644_10195795 | 3300025931 | Bacteria | 1591 |
| 528 | Ga0207644_10228680 | 3300025931 | Bacteria | 1477 |
| 529 | Ga0207644_10771129 | 3300025931 | Bacteria | 804 |
| 530 | Ga0207690_10001061 | 3300025932 | Bacteria | 17606 |
| 531 | Ga0207690_10008488 | 3300025932 | Bacteria | 6095 |
| 532 | Ga0207690_10128236 | 3300025932 | Bacteria | 1853 |
| 533 | Ga0207690_10456793 | 3300025932 | Unclassified | 1027 |
| 534 | Ga0207690_10469206 | 3300025932 | Bacteria | 1014 |
| 535 | Ga0207690_10485170 | 3300025932 | Bacteria | 998 |
| 536 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 537 | Ga0207706_10000585 | 3300025933 | Bacteria | 38812 |
| 538 | Ga0207706_10223969 | 3300025933 | Bacteria | 1646 |
| 539 | Ga0207706_10239475 | 3300025933 | Bacteria | 1586 |
| 540 | Ga0207706_10267134 | 3300025933 | Bacteria | 1493 |
| 541 | Ga0207706_10962515 | 3300025933 | Bacteria | 719 |
| 542 | Ga0207686_10002242 | 3300025934 | Bacteria | 10617 |
| 543 | Ga0207686_10434218 | 3300025934 | Bacteria | 1007 |
| 544 | Ga0207686_10623116 | 3300025934 | Bacteria | 851 |
| 545 | Ga0207709_10005847 | 3300025935 | Bacteria | 6953 |
| 546 | Ga0207670_10015865 | 3300025936 | Bacteria | 4511 |
| 547 | Ga0207670_10021052 | 3300025936 | Bacteria | 4017 |
| 548 | Ga0207670_10063507 | 3300025936 | Bacteria | 2527 |
| 549 | Ga0207670_10081540 | 3300025936 | Bacteria | 2264 |
| 550 | Ga0207669_10034323 | 3300025937 | Bacteria | 2873 |
| 551 | Ga0207669_10722320 | 3300025937 | Bacteria | 820 |
| 552 | Ga0207704_10001417 | 3300025938 | Bacteria | 10719 |
| 553 | Ga0207704_10026988 | 3300025938 | Bacteria | 3159 |
| 554 | Ga0207704_10050304 | 3300025938 | Bacteria | 2513 |
| 555 | Ga0207704_10067624 | 3300025938 | Bacteria | 2249 |
| 556 | Ga0207691_10000688 | 3300025940 | Bacteria | 33404 |
| 557 | Ga0207691_10013470 | 3300025940 | Bacteria | 7824 |
| 558 | Ga0207691_10014621 | 3300025940 | Bacteria | 7482 |
| 559 | Ga0207691_10040386 | 3300025940 | Bacteria | 4311 |
| 560 | Ga0207691_10043574 | 3300025940 | Bacteria | 4135 |
| 561 | Ga0207691_10173810 | 3300025940 | Bacteria | 1885 |
| 562 | Ga0207711_10000087 | 3300025941 | Bacteria | 98302 |
| 563 | Ga0207711_10007347 | 3300025941 | Bacteria | 9222 |
| 564 | Ga0207711_10022461 | 3300025941 | Bacteria | 5275 |
| 565 | Ga0207711_10081565 | 3300025941 | Bacteria | 2827 |
| 566 | Ga0207711_10233237 | 3300025941 | Bacteria | 1686 |
| 567 | Ga0207689_10000069 | 3300025942 | Bacteria | 83053 |
| 568 | Ga0207689_10000642 | 3300025942 | Bacteria | 33355 |
| 569 | Ga0207689_10003820 | 3300025942 | Bacteria | 13729 |
| 570 | Ga0207689_10027555 | 3300025942 | Bacteria | 4754 |
| 571 | Ga0207661_10010000 | 3300025944 | Bacteria | 6816 |
| 572 | Ga0207679_10013781 | 3300025945 | Bacteria | 5302 |
| 573 | Ga0207679_10051343 | 3300025945 | Bacteria | 3018 |
| 574 | Ga0207679_10067061 | 3300025945 | Bacteria | 2691 |
| 575 | Ga0207679_10105109 | 3300025945 | Bacteria | 2217 |
| 576 | Ga0207679_10151238 | 3300025945 | Bacteria | 1889 |
| 577 | Ga0207679_10174401 | 3300025945 | Bacteria | 1773 |
| 578 | Ga0207679_10485927 | 3300025945 | Bacteria | 1100 |
| 579 | Ga0207679_10653644 | 3300025945 | Bacteria | 951 |
| 580 | Ga0207667_10001383 | 3300025949 | Bacteria | 30431 |
| 581 | Ga0207667_10008157 | 3300025949 | Bacteria | 12470 |
| 582 | Ga0207667_10026225 | 3300025949 | Bacteria | 6369 |
| 583 | Ga0207667_10299919 | 3300025949 | Unclassified | 1642 |
| 584 | Ga0207667_10356438 | 3300025949 | Bacteria | 1492 |
| 585 | Ga0207651_10007432 | 3300025960 | Bacteria | 5838 |
| 586 | Ga0207651_10076905 | 3300025960 | Bacteria | 2387 |
| 587 | Ga0207651_10080674 | 3300025960 | Bacteria | 2342 |
| 588 | Ga0207712_10021014 | 3300025961 | Bacteria | 4280 |
| 589 | Ga0207712_10208263 | 3300025961 | Bacteria | 1555 |
| 590 | Ga0207668_10004330 | 3300025972 | Bacteria | 8333 |
| 591 | Ga0207668_10013121 | 3300025972 | Bacteria | 5092 |
| 592 | Ga0207668_10121321 | 3300025972 | Bacteria | 1980 |
| 593 | Ga0207640_10093279 | 3300025981 | Bacteria | 2091 |
| 594 | Ga0207640_10285338 | 3300025981 | Bacteria | 1299 |
| 595 | Ga0207658_10025203 | 3300025986 | Bacteria | 4163 |
| 596 | Ga0207658_10152481 | 3300025986 | Bacteria | 1884 |
| 597 | Ga0207658_10247727 | 3300025986 | Bacteria | 1512 |
| 598 | Ga0207677_10000700 | 3300026023 | Bacteria | 19901 |
| 599 | Ga0207677_10007124 | 3300026023 | Bacteria | 6157 |
| 600 | Ga0207677_10286087 | 3300026023 | Bacteria | 1355 |
| 601 | Ga0207677_10360332 | 3300026023 | Bacteria | 1221 |
| 602 | Ga0207677_10557167 | 3300026023 | Bacteria | 1000 |
| 603 | Ga0207703_10000994 | 3300026035 | Bacteria | 27268 |
| 604 | Ga0207703_10004909 | 3300026035 | Bacteria | 10868 |
| 605 | Ga0207703_10005565 | 3300026035 | Bacteria | 10111 |
| 606 | Ga0207703_10013743 | 3300026035 | Bacteria | 6311 |
| 607 | Ga0207703_10018715 | 3300026035 | Bacteria | 5410 |
| 608 | Ga0207639_10010939 | 3300026041 | Bacteria | 6292 |
| 609 | Ga0207639_10014491 | 3300026041 | Bacteria | 5547 |
| 610 | Ga0207639_10144669 | 3300026041 | Bacteria | 1985 |
| 611 | Ga0207639_10210511 | 3300026041 | Bacteria | 1673 |
| 612 | Ga0207639_10397560 | 3300026041 | Bacteria | 1241 |
| 613 | Ga0207639_10514032 | 3300026041 | Bacteria | 1096 |
| 614 | Ga0207678_10001787 | 3300026067 | Bacteria | 19688 |
| 615 | Ga0207678_10012488 | 3300026067 | Bacteria | 7458 |
| 616 | Ga0207678_10058005 | 3300026067 | Bacteria | 3332 |
| 617 | Ga0207678_10132633 | 3300026067 | Bacteria | 2126 |
| 618 | Ga0207678_10296284 | 3300026067 | Bacteria | 1390 |
| 619 | Ga0207708_10000102 | 3300026075 | Bacteria | 64743 |
| 620 | Ga0207708_10002194 | 3300026075 | Bacteria | 14414 |
| 621 | Ga0207708_10014181 | 3300026075 | Bacteria | 5959 |
| 622 | Ga0207708_10280486 | 3300026075 | Unclassified | 1350 |
| 623 | Ga0207702_10004398 | 3300026078 | Bacteria | 12551 |
| 624 | Ga0207702_10020136 | 3300026078 | Bacteria | 5527 |
| 625 | Ga0207702_10085787 | 3300026078 | Bacteria | 2744 |
| 626 | Ga0207641_10683779 | 3300026088 | Bacteria | 1009 |
| 627 | Ga0207648_10000048 | 3300026089 | Bacteria | 109946 |
| 628 | Ga0207648_10005941 | 3300026089 | Bacteria | 12211 |
| 629 | Ga0207648_10006115 | 3300026089 | Bacteria | 12004 |
| 630 | Ga0207648_10006307 | 3300026089 | Bacteria | 11795 |
| 631 | Ga0207648_10040528 | 3300026089 | Bacteria | 4092 |
| 632 | Ga0207676_10000140 | 3300026095 | Bacteria | 62993 |
| 633 | Ga0207676_10014793 | 3300026095 | Bacteria | 5620 |
| 634 | Ga0207676_10027398 | 3300026095 | Bacteria | 4244 |
| 635 | Ga0207676_10119335 | 3300026095 | Bacteria | 2221 |
| 636 | Ga0207676_10244230 | 3300026095 | Bacteria | 1612 |
| 637 | Ga0207676_10603737 | 3300026095 | Bacteria | 1054 |
| 638 | Ga0207674_10000429 | 3300026116 | Bacteria | 54858 |
| 639 | Ga0207674_10002511 | 3300026116 | Bacteria | 23131 |
| 640 | Ga0207674_10004730 | 3300026116 | Bacteria | 16322 |
| 641 | Ga0207674_10115494 | 3300026116 | Bacteria | 2656 |
| 642 | Ga0207674_10530958 | 3300026116 | Bacteria | 1137 |
| 643 | Ga0207675_100000527 | 3300026118 | Bacteria | 37150 |
| 644 | Ga0207675_100001991 | 3300026118 | Bacteria | 20375 |
| 645 | Ga0207675_100005190 | 3300026118 | Bacteria | 12538 |
| 646 | Ga0207675_100006094 | 3300026118 | Bacteria | 11473 |
| 647 | Ga0207675_100006419 | 3300026118 | Bacteria | 11136 |
| 648 | Ga0207675_100096997 | 3300026118 | Bacteria | 2776 |
| 649 | Ga0207675_100127263 | 3300026118 | Bacteria | 2414 |
| 650 | Ga0207675_100180959 | 3300026118 | Bacteria | 2018 |
| 651 | Ga0207675_100333972 | 3300026118 | Bacteria | 1482 |
| 652 | Ga0207683_10000258 | 3300026121 | Bacteria | 47224 |
| 653 | Ga0207683_10007413 | 3300026121 | Bacteria | 9407 |
| 654 | Ga0207683_10019835 | 3300026121 | Bacteria | 5743 |
| 655 | Ga0207683_10048403 | 3300026121 | Bacteria | 3723 |
| 656 | Ga0207683_10124070 | 3300026121 | Bacteria | 2320 |
| 657 | Ga0207683_10585378 | 3300026121 | Bacteria | 1032 |
| 658 | Ga0207683_10696537 | 3300026121 | Bacteria | 942 |
| 659 | Ga0207698_10025921 | 3300026142 | Bacteria | 4140 |
| 660 | Ga0207698_10027312 | 3300026142 | Bacteria | 4050 |
| 661 | Ga0207698_10083504 | 3300026142 | Bacteria | 2585 |
| 662 | Ga0207698_10176926 | 3300026142 | Bacteria | 1885 |
| 663 | Ga0207698_10371191 | 3300026142 | Bacteria | 1358 |
| 664 | Ga0207698_10474750 | 3300026142 | Bacteria | 1212 |
| 665 | Ga0207698_10484567 | 3300026142 | Bacteria | 1200 |
| 666 | Ga0207698_10972935 | 3300026142 | Bacteria | 858 |
| 667 | Ga0210000_1007201 | 3300027462 | Bacteria | 1626 |
| 668 | Ga0209971_1006278 | 3300027682 | Bacteria | 2813 |
| 669 | Ga0209974_10026864 | 3300027876 | Bacteria | 1904 |
| 670 | Ga0207428_10012525 | 3300027907 | Bacteria | 7446 |
| 671 | Ga0207428_10013315 | 3300027907 | Bacteria | 7191 |
| 672 | Ga0268266_10025724 | 3300028379 | Bacteria | 5008 |
| 673 | Ga0268266_10106968 | 3300028379 | Bacteria | 2473 |
| 674 | Ga0268266_10286865 | 3300028379 | Bacteria | 1532 |
| 675 | Ga0268265_10015056 | 3300028380 | Bacteria | 5282 |
| 676 | Ga0268265_10038563 | 3300028380 | Bacteria | 3515 |
| 677 | Ga0268265_10106839 | 3300028380 | Unclassified | 2274 |
| 678 | Ga0268265_10184640 | 3300028380 | Bacteria | 1795 |
| 679 | Ga0268265_10453058 | 3300028380 | Bacteria | 1199 |
| 680 | Ga0268265_10499085 | 3300028380 | Bacteria | 1146 |
| 681 | Ga0268264_10000523 | 3300028381 | Bacteria | 48670 |
| 682 | Ga0268264_10008062 | 3300028381 | Bacteria | 8760 |
| 683 | Ga0268264_10017643 | 3300028381 | Bacteria | 5844 |
| 684 | Ga0268264_10092267 | 3300028381 | Bacteria | 2613 |
| 685 | Ga0268264_10113457 | 3300028381 | Bacteria | 2378 |
| 686 | Ga0268264_10332787 | 3300028381 | Bacteria | 1440 |
| 687 | Ga0268264_10843934 | 3300028381 | Bacteria | 917 |
| 688 | Ga0307515_10026788 | 3300028794 | Bacteria | 9896 |
| 689 | Ga0265329_10025516 | 3300031242 | Bacteria | 1955 |
| 690 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 691 | Ga0307408_100040552 | 3300031548 | Bacteria | 3297 |
| 692 | Ga0307408_100195641 | 3300031548 | Bacteria | 1632 |
| 693 | Ga0307408_100200318 | 3300031548 | Bacteria | 1615 |
| 694 | Ga0265314_10060431 | 3300031711 | Bacteria | 2586 |
| 695 | Ga0307405_10098914 | 3300031731 | Unclassified | 1951 |
| 696 | Ga0307413_10000525 | 3300031824 | Bacteria | 12688 |
| 697 | Ga0307413_10065374 | 3300031824 | Bacteria | 2264 |
| 698 | Ga0307410_10013194 | 3300031852 | Bacteria | 4810 |
| 699 | Ga0307406_10014179 | 3300031901 | Bacteria | 4581 |
| 700 | Ga0307406_10094907 | 3300031901 | Unclassified | 2017 |
| 701 | Ga0307407_10003999 | 3300031903 | Bacteria | 6168 |
| 702 | Ga0307407_10006770 | 3300031903 | Bacteria | 5131 |
| 703 | Ga0307407_10227855 | 3300031903 | Bacteria | 1264 |
| 704 | Ga0307412_10047662 | 3300031911 | Bacteria | 2815 |
| 705 | Ga0307409_100010145 | 3300031995 | Bacteria | 5836 |
| 706 | Ga0307409_100016686 | 3300031995 | Bacteria | 4868 |
| 707 | Ga0307409_100163097 | 3300031995 | Bacteria | 1952 |
| 708 | Ga0307409_100324843 | 3300031995 | Unclassified | 1442 |
| 709 | Ga0307416_100004232 | 3300032002 | Bacteria | 8616 |
| 710 | Ga0307416_100014686 | 3300032002 | Bacteria | 5380 |
| 711 | Ga0307416_100087493 | 3300032002 | Bacteria | 2660 |
| 712 | Ga0307414_10012002 | 3300032004 | Bacteria | 5107 |
| 713 | Ga0307414_10120681 | 3300032004 | Bacteria | 2015 |
| 714 | Ga0307411_10002182 | 3300032005 | Bacteria | 8502 |
| 715 | Ga0307411_10006514 | 3300032005 | Bacteria | 5850 |
| 716 | Ga0307411_10016744 | 3300032005 | Bacteria | 4156 |
| 717 | Ga0373934_0148616 | 3300035086 | Unclassified | 959 |
| 718 | Ga0373940_0009372 | 3300035088 | Bacteria | 2275 |
| 719 | Ga0373923_0077260 | 3300035111 | Bacteria | 1439 |
| 720 | Ga0373936_0017734 | 3300035113 | Bacteria | 2743 |
| 721 | Ga0373936_0108957 | 3300035113 | Bacteria | 1175 |
| 722 | Ga0373939_0000089 | 3300035114 | Bacteria | 29155 |
| 723 | Ga0373953_0016078 | 3300035117 | Bacteria | 2725 |
| 724 | Ga0373954_0000495 | 3300035118 | Bacteria | 14814 |
| 725 | Ga0373954_0046201 | 3300035118 | Bacteria | 2035 |
| 726 | Ga0373956_0017278 | 3300035119 | Bacteria | 3039 |
| 727 | Ga0373957_0010986 | 3300035120 | Bacteria | 3009 |
| 728 | Ga0373960_0000853 | 3300035121 | Bacteria | 6448 |
| 729 | Ga0373960_0077176 | 3300035121 | Bacteria | 1042 |
| 730 | Ga0373943_0212706 | 3300035170 | Bacteria | 1074 |
| 731 | Ga0373955_0002775 | 3300035172 | Bacteria | 7684 |
| 732 | Ga0373955_0013970 | 3300035172 | Bacteria | 3898 |
| 733 | Ga0373955_0030278 | 3300035172 | Bacteria | 2824 |
| 734 | Ga0373955_0146636 | 3300035172 | Bacteria | 1387 |
| 735 | Ga0373955_0219442 | 3300035172 | Unclassified | 1135 |
| 736 | Ga0373924_0009262 | 3300035410 | Bacteria | 3606 |
| 737 | Ga0373931_0001113 | 3300035691 | Bacteria | 11411 |
| 738 | Ga0373931_0048919 | 3300035691 | Bacteria | 2243 |
| 739 | Ga0373931_0068163 | 3300035691 | Bacteria | 1936 |
| 740 | Ga0373935_0387188 | 3300035692 | Bacteria | 1002 |
| 741 | Ga0373935_0414952 | 3300035692 | Bacteria | 968 |
| 742 | Ga0373927_0323704 | 3300035695 | Bacteria | 1015 |
| 743 | Ga0373933_0007482 | 3300035724 | Bacteria | 5963 |
| 744 | Ga0373933_0177656 | 3300035724 | Bacteria | 1357 |
| 745 | Ga0373933_0325194 | 3300035724 | Bacteria | 997 |
| 746 | Ga0373947_0172210 | 3300035725 | Bacteria | 1405 |
| 747 | Ga0373947_0176670 | 3300035725 | Bacteria | 1388 |
| 748 | Ga0373937_0003673 | 3300036401 | Bacteria | 12956 |
| 749 | Ga0373937_0059200 | 3300036401 | Bacteria | 3520 |
| 750 | Ga0373937_0197746 | 3300036401 | Bacteria | 1889 |
| 751 | Ga0373937_0209720 | 3300036401 | Bacteria | 1833 |
| 752 | Ga0373937_0245343 | 3300036401 | Bacteria | 1688 |
| 753 | Ga0373937_0282294 | 3300036401 | Bacteria | 1568 |
| 754 | Ga0373937_0404930 | 3300036401 | Bacteria | 1294 |
| 755 | Ga0373925_0032323 | 3300037068 | Bacteria | 3852 |
| 756 | Ga0373925_0060497 | 3300037068 | Bacteria | 2844 |
| 757 | Ga0373925_0557647 | 3300037068 | Bacteria | 942 |
| 758 | Ga0395899_0094005 | 3300037312 | Bacteria | 2170 |
| 759 | Ga0395900_0279153 | 3300037418 | Bacteria | 1663 |
| 760 | Ga0395898_0128534 | 3300037466 | Bacteria | 2427 |
| 761 | Ga0395898_0245420 | 3300037466 | Bacteria | 1708 |
| 762 | Ga0395905_0101849 | 3300037471 | Bacteria | 2696 |
| 763 | Ga0395905_0163713 | 3300037471 | Bacteria | 2090 |
| 764 | Ga0395901_0215998 | 3300038443 | Bacteria | 2006 |
| 765 | Ga0451797_0459451 | 3300041453 | Bacteria | 2691 |
| 766 | Ga0451798_1011580 | 3300041458 | Bacteria | 1337 |
| 767 | Ga0451802_1947593 | 3300041460 | Bacteria | 4569 |
| 768 | Ga0451807_0129515 | 3300041486 | Bacteria | 6177 |
| 769 | Ga0451807_1798842 | 3300041486 | Bacteria | 1381 |
| 770 | Ga0451837_0939764 | 3300041494 | Unclassified | 2091 |
| 771 | Ga0451855_1464634 | 3300041511 | Bacteria | 896 |
| 772 | Ga0451853_0624379 | 3300041512 | Bacteria | 1125 |
| 773 | Ga0439445_0017454 | 3300042004 | Bacteria | 1774 |
| 774 | Ga0450913_006632 | 3300042117 | Bacteria | 854 |
| 775 | Ga0450888_000605 | 3300042126 | Bacteria | 3392 |
| 776 | Ga0450891_000309 | 3300042129 | Bacteria | 4999 |
| 777 | Ga0450902_017625 | 3300042137 | Bacteria | 1168 |
| 778 | Ga0450916_008109 | 3300042530 | Bacteria | 1273 |
| 779 | Ga0450918_000034 | 3300042531 | Bacteria | 28207 |
| 780 | Ga0451577_0099787 | 3300042876 | Bacteria | 2594 |
| 781 | Ga0453684_0148943 | 3300044712 | Bacteria | 2784 |
| 782 | Ga0453684_1057083 | 3300044712 | Bacteria | 860 |
| 783 | Ga0451576_0021175 | 3300045051 | Bacteria | 7069 |
| 784 | Ga0451576_0025168 | 3300045051 | Bacteria | 6416 |
| 785 | Ga0466958_0154382 | 3300045836 | Bacteria | 1449 |
| 786 | Ga0495638_0191523 | 3300046460 | Bacteria | 1160 |
| 787 | Ga0495651_0332618 | 3300046462 | Bacteria | 1009 |
| 788 | Ga0495580_0217320 | 3300046472 | Bacteria | 1314 |
| 789 | Ga0495664_0056002 | 3300046477 | Bacteria | 2345 |
| 790 | Ga0495664_0069842 | 3300046477 | Bacteria | 2097 |
| 791 | Ga0495616_0001229 | 3300046513 | Bacteria | 18020 |
| 792 | Ga0495621_0031615 | 3300046539 | Bacteria | 1817 |
| 793 | Ga0495645_0018541 | 3300046543 | Bacteria | 5000 |
| 794 | Ga0495625_0013181 | 3300046660 | Bacteria | 6658 |
| 795 | Ga0495625_0146774 | 3300046660 | Bacteria | 1588 |
| 796 | Ga0495623_0043132 | 3300046679 | Bacteria | 2871 |
| 797 | Ga0495647_0130193 | 3300046681 | Bacteria | 1066 |
| 798 | Ga0495674_0601374 | 3300047319 | Unclassified | 871 |
| 799 | Ga0495675_0167218 | 3300047444 | Bacteria | 1352 |
| 800 | Ga0495684_0433600 | 3300047471 | Bacteria | 916 |
| 801 | Ga0496100_0026018 | 3300048903 | Bacteria | 3584 |
| 802 | Ga0496100_0033781 | 3300048903 | Bacteria | 3203 |
| 803 | Ga0496100_0471390 | 3300048903 | Bacteria | 965 |
| 804 | Ga0496101_0015013 | 3300048904 | Bacteria | 5212 |
| 805 | Ga0496101_0241640 | 3300048904 | Bacteria | 1405 |
| 806 | Ga0496101_0282933 | 3300048904 | Bacteria | 1296 |
| 807 | Ga0496102_0056849 | 3300048905 | Bacteria | 3570 |
| 808 | Ga0496102_0058024 | 3300048905 | Bacteria | 3536 |
| 809 | Ga0496103_0075656 | 3300048906 | Bacteria | 2112 |
| 810 | Ga0496103_0107426 | 3300048906 | Bacteria | 1770 |
| 811 | Ga0496104_0008001 | 3300048907 | Bacteria | 9374 |
| 812 | Ga0496104_0026945 | 3300048907 | Bacteria | 5314 |
| 813 | Ga0496104_0708550 | 3300048907 | Bacteria | 914 |
| 814 | Ga0496105_0012713 | 3300048908 | Bacteria | 6667 |
| 815 | Ga0496105_0107189 | 3300048908 | Bacteria | 2306 |
| 816 | Ga0496106_0000852 | 3300048909 | Bacteria | 22131 |
| 817 | Ga0496106_0081744 | 3300048909 | Bacteria | 2482 |
| 818 | Ga0496107_0021694 | 3300048910 | Bacteria | 4538 |
| 819 | Ga0496107_0067426 | 3300048910 | Bacteria | 2596 |
| 820 | Ga0496108_0019587 | 3300048911 | Bacteria | 5558 |
| 821 | Ga0496108_0266329 | 3300048911 | Bacteria | 1491 |
| 822 | Ga0496108_0321395 | 3300048911 | Bacteria | 1349 |
| 823 | Ga0496109_0003510 | 3300048912 | Bacteria | 13099 |
| 824 | Ga0496109_0019713 | 3300048912 | Bacteria | 5950 |
| 825 | Ga0496109_0264746 | 3300048912 | Bacteria | 1619 |
| 826 | Ga0496109_0477369 | 3300048912 | Bacteria | 1177 |
| 827 | Ga0496110_0028598 | 3300048913 | Bacteria | 4790 |
| 828 | Ga0496110_0092598 | 3300048913 | Bacteria | 2705 |
| 829 | Ga0496110_0160414 | 3300048913 | Bacteria | 2038 |
| 830 | Ga0496112_0005376 | 3300048915 | Bacteria | 11066 |
| 831 | Ga0496112_0154131 | 3300048915 | Bacteria | 2265 |
| 832 | Ga0496113_0301136 | 3300048916 | Bacteria | 1284 |
| 833 | Ga0496113_0489886 | 3300048916 | Bacteria | 987 |
| 834 | Ga0496113_0550787 | 3300048916 | Bacteria | 925 |
| 835 | Ga0496114_0003360 | 3300048917 | Bacteria | 12292 |
| 836 | Ga0496114_0120452 | 3300048917 | Bacteria | 2256 |
| 837 | Ga0496114_0187330 | 3300048917 | Bacteria | 1809 |
| 838 | Ga0496114_0250926 | 3300048917 | Bacteria | 1557 |
| 839 | Ga0496114_0627911 | 3300048917 | Unclassified | 946 |
| 840 | Ga0496115_0047387 | 3300048918 | Bacteria | 3437 |
| 841 | Ga0496123_0041478 | 3300048926 | Bacteria | 3190 |
| 842 | Ga0496124_0042317 | 3300048927 | Bacteria | 3923 |
| 843 | Ga0496125_0029856 | 3300048928 | Bacteria | 4889 |
| 844 | Ga0501297_001234 | 3300049520 | Bacteria | 2338 |
| 845 | Ga0501300_004485 | 3300049523 | Bacteria | 2069 |
| 846 | Ga0501034_0000456 | 3300049571 | Bacteria | 67493 |
| 847 | Ga0501036_0339697 | 3300049572 | Bacteria | 1254 |
| 848 | Ga0501039_0374436 | 3300049575 | Bacteria | 1119 |
| 849 | Ga0501068_0000960 | 3300049584 | Bacteria | 15139 |
| 850 | Ga0501068_0454928 | 3300049584 | Unclassified | 828 |
| 851 | Ga0501070_0225770 | 3300049586 | Bacteria | 1535 |
| 852 | Ga0501072_0003561 | 3300049588 | Bacteria | 11719 |
| 853 | Ga0501073_0001375 | 3300049589 | Bacteria | 17975 |
| 854 | Ga0501074_0335658 | 3300049590 | Bacteria | 1073 |
| 855 | Ga0501077_0190580 | 3300049593 | Bacteria | 1302 |
| 856 | Ga0501222_000756 | 3300049662 | Bacteria | 4681 |
| 857 | Ga0501227_071474 | 3300049665 | Bacteria | 901 |
| 858 | Ga0501233_012729 | 3300049668 | Bacteria | 1694 |
| 859 | Ga0501253_003033 | 3300049683 | Bacteria | 1968 |
| 860 | Ga0501255_000806 | 3300049684 | Bacteria | 2304 |
| 861 | Ga0501221_000517 | 3300049704 | Bacteria | 6105 |
| 862 | Ga0501080_0001249 | 3300049742 | Bacteria | 21171 |
| 863 | Ga0501080_0721341 | 3300049742 | Bacteria | 878 |
| 864 | Ga0501083_0209491 | 3300049744 | Bacteria | 1271 |
| 865 | Ga0501269_026290 | 3300049766 | Bacteria | 735 |
| 866 | Ga0501044_0440135 | 3300049823 | Bacteria | 1211 |
| 867 | nmdc:mga0k408_8363_c1 | 3300050493 | Bacteria | 5552 |
| 868 | nmdc:mga07m45_139459_c1 | 3300050496 | Bacteria | 1404 |
| 869 | nmdc:mga07m45_93_c1 | 3300050496 | Bacteria | 34685 |
| 870 | nmdc:mga05p37_430_c1 | 3300050507 | Bacteria | 45408 |
| 871 | nmdc:mga05p37_46494_c1 | 3300050507 | Bacteria | 5336 |
| 872 | nmdc:mga09592_26270_c1 | 3300050508 | Bacteria | 4823 |
| 873 | nmdc:mga09592_37127_c1 | 3300050508 | Bacteria | 4085 |
| 874 | nmdc:mga06r32_1291_c1 | 3300050510 | Bacteria | 22555 |
| 875 | nmdc:mga08y16_105543_c1 | 3300050511 | Bacteria | 2933 |
| 876 | nmdc:mga08y16_1565_c1 | 3300050511 | Bacteria | 23071 |
| 877 | nmdc:mga08y16_328556_c1 | 3300050511 | Bacteria | 1573 |
| 878 | nmdc:mga08y16_51927_c1 | 3300050511 | Bacteria | 4290 |
| 879 | nmdc:mga0n895_346972_c1 | 3300050512 | Bacteria | 1503 |
| 880 | nmdc:mga0n895_459037_c1 | 3300050512 | Bacteria | 1286 |
| 881 | nmdc:mga0n895_634708_c1 | 3300050512 | Bacteria | 1068 |
| 882 | nmdc:mga0n895_911144_c1 | 3300050512 | Bacteria | 864 |
| 883 | nmdc:mga0rr50_400513_c1 | 3300050513 | Bacteria | 1159 |
| 884 | nmdc:mga0rr50_8013_c1 | 3300050513 | Bacteria | 6552 |
| 885 | Ga0495601_0073833 | 3300053077 | Bacteria | 2182 |
| 886 | Ga0495595_0182127 | 3300053084 | Bacteria | 1042 |
| 887 | Ga0495619_0400538 | 3300053085 | Bacteria | 948 |
| 888 | Ga0500644_0009902 | 3300053088 | Unclassified | 2564 |
| 889 | Ga0500616_0011463 | 3300053153 | Bacteria | 5233 |
| 890 | Ga0501084_0156004 | 3300054114 | Bacteria | 1925 |
| 891 | Ga0501082_0044702 | 3300060353 | Bacteria | 3820 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0454928 | Ga0501068_0454928_235_792 | 177 |
| 2 | 3300025941 | Ga0207711_10233237 | Ga0207711_102332372 | 181 |
| 3 | 3300013306 | Ga0163162_12018871 | Ga0163162_120188711 | 184 |
| 4 | 3300042530 | Ga0450916_008109 | Ga0450916_008109_369_953 | 187 |
| 5 | 3300005337 | Ga0070682_100405908 | Ga0070682_1004059082 | 195 |
| 6 | 3300005548 | Ga0070665_100276442 | Ga0070665_1002764422 | 195 |
| 7 | 3300005844 | Ga0068862_100978901 | Ga0068862_1009789012 | 195 |
| 8 | 3300026118 | Ga0207675_100180959 | Ga0207675_1001809593 | 195 |
| 9 | 3300005293 | Ga0065715_10446243 | Ga0065715_104462431 | 196 |
| 10 | 3300005328 | Ga0070676_10398702 | Ga0070676_103987021 | 196 |
| 11 | 3300005331 | Ga0070670_100151800 | Ga0070670_1001518003 | 196 |
| 12 | 3300005618 | Ga0068864_100086324 | Ga0068864_1000863243 | 196 |
| 13 | 3300005719 | Ga0068861_100497862 | Ga0068861_1004978621 | 196 |
| 14 | 3300005842 | Ga0068858_100133876 | Ga0068858_1001338762 | 196 |
| 15 | 3300013306 | Ga0163162_11007096 | Ga0163162_110070962 | 196 |
| 16 | 3300014968 | Ga0157379_11163853 | Ga0157379_111638532 | 196 |
| 17 | 3300025907 | Ga0207645_10270136 | Ga0207645_102701362 | 196 |
| 18 | 3300025925 | Ga0207650_10204871 | Ga0207650_102048712 | 196 |
| 19 | 3300026095 | Ga0207676_10119335 | Ga0207676_101193353 | 196 |
| 20 | 3300026118 | Ga0207675_100333972 | Ga0207675_1003339722 | 196 |
| 21 | 3300035088 | Ga0373940_0009372 | Ga0373940_0009372_1604_2254 | 196 |
| 22 | 3300035114 | Ga0373939_0000089 | Ga0373939_0000089_25606_26256 | 196 |
| 23 | 3300035121 | Ga0373960_0000853 | Ga0373960_0000853_3363_4013 | 196 |
| 24 | 3300035691 | Ga0373931_0001113 | Ga0373931_0001113_10214_10864 | 196 |
| 25 | 3300048915 | Ga0496112_0154131 | Ga0496112_0154131_633_1268 | 196 |
| 26 | 3300048916 | Ga0496113_0489886 | Ga0496113_0489886_93_728 | 196 |
| 27 | 3300006195 | Ga0075366_10088002 | Ga0075366_100880023 | 198 |
| 28 | 3300005334 | Ga0068869_100274296 | Ga0068869_1002742962 | 199 |
| 29 | 3300005344 | Ga0070661_100676822 | Ga0070661_1006768221 | 199 |
| 30 | 3300005564 | Ga0070664_100151426 | Ga0070664_1001514263 | 199 |
| 31 | 3300005614 | Ga0068856_100035198 | Ga0068856_1000351984 | 199 |
| 32 | 3300005617 | Ga0068859_100217700 | Ga0068859_1002177002 | 199 |
| 33 | 3300005841 | Ga0068863_100234342 | Ga0068863_1002343423 | 199 |
| 34 | 3300006931 | Ga0097620_100217712 | Ga0097620_1002177122 | 199 |
| 35 | 3300025945 | Ga0207679_10485927 | Ga0207679_104859272 | 199 |
| 36 | iso_pu_bacteria | 3000017691 | 3000019495 | 200 |
| 37 | iso_pu_bacteria | 2511231024 | 2511378008 | 202 |
| 38 | iso_pu_bacteria | 2765235841 | 2765584525 | 202 |
| 39 | iso_pu_bacteria | 8054929484 | 8054931277 | 202 |
| 40 | iso_pu_bacteria | 8056137416 | 8056140807 | 203 |
| 41 | 3300005549 | Ga0070704_100013168 | Ga0070704_1000131682 | 204 |
| 42 | 3300027462 | Ga0210000_1007201 | Ga0210000_10072012 | 204 |
| 43 | iso_pu_bacteria | 2643221544 | 2643744152 | 204 |
| 44 | 3300005549 | Ga0070704_100176187 | Ga0070704_1001761872 | 205 |
| 45 | 3300005355 | Ga0070671_100012552 | Ga0070671_1000125527 | 206 |
| 46 | 3300005367 | Ga0070667_100188580 | Ga0070667_1001885803 | 206 |
| 47 | 3300005843 | Ga0068860_100428198 | Ga0068860_1004281983 | 206 |
| 48 | 3300009011 | Ga0105251_10008897 | Ga0105251_100088973 | 206 |
| 49 | 3300013297 | Ga0157378_10119157 | Ga0157378_101191573 | 206 |
| 50 | 3300014325 | Ga0163163_10357665 | Ga0163163_103576653 | 206 |
| 51 | 3300025735 | Ga0207713_1024027 | Ga0207713_10240272 | 206 |
| 52 | 3300025931 | Ga0207644_10054154 | Ga0207644_100541543 | 206 |
| 53 | 3300025940 | Ga0207691_10043574 | Ga0207691_100435744 | 206 |
| 54 | 3300035691 | Ga0373931_0048919 | Ga0373931_0048919_1135_1773 | 206 |
| 55 | 3300048903 | Ga0496100_0471390 | Ga0496100_0471390_246_884 | 206 |
| 56 | 3300048907 | Ga0496104_0708550 | Ga0496104_0708550_16_654 | 206 |
| 57 | 3300048913 | Ga0496110_0028598 | Ga0496110_0028598_1915_2538 | 206 |
| 58 | 3300048917 | Ga0496114_0003360 | Ga0496114_0003360_4573_5196 | 206 |
| 59 | 3300048926 | Ga0496123_0041478 | Ga0496123_0041478_2404_3027 | 206 |
| 60 | 3300048927 | Ga0496124_0042317 | Ga0496124_0042317_873_1496 | 206 |
| 61 | 3300048928 | Ga0496125_0029856 | Ga0496125_0029856_2475_3098 | 206 |
| 62 | 3300013296 | Ga0157374_11005309 | Ga0157374_110053092 | 207 |
| 63 | 3300025907 | Ga0207645_10370344 | Ga0207645_103703442 | 207 |
| 64 | 3300031903 | Ga0307407_10227855 | Ga0307407_102278552 | 207 |
| 65 | 3300005290 | Ga0065712_10006136 | Ga0065712_100061364 | 208 |
| 66 | 3300005293 | Ga0065715_10139235 | Ga0065715_101392351 | 208 |
| 67 | 3300005330 | Ga0070690_100145969 | Ga0070690_1001459693 | 208 |
| 68 | 3300005331 | Ga0070670_100103130 | Ga0070670_1001031302 | 208 |
| 69 | 3300005336 | Ga0070680_100599651 | Ga0070680_1005996512 | 208 |
| 70 | 3300005337 | Ga0070682_100015068 | Ga0070682_1000150682 | 208 |
| 71 | 3300005340 | Ga0070689_100000781 | Ga0070689_1000007814 | 208 |
| 72 | 3300005344 | Ga0070661_100047425 | Ga0070661_1000474253 | 208 |
| 73 | 3300005347 | Ga0070668_100427380 | Ga0070668_1004273802 | 208 |
| 74 | 3300005354 | Ga0070675_100133188 | Ga0070675_1001331882 | 208 |
| 75 | 3300005354 | Ga0070675_100510249 | Ga0070675_1005102492 | 208 |
| 76 | 3300005438 | Ga0070701_10170488 | Ga0070701_101704882 | 208 |
| 77 | 3300005440 | Ga0070705_100050350 | Ga0070705_1000503503 | 208 |
| 78 | 3300005441 | Ga0070700_100002925 | Ga0070700_1000029255 | 208 |
| 79 | 3300005441 | Ga0070700_100061027 | Ga0070700_1000610271 | 208 |
| 80 | 3300005444 | Ga0070694_100060463 | Ga0070694_1000604633 | 208 |
| 81 | 3300005455 | Ga0070663_100089174 | Ga0070663_1000891742 | 208 |
| 82 | 3300005455 | Ga0070663_100214383 | Ga0070663_1002143832 | 208 |
| 83 | 3300005543 | Ga0070672_100031779 | Ga0070672_1000317795 | 208 |
| 84 | 3300005544 | Ga0070686_100052252 | Ga0070686_1000522523 | 208 |
| 85 | 3300005544 | Ga0070686_100207589 | Ga0070686_1002075891 | 208 |
| 86 | 3300005545 | Ga0070695_100393133 | Ga0070695_1003931332 | 208 |
| 87 | 3300005546 | Ga0070696_100192159 | Ga0070696_1001921591 | 208 |
| 88 | 3300005549 | Ga0070704_100605632 | Ga0070704_1006056322 | 208 |
| 89 | 3300005578 | Ga0068854_100587588 | Ga0068854_1005875882 | 208 |
| 90 | 3300005615 | Ga0070702_100002888 | Ga0070702_1000028883 | 208 |
| 91 | 3300005615 | Ga0070702_100673200 | Ga0070702_1006732001 | 208 |
| 92 | 3300005617 | Ga0068859_100050112 | Ga0068859_1000501124 | 208 |
| 93 | 3300005618 | Ga0068864_100013541 | Ga0068864_1000135416 | 208 |
| 94 | 3300005618 | Ga0068864_100125126 | Ga0068864_1001251262 | 208 |
| 95 | 3300005718 | Ga0068866_10295129 | Ga0068866_102951292 | 208 |
| 96 | 3300005719 | Ga0068861_100005833 | Ga0068861_10000583311 | 208 |
| 97 | 3300005719 | Ga0068861_100074737 | Ga0068861_1000747372 | 208 |
| 98 | 3300005840 | Ga0068870_10022434 | Ga0068870_100224344 | 208 |
| 99 | 3300005841 | Ga0068863_100031144 | Ga0068863_1000311445 | 208 |
| 100 | 3300005843 | Ga0068860_100239423 | Ga0068860_1002394233 | 208 |
| 101 | 3300005844 | Ga0068862_100076173 | Ga0068862_1000761733 | 208 |
| 102 | 3300005844 | Ga0068862_100308854 | Ga0068862_1003088542 | 208 |
| 103 | 3300006871 | Ga0075434_100159143 | Ga0075434_1001591433 | 208 |
| 104 | 3300006931 | Ga0097620_100050112 | Ga0097620_1000501124 | 208 |
| 105 | 3300009094 | Ga0111539_11200814 | Ga0111539_112008141 | 208 |
| 106 | 3300009176 | Ga0105242_10688935 | Ga0105242_106889352 | 208 |
| 107 | 3300009553 | Ga0105249_10092530 | Ga0105249_100925303 | 208 |
| 108 | 3300009553 | Ga0105249_11021939 | Ga0105249_110219392 | 208 |
| 109 | 3300013308 | Ga0157375_10419192 | Ga0157375_104191923 | 208 |
| 110 | 3300014326 | Ga0157380_10231317 | Ga0157380_102313171 | 208 |
| 111 | 3300017792 | Ga0163161_10214259 | Ga0163161_102142592 | 208 |
| 112 | 3300025908 | Ga0207643_10037936 | Ga0207643_100379363 | 208 |
| 113 | 3300025920 | Ga0207649_10063546 | Ga0207649_100635463 | 208 |
| 114 | 3300025940 | Ga0207691_10040386 | Ga0207691_100403864 | 208 |
| 115 | 3300025945 | Ga0207679_10151238 | Ga0207679_101512382 | 208 |
| 116 | 3300026041 | Ga0207639_10210511 | Ga0207639_102105112 | 208 |
| 117 | 3300026041 | Ga0207639_10514032 | Ga0207639_105140321 | 208 |
| 118 | 3300026075 | Ga0207708_10014181 | Ga0207708_100141814 | 208 |
| 119 | 3300026075 | Ga0207708_10280486 | Ga0207708_102804862 | 208 |
| 120 | 3300026095 | Ga0207676_10027398 | Ga0207676_100273984 | 208 |
| 121 | 3300026118 | Ga0207675_100006094 | Ga0207675_1000060944 | 208 |
| 122 | 3300026118 | Ga0207675_100006419 | Ga0207675_10000641913 | 208 |
| 123 | 3300028380 | Ga0268265_10106839 | Ga0268265_101068393 | 208 |
| 124 | 3300028380 | Ga0268265_10453058 | Ga0268265_104530582 | 208 |
| 125 | 3300028380 | Ga0268265_10499085 | Ga0268265_104990852 | 208 |
| 126 | 3300028381 | Ga0268264_10092267 | Ga0268264_100922672 | 208 |
| 127 | 3300028381 | Ga0268264_10332787 | Ga0268264_103327872 | 208 |
| 128 | 3300028794 | Ga0307515_10026788 | Ga0307515_100267883 | 208 |
| 129 | 3300031242 | Ga0265329_10025516 | Ga0265329_100255163 | 208 |
| 130 | 3300031548 | Ga0307408_100040552 | Ga0307408_1000405523 | 208 |
| 131 | 3300031548 | Ga0307408_100200318 | Ga0307408_1002003182 | 208 |
| 132 | 3300031711 | Ga0265314_10060431 | Ga0265314_100604313 | 208 |
| 133 | 3300031731 | Ga0307405_10098914 | Ga0307405_100989142 | 208 |
| 134 | 3300031824 | Ga0307413_10000525 | Ga0307413_100005257 | 208 |
| 135 | 3300031901 | Ga0307406_10094907 | Ga0307406_100949072 | 208 |
| 136 | 3300031903 | Ga0307407_10003999 | Ga0307407_100039997 | 208 |
| 137 | 3300031995 | Ga0307409_100010145 | Ga0307409_1000101455 | 208 |
| 138 | 3300031995 | Ga0307409_100163097 | Ga0307409_1001630973 | 208 |
| 139 | 3300031995 | Ga0307409_100324843 | Ga0307409_1003248432 | 208 |
| 140 | 3300032002 | Ga0307416_100004232 | Ga0307416_1000042326 | 208 |
| 141 | 3300032002 | Ga0307416_100087493 | Ga0307416_1000874933 | 208 |
| 142 | 3300032004 | Ga0307414_10012002 | Ga0307414_100120026 | 208 |
| 143 | 3300032005 | Ga0307411_10002182 | Ga0307411_100021825 | 208 |
| 144 | 3300032005 | Ga0307411_10006514 | Ga0307411_100065145 | 208 |
| 145 | 3300035172 | Ga0373955_0013970 | Ga0373955_0013970_695_1345 | 208 |
| 146 | 3300036401 | Ga0373937_0209720 | Ga0373937_0209720_427_1053 | 208 |
| 147 | 3300041453 | Ga0451797_0459451 | Ga0451797_0459451_512_1162 | 208 |
| 148 | 3300041458 | Ga0451798_1011580 | Ga0451798_1011580_568_1218 | 208 |
| 149 | 3300041460 | Ga0451802_1947593 | Ga0451802_1947593_3268_3918 | 208 |
| 150 | 3300041486 | Ga0451807_0129515 | Ga0451807_0129515_2578_3228 | 208 |
| 151 | 3300041494 | Ga0451837_0939764 | Ga0451837_0939764_1293_1943 | 208 |
| 152 | 3300041511 | Ga0451855_1464634 | Ga0451855_1464634_96_749 | 208 |
| 153 | 3300042004 | Ga0439445_0017454 | Ga0439445_0017454_813_1466 | 208 |
| 154 | 3300042117 | Ga0450913_006632 | Ga0450913_006632_85_738 | 208 |
| 155 | 3300042126 | Ga0450888_000605 | Ga0450888_000605_1002_1655 | 208 |
| 156 | 3300042129 | Ga0450891_000309 | Ga0450891_000309_768_1421 | 208 |
| 157 | 3300042137 | Ga0450902_017625 | Ga0450902_017625_258_911 | 208 |
| 158 | 3300042531 | Ga0450918_000034 | Ga0450918_000034_24786_25436 | 208 |
| 159 | 3300042876 | Ga0451577_0099787 | Ga0451577_0099787_500_1150 | 208 |
| 160 | 3300044712 | Ga0453684_0148943 | Ga0453684_0148943_380_1030 | 208 |
| 161 | 3300045051 | Ga0451576_0025168 | Ga0451576_0025168_4417_5067 | 208 |
| 162 | 3300046460 | Ga0495638_0191523 | Ga0495638_0191523_348_998 | 208 |
| 163 | 3300046513 | Ga0495616_0001229 | Ga0495616_0001229_1099_1749 | 208 |
| 164 | 3300046660 | Ga0495625_0013181 | Ga0495625_0013181_5537_6187 | 208 |
| 165 | 3300046660 | Ga0495625_0146774 | Ga0495625_0146774_38_688 | 208 |
| 166 | 3300048903 | Ga0496100_0026018 | Ga0496100_0026018_2271_2912 | 208 |
| 167 | 3300049520 | Ga0501297_001234 | Ga0501297_001234_1015_1668 | 208 |
| 168 | 3300049523 | Ga0501300_004485 | Ga0501300_004485_1334_1987 | 208 |
| 169 | 3300049662 | Ga0501222_000756 | Ga0501222_000756_1890_2543 | 208 |
| 170 | 3300049665 | Ga0501227_071474 | Ga0501227_071474_116_769 | 208 |
| 171 | 3300049668 | Ga0501233_012729 | Ga0501233_012729_21_674 | 208 |
| 172 | 3300049683 | Ga0501253_003033 | Ga0501253_003033_904_1557 | 208 |
| 173 | 3300049684 | Ga0501255_000806 | Ga0501255_000806_854_1507 | 208 |
| 174 | 3300049704 | Ga0501221_000517 | Ga0501221_000517_4925_5578 | 208 |
| 175 | 3300049766 | Ga0501269_026290 | Ga0501269_026290_70_723 | 208 |
| 176 | 3300050496 | nmdc:mga07m45_93_c1 | nmdc:mga07m45_93_c1_18787_19440 | 208 |
| 177 | 3300050511 | nmdc:mga08y16_328556_c1 | nmdc:mga08y16_328556_c1_51_701 | 208 |
| 178 | 3300053088 | Ga0500644_0009902 | Ga0500644_0009902_1667_2317 | 208 |
| 179 | 3300053153 | Ga0500616_0011463 | Ga0500616_0011463_2739_3383 | 208 |
| 180 | 3300003316 | rootH1_10003216 | rootH1_1000321616 | 209 |
| 181 | 3300003322 | rootL2_10002048 | rootL2_100020482 | 209 |
| 182 | 3300005347 | Ga0070668_100065413 | Ga0070668_1000654134 | 209 |
| 183 | 3300005353 | Ga0070669_100082815 | Ga0070669_1000828152 | 209 |
| 184 | 3300005356 | Ga0070674_100197260 | Ga0070674_1001972602 | 209 |
| 185 | 3300005365 | Ga0070688_100049737 | Ga0070688_1000497372 | 209 |
| 186 | 3300005459 | Ga0068867_100423508 | Ga0068867_1004235082 | 209 |
| 187 | 3300005618 | Ga0068864_100517332 | Ga0068864_1005173322 | 209 |
| 188 | 3300006353 | Ga0075370_10173486 | Ga0075370_101734862 | 209 |
| 189 | 3300006358 | Ga0068871_100183402 | Ga0068871_1001834022 | 209 |
| 190 | 3300006871 | Ga0075434_100153127 | Ga0075434_1001531273 | 209 |
| 191 | 3300009094 | Ga0111539_10166724 | Ga0111539_101667242 | 209 |
| 192 | 3300013308 | Ga0157375_10872079 | Ga0157375_108720792 | 209 |
| 193 | 3300014326 | Ga0157380_10040064 | Ga0157380_100400643 | 209 |
| 194 | 3300025923 | Ga0207681_10155468 | Ga0207681_101554683 | 209 |
| 195 | 3300025972 | Ga0207668_10004330 | Ga0207668_100043307 | 209 |
| 196 | 3300026089 | Ga0207648_10040528 | Ga0207648_100405286 | 209 |
| 197 | 3300026095 | Ga0207676_10603737 | Ga0207676_106037372 | 209 |
| 198 | 3300028380 | Ga0268265_10184640 | Ga0268265_101846402 | 209 |
| 199 | 3300035113 | Ga0373936_0108957 | Ga0373936_0108957_151_780 | 209 |
| 200 | 3300035172 | Ga0373955_0030278 | Ga0373955_0030278_73_702 | 209 |
| 201 | 3300035692 | Ga0373935_0387188 | Ga0373935_0387188_38_667 | 209 |
| 202 | 3300035724 | Ga0373933_0325194 | Ga0373933_0325194_69_698 | 209 |
| 203 | 3300036401 | Ga0373937_0059200 | Ga0373937_0059200_1424_2053 | 209 |
| 204 | 3300036401 | Ga0373937_0245343 | Ga0373937_0245343_88_717 | 209 |
| 205 | 3300037068 | Ga0373925_0060497 | Ga0373925_0060497_1269_1898 | 209 |
| 206 | 3300041512 | Ga0451853_0624379 | Ga0451853_0624379_13_669 | 209 |
| 207 | 3300045051 | Ga0451576_0021175 | Ga0451576_0021175_4388_5044 | 209 |
| 208 | 3300046543 | Ga0495645_0018541 | Ga0495645_0018541_3988_4617 | 209 |
| 209 | 3300048904 | Ga0496101_0282933 | Ga0496101_0282933_601_1248 | 209 |
| 210 | 3300050496 | nmdc:mga07m45_139459_c1 | nmdc:mga07m45_139459_c1_277_933 | 209 |
| 211 | 3300050513 | nmdc:mga0rr50_8013_c1 | nmdc:mga0rr50_8013_c1_5573_6220 | 209 |
| 212 | 3300005328 | Ga0070676_10010963 | Ga0070676_100109636 | 210 |
| 213 | 3300005331 | Ga0070670_100028486 | Ga0070670_1000284864 | 210 |
| 214 | 3300005334 | Ga0068869_100001258 | Ga0068869_1000012586 | 210 |
| 215 | 3300005340 | Ga0070689_100081017 | Ga0070689_1000810172 | 210 |
| 216 | 3300005345 | Ga0070692_10077601 | Ga0070692_100776011 | 210 |
| 217 | 3300005347 | Ga0070668_100001957 | Ga0070668_10000195713 | 210 |
| 218 | 3300005355 | Ga0070671_100355246 | Ga0070671_1003552462 | 210 |
| 219 | 3300005367 | Ga0070667_100000537 | Ga0070667_10000053729 | 210 |
| 220 | 3300005434 | Ga0070709_10727809 | Ga0070709_107278091 | 210 |
| 221 | 3300005456 | Ga0070678_100376935 | Ga0070678_1003769352 | 210 |
| 222 | 3300005457 | Ga0070662_100075514 | Ga0070662_1000755143 | 210 |
| 223 | 3300005457 | Ga0070662_100488439 | Ga0070662_1004884392 | 210 |
| 224 | 3300005459 | Ga0068867_100011849 | Ga0068867_1000118496 | 210 |
| 225 | 3300005459 | Ga0068867_100017076 | Ga0068867_1000170765 | 210 |
| 226 | 3300005459 | Ga0068867_100352997 | Ga0068867_1003529972 | 210 |
| 227 | 3300005539 | Ga0068853_100024944 | Ga0068853_1000249444 | 210 |
| 228 | 3300005543 | Ga0070672_100150637 | Ga0070672_1001506373 | 210 |
| 229 | 3300005549 | Ga0070704_100110206 | Ga0070704_1001102062 | 210 |
| 230 | 3300005577 | Ga0068857_100001800 | Ga0068857_10000180015 | 210 |
| 231 | 3300005615 | Ga0070702_100067716 | Ga0070702_1000677162 | 210 |
| 232 | 3300005617 | Ga0068859_100000548 | Ga0068859_10000054828 | 210 |
| 233 | 3300005617 | Ga0068859_101148230 | Ga0068859_1011482302 | 210 |
| 234 | 3300005618 | Ga0068864_100000759 | Ga0068864_10000075914 | 210 |
| 235 | 3300005719 | Ga0068861_100001692 | Ga0068861_10000169212 | 210 |
| 236 | 3300005841 | Ga0068863_100002477 | Ga0068863_10000247714 | 210 |
| 237 | 3300005841 | Ga0068863_100472998 | Ga0068863_1004729982 | 210 |
| 238 | 3300005842 | Ga0068858_100038945 | Ga0068858_1000389456 | 210 |
| 239 | 3300005844 | Ga0068862_100003241 | Ga0068862_10000324113 | 210 |
| 240 | 3300005983 | Ga0081540_1013533 | Ga0081540_10135334 | 210 |
| 241 | 3300006358 | Ga0068871_100441896 | Ga0068871_1004418962 | 210 |
| 242 | 3300006844 | Ga0075428_100002872 | Ga0075428_10000287222 | 210 |
| 243 | 3300006847 | Ga0075431_100001468 | Ga0075431_10000146824 | 210 |
| 244 | 3300006880 | Ga0075429_100093494 | Ga0075429_1000934941 | 210 |
| 245 | 3300006881 | Ga0068865_100085032 | Ga0068865_1000850322 | 210 |
| 246 | 3300006881 | Ga0068865_100096792 | Ga0068865_1000967922 | 210 |
| 247 | 3300006931 | Ga0097620_100000548 | Ga0097620_10000054828 | 210 |
| 248 | 3300006931 | Ga0097620_101148334 | Ga0097620_1011483342 | 210 |
| 249 | 3300009094 | Ga0111539_10003134 | Ga0111539_1000313421 | 210 |
| 250 | 3300009101 | Ga0105247_10042203 | Ga0105247_100422034 | 210 |
| 251 | 3300009147 | Ga0114129_10001566 | Ga0114129_1000156631 | 210 |
| 252 | 3300009174 | Ga0105241_10371043 | Ga0105241_103710431 | 210 |
| 253 | 3300009176 | Ga0105242_10148426 | Ga0105242_101484262 | 210 |
| 254 | 3300009177 | Ga0105248_10009060 | Ga0105248_100090608 | 210 |
| 255 | 3300009545 | Ga0105237_10204634 | Ga0105237_102046342 | 210 |
| 256 | 3300009553 | Ga0105249_10300942 | Ga0105249_103009422 | 210 |
| 257 | 3300013100 | Ga0157373_10269897 | Ga0157373_102698972 | 210 |
| 258 | 3300013297 | Ga0157378_10079153 | Ga0157378_100791532 | 210 |
| 259 | 3300013306 | Ga0163162_10295960 | Ga0163162_102959602 | 210 |
| 260 | 3300013307 | Ga0157372_10476525 | Ga0157372_104765253 | 210 |
| 261 | 3300013308 | Ga0157375_10038446 | Ga0157375_100384462 | 210 |
| 262 | 3300017792 | Ga0163161_10067580 | Ga0163161_100675802 | 210 |
| 263 | 3300025321 | Ga0207656_10264257 | Ga0207656_102642571 | 210 |
| 264 | 3300025899 | Ga0207642_10149201 | Ga0207642_101492012 | 210 |
| 265 | 3300025900 | Ga0207710_10019811 | Ga0207710_100198112 | 210 |
| 266 | 3300025906 | Ga0207699_10511103 | Ga0207699_105111032 | 210 |
| 267 | 3300025907 | Ga0207645_10014722 | Ga0207645_100147226 | 210 |
| 268 | 3300025908 | Ga0207643_10034526 | Ga0207643_100345264 | 210 |
| 269 | 3300025914 | Ga0207671_10139784 | Ga0207671_101397842 | 210 |
| 270 | 3300025931 | Ga0207644_10228680 | Ga0207644_102286802 | 210 |
| 271 | 3300025933 | Ga0207706_10223969 | Ga0207706_102239692 | 210 |
| 272 | 3300025933 | Ga0207706_10239475 | Ga0207706_102394752 | 210 |
| 273 | 3300025934 | Ga0207686_10434218 | Ga0207686_104342182 | 210 |
| 274 | 3300025936 | Ga0207670_10081540 | Ga0207670_100815403 | 210 |
| 275 | 3300025937 | Ga0207669_10722320 | Ga0207669_107223201 | 210 |
| 276 | 3300025938 | Ga0207704_10050304 | Ga0207704_100503043 | 210 |
| 277 | 3300025940 | Ga0207691_10173810 | Ga0207691_101738102 | 210 |
| 278 | 3300025941 | Ga0207711_10007347 | Ga0207711_100073478 | 210 |
| 279 | 3300025942 | Ga0207689_10003820 | Ga0207689_1000382014 | 210 |
| 280 | 3300025961 | Ga0207712_10208263 | Ga0207712_102082632 | 210 |
| 281 | 3300026035 | Ga0207703_10000994 | Ga0207703_1000099415 | 210 |
| 282 | 3300026089 | Ga0207648_10006115 | Ga0207648_1000611512 | 210 |
| 283 | 3300026116 | Ga0207674_10002511 | Ga0207674_1000251111 | 210 |
| 284 | 3300026118 | Ga0207675_100001991 | Ga0207675_10000199113 | 210 |
| 285 | 3300026118 | Ga0207675_100127263 | Ga0207675_1001272632 | 210 |
| 286 | 3300026121 | Ga0207683_10124070 | Ga0207683_101240702 | 210 |
| 287 | 3300026121 | Ga0207683_10696537 | Ga0207683_106965371 | 210 |
| 288 | 3300026142 | Ga0207698_10972935 | Ga0207698_109729352 | 210 |
| 289 | 3300027907 | Ga0207428_10013315 | Ga0207428_100133155 | 210 |
| 290 | 3300028381 | Ga0268264_10000523 | Ga0268264_1000052315 | 210 |
| 291 | 3300028381 | Ga0268264_10113457 | Ga0268264_101134572 | 210 |
| 292 | 3300031548 | Ga0307408_100000006 | Ga0307408_100000006337 | 210 |
| 293 | 3300044712 | Ga0453684_1057083 | Ga0453684_1057083_65_715 | 210 |
| 294 | 3300048906 | Ga0496103_0107426 | Ga0496103_0107426_790_1422 | 210 |
| 295 | 3300048911 | Ga0496108_0266329 | Ga0496108_0266329_811_1443 | 210 |
| 296 | 3300048912 | Ga0496109_0003510 | Ga0496109_0003510_5532_6164 | 210 |
| 297 | 3300049590 | Ga0501074_0335658 | Ga0501074_0335658_237_920 | 210 |
| 298 | 3300050507 | nmdc:mga05p37_430_c1 | nmdc:mga05p37_430_c1_25156_25824 | 210 |
| 299 | 3300050508 | nmdc:mga09592_37127_c1 | nmdc:mga09592_37127_c1_1654_2322 | 210 |
| 300 | 3300050510 | nmdc:mga06r32_1291_c1 | nmdc:mga06r32_1291_c1_2729_3397 | 210 |
| 301 | 3300050511 | nmdc:mga08y16_1565_c1 | nmdc:mga08y16_1565_c1_1574_2242 | 210 |
| 302 | 3300050512 | nmdc:mga0n895_911144_c1 | nmdc:mga0n895_911144_c1_117_767 | 210 |
| 303 | 3300001991 | JGI24743J22301_10012326 | JGI24743J22301_100123263 | 211 |
| 304 | 3300002076 | JGI24749J21850_1023695 | JGI24749J21850_10236952 | 211 |
| 305 | 3300002239 | JGI24034J26672_10048157 | JGI24034J26672_100481571 | 211 |
| 306 | 3300002244 | JGI24742J22300_10057369 | JGI24742J22300_100573691 | 211 |
| 307 | 3300005327 | Ga0070658_10019632 | Ga0070658_100196323 | 211 |
| 308 | 3300005327 | Ga0070658_10218595 | Ga0070658_102185952 | 211 |
| 309 | 3300005327 | Ga0070658_10410322 | Ga0070658_104103222 | 211 |
| 310 | 3300005328 | Ga0070676_10000712 | Ga0070676_100007122 | 211 |
| 311 | 3300005328 | Ga0070676_10082019 | Ga0070676_100820192 | 211 |
| 312 | 3300005329 | Ga0070683_100010112 | Ga0070683_1000101123 | 211 |
| 313 | 3300005329 | Ga0070683_100285637 | Ga0070683_1002856372 | 211 |
| 314 | 3300005329 | Ga0070683_100375282 | Ga0070683_1003752821 | 211 |
| 315 | 3300005330 | Ga0070690_100001392 | Ga0070690_1000013924 | 211 |
| 316 | 3300005330 | Ga0070690_100003483 | Ga0070690_1000034831 | 211 |
| 317 | 3300005330 | Ga0070690_100018815 | Ga0070690_1000188152 | 211 |
| 318 | 3300005330 | Ga0070690_100448582 | Ga0070690_1004485821 | 211 |
| 319 | 3300005331 | Ga0070670_100046953 | Ga0070670_1000469531 | 211 |
| 320 | 3300005331 | Ga0070670_100059340 | Ga0070670_1000593402 | 211 |
| 321 | 3300005331 | Ga0070670_100205984 | Ga0070670_1002059842 | 211 |
| 322 | 3300005331 | Ga0070670_100269697 | Ga0070670_1002696972 | 211 |
| 323 | 3300005333 | Ga0070677_10030637 | Ga0070677_100306372 | 211 |
| 324 | 3300005334 | Ga0068869_100000631 | Ga0068869_10000063111 | 211 |
| 325 | 3300005334 | Ga0068869_100008561 | Ga0068869_1000085613 | 211 |
| 326 | 3300005334 | Ga0068869_100210289 | Ga0068869_1002102892 | 211 |
| 327 | 3300005335 | Ga0070666_10001286 | Ga0070666_100012867 | 211 |
| 328 | 3300005335 | Ga0070666_10013719 | Ga0070666_100137196 | 211 |
| 329 | 3300005337 | Ga0070682_100461479 | Ga0070682_1004614792 | 211 |
| 330 | 3300005338 | Ga0068868_100001544 | Ga0068868_10000154414 | 211 |
| 331 | 3300005338 | Ga0068868_100002946 | Ga0068868_1000029466 | 211 |
| 332 | 3300005338 | Ga0068868_100281599 | Ga0068868_1002815992 | 211 |
| 333 | 3300005338 | Ga0068868_100479627 | Ga0068868_1004796272 | 211 |
| 334 | 3300005339 | Ga0070660_100003674 | Ga0070660_1000036746 | 211 |
| 335 | 3300005339 | Ga0070660_100027048 | Ga0070660_1000270484 | 211 |
| 336 | 3300005339 | Ga0070660_100040566 | Ga0070660_1000405663 | 211 |
| 337 | 3300005340 | Ga0070689_100003108 | Ga0070689_1000031084 | 211 |
| 338 | 3300005340 | Ga0070689_100005522 | Ga0070689_1000055226 | 211 |
| 339 | 3300005340 | Ga0070689_100042402 | Ga0070689_1000424023 | 211 |
| 340 | 3300005341 | Ga0070691_10035517 | Ga0070691_100355173 | 211 |
| 341 | 3300005343 | Ga0070687_100009949 | Ga0070687_1000099492 | 211 |
| 342 | 3300005343 | Ga0070687_100028147 | Ga0070687_1000281472 | 211 |
| 343 | 3300005343 | Ga0070687_100265424 | Ga0070687_1002654241 | 211 |
| 344 | 3300005344 | Ga0070661_100009592 | Ga0070661_1000095924 | 211 |
| 345 | 3300005344 | Ga0070661_100032273 | Ga0070661_1000322732 | 211 |
| 346 | 3300005344 | Ga0070661_100068496 | Ga0070661_1000684962 | 211 |
| 347 | 3300005344 | Ga0070661_100119601 | Ga0070661_1001196013 | 211 |
| 348 | 3300005344 | Ga0070661_100184529 | Ga0070661_1001845292 | 211 |
| 349 | 3300005344 | Ga0070661_100210364 | Ga0070661_1002103641 | 211 |
| 350 | 3300005345 | Ga0070692_10010969 | Ga0070692_100109693 | 211 |
| 351 | 3300005347 | Ga0070668_100005291 | Ga0070668_1000052914 | 211 |
| 352 | 3300005347 | Ga0070668_100130810 | Ga0070668_1001308103 | 211 |
| 353 | 3300005353 | Ga0070669_100001265 | Ga0070669_10000126515 | 211 |
| 354 | 3300005353 | Ga0070669_100078882 | Ga0070669_1000788823 | 211 |
| 355 | 3300005354 | Ga0070675_100018807 | Ga0070675_1000188072 | 211 |
| 356 | 3300005354 | Ga0070675_100182643 | Ga0070675_1001826432 | 211 |
| 357 | 3300005354 | Ga0070675_100242682 | Ga0070675_1002426822 | 211 |
| 358 | 3300005354 | Ga0070675_100524603 | Ga0070675_1005246032 | 211 |
| 359 | 3300005355 | Ga0070671_100018529 | Ga0070671_1000185297 | 211 |
| 360 | 3300005355 | Ga0070671_100023505 | Ga0070671_1000235056 | 211 |
| 361 | 3300005355 | Ga0070671_100122018 | Ga0070671_1001220183 | 211 |
| 362 | 3300005355 | Ga0070671_100126289 | Ga0070671_1001262894 | 211 |
| 363 | 3300005356 | Ga0070674_100071357 | Ga0070674_1000713572 | 211 |
| 364 | 3300005356 | Ga0070674_100229909 | Ga0070674_1002299092 | 211 |
| 365 | 3300005356 | Ga0070674_100341933 | Ga0070674_1003419332 | 211 |
| 366 | 3300005364 | Ga0070673_100012387 | Ga0070673_1000123873 | 211 |
| 367 | 3300005364 | Ga0070673_100956517 | Ga0070673_1009565171 | 211 |
| 368 | 3300005365 | Ga0070688_100018907 | Ga0070688_1000189073 | 211 |
| 369 | 3300005365 | Ga0070688_100287089 | Ga0070688_1002870891 | 211 |
| 370 | 3300005365 | Ga0070688_100808024 | Ga0070688_1008080241 | 211 |
| 371 | 3300005366 | Ga0070659_100000738 | Ga0070659_10000073818 | 211 |
| 372 | 3300005366 | Ga0070659_100001702 | Ga0070659_1000017022 | 211 |
| 373 | 3300005366 | Ga0070659_100068711 | Ga0070659_1000687113 | 211 |
| 374 | 3300005366 | Ga0070659_100124765 | Ga0070659_1001247652 | 211 |
| 375 | 3300005366 | Ga0070659_100498199 | Ga0070659_1004981992 | 211 |
| 376 | 3300005366 | Ga0070659_100803268 | Ga0070659_1008032681 | 211 |
| 377 | 3300005367 | Ga0070667_100001294 | Ga0070667_10000129413 | 211 |
| 378 | 3300005367 | Ga0070667_100006565 | Ga0070667_1000065655 | 211 |
| 379 | 3300005434 | Ga0070709_10001554 | Ga0070709_100015549 | 211 |
| 380 | 3300005434 | Ga0070709_10023418 | Ga0070709_100234183 | 211 |
| 381 | 3300005434 | Ga0070709_10126273 | Ga0070709_101262732 | 211 |
| 382 | 3300005435 | Ga0070714_100011182 | Ga0070714_1000111828 | 211 |
| 383 | 3300005435 | Ga0070714_100241805 | Ga0070714_1002418052 | 211 |
| 384 | 3300005435 | Ga0070714_100571301 | Ga0070714_1005713011 | 211 |
| 385 | 3300005436 | Ga0070713_100000093 | Ga0070713_10000009310 | 211 |
| 386 | 3300005436 | Ga0070713_100022947 | Ga0070713_1000229476 | 211 |
| 387 | 3300005436 | Ga0070713_100073880 | Ga0070713_1000738802 | 211 |
| 388 | 3300005437 | Ga0070710_10002620 | Ga0070710_100026206 | 211 |
| 389 | 3300005437 | Ga0070710_10033776 | Ga0070710_100337764 | 211 |
| 390 | 3300005437 | Ga0070710_10164745 | Ga0070710_101647451 | 211 |
| 391 | 3300005438 | Ga0070701_10000512 | Ga0070701_100005129 | 211 |
| 392 | 3300005438 | Ga0070701_10004791 | Ga0070701_100047915 | 211 |
| 393 | 3300005438 | Ga0070701_10269498 | Ga0070701_102694982 | 211 |
| 394 | 3300005439 | Ga0070711_100015980 | Ga0070711_1000159802 | 211 |
| 395 | 3300005439 | Ga0070711_100043941 | Ga0070711_1000439412 | 211 |
| 396 | 3300005441 | Ga0070700_100000680 | Ga0070700_1000006809 | 211 |
| 397 | 3300005441 | Ga0070700_100077251 | Ga0070700_1000772512 | 211 |
| 398 | 3300005444 | Ga0070694_100279301 | Ga0070694_1002793012 | 211 |
| 399 | 3300005445 | Ga0070708_100000235 | Ga0070708_10000023523 | 211 |
| 400 | 3300005445 | Ga0070708_100132795 | Ga0070708_1001327952 | 211 |
| 401 | 3300005445 | Ga0070708_100234089 | Ga0070708_1002340892 | 211 |
| 402 | 3300005455 | Ga0070663_100006029 | Ga0070663_1000060296 | 211 |
| 403 | 3300005455 | Ga0070663_100007958 | Ga0070663_1000079582 | 211 |
| 404 | 3300005455 | Ga0070663_100026121 | Ga0070663_1000261214 | 211 |
| 405 | 3300005456 | Ga0070678_100000115 | Ga0070678_10000011513 | 211 |
| 406 | 3300005456 | Ga0070678_100011176 | Ga0070678_1000111763 | 211 |
| 407 | 3300005456 | Ga0070678_100205014 | Ga0070678_1002050142 | 211 |
| 408 | 3300005456 | Ga0070678_100424961 | Ga0070678_1004249612 | 211 |
| 409 | 3300005457 | Ga0070662_100001899 | Ga0070662_1000018999 | 211 |
| 410 | 3300005457 | Ga0070662_100109767 | Ga0070662_1001097671 | 211 |
| 411 | 3300005457 | Ga0070662_100398670 | Ga0070662_1003986701 | 211 |
| 412 | 3300005458 | Ga0070681_10159048 | Ga0070681_101590483 | 211 |
| 413 | 3300005459 | Ga0068867_100002089 | Ga0068867_10000208914 | 211 |
| 414 | 3300005459 | Ga0068867_100002384 | Ga0068867_1000023849 | 211 |
| 415 | 3300005466 | Ga0070685_10000280 | Ga0070685_1000028015 | 211 |
| 416 | 3300005466 | Ga0070685_10004000 | Ga0070685_100040007 | 211 |
| 417 | 3300005467 | Ga0070706_100003250 | Ga0070706_10000325010 | 211 |
| 418 | 3300005471 | Ga0070698_100038927 | Ga0070698_1000389275 | 211 |
| 419 | 3300005471 | Ga0070698_100457357 | Ga0070698_1004573572 | 211 |
| 420 | 3300005518 | Ga0070699_100021973 | Ga0070699_1000219732 | 211 |
| 421 | 3300005530 | Ga0070679_100319854 | Ga0070679_1003198541 | 211 |
| 422 | 3300005535 | Ga0070684_100127045 | Ga0070684_1001270452 | 211 |
| 423 | 3300005535 | Ga0070684_101079181 | Ga0070684_1010791811 | 211 |
| 424 | 3300005539 | Ga0068853_100004240 | Ga0068853_1000042405 | 211 |
| 425 | 3300005539 | Ga0068853_100100019 | Ga0068853_1001000193 | 211 |
| 426 | 3300005539 | Ga0068853_100172200 | Ga0068853_1001722003 | 211 |
| 427 | 3300005539 | Ga0068853_100216891 | Ga0068853_1002168913 | 211 |
| 428 | 3300005539 | Ga0068853_100305750 | Ga0068853_1003057502 | 211 |
| 429 | 3300005539 | Ga0068853_100810180 | Ga0068853_1008101801 | 211 |
| 430 | 3300005543 | Ga0070672_100000912 | Ga0070672_10000091215 | 211 |
| 431 | 3300005543 | Ga0070672_100025764 | Ga0070672_1000257643 | 211 |
| 432 | 3300005544 | Ga0070686_100000973 | Ga0070686_10000097311 | 211 |
| 433 | 3300005544 | Ga0070686_100059674 | Ga0070686_1000596743 | 211 |
| 434 | 3300005546 | Ga0070696_100014415 | Ga0070696_1000144155 | 211 |
| 435 | 3300005546 | Ga0070696_100023215 | Ga0070696_1000232154 | 211 |
| 436 | 3300005547 | Ga0070693_100204317 | Ga0070693_1002043172 | 211 |
| 437 | 3300005548 | Ga0070665_100010968 | Ga0070665_1000109687 | 211 |
| 438 | 3300005548 | Ga0070665_100022112 | Ga0070665_1000221124 | 211 |
| 439 | 3300005548 | Ga0070665_100258975 | Ga0070665_1002589753 | 211 |
| 440 | 3300005563 | Ga0068855_100001097 | Ga0068855_10000109726 | 211 |
| 441 | 3300005563 | Ga0068855_100023399 | Ga0068855_1000233993 | 211 |
| 442 | 3300005563 | Ga0068855_100440046 | Ga0068855_1004400462 | 211 |
| 443 | 3300005564 | Ga0070664_100003001 | Ga0070664_10000300111 | 211 |
| 444 | 3300005564 | Ga0070664_100010765 | Ga0070664_1000107652 | 211 |
| 445 | 3300005564 | Ga0070664_100028505 | Ga0070664_1000285052 | 211 |
| 446 | 3300005564 | Ga0070664_100062529 | Ga0070664_1000625293 | 211 |
| 447 | 3300005577 | Ga0068857_100121668 | Ga0068857_1001216683 | 211 |
| 448 | 3300005577 | Ga0068857_100385254 | Ga0068857_1003852541 | 211 |
| 449 | 3300005578 | Ga0068854_100023280 | Ga0068854_1000232805 | 211 |
| 450 | 3300005578 | Ga0068854_100049838 | Ga0068854_1000498384 | 211 |
| 451 | 3300005614 | Ga0068856_100003602 | Ga0068856_1000036026 | 211 |
| 452 | 3300005614 | Ga0068856_100004835 | Ga0068856_10000483513 | 211 |
| 453 | 3300005614 | Ga0068856_100066958 | Ga0068856_1000669583 | 211 |
| 454 | 3300005614 | Ga0068856_100139215 | Ga0068856_1001392153 | 211 |
| 455 | 3300005615 | Ga0070702_100001461 | Ga0070702_1000014612 | 211 |
| 456 | 3300005615 | Ga0070702_100068538 | Ga0070702_1000685382 | 211 |
| 457 | 3300005615 | Ga0070702_100094931 | Ga0070702_1000949312 | 211 |
| 458 | 3300005615 | Ga0070702_100231428 | Ga0070702_1002314281 | 211 |
| 459 | 3300005616 | Ga0068852_100023710 | Ga0068852_1000237104 | 211 |
| 460 | 3300005616 | Ga0068852_100125206 | Ga0068852_1001252063 | 211 |
| 461 | 3300005616 | Ga0068852_100135834 | Ga0068852_1001358342 | 211 |
| 462 | 3300005616 | Ga0068852_100322172 | Ga0068852_1003221722 | 211 |
| 463 | 3300005617 | Ga0068859_100003142 | Ga0068859_1000031427 | 211 |
| 464 | 3300005617 | Ga0068859_100007100 | Ga0068859_10000710011 | 211 |
| 465 | 3300005617 | Ga0068859_100024433 | Ga0068859_1000244334 | 211 |
| 466 | 3300005618 | Ga0068864_100004336 | Ga0068864_1000043364 | 211 |
| 467 | 3300005618 | Ga0068864_100006912 | Ga0068864_1000069122 | 211 |
| 468 | 3300005718 | Ga0068866_10000632 | Ga0068866_100006327 | 211 |
| 469 | 3300005718 | Ga0068866_10003761 | Ga0068866_100037612 | 211 |
| 470 | 3300005718 | Ga0068866_10032069 | Ga0068866_100320692 | 211 |
| 471 | 3300005719 | Ga0068861_100004985 | Ga0068861_1000049855 | 211 |
| 472 | 3300005719 | Ga0068861_100077602 | Ga0068861_1000776022 | 211 |
| 473 | 3300005719 | Ga0068861_100581050 | Ga0068861_1005810502 | 211 |
| 474 | 3300005834 | Ga0068851_10001169 | Ga0068851_100011692 | 211 |
| 475 | 3300005834 | Ga0068851_10004676 | Ga0068851_100046763 | 211 |
| 476 | 3300005834 | Ga0068851_10037191 | Ga0068851_100371912 | 211 |
| 477 | 3300005834 | Ga0068851_10055432 | Ga0068851_100554322 | 211 |
| 478 | 3300005834 | Ga0068851_10123578 | Ga0068851_101235782 | 211 |
| 479 | 3300005840 | Ga0068870_10010668 | Ga0068870_100106684 | 211 |
| 480 | 3300005840 | Ga0068870_10089571 | Ga0068870_100895712 | 211 |
| 481 | 3300005840 | Ga0068870_10157105 | Ga0068870_101571052 | 211 |
| 482 | 3300005841 | Ga0068863_100001304 | Ga0068863_10000130417 | 211 |
| 483 | 3300005841 | Ga0068863_100003845 | Ga0068863_10000384514 | 211 |
| 484 | 3300005841 | Ga0068863_100069978 | Ga0068863_1000699784 | 211 |
| 485 | 3300005842 | Ga0068858_100000652 | Ga0068858_10000065226 | 211 |
| 486 | 3300005842 | Ga0068858_100006770 | Ga0068858_10000677013 | 211 |
| 487 | 3300005842 | Ga0068858_100030416 | Ga0068858_1000304164 | 211 |
| 488 | 3300005843 | Ga0068860_100004322 | Ga0068860_10000432214 | 211 |
| 489 | 3300005843 | Ga0068860_100020811 | Ga0068860_1000208117 | 211 |
| 490 | 3300005843 | Ga0068860_100040991 | Ga0068860_1000409912 | 211 |
| 491 | 3300005843 | Ga0068860_100358405 | Ga0068860_1003584052 | 211 |
| 492 | 3300005844 | Ga0068862_100002384 | Ga0068862_1000023849 | 211 |
| 493 | 3300005844 | Ga0068862_100042079 | Ga0068862_1000420792 | 211 |
| 494 | 3300005844 | Ga0068862_100271715 | Ga0068862_1002717152 | 211 |
| 495 | 3300005844 | Ga0068862_100618267 | Ga0068862_1006182672 | 211 |
| 496 | 3300005985 | Ga0081539_10027713 | Ga0081539_100277134 | 211 |
| 497 | 3300006048 | Ga0075363_100443198 | Ga0075363_1004431981 | 211 |
| 498 | 3300006163 | Ga0070715_10000885 | Ga0070715_100008857 | 211 |
| 499 | 3300006175 | Ga0070712_100005914 | Ga0070712_1000059144 | 211 |
| 500 | 3300006175 | Ga0070712_100038639 | Ga0070712_1000386393 | 211 |
| 501 | 3300006195 | Ga0075366_10029069 | Ga0075366_100290693 | 211 |
| 502 | 3300006237 | Ga0097621_100002419 | Ga0097621_1000024194 | 211 |
| 503 | 3300006237 | Ga0097621_100002825 | Ga0097621_1000028255 | 211 |
| 504 | 3300006237 | Ga0097621_100020672 | Ga0097621_1000206726 | 211 |
| 505 | 3300006237 | Ga0097621_100265158 | Ga0097621_1002651582 | 211 |
| 506 | 3300006358 | Ga0068871_100001447 | Ga0068871_10000144711 | 211 |
| 507 | 3300006358 | Ga0068871_100005154 | Ga0068871_1000051547 | 211 |
| 508 | 3300006358 | Ga0068871_100108277 | Ga0068871_1001082773 | 211 |
| 509 | 3300006844 | Ga0075428_100063847 | Ga0075428_1000638475 | 211 |
| 510 | 3300006871 | Ga0075434_100056642 | Ga0075434_1000566424 | 211 |
| 511 | 3300006871 | Ga0075434_100360468 | Ga0075434_1003604682 | 211 |
| 512 | 3300006871 | Ga0075434_100578741 | Ga0075434_1005787412 | 211 |
| 513 | 3300006880 | Ga0075429_100030854 | Ga0075429_1000308546 | 211 |
| 514 | 3300006881 | Ga0068865_100000305 | Ga0068865_10000030510 | 211 |
| 515 | 3300006881 | Ga0068865_100006566 | Ga0068865_1000065663 | 211 |
| 516 | 3300006881 | Ga0068865_100053296 | Ga0068865_1000532963 | 211 |
| 517 | 3300006931 | Ga0097620_100003142 | Ga0097620_1000031427 | 211 |
| 518 | 3300006931 | Ga0097620_100007100 | Ga0097620_10000710011 | 211 |
| 519 | 3300006931 | Ga0097620_100024433 | Ga0097620_1000244335 | 211 |
| 520 | 3300009093 | Ga0105240_10014974 | Ga0105240_100149742 | 211 |
| 521 | 3300009093 | Ga0105240_10108406 | Ga0105240_101084064 | 211 |
| 522 | 3300009093 | Ga0105240_10174218 | Ga0105240_101742182 | 211 |
| 523 | 3300009094 | Ga0111539_10028863 | Ga0111539_100288637 | 211 |
| 524 | 3300009094 | Ga0111539_10192785 | Ga0111539_101927853 | 211 |
| 525 | 3300009098 | Ga0105245_10008300 | Ga0105245_100083004 | 211 |
| 526 | 3300009098 | Ga0105245_10950510 | Ga0105245_109505101 | 211 |
| 527 | 3300009101 | Ga0105247_10010870 | Ga0105247_100108706 | 211 |
| 528 | 3300009147 | Ga0114129_10103578 | Ga0114129_101035782 | 211 |
| 529 | 3300009147 | Ga0114129_10988474 | Ga0114129_109884742 | 211 |
| 530 | 3300009147 | Ga0114129_11331391 | Ga0114129_113313911 | 211 |
| 531 | 3300009148 | Ga0105243_10004538 | Ga0105243_100045385 | 211 |
| 532 | 3300009174 | Ga0105241_10006534 | Ga0105241_100065346 | 211 |
| 533 | 3300009176 | Ga0105242_10029601 | Ga0105242_100296013 | 211 |
| 534 | 3300009176 | Ga0105242_10079223 | Ga0105242_100792232 | 211 |
| 535 | 3300009177 | Ga0105248_10030473 | Ga0105248_100304733 | 211 |
| 536 | 3300009177 | Ga0105248_10034915 | Ga0105248_100349155 | 211 |
| 537 | 3300009177 | Ga0105248_10130909 | Ga0105248_101309093 | 211 |
| 538 | 3300009177 | Ga0105248_10131205 | Ga0105248_101312053 | 211 |
| 539 | 3300009177 | Ga0105248_10315236 | Ga0105248_103152362 | 211 |
| 540 | 3300009545 | Ga0105237_10251426 | Ga0105237_102514262 | 211 |
| 541 | 3300009545 | Ga0105237_10512691 | Ga0105237_105126912 | 211 |
| 542 | 3300009545 | Ga0105237_11121596 | Ga0105237_111215961 | 211 |
| 543 | 3300009551 | Ga0105238_10007180 | Ga0105238_1000718011 | 211 |
| 544 | 3300009551 | Ga0105238_10071679 | Ga0105238_100716795 | 211 |
| 545 | 3300009553 | Ga0105249_10009105 | Ga0105249_100091055 | 211 |
| 546 | 3300009553 | Ga0105249_10232227 | Ga0105249_102322271 | 211 |
| 547 | 3300010375 | Ga0105239_10021898 | Ga0105239_100218984 | 211 |
| 548 | 3300010375 | Ga0105239_10058956 | Ga0105239_100589564 | 211 |
| 549 | 3300010375 | Ga0105239_10119122 | Ga0105239_101191222 | 211 |
| 550 | 3300010375 | Ga0105239_10535735 | Ga0105239_105357352 | 211 |
| 551 | 3300011119 | Ga0105246_10065155 | Ga0105246_100651552 | 211 |
| 552 | 3300011119 | Ga0105246_10752466 | Ga0105246_107524662 | 211 |
| 553 | 3300013100 | Ga0157373_10005110 | Ga0157373_100051104 | 211 |
| 554 | 3300013100 | Ga0157373_10064475 | Ga0157373_100644754 | 211 |
| 555 | 3300013102 | Ga0157371_10000330 | Ga0157371_1000033040 | 211 |
| 556 | 3300013102 | Ga0157371_10132508 | Ga0157371_101325083 | 211 |
| 557 | 3300013102 | Ga0157371_10634718 | Ga0157371_106347182 | 211 |
| 558 | 3300013104 | Ga0157370_10027517 | Ga0157370_100275173 | 211 |
| 559 | 3300013104 | Ga0157370_10063967 | Ga0157370_100639672 | 211 |
| 560 | 3300013105 | Ga0157369_10017713 | Ga0157369_100177136 | 211 |
| 561 | 3300013105 | Ga0157369_10161662 | Ga0157369_101616622 | 211 |
| 562 | 3300013105 | Ga0157369_10232934 | Ga0157369_102329344 | 211 |
| 563 | 3300013105 | Ga0157369_10366923 | Ga0157369_103669232 | 211 |
| 564 | 3300013105 | Ga0157369_10496390 | Ga0157369_104963902 | 211 |
| 565 | 3300013296 | Ga0157374_10000286 | Ga0157374_1000028622 | 211 |
| 566 | 3300013296 | Ga0157374_10002810 | Ga0157374_100028103 | 211 |
| 567 | 3300013296 | Ga0157374_10040877 | Ga0157374_100408774 | 211 |
| 568 | 3300013296 | Ga0157374_10158128 | Ga0157374_101581282 | 211 |
| 569 | 3300013296 | Ga0157374_10236500 | Ga0157374_102365002 | 211 |
| 570 | 3300013297 | Ga0157378_10001140 | Ga0157378_100011408 | 211 |
| 571 | 3300013297 | Ga0157378_10056612 | Ga0157378_100566123 | 211 |
| 572 | 3300013297 | Ga0157378_10076042 | Ga0157378_100760423 | 211 |
| 573 | 3300013297 | Ga0157378_10123996 | Ga0157378_101239963 | 211 |
| 574 | 3300013297 | Ga0157378_10143688 | Ga0157378_101436882 | 211 |
| 575 | 3300013306 | Ga0163162_10003799 | Ga0163162_100037994 | 211 |
| 576 | 3300013306 | Ga0163162_10158951 | Ga0163162_101589514 | 211 |
| 577 | 3300013306 | Ga0163162_10161614 | Ga0163162_101616143 | 211 |
| 578 | 3300013306 | Ga0163162_11186080 | Ga0163162_111860801 | 211 |
| 579 | 3300013307 | Ga0157372_10018145 | Ga0157372_100181457 | 211 |
| 580 | 3300013307 | Ga0157372_10203107 | Ga0157372_102031073 | 211 |
| 581 | 3300013307 | Ga0157372_10247440 | Ga0157372_102474403 | 211 |
| 582 | 3300013308 | Ga0157375_10029021 | Ga0157375_100290212 | 211 |
| 583 | 3300013308 | Ga0157375_10061001 | Ga0157375_100610014 | 211 |
| 584 | 3300014325 | Ga0163163_10022213 | Ga0163163_100222132 | 211 |
| 585 | 3300014325 | Ga0163163_10035753 | Ga0163163_100357535 | 211 |
| 586 | 3300014325 | Ga0163163_10128168 | Ga0163163_101281683 | 211 |
| 587 | 3300014326 | Ga0157380_10000449 | Ga0157380_1000044915 | 211 |
| 588 | 3300014326 | Ga0157380_10066986 | Ga0157380_100669863 | 211 |
| 589 | 3300014497 | Ga0182008_10267819 | Ga0182008_102678191 | 211 |
| 590 | 3300014745 | Ga0157377_10214265 | Ga0157377_102142652 | 211 |
| 591 | 3300014968 | Ga0157379_10020080 | Ga0157379_100200803 | 211 |
| 592 | 3300014968 | Ga0157379_10034811 | Ga0157379_100348114 | 211 |
| 593 | 3300014968 | Ga0157379_10373771 | Ga0157379_103737712 | 211 |
| 594 | 3300014969 | Ga0157376_10008963 | Ga0157376_100089636 | 211 |
| 595 | 3300014969 | Ga0157376_10136242 | Ga0157376_101362422 | 211 |
| 596 | 3300014969 | Ga0157376_11057459 | Ga0157376_110574592 | 211 |
| 597 | 3300017792 | Ga0163161_10021490 | Ga0163161_100214904 | 211 |
| 598 | 3300020081 | Ga0206354_11167538 | Ga0206354_111675382 | 211 |
| 599 | 3300025315 | Ga0207697_10018755 | Ga0207697_100187553 | 211 |
| 600 | 3300025321 | Ga0207656_10004890 | Ga0207656_100048904 | 211 |
| 601 | 3300025321 | Ga0207656_10018064 | Ga0207656_100180642 | 211 |
| 602 | 3300025321 | Ga0207656_10173677 | Ga0207656_101736772 | 211 |
| 603 | 3300025321 | Ga0207656_10256049 | Ga0207656_102560492 | 211 |
| 604 | 3300025893 | Ga0207682_10001309 | Ga0207682_1000130910 | 211 |
| 605 | 3300025898 | Ga0207692_10119800 | Ga0207692_101198002 | 211 |
| 606 | 3300025898 | Ga0207692_10148269 | Ga0207692_101482692 | 211 |
| 607 | 3300025899 | Ga0207642_10000855 | Ga0207642_1000085510 | 211 |
| 608 | 3300025900 | Ga0207710_10261838 | Ga0207710_102618381 | 211 |
| 609 | 3300025901 | Ga0207688_10000064 | Ga0207688_1000006425 | 211 |
| 610 | 3300025903 | Ga0207680_10002662 | Ga0207680_100026629 | 211 |
| 611 | 3300025903 | Ga0207680_10008244 | Ga0207680_100082445 | 211 |
| 612 | 3300025903 | Ga0207680_10144850 | Ga0207680_101448502 | 211 |
| 613 | 3300025906 | Ga0207699_10022518 | Ga0207699_100225183 | 211 |
| 614 | 3300025906 | Ga0207699_10082855 | Ga0207699_100828553 | 211 |
| 615 | 3300025906 | Ga0207699_10106843 | Ga0207699_101068433 | 211 |
| 616 | 3300025907 | Ga0207645_10000517 | Ga0207645_1000051731 | 211 |
| 617 | 3300025907 | Ga0207645_10004266 | Ga0207645_1000426610 | 211 |
| 618 | 3300025908 | Ga0207643_10000593 | Ga0207643_1000059313 | 211 |
| 619 | 3300025908 | Ga0207643_10061840 | Ga0207643_100618402 | 211 |
| 620 | 3300025908 | Ga0207643_10079348 | Ga0207643_100793482 | 211 |
| 621 | 3300025909 | Ga0207705_10065087 | Ga0207705_100650874 | 211 |
| 622 | 3300025909 | Ga0207705_10290055 | Ga0207705_102900552 | 211 |
| 623 | 3300025910 | Ga0207684_10020548 | Ga0207684_100205483 | 211 |
| 624 | 3300025911 | Ga0207654_10012461 | Ga0207654_100124613 | 211 |
| 625 | 3300025912 | Ga0207707_10001948 | Ga0207707_100019483 | 211 |
| 626 | 3300025912 | Ga0207707_10177929 | Ga0207707_101779292 | 211 |
| 627 | 3300025913 | Ga0207695_10006723 | Ga0207695_100067236 | 211 |
| 628 | 3300025913 | Ga0207695_10191046 | Ga0207695_101910462 | 211 |
| 629 | 3300025914 | Ga0207671_10330991 | Ga0207671_103309912 | 211 |
| 630 | 3300025915 | Ga0207693_10003485 | Ga0207693_100034859 | 211 |
| 631 | 3300025915 | Ga0207693_10043597 | Ga0207693_100435973 | 211 |
| 632 | 3300025916 | Ga0207663_10013001 | Ga0207663_100130013 | 211 |
| 633 | 3300025917 | Ga0207660_10007884 | Ga0207660_100078842 | 211 |
| 634 | 3300025918 | Ga0207662_10004084 | Ga0207662_100040841 | 211 |
| 635 | 3300025918 | Ga0207662_10022451 | Ga0207662_100224513 | 211 |
| 636 | 3300025918 | Ga0207662_10046069 | Ga0207662_100460693 | 211 |
| 637 | 3300025919 | Ga0207657_10000745 | Ga0207657_1000074515 | 211 |
| 638 | 3300025919 | Ga0207657_10000927 | Ga0207657_100009277 | 211 |
| 639 | 3300025919 | Ga0207657_10033548 | Ga0207657_100335484 | 211 |
| 640 | 3300025919 | Ga0207657_10061986 | Ga0207657_100619863 | 211 |
| 641 | 3300025920 | Ga0207649_10046725 | Ga0207649_100467252 | 211 |
| 642 | 3300025920 | Ga0207649_10131544 | Ga0207649_101315442 | 211 |
| 643 | 3300025920 | Ga0207649_10235537 | Ga0207649_102355372 | 211 |
| 644 | 3300025921 | Ga0207652_10013940 | Ga0207652_100139406 | 211 |
| 645 | 3300025921 | Ga0207652_10169230 | Ga0207652_101692302 | 211 |
| 646 | 3300025921 | Ga0207652_10178783 | Ga0207652_101787832 | 211 |
| 647 | 3300025921 | Ga0207652_10218140 | Ga0207652_102181402 | 211 |
| 648 | 3300025923 | Ga0207681_10007743 | Ga0207681_100077432 | 211 |
| 649 | 3300025923 | Ga0207681_10083857 | Ga0207681_100838572 | 211 |
| 650 | 3300025923 | Ga0207681_10725148 | Ga0207681_107251482 | 211 |
| 651 | 3300025924 | Ga0207694_10016717 | Ga0207694_100167175 | 211 |
| 652 | 3300025925 | Ga0207650_10005701 | Ga0207650_100057018 | 211 |
| 653 | 3300025925 | Ga0207650_10012515 | Ga0207650_100125153 | 211 |
| 654 | 3300025925 | Ga0207650_10012972 | Ga0207650_100129724 | 211 |
| 655 | 3300025925 | Ga0207650_10038721 | Ga0207650_100387213 | 211 |
| 656 | 3300025925 | Ga0207650_10062656 | Ga0207650_100626562 | 211 |
| 657 | 3300025925 | Ga0207650_10276376 | Ga0207650_102763762 | 211 |
| 658 | 3300025926 | Ga0207659_10008481 | Ga0207659_100084814 | 211 |
| 659 | 3300025926 | Ga0207659_10039126 | Ga0207659_100391263 | 211 |
| 660 | 3300025926 | Ga0207659_10039639 | Ga0207659_100396394 | 211 |
| 661 | 3300025926 | Ga0207659_10180953 | Ga0207659_101809532 | 211 |
| 662 | 3300025926 | Ga0207659_10304532 | Ga0207659_103045322 | 211 |
| 663 | 3300025926 | Ga0207659_10415873 | Ga0207659_104158732 | 211 |
| 664 | 3300025927 | Ga0207687_10000800 | Ga0207687_100008004 | 211 |
| 665 | 3300025927 | Ga0207687_10478042 | Ga0207687_104780422 | 211 |
| 666 | 3300025928 | Ga0207700_10000073 | Ga0207700_1000007348 | 211 |
| 667 | 3300025928 | Ga0207700_10444260 | Ga0207700_104442602 | 211 |
| 668 | 3300025929 | Ga0207664_10015163 | Ga0207664_100151634 | 211 |
| 669 | 3300025931 | Ga0207644_10002067 | Ga0207644_100020677 | 211 |
| 670 | 3300025931 | Ga0207644_10014673 | Ga0207644_100146736 | 211 |
| 671 | 3300025931 | Ga0207644_10040602 | Ga0207644_100406023 | 211 |
| 672 | 3300025931 | Ga0207644_10048940 | Ga0207644_100489402 | 211 |
| 673 | 3300025931 | Ga0207644_10195795 | Ga0207644_101957952 | 211 |
| 674 | 3300025931 | Ga0207644_10771129 | Ga0207644_107711292 | 211 |
| 675 | 3300025932 | Ga0207690_10001061 | Ga0207690_1000106114 | 211 |
| 676 | 3300025932 | Ga0207690_10008488 | Ga0207690_100084883 | 211 |
| 677 | 3300025932 | Ga0207690_10128236 | Ga0207690_101282362 | 211 |
| 678 | 3300025932 | Ga0207690_10456793 | Ga0207690_104567931 | 211 |
| 679 | 3300025932 | Ga0207690_10469206 | Ga0207690_104692062 | 211 |
| 680 | 3300025932 | Ga0207690_10485170 | Ga0207690_104851701 | 211 |
| 681 | 3300025933 | Ga0207706_10000023 | Ga0207706_100000239 | 211 |
| 682 | 3300025933 | Ga0207706_10000585 | Ga0207706_1000058526 | 211 |
| 683 | 3300025933 | Ga0207706_10267134 | Ga0207706_102671342 | 211 |
| 684 | 3300025933 | Ga0207706_10962515 | Ga0207706_109625151 | 211 |
| 685 | 3300025934 | Ga0207686_10002242 | Ga0207686_100022427 | 211 |
| 686 | 3300025934 | Ga0207686_10623116 | Ga0207686_106231162 | 211 |
| 687 | 3300025935 | Ga0207709_10005847 | Ga0207709_100058474 | 211 |
| 688 | 3300025936 | Ga0207670_10015865 | Ga0207670_100158654 | 211 |
| 689 | 3300025936 | Ga0207670_10021052 | Ga0207670_100210522 | 211 |
| 690 | 3300025936 | Ga0207670_10063507 | Ga0207670_100635073 | 211 |
| 691 | 3300025937 | Ga0207669_10034323 | Ga0207669_100343233 | 211 |
| 692 | 3300025938 | Ga0207704_10001417 | Ga0207704_100014176 | 211 |
| 693 | 3300025938 | Ga0207704_10026988 | Ga0207704_100269883 | 211 |
| 694 | 3300025938 | Ga0207704_10067624 | Ga0207704_100676242 | 211 |
| 695 | 3300025940 | Ga0207691_10000688 | Ga0207691_100006884 | 211 |
| 696 | 3300025940 | Ga0207691_10013470 | Ga0207691_100134707 | 211 |
| 697 | 3300025940 | Ga0207691_10014621 | Ga0207691_100146215 | 211 |
| 698 | 3300025941 | Ga0207711_10000087 | Ga0207711_1000008744 | 211 |
| 699 | 3300025941 | Ga0207711_10022461 | Ga0207711_100224616 | 211 |
| 700 | 3300025941 | Ga0207711_10081565 | Ga0207711_100815653 | 211 |
| 701 | 3300025942 | Ga0207689_10000069 | Ga0207689_1000006925 | 211 |
| 702 | 3300025942 | Ga0207689_10000642 | Ga0207689_1000064221 | 211 |
| 703 | 3300025942 | Ga0207689_10027555 | Ga0207689_100275555 | 211 |
| 704 | 3300025944 | Ga0207661_10010000 | Ga0207661_100100006 | 211 |
| 705 | 3300025945 | Ga0207679_10013781 | Ga0207679_100137816 | 211 |
| 706 | 3300025945 | Ga0207679_10051343 | Ga0207679_100513433 | 211 |
| 707 | 3300025945 | Ga0207679_10067061 | Ga0207679_100670613 | 211 |
| 708 | 3300025945 | Ga0207679_10105109 | Ga0207679_101051093 | 211 |
| 709 | 3300025945 | Ga0207679_10174401 | Ga0207679_101744012 | 211 |
| 710 | 3300025945 | Ga0207679_10653644 | Ga0207679_106536442 | 211 |
| 711 | 3300025949 | Ga0207667_10001383 | Ga0207667_1000138311 | 211 |
| 712 | 3300025949 | Ga0207667_10008157 | Ga0207667_100081572 | 211 |
| 713 | 3300025949 | Ga0207667_10026225 | Ga0207667_100262256 | 211 |
| 714 | 3300025949 | Ga0207667_10299919 | Ga0207667_102999193 | 211 |
| 715 | 3300025949 | Ga0207667_10356438 | Ga0207667_103564382 | 211 |
| 716 | 3300025960 | Ga0207651_10007432 | Ga0207651_100074325 | 211 |
| 717 | 3300025960 | Ga0207651_10076905 | Ga0207651_100769053 | 211 |
| 718 | 3300025960 | Ga0207651_10080674 | Ga0207651_100806743 | 211 |
| 719 | 3300025961 | Ga0207712_10021014 | Ga0207712_100210144 | 211 |
| 720 | 3300025972 | Ga0207668_10013121 | Ga0207668_100131214 | 211 |
| 721 | 3300025972 | Ga0207668_10121321 | Ga0207668_101213213 | 211 |
| 722 | 3300025981 | Ga0207640_10093279 | Ga0207640_100932792 | 211 |
| 723 | 3300025981 | Ga0207640_10285338 | Ga0207640_102853382 | 211 |
| 724 | 3300025986 | Ga0207658_10025203 | Ga0207658_100252034 | 211 |
| 725 | 3300025986 | Ga0207658_10152481 | Ga0207658_101524812 | 211 |
| 726 | 3300025986 | Ga0207658_10247727 | Ga0207658_102477272 | 211 |
| 727 | 3300026023 | Ga0207677_10000700 | Ga0207677_100007003 | 211 |
| 728 | 3300026023 | Ga0207677_10007124 | Ga0207677_100071244 | 211 |
| 729 | 3300026023 | Ga0207677_10286087 | Ga0207677_102860872 | 211 |
| 730 | 3300026023 | Ga0207677_10360332 | Ga0207677_103603322 | 211 |
| 731 | 3300026023 | Ga0207677_10557167 | Ga0207677_105571672 | 211 |
| 732 | 3300026035 | Ga0207703_10004909 | Ga0207703_1000490910 | 211 |
| 733 | 3300026035 | Ga0207703_10005565 | Ga0207703_100055656 | 211 |
| 734 | 3300026035 | Ga0207703_10013743 | Ga0207703_100137434 | 211 |
| 735 | 3300026035 | Ga0207703_10018715 | Ga0207703_100187155 | 211 |
| 736 | 3300026041 | Ga0207639_10010939 | Ga0207639_100109396 | 211 |
| 737 | 3300026041 | Ga0207639_10014491 | Ga0207639_100144913 | 211 |
| 738 | 3300026041 | Ga0207639_10144669 | Ga0207639_101446692 | 211 |
| 739 | 3300026041 | Ga0207639_10397560 | Ga0207639_103975602 | 211 |
| 740 | 3300026067 | Ga0207678_10001787 | Ga0207678_1000178710 | 211 |
| 741 | 3300026067 | Ga0207678_10012488 | Ga0207678_100124883 | 211 |
| 742 | 3300026067 | Ga0207678_10058005 | Ga0207678_100580052 | 211 |
| 743 | 3300026067 | Ga0207678_10132633 | Ga0207678_101326332 | 211 |
| 744 | 3300026067 | Ga0207678_10296284 | Ga0207678_102962842 | 211 |
| 745 | 3300026075 | Ga0207708_10000102 | Ga0207708_1000010247 | 211 |
| 746 | 3300026075 | Ga0207708_10002194 | Ga0207708_1000219413 | 211 |
| 747 | 3300026078 | Ga0207702_10004398 | Ga0207702_100043988 | 211 |
| 748 | 3300026078 | Ga0207702_10020136 | Ga0207702_100201365 | 211 |
| 749 | 3300026078 | Ga0207702_10085787 | Ga0207702_100857873 | 211 |
| 750 | 3300026088 | Ga0207641_10683779 | Ga0207641_106837791 | 211 |
| 751 | 3300026089 | Ga0207648_10000048 | Ga0207648_1000004852 | 211 |
| 752 | 3300026089 | Ga0207648_10005941 | Ga0207648_100059419 | 211 |
| 753 | 3300026089 | Ga0207648_10006307 | Ga0207648_100063073 | 211 |
| 754 | 3300026095 | Ga0207676_10000140 | Ga0207676_1000014014 | 211 |
| 755 | 3300026095 | Ga0207676_10014793 | Ga0207676_100147935 | 211 |
| 756 | 3300026095 | Ga0207676_10244230 | Ga0207676_102442302 | 211 |
| 757 | 3300026116 | Ga0207674_10000429 | Ga0207674_100004296 | 211 |
| 758 | 3300026116 | Ga0207674_10004730 | Ga0207674_1000473013 | 211 |
| 759 | 3300026116 | Ga0207674_10115494 | Ga0207674_101154943 | 211 |
| 760 | 3300026116 | Ga0207674_10530958 | Ga0207674_105309581 | 211 |
| 761 | 3300026118 | Ga0207675_100000527 | Ga0207675_10000052722 | 211 |
| 762 | 3300026118 | Ga0207675_100005190 | Ga0207675_1000051905 | 211 |
| 763 | 3300026118 | Ga0207675_100096997 | Ga0207675_1000969972 | 211 |
| 764 | 3300026121 | Ga0207683_10000258 | Ga0207683_100002584 | 211 |
| 765 | 3300026121 | Ga0207683_10007413 | Ga0207683_100074138 | 211 |
| 766 | 3300026121 | Ga0207683_10019835 | Ga0207683_100198354 | 211 |
| 767 | 3300026121 | Ga0207683_10048403 | Ga0207683_100484033 | 211 |
| 768 | 3300026121 | Ga0207683_10585378 | Ga0207683_105853782 | 211 |
| 769 | 3300026142 | Ga0207698_10025921 | Ga0207698_100259214 | 211 |
| 770 | 3300026142 | Ga0207698_10027312 | Ga0207698_100273123 | 211 |
| 771 | 3300026142 | Ga0207698_10083504 | Ga0207698_100835043 | 211 |
| 772 | 3300026142 | Ga0207698_10176926 | Ga0207698_101769263 | 211 |
| 773 | 3300026142 | Ga0207698_10371191 | Ga0207698_103711912 | 211 |
| 774 | 3300026142 | Ga0207698_10474750 | Ga0207698_104747502 | 211 |
| 775 | 3300026142 | Ga0207698_10484567 | Ga0207698_104845672 | 211 |
| 776 | 3300027682 | Ga0209971_1006278 | Ga0209971_10062783 | 211 |
| 777 | 3300027876 | Ga0209974_10026864 | Ga0209974_100268642 | 211 |
| 778 | 3300027907 | Ga0207428_10012525 | Ga0207428_100125252 | 211 |
| 779 | 3300028379 | Ga0268266_10025724 | Ga0268266_100257244 | 211 |
| 780 | 3300028379 | Ga0268266_10106968 | Ga0268266_101069682 | 211 |
| 781 | 3300028379 | Ga0268266_10286865 | Ga0268266_102868652 | 211 |
| 782 | 3300028380 | Ga0268265_10015056 | Ga0268265_100150563 | 211 |
| 783 | 3300028380 | Ga0268265_10038563 | Ga0268265_100385632 | 211 |
| 784 | 3300028381 | Ga0268264_10008062 | Ga0268264_100080625 | 211 |
| 785 | 3300028381 | Ga0268264_10017643 | Ga0268264_100176434 | 211 |
| 786 | 3300028381 | Ga0268264_10843934 | Ga0268264_108439341 | 211 |
| 787 | 3300031548 | Ga0307408_100195641 | Ga0307408_1001956413 | 211 |
| 788 | 3300031824 | Ga0307413_10065374 | Ga0307413_100653744 | 211 |
| 789 | 3300031852 | Ga0307410_10013194 | Ga0307410_100131946 | 211 |
| 790 | 3300031901 | Ga0307406_10014179 | Ga0307406_100141795 | 211 |
| 791 | 3300031903 | Ga0307407_10006770 | Ga0307407_100067704 | 211 |
| 792 | 3300031911 | Ga0307412_10047662 | Ga0307412_100476623 | 211 |
| 793 | 3300031995 | Ga0307409_100016686 | Ga0307409_1000166867 | 211 |
| 794 | 3300032002 | Ga0307416_100014686 | Ga0307416_1000146865 | 211 |
| 795 | 3300032004 | Ga0307414_10120681 | Ga0307414_101206813 | 211 |
| 796 | 3300032005 | Ga0307411_10016744 | Ga0307411_100167444 | 211 |
| 797 | 3300035086 | Ga0373934_0148616 | Ga0373934_0148616_235_882 | 211 |
| 798 | 3300035111 | Ga0373923_0077260 | Ga0373923_0077260_142_789 | 211 |
| 799 | 3300035113 | Ga0373936_0017734 | Ga0373936_0017734_1738_2388 | 211 |
| 800 | 3300035117 | Ga0373953_0016078 | Ga0373953_0016078_243_893 | 211 |
| 801 | 3300035118 | Ga0373954_0000495 | Ga0373954_0000495_142_792 | 211 |
| 802 | 3300035118 | Ga0373954_0046201 | Ga0373954_0046201_117_752 | 211 |
| 803 | 3300035119 | Ga0373956_0017278 | Ga0373956_0017278_874_1521 | 211 |
| 804 | 3300035120 | Ga0373957_0010986 | Ga0373957_0010986_1560_2210 | 211 |
| 805 | 3300035121 | Ga0373960_0077176 | Ga0373960_0077176_36_671 | 211 |
| 806 | 3300035170 | Ga0373943_0212706 | Ga0373943_0212706_421_1056 | 211 |
| 807 | 3300035172 | Ga0373955_0002775 | Ga0373955_0002775_6277_6924 | 211 |
| 808 | 3300035172 | Ga0373955_0146636 | Ga0373955_0146636_128_763 | 211 |
| 809 | 3300035172 | Ga0373955_0219442 | Ga0373955_0219442_423_1070 | 211 |
| 810 | 3300035410 | Ga0373924_0009262 | Ga0373924_0009262_2796_3446 | 211 |
| 811 | 3300035691 | Ga0373931_0068163 | Ga0373931_0068163_1125_1763 | 211 |
| 812 | 3300035692 | Ga0373935_0414952 | Ga0373935_0414952_57_692 | 211 |
| 813 | 3300035695 | Ga0373927_0323704 | Ga0373927_0323704_162_797 | 211 |
| 814 | 3300035724 | Ga0373933_0007482 | Ga0373933_0007482_3852_4502 | 211 |
| 815 | 3300035724 | Ga0373933_0177656 | Ga0373933_0177656_472_1107 | 211 |
| 816 | 3300035725 | Ga0373947_0172210 | Ga0373947_0172210_285_920 | 211 |
| 817 | 3300035725 | Ga0373947_0176670 | Ga0373947_0176670_569_1219 | 211 |
| 818 | 3300036401 | Ga0373937_0003673 | Ga0373937_0003673_7005_7652 | 211 |
| 819 | 3300036401 | Ga0373937_0197746 | Ga0373937_0197746_479_1129 | 211 |
| 820 | 3300036401 | Ga0373937_0282294 | Ga0373937_0282294_715_1350 | 211 |
| 821 | 3300036401 | Ga0373937_0404930 | Ga0373937_0404930_443_1078 | 211 |
| 822 | 3300037068 | Ga0373925_0032323 | Ga0373925_0032323_546_1181 | 211 |
| 823 | 3300037068 | Ga0373925_0557647 | Ga0373925_0557647_74_724 | 211 |
| 824 | 3300037312 | Ga0395899_0094005 | Ga0395899_0094005_87_725 | 211 |
| 825 | 3300037418 | Ga0395900_0279153 | Ga0395900_0279153_508_1152 | 211 |
| 826 | 3300037466 | Ga0395898_0128534 | Ga0395898_0128534_1320_1958 | 211 |
| 827 | 3300037466 | Ga0395898_0245420 | Ga0395898_0245420_735_1379 | 211 |
| 828 | 3300037471 | Ga0395905_0101849 | Ga0395905_0101849_1133_1771 | 211 |
| 829 | 3300037471 | Ga0395905_0163713 | Ga0395905_0163713_1061_1705 | 211 |
| 830 | 3300038443 | Ga0395901_0215998 | Ga0395901_0215998_869_1513 | 211 |
| 831 | 3300041486 | Ga0451807_1798842 | Ga0451807_1798842_618_1268 | 211 |
| 832 | 3300045836 | Ga0466958_0154382 | Ga0466958_0154382_509_1186 | 211 |
| 833 | 3300046462 | Ga0495651_0332618 | Ga0495651_0332618_233_880 | 211 |
| 834 | 3300046472 | Ga0495580_0217320 | Ga0495580_0217320_207_842 | 211 |
| 835 | 3300046477 | Ga0495664_0056002 | Ga0495664_0056002_456_1106 | 211 |
| 836 | 3300046477 | Ga0495664_0069842 | Ga0495664_0069842_502_1152 | 211 |
| 837 | 3300046539 | Ga0495621_0031615 | Ga0495621_0031615_524_1159 | 211 |
| 838 | 3300046679 | Ga0495623_0043132 | Ga0495623_0043132_1462_2112 | 211 |
| 839 | 3300046681 | Ga0495647_0130193 | Ga0495647_0130193_363_1001 | 211 |
| 840 | 3300047319 | Ga0495674_0601374 | Ga0495674_0601374_125_772 | 211 |
| 841 | 3300047444 | Ga0495675_0167218 | Ga0495675_0167218_410_1060 | 211 |
| 842 | 3300047471 | Ga0495684_0433600 | Ga0495684_0433600_161_811 | 211 |
| 843 | 3300048903 | Ga0496100_0033781 | Ga0496100_0033781_864_1499 | 211 |
| 844 | 3300048904 | Ga0496101_0015013 | Ga0496101_0015013_3190_3840 | 211 |
| 845 | 3300048904 | Ga0496101_0241640 | Ga0496101_0241640_426_1061 | 211 |
| 846 | 3300048905 | Ga0496102_0056849 | Ga0496102_0056849_2295_2930 | 211 |
| 847 | 3300048905 | Ga0496102_0058024 | Ga0496102_0058024_2029_2664 | 211 |
| 848 | 3300048906 | Ga0496103_0075656 | Ga0496103_0075656_1165_1800 | 211 |
| 849 | 3300048907 | Ga0496104_0008001 | Ga0496104_0008001_3696_4343 | 211 |
| 850 | 3300048907 | Ga0496104_0026945 | Ga0496104_0026945_538_1173 | 211 |
| 851 | 3300048908 | Ga0496105_0012713 | Ga0496105_0012713_1775_2410 | 211 |
| 852 | 3300048908 | Ga0496105_0107189 | Ga0496105_0107189_1361_2011 | 211 |
| 853 | 3300048909 | Ga0496106_0000852 | Ga0496106_0000852_17183_17818 | 211 |
| 854 | 3300048909 | Ga0496106_0081744 | Ga0496106_0081744_28_663 | 211 |
| 855 | 3300048910 | Ga0496107_0021694 | Ga0496107_0021694_899_1534 | 211 |
| 856 | 3300048910 | Ga0496107_0067426 | Ga0496107_0067426_1789_2436 | 211 |
| 857 | 3300048911 | Ga0496108_0019587 | Ga0496108_0019587_378_1013 | 211 |
| 858 | 3300048911 | Ga0496108_0321395 | Ga0496108_0321395_526_1161 | 211 |
| 859 | 3300048912 | Ga0496109_0019713 | Ga0496109_0019713_984_1631 | 211 |
| 860 | 3300048912 | Ga0496109_0264746 | Ga0496109_0264746_279_914 | 211 |
| 861 | 3300048912 | Ga0496109_0477369 | Ga0496109_0477369_390_1025 | 211 |
| 862 | 3300048913 | Ga0496110_0092598 | Ga0496110_0092598_344_979 | 211 |
| 863 | 3300048913 | Ga0496110_0160414 | Ga0496110_0160414_1105_1740 | 211 |
| 864 | 3300048915 | Ga0496112_0005376 | Ga0496112_0005376_4586_5233 | 211 |
| 865 | 3300048916 | Ga0496113_0301136 | Ga0496113_0301136_564_1208 | 211 |
| 866 | 3300048916 | Ga0496113_0550787 | Ga0496113_0550787_271_906 | 211 |
| 867 | 3300048917 | Ga0496114_0120452 | Ga0496114_0120452_1293_1928 | 211 |
| 868 | 3300048917 | Ga0496114_0187330 | Ga0496114_0187330_765_1415 | 211 |
| 869 | 3300048917 | Ga0496114_0250926 | Ga0496114_0250926_217_852 | 211 |
| 870 | 3300048917 | Ga0496114_0627911 | Ga0496114_0627911_116_751 | 211 |
| 871 | 3300048918 | Ga0496115_0047387 | Ga0496115_0047387_1462_2109 | 211 |
| 872 | 3300049571 | Ga0501034_0000456 | Ga0501034_0000456_62035_62673 | 211 |
| 873 | 3300049572 | Ga0501036_0339697 | Ga0501036_0339697_430_1101 | 211 |
| 874 | 3300049575 | Ga0501039_0374436 | Ga0501039_0374436_201_839 | 211 |
| 875 | 3300049584 | Ga0501068_0000960 | Ga0501068_0000960_3663_4301 | 211 |
| 876 | 3300049586 | Ga0501070_0225770 | Ga0501070_0225770_605_1243 | 211 |
| 877 | 3300049588 | Ga0501072_0003561 | Ga0501072_0003561_607_1245 | 211 |
| 878 | 3300049589 | Ga0501073_0001375 | Ga0501073_0001375_6180_6818 | 211 |
| 879 | 3300049593 | Ga0501077_0190580 | Ga0501077_0190580_634_1272 | 211 |
| 880 | 3300049742 | Ga0501080_0001249 | Ga0501080_0001249_8106_8744 | 211 |
| 881 | 3300049742 | Ga0501080_0721341 | Ga0501080_0721341_197_835 | 211 |
| 882 | 3300049744 | Ga0501083_0209491 | Ga0501083_0209491_409_1047 | 211 |
| 883 | 3300049823 | Ga0501044_0440135 | Ga0501044_0440135_505_1176 | 211 |
| 884 | 3300050493 | nmdc:mga0k408_8363_c1 | nmdc:mga0k408_8363_c1_4572_5210 | 211 |
| 885 | 3300050507 | nmdc:mga05p37_46494_c1 | nmdc:mga05p37_46494_c1_556_1200 | 211 |
| 886 | 3300050508 | nmdc:mga09592_26270_c1 | nmdc:mga09592_26270_c1_3713_4357 | 211 |
| 887 | 3300050511 | nmdc:mga08y16_105543_c1 | nmdc:mga08y16_105543_c1_641_1285 | 211 |
| 888 | 3300050511 | nmdc:mga08y16_51927_c1 | nmdc:mga08y16_51927_c1_3080_3715 | 211 |
| 889 | 3300050512 | nmdc:mga0n895_346972_c1 | nmdc:mga0n895_346972_c1_383_1018 | 211 |
| 890 | 3300050512 | nmdc:mga0n895_459037_c1 | nmdc:mga0n895_459037_c1_290_937 | 211 |
| 891 | 3300050512 | nmdc:mga0n895_634708_c1 | nmdc:mga0n895_634708_c1_83_718 | 211 |
| 892 | 3300050513 | nmdc:mga0rr50_400513_c1 | nmdc:mga0rr50_400513_c1_102_737 | 211 |
| 893 | 3300053077 | Ga0495601_0073833 | Ga0495601_0073833_502_1152 | 211 |
| 894 | 3300053084 | Ga0495595_0182127 | Ga0495595_0182127_140_775 | 211 |
| 895 | 3300053085 | Ga0495619_0400538 | Ga0495619_0400538_24_659 | 211 |
| 896 | 3300054114 | Ga0501084_0156004 | Ga0501084_0156004_1252_1890 | 211 |
| 897 | 3300060353 | Ga0501082_0044702 | Ga0501082_0044702_296_934 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m3m-assembly1.cif.gz_A | crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] | 0.9471 | 2 | 196 |
| 3m8n-assembly2.cif.gz_D | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.9372 | 4 | 198 |
| 3m8n-assembly2.cif.gz_C | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.9366 | 2 | 198 |
| 3m8n-assembly1.cif.gz_A | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.9363 | 2 | 198 |
| 4f0c-assembly1.cif.gz_A-2 | crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium | 0.9359 | 1 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54JU2_4_83_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9708 | 4 | 81 | 3.40.30.10 |
| 4pxoB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9641 | 7 | 75 | 3.40.30.10 |
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9639 | 7 | 80 | 3.40.30.10 |
| af_B8A514_42_123_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9584 | 2 | 77 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9581 | 4 | 79 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536ZHK8-F1-model_v4 | Glutathione S-transferase | 0.9943 | 1 | 208 |
GO:0016740
|
| AF-A0A537C7K6-F1-model_v4 | Glutathione S-transferase family protein | 0.9887 | 1 | 211 |
GO:0016740
|
| AF-A0A2Z2NWW5-F1-model_v4 | Glutathione S-transferase GST-4.5 (EC 2.5.1.18) | 0.9818 | 21 | 207 |
GO:0004364
|
| AF-A0A3N5HRF6-F1-model_v4 | Glutathione S-transferase | 0.9812 | 1 | 175 |
GO:0016740
|
| AF-A0A3C1AKK6-F1-model_v4 | deleted | 0.9802 | 1 | 203 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar