F485041

General Info

Members Datasets Scaffolds Average Seq Length
897 328 891 212

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100153127|Ga0075434_1001531273
Length 233
Sequence VVAAAATAAVRVTSTKQPMAAEHTLYCFAQSGNAYKAALMLAVTGSSWAPRFVDYFGGETRTPEYRVINVMGEVPVLEHEGRRLTQSGVILDYLAEKTGQFGPANGEERRDILRWLFFDNHKLTSYTATYRFMRTFVSAPNPAVMEEFRKRAETAWRVLDAHLDGRRSVVGERLTIADLSLVGYLFFDDEIGVDWNDYPHLRDWLARIRALPGWAHPYDLMPGHPLPAKDAAK

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2765235841 Pseudomonas putida AA7 Isolate Unclassified
4 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
243 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
251 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
252 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
253 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
254 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
255 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
292 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
303 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
304 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
305 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
306 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
307 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
328 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.11
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0.11
Rhizoplane 5.02
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10012326 3300001991 Bacteria 1554
2 JGI24749J21850_1023695 3300002076 Bacteria 872
3 JGI24034J26672_10048157 3300002239 Bacteria 728
4 JGI24742J22300_10057369 3300002244 Bacteria 712
5 rootH1_10003216 3300003316 Bacteria 15917
6 rootL2_10002048 3300003322 Bacteria 12254
7 Ga0065712_10006136 3300005290 Bacteria 3721
8 Ga0065715_10139235 3300005293 Unclassified 1879
9 Ga0065715_10446243 3300005293 Bacteria 809
10 Ga0070658_10019632 3300005327 Bacteria 5411
11 Ga0070658_10218595 3300005327 Bacteria 1611
12 Ga0070658_10410322 3300005327 Bacteria 1164
13 Ga0070676_10000712 3300005328 Bacteria 16253
14 Ga0070676_10010963 3300005328 Bacteria 4924
15 Ga0070676_10082019 3300005328 Bacteria 1958
16 Ga0070676_10398702 3300005328 Bacteria 957
17 Ga0070683_100010112 3300005329 Bacteria 8094
18 Ga0070683_100285637 3300005329 Bacteria 1570
19 Ga0070683_100375282 3300005329 Unclassified 1355
20 Ga0070690_100001392 3300005330 Bacteria 12605
21 Ga0070690_100003483 3300005330 Bacteria 8610
22 Ga0070690_100018815 3300005330 Bacteria 4180
23 Ga0070690_100145969 3300005330 Bacteria 1610
24 Ga0070690_100448582 3300005330 Bacteria 956
25 Ga0070670_100028486 3300005331 Bacteria 4807
26 Ga0070670_100046953 3300005331 Bacteria 3715
27 Ga0070670_100059340 3300005331 Bacteria 3284
28 Ga0070670_100103130 3300005331 Bacteria 2457
29 Ga0070670_100151800 3300005331 Bacteria 2005
30 Ga0070670_100205984 3300005331 Bacteria 1710
31 Ga0070670_100269697 3300005331 Bacteria 1485
32 Ga0070677_10030637 3300005333 Bacteria 2049
33 Ga0068869_100000631 3300005334 Bacteria 19900
34 Ga0068869_100001258 3300005334 Bacteria 14962
35 Ga0068869_100008561 3300005334 Bacteria 6604
36 Ga0068869_100210289 3300005334 Bacteria 1537
37 Ga0068869_100274296 3300005334 Bacteria 1354
38 Ga0070666_10001286 3300005335 Bacteria 15184
39 Ga0070666_10013719 3300005335 Bacteria 5144
40 Ga0070680_100599651 3300005336 Unclassified 945
41 Ga0070682_100015068 3300005337 Bacteria 4476
42 Ga0070682_100405908 3300005337 Unclassified 1032
43 Ga0070682_100461479 3300005337 Bacteria 975
44 Ga0068868_100001544 3300005338 Bacteria 15719
45 Ga0068868_100002946 3300005338 Bacteria 11816
46 Ga0068868_100281599 3300005338 Bacteria 1407
47 Ga0068868_100479627 3300005338 Bacteria 1086
48 Ga0070660_100003674 3300005339 Bacteria 10596
49 Ga0070660_100027048 3300005339 Bacteria 4278
50 Ga0070660_100040566 3300005339 Bacteria 3543
51 Ga0070689_100000781 3300005340 Bacteria 19535
52 Ga0070689_100003108 3300005340 Bacteria 10962
53 Ga0070689_100005522 3300005340 Bacteria 8646
54 Ga0070689_100042402 3300005340 Bacteria 3494
55 Ga0070689_100081017 3300005340 Bacteria 2548
56 Ga0070691_10035517 3300005341 Bacteria 2347
57 Ga0070687_100009949 3300005343 Bacteria 4091
58 Ga0070687_100028147 3300005343 Bacteria 2723
59 Ga0070687_100265424 3300005343 Bacteria 1073
60 Ga0070661_100009592 3300005344 Bacteria 6705
61 Ga0070661_100032273 3300005344 Bacteria 3790
62 Ga0070661_100047425 3300005344 Bacteria 3144
63 Ga0070661_100068496 3300005344 Bacteria 2608
64 Ga0070661_100119601 3300005344 Bacteria 1972
65 Ga0070661_100184529 3300005344 Bacteria 1589
66 Ga0070661_100210364 3300005344 Bacteria 1489
67 Ga0070661_100676822 3300005344 Bacteria 839
68 Ga0070692_10010969 3300005345 Bacteria 4147
69 Ga0070692_10077601 3300005345 Bacteria 1782
70 Ga0070668_100001957 3300005347 Bacteria 15024
71 Ga0070668_100005291 3300005347 Bacteria 9575
72 Ga0070668_100065413 3300005347 Bacteria 2820
73 Ga0070668_100130810 3300005347 Bacteria 2014
74 Ga0070668_100427380 3300005347 Unclassified 1135
75 Ga0070669_100001265 3300005353 Bacteria 18326
76 Ga0070669_100078882 3300005353 Bacteria 2448
77 Ga0070669_100082815 3300005353 Bacteria 2392
78 Ga0070675_100018807 3300005354 Bacteria 5499
79 Ga0070675_100133188 3300005354 Bacteria 2120
80 Ga0070675_100182643 3300005354 Bacteria 1814
81 Ga0070675_100242682 3300005354 Bacteria 1574
82 Ga0070675_100510249 3300005354 Unclassified 1084
83 Ga0070675_100524603 3300005354 Bacteria 1069
84 Ga0070671_100012552 3300005355 Bacteria 6822
85 Ga0070671_100018529 3300005355 Bacteria 5655
86 Ga0070671_100023505 3300005355 Bacteria 5045
87 Ga0070671_100122018 3300005355 Bacteria 2193
88 Ga0070671_100126289 3300005355 Bacteria 2153
89 Ga0070671_100355246 3300005355 Bacteria 1251
90 Ga0070674_100071357 3300005356 Bacteria 2456
91 Ga0070674_100197260 3300005356 Bacteria 1552
92 Ga0070674_100229909 3300005356 Bacteria 1447
93 Ga0070674_100341933 3300005356 Bacteria 1206
94 Ga0070673_100012387 3300005364 Bacteria 5853
95 Ga0070673_100956517 3300005364 Unclassified 796
96 Ga0070688_100018907 3300005365 Bacteria 3984
97 Ga0070688_100049737 3300005365 Bacteria 2609
98 Ga0070688_100287089 3300005365 Bacteria 1184
99 Ga0070688_100808024 3300005365 Unclassified 734
100 Ga0070659_100000738 3300005366 Bacteria 23779
101 Ga0070659_100001702 3300005366 Bacteria 15803
102 Ga0070659_100068711 3300005366 Bacteria 2811
103 Ga0070659_100124765 3300005366 Bacteria 2089
104 Ga0070659_100498199 3300005366 Bacteria 1038
105 Ga0070659_100803268 3300005366 Unclassified 818
106 Ga0070667_100000537 3300005367 Bacteria 37823
107 Ga0070667_100001294 3300005367 Bacteria 22631
108 Ga0070667_100006565 3300005367 Bacteria 9669
109 Ga0070667_100188580 3300005367 Bacteria 1826
110 Ga0070709_10001554 3300005434 Bacteria 12384
111 Ga0070709_10023418 3300005434 Bacteria 3626
112 Ga0070709_10126273 3300005434 Bacteria 1741
113 Ga0070709_10727809 3300005434 Bacteria 774
114 Ga0070714_100011182 3300005435 Bacteria 7116
115 Ga0070714_100241805 3300005435 Bacteria 1666
116 Ga0070714_100571301 3300005435 Bacteria 1084
117 Ga0070713_100000093 3300005436 Bacteria 57164
118 Ga0070713_100022947 3300005436 Bacteria 4831
119 Ga0070713_100073880 3300005436 Bacteria 2887
120 Ga0070710_10002620 3300005437 Bacteria 8549
121 Ga0070710_10033776 3300005437 Bacteria 2780
122 Ga0070710_10164745 3300005437 Bacteria 1377
123 Ga0070701_10000512 3300005438 Bacteria 13327
124 Ga0070701_10004791 3300005438 Bacteria 5530
125 Ga0070701_10170488 3300005438 Bacteria 1267
126 Ga0070701_10269498 3300005438 Bacteria 1035
127 Ga0070711_100015980 3300005439 Bacteria 4758
128 Ga0070711_100043941 3300005439 Bacteria 3030
129 Ga0070705_100050350 3300005440 Unclassified 2423
130 Ga0070700_100000680 3300005441 Bacteria 16817
131 Ga0070700_100002925 3300005441 Bacteria 8758
132 Ga0070700_100061027 3300005441 Bacteria 2378
133 Ga0070700_100077251 3300005441 Bacteria 2140
134 Ga0070694_100060463 3300005444 Bacteria 2584
135 Ga0070694_100279301 3300005444 Bacteria 1273
136 Ga0070708_100000235 3300005445 Bacteria 41417
137 Ga0070708_100132795 3300005445 Bacteria 2305
138 Ga0070708_100234089 3300005445 Bacteria 1724
139 Ga0070663_100006029 3300005455 Bacteria 7256
140 Ga0070663_100007958 3300005455 Bacteria 6495
141 Ga0070663_100026121 3300005455 Bacteria 3951
142 Ga0070663_100089174 3300005455 Bacteria 2282
143 Ga0070663_100214383 3300005455 Bacteria 1509
144 Ga0070678_100000115 3300005456 Bacteria 31495
145 Ga0070678_100011176 3300005456 Bacteria 5528
146 Ga0070678_100205014 3300005456 Bacteria 1630
147 Ga0070678_100376935 3300005456 Bacteria 1226
148 Ga0070678_100424961 3300005456 Bacteria 1159
149 Ga0070662_100001899 3300005457 Bacteria 12825
150 Ga0070662_100075514 3300005457 Bacteria 2496
151 Ga0070662_100109767 3300005457 Bacteria 2100
152 Ga0070662_100398670 3300005457 Bacteria 1135
153 Ga0070662_100488439 3300005457 Bacteria 1026
154 Ga0070681_10159048 3300005458 Bacteria 2183
155 Ga0068867_100002089 3300005459 Bacteria 14000
156 Ga0068867_100002384 3300005459 Bacteria 13215
157 Ga0068867_100011849 3300005459 Bacteria 6159
158 Ga0068867_100017076 3300005459 Bacteria 5156
159 Ga0068867_100352997 3300005459 Bacteria 1228
160 Ga0068867_100423508 3300005459 Bacteria 1128
161 Ga0070685_10000280 3300005466 Bacteria 32659
162 Ga0070685_10004000 3300005466 Bacteria 7446
163 Ga0070706_100003250 3300005467 Bacteria 16066
164 Ga0070698_100038927 3300005471 Bacteria 4898
165 Ga0070698_100457357 3300005471 Bacteria 1212
166 Ga0070699_100021973 3300005518 Bacteria 5497
167 Ga0070679_100319854 3300005530 Bacteria 1501
168 Ga0070684_100127045 3300005535 Bacteria 2297
169 Ga0070684_101079181 3300005535 Unclassified 754
170 Ga0068853_100004240 3300005539 Bacteria 11071
171 Ga0068853_100024944 3300005539 Bacteria 5017
172 Ga0068853_100100019 3300005539 Bacteria 2562
173 Ga0068853_100172200 3300005539 Bacteria 1959
174 Ga0068853_100216891 3300005539 Bacteria 1746
175 Ga0068853_100305750 3300005539 Bacteria 1471
176 Ga0068853_100810180 3300005539 Bacteria 897
177 Ga0070672_100000912 3300005543 Bacteria 17711
178 Ga0070672_100025764 3300005543 Bacteria 4368
179 Ga0070672_100031779 3300005543 Bacteria 3977
180 Ga0070672_100150637 3300005543 Bacteria 1924
181 Ga0070686_100000973 3300005544 Bacteria 16512
182 Ga0070686_100052252 3300005544 Unclassified 2605
183 Ga0070686_100059674 3300005544 Bacteria 2458
184 Ga0070686_100207589 3300005544 Bacteria 1408
185 Ga0070695_100393133 3300005545 Bacteria 1049
186 Ga0070696_100014415 3300005546 Bacteria 5301
187 Ga0070696_100023215 3300005546 Bacteria 4215
188 Ga0070696_100192159 3300005546 Bacteria 1520
189 Ga0070693_100204317 3300005547 Bacteria 1285
190 Ga0070665_100010968 3300005548 Bacteria 9164
191 Ga0070665_100022112 3300005548 Bacteria 6397
192 Ga0070665_100258975 3300005548 Bacteria 1741
193 Ga0070665_100276442 3300005548 Unclassified 1681
194 Ga0070704_100013168 3300005549 Bacteria 5125
195 Ga0070704_100110206 3300005549 Bacteria 2093
196 Ga0070704_100176187 3300005549 Bacteria 1706
197 Ga0070704_100605632 3300005549 Bacteria 963
198 Ga0068855_100001097 3300005563 Bacteria 33624
199 Ga0068855_100023399 3300005563 Bacteria 7399
200 Ga0068855_100440046 3300005563 Bacteria 1424
201 Ga0070664_100003001 3300005564 Bacteria 13649
202 Ga0070664_100010765 3300005564 Bacteria 7416
203 Ga0070664_100028505 3300005564 Bacteria 4645
204 Ga0070664_100062529 3300005564 Bacteria 3174
205 Ga0070664_100151426 3300005564 Bacteria 2048
206 Ga0068857_100001800 3300005577 Bacteria 17243
207 Ga0068857_100121668 3300005577 Bacteria 2350
208 Ga0068857_100385254 3300005577 Bacteria 1302
209 Ga0068854_100023280 3300005578 Bacteria 4229
210 Ga0068854_100049838 3300005578 Bacteria 2994
211 Ga0068854_100587588 3300005578 Bacteria 949
212 Ga0068856_100003602 3300005614 Bacteria 15590
213 Ga0068856_100004835 3300005614 Bacteria 13357
214 Ga0068856_100035198 3300005614 Bacteria 4906
215 Ga0068856_100066958 3300005614 Bacteria 3549
216 Ga0068856_100139215 3300005614 Bacteria 2434
217 Ga0070702_100001461 3300005615 Bacteria 9684
218 Ga0070702_100002888 3300005615 Bacteria 7553
219 Ga0070702_100067716 3300005615 Bacteria 2099
220 Ga0070702_100068538 3300005615 Bacteria 2088
221 Ga0070702_100094931 3300005615 Bacteria 1817
222 Ga0070702_100231428 3300005615 Bacteria 1242
223 Ga0070702_100673200 3300005615 Unclassified 785
224 Ga0068852_100023710 3300005616 Bacteria 4945
225 Ga0068852_100125206 3300005616 Bacteria 2359
226 Ga0068852_100135834 3300005616 Bacteria 2270
227 Ga0068852_100322172 3300005616 Bacteria 1501
228 Ga0068859_100000548 3300005617 Bacteria 37251
229 Ga0068859_100003142 3300005617 Bacteria 16795
230 Ga0068859_100007100 3300005617 Bacteria 11368
231 Ga0068859_100024433 3300005617 Bacteria 6062
232 Ga0068859_100050112 3300005617 Bacteria 4194
233 Ga0068859_100217700 3300005617 Bacteria 1997
234 Ga0068859_101148230 3300005617 Bacteria 855
235 Ga0068864_100000759 3300005618 Bacteria 27157
236 Ga0068864_100004336 3300005618 Bacteria 11650
237 Ga0068864_100006912 3300005618 Bacteria 9305
238 Ga0068864_100013541 3300005618 Bacteria 6762
239 Ga0068864_100086324 3300005618 Bacteria 2760
240 Ga0068864_100125126 3300005618 Bacteria 2303
241 Ga0068864_100517332 3300005618 Bacteria 1150
242 Ga0068866_10000632 3300005718 Bacteria 15998
243 Ga0068866_10003761 3300005718 Bacteria 6218
244 Ga0068866_10032069 3300005718 Bacteria 2537
245 Ga0068866_10295129 3300005718 Bacteria 1010
246 Ga0068861_100001692 3300005719 Bacteria 14152
247 Ga0068861_100004985 3300005719 Bacteria 8946
248 Ga0068861_100005833 3300005719 Bacteria 8361
249 Ga0068861_100074737 3300005719 Unclassified 2636
250 Ga0068861_100077602 3300005719 Bacteria 2591
251 Ga0068861_100497862 3300005719 Bacteria 1101
252 Ga0068861_100581050 3300005719 Bacteria 1025
253 Ga0068851_10001169 3300005834 Bacteria 11384
254 Ga0068851_10004676 3300005834 Bacteria 6186
255 Ga0068851_10037191 3300005834 Bacteria 2440
256 Ga0068851_10055432 3300005834 Bacteria 2019
257 Ga0068851_10123578 3300005834 Bacteria 1393
258 Ga0068870_10010668 3300005840 Bacteria 4228
259 Ga0068870_10022434 3300005840 Bacteria 3102
260 Ga0068870_10089571 3300005840 Bacteria 1717
261 Ga0068870_10157105 3300005840 Bacteria 1345
262 Ga0068863_100001304 3300005841 Bacteria 24887
263 Ga0068863_100002477 3300005841 Bacteria 18351
264 Ga0068863_100003845 3300005841 Bacteria 14849
265 Ga0068863_100031144 3300005841 Bacteria 5093
266 Ga0068863_100069978 3300005841 Bacteria 3318
267 Ga0068863_100234342 3300005841 Bacteria 1771
268 Ga0068863_100472998 3300005841 Bacteria 1232
269 Ga0068858_100000652 3300005842 Bacteria 36211
270 Ga0068858_100006770 3300005842 Bacteria 11150
271 Ga0068858_100030416 3300005842 Bacteria 5013
272 Ga0068858_100038945 3300005842 Bacteria 4409
273 Ga0068858_100133876 3300005842 Bacteria 2325
274 Ga0068860_100004322 3300005843 Bacteria 14523
275 Ga0068860_100020811 3300005843 Bacteria 6356
276 Ga0068860_100040991 3300005843 Bacteria 4424
277 Ga0068860_100239423 3300005843 Bacteria 1765
278 Ga0068860_100358405 3300005843 Bacteria 1436
279 Ga0068860_100428198 3300005843 Bacteria 1313
280 Ga0068862_100002384 3300005844 Bacteria 16717
281 Ga0068862_100003241 3300005844 Bacteria 14082
282 Ga0068862_100042079 3300005844 Bacteria 3890
283 Ga0068862_100076173 3300005844 Unclassified 2903
284 Ga0068862_100271715 3300005844 Bacteria 1550
285 Ga0068862_100308854 3300005844 Bacteria 1457
286 Ga0068862_100618267 3300005844 Bacteria 1042
287 Ga0068862_100978901 3300005844 Unclassified 835
288 Ga0081540_1013533 3300005983 Bacteria 5298
289 Ga0081539_10027713 3300005985 Bacteria 3581
290 Ga0075363_100443198 3300006048 Bacteria 766
291 Ga0070715_10000885 3300006163 Bacteria 8298
292 Ga0070712_100005914 3300006175 Bacteria 7569
293 Ga0070712_100038639 3300006175 Bacteria 3263
294 Ga0075366_10029069 3300006195 Bacteria 3246
295 Ga0075366_10088002 3300006195 Bacteria 1860
296 Ga0097621_100002419 3300006237 Bacteria 12782
297 Ga0097621_100002825 3300006237 Bacteria 11902
298 Ga0097621_100020672 3300006237 Bacteria 5076
299 Ga0097621_100265158 3300006237 Bacteria 1508
300 Ga0075370_10173486 3300006353 Bacteria 1268
301 Ga0068871_100001447 3300006358 Bacteria 15879
302 Ga0068871_100005154 3300006358 Bacteria 9137
303 Ga0068871_100108277 3300006358 Bacteria 2335
304 Ga0068871_100183402 3300006358 Bacteria 1800
305 Ga0068871_100441896 3300006358 Bacteria 1164
306 Ga0075428_100002872 3300006844 Bacteria 18789
307 Ga0075428_100063847 3300006844 Bacteria 4032
308 Ga0075431_100001468 3300006847 Bacteria 21760
309 Ga0075434_100056642 3300006871 Bacteria 3896
310 Ga0075434_100153127 3300006871 Bacteria 2326
311 Ga0075434_100159143 3300006871 Unclassified 2278
312 Ga0075434_100360468 3300006871 Bacteria 1475
313 Ga0075434_100578741 3300006871 Bacteria 1142
314 Ga0075429_100030854 3300006880 Bacteria 4658
315 Ga0075429_100093494 3300006880 Bacteria 2622
316 Ga0068865_100000305 3300006881 Bacteria 27101
317 Ga0068865_100006566 3300006881 Bacteria 7110
318 Ga0068865_100053296 3300006881 Bacteria 2806
319 Ga0068865_100085032 3300006881 Bacteria 2281
320 Ga0068865_100096792 3300006881 Bacteria 2153
321 Ga0097620_100000548 3300006931 Bacteria 37251
322 Ga0097620_100003142 3300006931 Bacteria 16795
323 Ga0097620_100007100 3300006931 Bacteria 11368
324 Ga0097620_100024433 3300006931 Bacteria 6062
325 Ga0097620_100050112 3300006931 Bacteria 4194
326 Ga0097620_100217712 3300006931 Bacteria 1997
327 Ga0097620_101148334 3300006931 Bacteria 855
328 Ga0105251_10008897 3300009011 Bacteria 6010
329 Ga0105240_10014974 3300009093 Bacteria 10566
330 Ga0105240_10108406 3300009093 Bacteria 3365
331 Ga0105240_10174218 3300009093 Bacteria 2545
332 Ga0111539_10003134 3300009094 Bacteria 21872
333 Ga0111539_10028863 3300009094 Bacteria 6766
334 Ga0111539_10166724 3300009094 Bacteria 2575
335 Ga0111539_10192785 3300009094 Bacteria 2377
336 Ga0111539_11200814 3300009094 Bacteria 881
337 Ga0105245_10008300 3300009098 Bacteria 9072
338 Ga0105245_10950510 3300009098 Bacteria 902
339 Ga0105247_10010870 3300009101 Bacteria 5499
340 Ga0105247_10042203 3300009101 Bacteria 2793
341 Ga0114129_10001566 3300009147 Bacteria 31036
342 Ga0114129_10103578 3300009147 Bacteria 3935
343 Ga0114129_10988474 3300009147 Bacteria 1060
344 Ga0114129_11331391 3300009147 Bacteria 889
345 Ga0105243_10004538 3300009148 Bacteria 10971
346 Ga0105241_10006534 3300009174 Bacteria 8593
347 Ga0105241_10371043 3300009174 Bacteria 1248
348 Ga0105242_10029601 3300009176 Bacteria 4368
349 Ga0105242_10079223 3300009176 Bacteria 2744
350 Ga0105242_10148426 3300009176 Bacteria 2042
351 Ga0105242_10688935 3300009176 Bacteria 998
352 Ga0105248_10009060 3300009177 Bacteria 10946
353 Ga0105248_10030473 3300009177 Bacteria 6023
354 Ga0105248_10034915 3300009177 Bacteria 5627
355 Ga0105248_10130909 3300009177 Bacteria 2830
356 Ga0105248_10131205 3300009177 Bacteria 2827
357 Ga0105248_10315236 3300009177 Bacteria 1762
358 Ga0105237_10204634 3300009545 Bacteria 1974
359 Ga0105237_10251426 3300009545 Bacteria 1770
360 Ga0105237_10512691 3300009545 Bacteria 1206
361 Ga0105237_11121596 3300009545 Bacteria 793
362 Ga0105238_10007180 3300009551 Bacteria 11142
363 Ga0105238_10071679 3300009551 Bacteria 3462
364 Ga0105249_10009105 3300009553 Bacteria 8683
365 Ga0105249_10092530 3300009553 Unclassified 2831
366 Ga0105249_10232227 3300009553 Bacteria 1820
367 Ga0105249_10300942 3300009553 Bacteria 1609
368 Ga0105249_11021939 3300009553 Unclassified 896
369 Ga0105239_10021898 3300010375 Bacteria 7046
370 Ga0105239_10058956 3300010375 Bacteria 4214
371 Ga0105239_10119122 3300010375 Bacteria 2930
372 Ga0105239_10535735 3300010375 Bacteria 1333
373 Ga0105246_10065155 3300011119 Bacteria 2547
374 Ga0105246_10752466 3300011119 Bacteria 860
375 Ga0157373_10005110 3300013100 Bacteria 9862
376 Ga0157373_10064475 3300013100 Bacteria 2593
377 Ga0157373_10269897 3300013100 Bacteria 1204
378 Ga0157371_10000330 3300013102 Bacteria 61144
379 Ga0157371_10132508 3300013102 Unclassified 1774
380 Ga0157371_10634718 3300013102 Bacteria 796
381 Ga0157370_10027517 3300013104 Bacteria 5606
382 Ga0157370_10063967 3300013104 Bacteria 3483
383 Ga0157369_10017713 3300013105 Bacteria 8000
384 Ga0157369_10161662 3300013105 Bacteria 2364
385 Ga0157369_10232934 3300013105 Bacteria 1925
386 Ga0157369_10366923 3300013105 Bacteria 1495
387 Ga0157369_10496390 3300013105 Bacteria 1263
388 Ga0157374_10000286 3300013296 Bacteria 46853
389 Ga0157374_10002810 3300013296 Bacteria 14607
390 Ga0157374_10040877 3300013296 Bacteria 4271
391 Ga0157374_10158128 3300013296 Bacteria 2206
392 Ga0157374_10236500 3300013296 Bacteria 1795
393 Ga0157374_11005309 3300013296 Bacteria 853
394 Ga0157378_10001140 3300013297 Bacteria 24155
395 Ga0157378_10056612 3300013297 Bacteria 3494
396 Ga0157378_10076042 3300013297 Bacteria 3024
397 Ga0157378_10079153 3300013297 Bacteria 2967
398 Ga0157378_10119157 3300013297 Bacteria 2431
399 Ga0157378_10123996 3300013297 Bacteria 2385
400 Ga0157378_10143688 3300013297 Bacteria 2218
401 Ga0163162_10003799 3300013306 Bacteria 14485
402 Ga0163162_10158951 3300013306 Bacteria 2381
403 Ga0163162_10161614 3300013306 Bacteria 2362
404 Ga0163162_10295960 3300013306 Bacteria 1750
405 Ga0163162_11007096 3300013306 Bacteria 942
406 Ga0163162_11186080 3300013306 Bacteria 866
407 Ga0163162_12018871 3300013306 Bacteria 661
408 Ga0157372_10018145 3300013307 Bacteria 7565
409 Ga0157372_10203107 3300013307 Bacteria 2296
410 Ga0157372_10247440 3300013307 Bacteria 2069
411 Ga0157372_10476525 3300013307 Bacteria 1455
412 Ga0157375_10029021 3300013308 Bacteria 5196
413 Ga0157375_10038446 3300013308 Bacteria 4595
414 Ga0157375_10061001 3300013308 Bacteria 3742
415 Ga0157375_10419192 3300013308 Bacteria 1505
416 Ga0157375_10872079 3300013308 Bacteria 1045
417 Ga0163163_10022213 3300014325 Bacteria 6003
418 Ga0163163_10035753 3300014325 Bacteria 4821
419 Ga0163163_10128168 3300014325 Bacteria 2576
420 Ga0163163_10357665 3300014325 Bacteria 1516
421 Ga0157380_10000449 3300014326 Bacteria 25167
422 Ga0157380_10040064 3300014326 Bacteria 3646
423 Ga0157380_10066986 3300014326 Bacteria 2890
424 Ga0157380_10231317 3300014326 Bacteria 1660
425 Ga0182008_10267819 3300014497 Bacteria 885
426 Ga0157377_10214265 3300014745 Bacteria 1230
427 Ga0157379_10020080 3300014968 Bacteria 5905
428 Ga0157379_10034811 3300014968 Bacteria 4491
429 Ga0157379_10373771 3300014968 Bacteria 1307
430 Ga0157379_11163853 3300014968 Unclassified 741
431 Ga0157376_10008963 3300014969 Bacteria 7245
432 Ga0157376_10136242 3300014969 Bacteria 2197
433 Ga0157376_11057459 3300014969 Bacteria 836
434 Ga0163161_10021490 3300017792 Bacteria 4534
435 Ga0163161_10067580 3300017792 Bacteria 2610
436 Ga0163161_10214259 3300017792 Unclassified 1489
437 Ga0206354_11167538 3300020081 Bacteria 1647
438 Ga0207697_10018755 3300025315 Bacteria 2835
439 Ga0207656_10004890 3300025321 Bacteria 4702
440 Ga0207656_10018064 3300025321 Bacteria 2770
441 Ga0207656_10173677 3300025321 Bacteria 1031
442 Ga0207656_10256049 3300025321 Bacteria 858
443 Ga0207656_10264257 3300025321 Bacteria 846
444 Ga0207713_1024027 3300025735 Bacteria 2851
445 Ga0207682_10001309 3300025893 Bacteria 11440
446 Ga0207692_10119800 3300025898 Bacteria 1472
447 Ga0207692_10148269 3300025898 Bacteria 1341
448 Ga0207642_10000855 3300025899 Bacteria 9475
449 Ga0207642_10149201 3300025899 Bacteria 1242
450 Ga0207710_10019811 3300025900 Bacteria 2872
451 Ga0207710_10261838 3300025900 Bacteria 867
452 Ga0207688_10000064 3300025901 Bacteria 38683
453 Ga0207680_10002662 3300025903 Bacteria 8352
454 Ga0207680_10008244 3300025903 Bacteria 5108
455 Ga0207680_10144850 3300025903 Bacteria 1578
456 Ga0207699_10022518 3300025906 Bacteria 3415
457 Ga0207699_10082855 3300025906 Bacteria 1993
458 Ga0207699_10106843 3300025906 Bacteria 1787
459 Ga0207699_10511103 3300025906 Bacteria 868
460 Ga0207645_10000517 3300025907 Bacteria 32075
461 Ga0207645_10004266 3300025907 Bacteria 10610
462 Ga0207645_10014722 3300025907 Bacteria 5222
463 Ga0207645_10270136 3300025907 Bacteria 1127
464 Ga0207645_10370344 3300025907 Bacteria 960
465 Ga0207643_10000593 3300025908 Bacteria 22972
466 Ga0207643_10034526 3300025908 Bacteria 2834
467 Ga0207643_10037936 3300025908 Bacteria 2705
468 Ga0207643_10061840 3300025908 Bacteria 2139
469 Ga0207643_10079348 3300025908 Bacteria 1900
470 Ga0207705_10065087 3300025909 Bacteria 2635
471 Ga0207705_10290055 3300025909 Bacteria 1254
472 Ga0207684_10020548 3300025910 Bacteria 5642
473 Ga0207654_10012461 3300025911 Bacteria 4357
474 Ga0207707_10001948 3300025912 Bacteria 18787
475 Ga0207707_10177929 3300025912 Bacteria 1858
476 Ga0207695_10006723 3300025913 Bacteria 14842
477 Ga0207695_10191046 3300025913 Bacteria 1965
478 Ga0207671_10139784 3300025914 Bacteria 1865
479 Ga0207671_10330991 3300025914 Bacteria 1206
480 Ga0207693_10003485 3300025915 Bacteria 13422
481 Ga0207693_10043597 3300025915 Bacteria 3528
482 Ga0207663_10013001 3300025916 Bacteria 4514
483 Ga0207660_10007884 3300025917 Bacteria 6892
484 Ga0207662_10004084 3300025918 Bacteria 7627
485 Ga0207662_10022451 3300025918 Bacteria 3619
486 Ga0207662_10046069 3300025918 Bacteria 2579
487 Ga0207657_10000745 3300025919 Bacteria 34547
488 Ga0207657_10000927 3300025919 Bacteria 31004
489 Ga0207657_10033548 3300025919 Bacteria 4626
490 Ga0207657_10061986 3300025919 Bacteria 3203
491 Ga0207649_10046725 3300025920 Bacteria 2661
492 Ga0207649_10063546 3300025920 Bacteria 2331
493 Ga0207649_10131544 3300025920 Bacteria 1700
494 Ga0207649_10235537 3300025920 Bacteria 1311
495 Ga0207652_10013940 3300025921 Bacteria 6508
496 Ga0207652_10169230 3300025921 Bacteria 1960
497 Ga0207652_10178783 3300025921 Bacteria 1906
498 Ga0207652_10218140 3300025921 Bacteria 1719
499 Ga0207681_10007743 3300025923 Bacteria 6580
500 Ga0207681_10083857 3300025923 Bacteria 2257
501 Ga0207681_10155468 3300025923 Bacteria 1718
502 Ga0207681_10725148 3300025923 Bacteria 827
503 Ga0207694_10016717 3300025924 Bacteria 5546
504 Ga0207650_10005701 3300025925 Bacteria 8500
505 Ga0207650_10012515 3300025925 Bacteria 5856
506 Ga0207650_10012972 3300025925 Bacteria 5761
507 Ga0207650_10038721 3300025925 Bacteria 3483
508 Ga0207650_10062656 3300025925 Bacteria 2779
509 Ga0207650_10204871 3300025925 Bacteria 1582
510 Ga0207650_10276376 3300025925 Bacteria 1366
511 Ga0207659_10008481 3300025926 Bacteria 6383
512 Ga0207659_10039126 3300025926 Bacteria 3304
513 Ga0207659_10039639 3300025926 Bacteria 3287
514 Ga0207659_10180953 3300025926 Bacteria 1670
515 Ga0207659_10304532 3300025926 Bacteria 1310
516 Ga0207659_10415873 3300025926 Bacteria 1127
517 Ga0207687_10000800 3300025927 Bacteria 21246
518 Ga0207687_10478042 3300025927 Bacteria 1037
519 Ga0207700_10000073 3300025928 Bacteria 61784
520 Ga0207700_10444260 3300025928 Bacteria 1142
521 Ga0207664_10015163 3300025929 Bacteria 5585
522 Ga0207644_10002067 3300025931 Bacteria 12998
523 Ga0207644_10014673 3300025931 Bacteria 5249
524 Ga0207644_10040602 3300025931 Bacteria 3289
525 Ga0207644_10048940 3300025931 Bacteria 3025
526 Ga0207644_10054154 3300025931 Bacteria 2888
527 Ga0207644_10195795 3300025931 Bacteria 1591
528 Ga0207644_10228680 3300025931 Bacteria 1477
529 Ga0207644_10771129 3300025931 Bacteria 804
530 Ga0207690_10001061 3300025932 Bacteria 17606
531 Ga0207690_10008488 3300025932 Bacteria 6095
532 Ga0207690_10128236 3300025932 Bacteria 1853
533 Ga0207690_10456793 3300025932 Unclassified 1027
534 Ga0207690_10469206 3300025932 Bacteria 1014
535 Ga0207690_10485170 3300025932 Bacteria 998
536 Ga0207706_10000023 3300025933 Bacteria 153979
537 Ga0207706_10000585 3300025933 Bacteria 38812
538 Ga0207706_10223969 3300025933 Bacteria 1646
539 Ga0207706_10239475 3300025933 Bacteria 1586
540 Ga0207706_10267134 3300025933 Bacteria 1493
541 Ga0207706_10962515 3300025933 Bacteria 719
542 Ga0207686_10002242 3300025934 Bacteria 10617
543 Ga0207686_10434218 3300025934 Bacteria 1007
544 Ga0207686_10623116 3300025934 Bacteria 851
545 Ga0207709_10005847 3300025935 Bacteria 6953
546 Ga0207670_10015865 3300025936 Bacteria 4511
547 Ga0207670_10021052 3300025936 Bacteria 4017
548 Ga0207670_10063507 3300025936 Bacteria 2527
549 Ga0207670_10081540 3300025936 Bacteria 2264
550 Ga0207669_10034323 3300025937 Bacteria 2873
551 Ga0207669_10722320 3300025937 Bacteria 820
552 Ga0207704_10001417 3300025938 Bacteria 10719
553 Ga0207704_10026988 3300025938 Bacteria 3159
554 Ga0207704_10050304 3300025938 Bacteria 2513
555 Ga0207704_10067624 3300025938 Bacteria 2249
556 Ga0207691_10000688 3300025940 Bacteria 33404
557 Ga0207691_10013470 3300025940 Bacteria 7824
558 Ga0207691_10014621 3300025940 Bacteria 7482
559 Ga0207691_10040386 3300025940 Bacteria 4311
560 Ga0207691_10043574 3300025940 Bacteria 4135
561 Ga0207691_10173810 3300025940 Bacteria 1885
562 Ga0207711_10000087 3300025941 Bacteria 98302
563 Ga0207711_10007347 3300025941 Bacteria 9222
564 Ga0207711_10022461 3300025941 Bacteria 5275
565 Ga0207711_10081565 3300025941 Bacteria 2827
566 Ga0207711_10233237 3300025941 Bacteria 1686
567 Ga0207689_10000069 3300025942 Bacteria 83053
568 Ga0207689_10000642 3300025942 Bacteria 33355
569 Ga0207689_10003820 3300025942 Bacteria 13729
570 Ga0207689_10027555 3300025942 Bacteria 4754
571 Ga0207661_10010000 3300025944 Bacteria 6816
572 Ga0207679_10013781 3300025945 Bacteria 5302
573 Ga0207679_10051343 3300025945 Bacteria 3018
574 Ga0207679_10067061 3300025945 Bacteria 2691
575 Ga0207679_10105109 3300025945 Bacteria 2217
576 Ga0207679_10151238 3300025945 Bacteria 1889
577 Ga0207679_10174401 3300025945 Bacteria 1773
578 Ga0207679_10485927 3300025945 Bacteria 1100
579 Ga0207679_10653644 3300025945 Bacteria 951
580 Ga0207667_10001383 3300025949 Bacteria 30431
581 Ga0207667_10008157 3300025949 Bacteria 12470
582 Ga0207667_10026225 3300025949 Bacteria 6369
583 Ga0207667_10299919 3300025949 Unclassified 1642
584 Ga0207667_10356438 3300025949 Bacteria 1492
585 Ga0207651_10007432 3300025960 Bacteria 5838
586 Ga0207651_10076905 3300025960 Bacteria 2387
587 Ga0207651_10080674 3300025960 Bacteria 2342
588 Ga0207712_10021014 3300025961 Bacteria 4280
589 Ga0207712_10208263 3300025961 Bacteria 1555
590 Ga0207668_10004330 3300025972 Bacteria 8333
591 Ga0207668_10013121 3300025972 Bacteria 5092
592 Ga0207668_10121321 3300025972 Bacteria 1980
593 Ga0207640_10093279 3300025981 Bacteria 2091
594 Ga0207640_10285338 3300025981 Bacteria 1299
595 Ga0207658_10025203 3300025986 Bacteria 4163
596 Ga0207658_10152481 3300025986 Bacteria 1884
597 Ga0207658_10247727 3300025986 Bacteria 1512
598 Ga0207677_10000700 3300026023 Bacteria 19901
599 Ga0207677_10007124 3300026023 Bacteria 6157
600 Ga0207677_10286087 3300026023 Bacteria 1355
601 Ga0207677_10360332 3300026023 Bacteria 1221
602 Ga0207677_10557167 3300026023 Bacteria 1000
603 Ga0207703_10000994 3300026035 Bacteria 27268
604 Ga0207703_10004909 3300026035 Bacteria 10868
605 Ga0207703_10005565 3300026035 Bacteria 10111
606 Ga0207703_10013743 3300026035 Bacteria 6311
607 Ga0207703_10018715 3300026035 Bacteria 5410
608 Ga0207639_10010939 3300026041 Bacteria 6292
609 Ga0207639_10014491 3300026041 Bacteria 5547
610 Ga0207639_10144669 3300026041 Bacteria 1985
611 Ga0207639_10210511 3300026041 Bacteria 1673
612 Ga0207639_10397560 3300026041 Bacteria 1241
613 Ga0207639_10514032 3300026041 Bacteria 1096
614 Ga0207678_10001787 3300026067 Bacteria 19688
615 Ga0207678_10012488 3300026067 Bacteria 7458
616 Ga0207678_10058005 3300026067 Bacteria 3332
617 Ga0207678_10132633 3300026067 Bacteria 2126
618 Ga0207678_10296284 3300026067 Bacteria 1390
619 Ga0207708_10000102 3300026075 Bacteria 64743
620 Ga0207708_10002194 3300026075 Bacteria 14414
621 Ga0207708_10014181 3300026075 Bacteria 5959
622 Ga0207708_10280486 3300026075 Unclassified 1350
623 Ga0207702_10004398 3300026078 Bacteria 12551
624 Ga0207702_10020136 3300026078 Bacteria 5527
625 Ga0207702_10085787 3300026078 Bacteria 2744
626 Ga0207641_10683779 3300026088 Bacteria 1009
627 Ga0207648_10000048 3300026089 Bacteria 109946
628 Ga0207648_10005941 3300026089 Bacteria 12211
629 Ga0207648_10006115 3300026089 Bacteria 12004
630 Ga0207648_10006307 3300026089 Bacteria 11795
631 Ga0207648_10040528 3300026089 Bacteria 4092
632 Ga0207676_10000140 3300026095 Bacteria 62993
633 Ga0207676_10014793 3300026095 Bacteria 5620
634 Ga0207676_10027398 3300026095 Bacteria 4244
635 Ga0207676_10119335 3300026095 Bacteria 2221
636 Ga0207676_10244230 3300026095 Bacteria 1612
637 Ga0207676_10603737 3300026095 Bacteria 1054
638 Ga0207674_10000429 3300026116 Bacteria 54858
639 Ga0207674_10002511 3300026116 Bacteria 23131
640 Ga0207674_10004730 3300026116 Bacteria 16322
641 Ga0207674_10115494 3300026116 Bacteria 2656
642 Ga0207674_10530958 3300026116 Bacteria 1137
643 Ga0207675_100000527 3300026118 Bacteria 37150
644 Ga0207675_100001991 3300026118 Bacteria 20375
645 Ga0207675_100005190 3300026118 Bacteria 12538
646 Ga0207675_100006094 3300026118 Bacteria 11473
647 Ga0207675_100006419 3300026118 Bacteria 11136
648 Ga0207675_100096997 3300026118 Bacteria 2776
649 Ga0207675_100127263 3300026118 Bacteria 2414
650 Ga0207675_100180959 3300026118 Bacteria 2018
651 Ga0207675_100333972 3300026118 Bacteria 1482
652 Ga0207683_10000258 3300026121 Bacteria 47224
653 Ga0207683_10007413 3300026121 Bacteria 9407
654 Ga0207683_10019835 3300026121 Bacteria 5743
655 Ga0207683_10048403 3300026121 Bacteria 3723
656 Ga0207683_10124070 3300026121 Bacteria 2320
657 Ga0207683_10585378 3300026121 Bacteria 1032
658 Ga0207683_10696537 3300026121 Bacteria 942
659 Ga0207698_10025921 3300026142 Bacteria 4140
660 Ga0207698_10027312 3300026142 Bacteria 4050
661 Ga0207698_10083504 3300026142 Bacteria 2585
662 Ga0207698_10176926 3300026142 Bacteria 1885
663 Ga0207698_10371191 3300026142 Bacteria 1358
664 Ga0207698_10474750 3300026142 Bacteria 1212
665 Ga0207698_10484567 3300026142 Bacteria 1200
666 Ga0207698_10972935 3300026142 Bacteria 858
667 Ga0210000_1007201 3300027462 Bacteria 1626
668 Ga0209971_1006278 3300027682 Bacteria 2813
669 Ga0209974_10026864 3300027876 Bacteria 1904
670 Ga0207428_10012525 3300027907 Bacteria 7446
671 Ga0207428_10013315 3300027907 Bacteria 7191
672 Ga0268266_10025724 3300028379 Bacteria 5008
673 Ga0268266_10106968 3300028379 Bacteria 2473
674 Ga0268266_10286865 3300028379 Bacteria 1532
675 Ga0268265_10015056 3300028380 Bacteria 5282
676 Ga0268265_10038563 3300028380 Bacteria 3515
677 Ga0268265_10106839 3300028380 Unclassified 2274
678 Ga0268265_10184640 3300028380 Bacteria 1795
679 Ga0268265_10453058 3300028380 Bacteria 1199
680 Ga0268265_10499085 3300028380 Bacteria 1146
681 Ga0268264_10000523 3300028381 Bacteria 48670
682 Ga0268264_10008062 3300028381 Bacteria 8760
683 Ga0268264_10017643 3300028381 Bacteria 5844
684 Ga0268264_10092267 3300028381 Bacteria 2613
685 Ga0268264_10113457 3300028381 Bacteria 2378
686 Ga0268264_10332787 3300028381 Bacteria 1440
687 Ga0268264_10843934 3300028381 Bacteria 917
688 Ga0307515_10026788 3300028794 Bacteria 9896
689 Ga0265329_10025516 3300031242 Bacteria 1955
690 Ga0307408_100000006 3300031548 Bacteria 472824
691 Ga0307408_100040552 3300031548 Bacteria 3297
692 Ga0307408_100195641 3300031548 Bacteria 1632
693 Ga0307408_100200318 3300031548 Bacteria 1615
694 Ga0265314_10060431 3300031711 Bacteria 2586
695 Ga0307405_10098914 3300031731 Unclassified 1951
696 Ga0307413_10000525 3300031824 Bacteria 12688
697 Ga0307413_10065374 3300031824 Bacteria 2264
698 Ga0307410_10013194 3300031852 Bacteria 4810
699 Ga0307406_10014179 3300031901 Bacteria 4581
700 Ga0307406_10094907 3300031901 Unclassified 2017
701 Ga0307407_10003999 3300031903 Bacteria 6168
702 Ga0307407_10006770 3300031903 Bacteria 5131
703 Ga0307407_10227855 3300031903 Bacteria 1264
704 Ga0307412_10047662 3300031911 Bacteria 2815
705 Ga0307409_100010145 3300031995 Bacteria 5836
706 Ga0307409_100016686 3300031995 Bacteria 4868
707 Ga0307409_100163097 3300031995 Bacteria 1952
708 Ga0307409_100324843 3300031995 Unclassified 1442
709 Ga0307416_100004232 3300032002 Bacteria 8616
710 Ga0307416_100014686 3300032002 Bacteria 5380
711 Ga0307416_100087493 3300032002 Bacteria 2660
712 Ga0307414_10012002 3300032004 Bacteria 5107
713 Ga0307414_10120681 3300032004 Bacteria 2015
714 Ga0307411_10002182 3300032005 Bacteria 8502
715 Ga0307411_10006514 3300032005 Bacteria 5850
716 Ga0307411_10016744 3300032005 Bacteria 4156
717 Ga0373934_0148616 3300035086 Unclassified 959
718 Ga0373940_0009372 3300035088 Bacteria 2275
719 Ga0373923_0077260 3300035111 Bacteria 1439
720 Ga0373936_0017734 3300035113 Bacteria 2743
721 Ga0373936_0108957 3300035113 Bacteria 1175
722 Ga0373939_0000089 3300035114 Bacteria 29155
723 Ga0373953_0016078 3300035117 Bacteria 2725
724 Ga0373954_0000495 3300035118 Bacteria 14814
725 Ga0373954_0046201 3300035118 Bacteria 2035
726 Ga0373956_0017278 3300035119 Bacteria 3039
727 Ga0373957_0010986 3300035120 Bacteria 3009
728 Ga0373960_0000853 3300035121 Bacteria 6448
729 Ga0373960_0077176 3300035121 Bacteria 1042
730 Ga0373943_0212706 3300035170 Bacteria 1074
731 Ga0373955_0002775 3300035172 Bacteria 7684
732 Ga0373955_0013970 3300035172 Bacteria 3898
733 Ga0373955_0030278 3300035172 Bacteria 2824
734 Ga0373955_0146636 3300035172 Bacteria 1387
735 Ga0373955_0219442 3300035172 Unclassified 1135
736 Ga0373924_0009262 3300035410 Bacteria 3606
737 Ga0373931_0001113 3300035691 Bacteria 11411
738 Ga0373931_0048919 3300035691 Bacteria 2243
739 Ga0373931_0068163 3300035691 Bacteria 1936
740 Ga0373935_0387188 3300035692 Bacteria 1002
741 Ga0373935_0414952 3300035692 Bacteria 968
742 Ga0373927_0323704 3300035695 Bacteria 1015
743 Ga0373933_0007482 3300035724 Bacteria 5963
744 Ga0373933_0177656 3300035724 Bacteria 1357
745 Ga0373933_0325194 3300035724 Bacteria 997
746 Ga0373947_0172210 3300035725 Bacteria 1405
747 Ga0373947_0176670 3300035725 Bacteria 1388
748 Ga0373937_0003673 3300036401 Bacteria 12956
749 Ga0373937_0059200 3300036401 Bacteria 3520
750 Ga0373937_0197746 3300036401 Bacteria 1889
751 Ga0373937_0209720 3300036401 Bacteria 1833
752 Ga0373937_0245343 3300036401 Bacteria 1688
753 Ga0373937_0282294 3300036401 Bacteria 1568
754 Ga0373937_0404930 3300036401 Bacteria 1294
755 Ga0373925_0032323 3300037068 Bacteria 3852
756 Ga0373925_0060497 3300037068 Bacteria 2844
757 Ga0373925_0557647 3300037068 Bacteria 942
758 Ga0395899_0094005 3300037312 Bacteria 2170
759 Ga0395900_0279153 3300037418 Bacteria 1663
760 Ga0395898_0128534 3300037466 Bacteria 2427
761 Ga0395898_0245420 3300037466 Bacteria 1708
762 Ga0395905_0101849 3300037471 Bacteria 2696
763 Ga0395905_0163713 3300037471 Bacteria 2090
764 Ga0395901_0215998 3300038443 Bacteria 2006
765 Ga0451797_0459451 3300041453 Bacteria 2691
766 Ga0451798_1011580 3300041458 Bacteria 1337
767 Ga0451802_1947593 3300041460 Bacteria 4569
768 Ga0451807_0129515 3300041486 Bacteria 6177
769 Ga0451807_1798842 3300041486 Bacteria 1381
770 Ga0451837_0939764 3300041494 Unclassified 2091
771 Ga0451855_1464634 3300041511 Bacteria 896
772 Ga0451853_0624379 3300041512 Bacteria 1125
773 Ga0439445_0017454 3300042004 Bacteria 1774
774 Ga0450913_006632 3300042117 Bacteria 854
775 Ga0450888_000605 3300042126 Bacteria 3392
776 Ga0450891_000309 3300042129 Bacteria 4999
777 Ga0450902_017625 3300042137 Bacteria 1168
778 Ga0450916_008109 3300042530 Bacteria 1273
779 Ga0450918_000034 3300042531 Bacteria 28207
780 Ga0451577_0099787 3300042876 Bacteria 2594
781 Ga0453684_0148943 3300044712 Bacteria 2784
782 Ga0453684_1057083 3300044712 Bacteria 860
783 Ga0451576_0021175 3300045051 Bacteria 7069
784 Ga0451576_0025168 3300045051 Bacteria 6416
785 Ga0466958_0154382 3300045836 Bacteria 1449
786 Ga0495638_0191523 3300046460 Bacteria 1160
787 Ga0495651_0332618 3300046462 Bacteria 1009
788 Ga0495580_0217320 3300046472 Bacteria 1314
789 Ga0495664_0056002 3300046477 Bacteria 2345
790 Ga0495664_0069842 3300046477 Bacteria 2097
791 Ga0495616_0001229 3300046513 Bacteria 18020
792 Ga0495621_0031615 3300046539 Bacteria 1817
793 Ga0495645_0018541 3300046543 Bacteria 5000
794 Ga0495625_0013181 3300046660 Bacteria 6658
795 Ga0495625_0146774 3300046660 Bacteria 1588
796 Ga0495623_0043132 3300046679 Bacteria 2871
797 Ga0495647_0130193 3300046681 Bacteria 1066
798 Ga0495674_0601374 3300047319 Unclassified 871
799 Ga0495675_0167218 3300047444 Bacteria 1352
800 Ga0495684_0433600 3300047471 Bacteria 916
801 Ga0496100_0026018 3300048903 Bacteria 3584
802 Ga0496100_0033781 3300048903 Bacteria 3203
803 Ga0496100_0471390 3300048903 Bacteria 965
804 Ga0496101_0015013 3300048904 Bacteria 5212
805 Ga0496101_0241640 3300048904 Bacteria 1405
806 Ga0496101_0282933 3300048904 Bacteria 1296
807 Ga0496102_0056849 3300048905 Bacteria 3570
808 Ga0496102_0058024 3300048905 Bacteria 3536
809 Ga0496103_0075656 3300048906 Bacteria 2112
810 Ga0496103_0107426 3300048906 Bacteria 1770
811 Ga0496104_0008001 3300048907 Bacteria 9374
812 Ga0496104_0026945 3300048907 Bacteria 5314
813 Ga0496104_0708550 3300048907 Bacteria 914
814 Ga0496105_0012713 3300048908 Bacteria 6667
815 Ga0496105_0107189 3300048908 Bacteria 2306
816 Ga0496106_0000852 3300048909 Bacteria 22131
817 Ga0496106_0081744 3300048909 Bacteria 2482
818 Ga0496107_0021694 3300048910 Bacteria 4538
819 Ga0496107_0067426 3300048910 Bacteria 2596
820 Ga0496108_0019587 3300048911 Bacteria 5558
821 Ga0496108_0266329 3300048911 Bacteria 1491
822 Ga0496108_0321395 3300048911 Bacteria 1349
823 Ga0496109_0003510 3300048912 Bacteria 13099
824 Ga0496109_0019713 3300048912 Bacteria 5950
825 Ga0496109_0264746 3300048912 Bacteria 1619
826 Ga0496109_0477369 3300048912 Bacteria 1177
827 Ga0496110_0028598 3300048913 Bacteria 4790
828 Ga0496110_0092598 3300048913 Bacteria 2705
829 Ga0496110_0160414 3300048913 Bacteria 2038
830 Ga0496112_0005376 3300048915 Bacteria 11066
831 Ga0496112_0154131 3300048915 Bacteria 2265
832 Ga0496113_0301136 3300048916 Bacteria 1284
833 Ga0496113_0489886 3300048916 Bacteria 987
834 Ga0496113_0550787 3300048916 Bacteria 925
835 Ga0496114_0003360 3300048917 Bacteria 12292
836 Ga0496114_0120452 3300048917 Bacteria 2256
837 Ga0496114_0187330 3300048917 Bacteria 1809
838 Ga0496114_0250926 3300048917 Bacteria 1557
839 Ga0496114_0627911 3300048917 Unclassified 946
840 Ga0496115_0047387 3300048918 Bacteria 3437
841 Ga0496123_0041478 3300048926 Bacteria 3190
842 Ga0496124_0042317 3300048927 Bacteria 3923
843 Ga0496125_0029856 3300048928 Bacteria 4889
844 Ga0501297_001234 3300049520 Bacteria 2338
845 Ga0501300_004485 3300049523 Bacteria 2069
846 Ga0501034_0000456 3300049571 Bacteria 67493
847 Ga0501036_0339697 3300049572 Bacteria 1254
848 Ga0501039_0374436 3300049575 Bacteria 1119
849 Ga0501068_0000960 3300049584 Bacteria 15139
850 Ga0501068_0454928 3300049584 Unclassified 828
851 Ga0501070_0225770 3300049586 Bacteria 1535
852 Ga0501072_0003561 3300049588 Bacteria 11719
853 Ga0501073_0001375 3300049589 Bacteria 17975
854 Ga0501074_0335658 3300049590 Bacteria 1073
855 Ga0501077_0190580 3300049593 Bacteria 1302
856 Ga0501222_000756 3300049662 Bacteria 4681
857 Ga0501227_071474 3300049665 Bacteria 901
858 Ga0501233_012729 3300049668 Bacteria 1694
859 Ga0501253_003033 3300049683 Bacteria 1968
860 Ga0501255_000806 3300049684 Bacteria 2304
861 Ga0501221_000517 3300049704 Bacteria 6105
862 Ga0501080_0001249 3300049742 Bacteria 21171
863 Ga0501080_0721341 3300049742 Bacteria 878
864 Ga0501083_0209491 3300049744 Bacteria 1271
865 Ga0501269_026290 3300049766 Bacteria 735
866 Ga0501044_0440135 3300049823 Bacteria 1211
867 nmdc:mga0k408_8363_c1 3300050493 Bacteria 5552
868 nmdc:mga07m45_139459_c1 3300050496 Bacteria 1404
869 nmdc:mga07m45_93_c1 3300050496 Bacteria 34685
870 nmdc:mga05p37_430_c1 3300050507 Bacteria 45408
871 nmdc:mga05p37_46494_c1 3300050507 Bacteria 5336
872 nmdc:mga09592_26270_c1 3300050508 Bacteria 4823
873 nmdc:mga09592_37127_c1 3300050508 Bacteria 4085
874 nmdc:mga06r32_1291_c1 3300050510 Bacteria 22555
875 nmdc:mga08y16_105543_c1 3300050511 Bacteria 2933
876 nmdc:mga08y16_1565_c1 3300050511 Bacteria 23071
877 nmdc:mga08y16_328556_c1 3300050511 Bacteria 1573
878 nmdc:mga08y16_51927_c1 3300050511 Bacteria 4290
879 nmdc:mga0n895_346972_c1 3300050512 Bacteria 1503
880 nmdc:mga0n895_459037_c1 3300050512 Bacteria 1286
881 nmdc:mga0n895_634708_c1 3300050512 Bacteria 1068
882 nmdc:mga0n895_911144_c1 3300050512 Bacteria 864
883 nmdc:mga0rr50_400513_c1 3300050513 Bacteria 1159
884 nmdc:mga0rr50_8013_c1 3300050513 Bacteria 6552
885 Ga0495601_0073833 3300053077 Bacteria 2182
886 Ga0495595_0182127 3300053084 Bacteria 1042
887 Ga0495619_0400538 3300053085 Bacteria 948
888 Ga0500644_0009902 3300053088 Unclassified 2564
889 Ga0500616_0011463 3300053153 Bacteria 5233
890 Ga0501084_0156004 3300054114 Bacteria 1925
891 Ga0501082_0044702 3300060353 Bacteria 3820

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0454928 Ga0501068_0454928_235_792 177
2 3300025941 Ga0207711_10233237 Ga0207711_102332372 181
3 3300013306 Ga0163162_12018871 Ga0163162_120188711 184
4 3300042530 Ga0450916_008109 Ga0450916_008109_369_953 187
5 3300005337 Ga0070682_100405908 Ga0070682_1004059082 195
6 3300005548 Ga0070665_100276442 Ga0070665_1002764422 195
7 3300005844 Ga0068862_100978901 Ga0068862_1009789012 195
8 3300026118 Ga0207675_100180959 Ga0207675_1001809593 195
9 3300005293 Ga0065715_10446243 Ga0065715_104462431 196
10 3300005328 Ga0070676_10398702 Ga0070676_103987021 196
11 3300005331 Ga0070670_100151800 Ga0070670_1001518003 196
12 3300005618 Ga0068864_100086324 Ga0068864_1000863243 196
13 3300005719 Ga0068861_100497862 Ga0068861_1004978621 196
14 3300005842 Ga0068858_100133876 Ga0068858_1001338762 196
15 3300013306 Ga0163162_11007096 Ga0163162_110070962 196
16 3300014968 Ga0157379_11163853 Ga0157379_111638532 196
17 3300025907 Ga0207645_10270136 Ga0207645_102701362 196
18 3300025925 Ga0207650_10204871 Ga0207650_102048712 196
19 3300026095 Ga0207676_10119335 Ga0207676_101193353 196
20 3300026118 Ga0207675_100333972 Ga0207675_1003339722 196
21 3300035088 Ga0373940_0009372 Ga0373940_0009372_1604_2254 196
22 3300035114 Ga0373939_0000089 Ga0373939_0000089_25606_26256 196
23 3300035121 Ga0373960_0000853 Ga0373960_0000853_3363_4013 196
24 3300035691 Ga0373931_0001113 Ga0373931_0001113_10214_10864 196
25 3300048915 Ga0496112_0154131 Ga0496112_0154131_633_1268 196
26 3300048916 Ga0496113_0489886 Ga0496113_0489886_93_728 196
27 3300006195 Ga0075366_10088002 Ga0075366_100880023 198
28 3300005334 Ga0068869_100274296 Ga0068869_1002742962 199
29 3300005344 Ga0070661_100676822 Ga0070661_1006768221 199
30 3300005564 Ga0070664_100151426 Ga0070664_1001514263 199
31 3300005614 Ga0068856_100035198 Ga0068856_1000351984 199
32 3300005617 Ga0068859_100217700 Ga0068859_1002177002 199
33 3300005841 Ga0068863_100234342 Ga0068863_1002343423 199
34 3300006931 Ga0097620_100217712 Ga0097620_1002177122 199
35 3300025945 Ga0207679_10485927 Ga0207679_104859272 199
36 iso_pu_bacteria 3000017691 3000019495 200
37 iso_pu_bacteria 2511231024 2511378008 202
38 iso_pu_bacteria 2765235841 2765584525 202
39 iso_pu_bacteria 8054929484 8054931277 202
40 iso_pu_bacteria 8056137416 8056140807 203
41 3300005549 Ga0070704_100013168 Ga0070704_1000131682 204
42 3300027462 Ga0210000_1007201 Ga0210000_10072012 204
43 iso_pu_bacteria 2643221544 2643744152 204
44 3300005549 Ga0070704_100176187 Ga0070704_1001761872 205
45 3300005355 Ga0070671_100012552 Ga0070671_1000125527 206
46 3300005367 Ga0070667_100188580 Ga0070667_1001885803 206
47 3300005843 Ga0068860_100428198 Ga0068860_1004281983 206
48 3300009011 Ga0105251_10008897 Ga0105251_100088973 206
49 3300013297 Ga0157378_10119157 Ga0157378_101191573 206
50 3300014325 Ga0163163_10357665 Ga0163163_103576653 206
51 3300025735 Ga0207713_1024027 Ga0207713_10240272 206
52 3300025931 Ga0207644_10054154 Ga0207644_100541543 206
53 3300025940 Ga0207691_10043574 Ga0207691_100435744 206
54 3300035691 Ga0373931_0048919 Ga0373931_0048919_1135_1773 206
55 3300048903 Ga0496100_0471390 Ga0496100_0471390_246_884 206
56 3300048907 Ga0496104_0708550 Ga0496104_0708550_16_654 206
57 3300048913 Ga0496110_0028598 Ga0496110_0028598_1915_2538 206
58 3300048917 Ga0496114_0003360 Ga0496114_0003360_4573_5196 206
59 3300048926 Ga0496123_0041478 Ga0496123_0041478_2404_3027 206
60 3300048927 Ga0496124_0042317 Ga0496124_0042317_873_1496 206
61 3300048928 Ga0496125_0029856 Ga0496125_0029856_2475_3098 206
62 3300013296 Ga0157374_11005309 Ga0157374_110053092 207
63 3300025907 Ga0207645_10370344 Ga0207645_103703442 207
64 3300031903 Ga0307407_10227855 Ga0307407_102278552 207
65 3300005290 Ga0065712_10006136 Ga0065712_100061364 208
66 3300005293 Ga0065715_10139235 Ga0065715_101392351 208
67 3300005330 Ga0070690_100145969 Ga0070690_1001459693 208
68 3300005331 Ga0070670_100103130 Ga0070670_1001031302 208
69 3300005336 Ga0070680_100599651 Ga0070680_1005996512 208
70 3300005337 Ga0070682_100015068 Ga0070682_1000150682 208
71 3300005340 Ga0070689_100000781 Ga0070689_1000007814 208
72 3300005344 Ga0070661_100047425 Ga0070661_1000474253 208
73 3300005347 Ga0070668_100427380 Ga0070668_1004273802 208
74 3300005354 Ga0070675_100133188 Ga0070675_1001331882 208
75 3300005354 Ga0070675_100510249 Ga0070675_1005102492 208
76 3300005438 Ga0070701_10170488 Ga0070701_101704882 208
77 3300005440 Ga0070705_100050350 Ga0070705_1000503503 208
78 3300005441 Ga0070700_100002925 Ga0070700_1000029255 208
79 3300005441 Ga0070700_100061027 Ga0070700_1000610271 208
80 3300005444 Ga0070694_100060463 Ga0070694_1000604633 208
81 3300005455 Ga0070663_100089174 Ga0070663_1000891742 208
82 3300005455 Ga0070663_100214383 Ga0070663_1002143832 208
83 3300005543 Ga0070672_100031779 Ga0070672_1000317795 208
84 3300005544 Ga0070686_100052252 Ga0070686_1000522523 208
85 3300005544 Ga0070686_100207589 Ga0070686_1002075891 208
86 3300005545 Ga0070695_100393133 Ga0070695_1003931332 208
87 3300005546 Ga0070696_100192159 Ga0070696_1001921591 208
88 3300005549 Ga0070704_100605632 Ga0070704_1006056322 208
89 3300005578 Ga0068854_100587588 Ga0068854_1005875882 208
90 3300005615 Ga0070702_100002888 Ga0070702_1000028883 208
91 3300005615 Ga0070702_100673200 Ga0070702_1006732001 208
92 3300005617 Ga0068859_100050112 Ga0068859_1000501124 208
93 3300005618 Ga0068864_100013541 Ga0068864_1000135416 208
94 3300005618 Ga0068864_100125126 Ga0068864_1001251262 208
95 3300005718 Ga0068866_10295129 Ga0068866_102951292 208
96 3300005719 Ga0068861_100005833 Ga0068861_10000583311 208
97 3300005719 Ga0068861_100074737 Ga0068861_1000747372 208
98 3300005840 Ga0068870_10022434 Ga0068870_100224344 208
99 3300005841 Ga0068863_100031144 Ga0068863_1000311445 208
100 3300005843 Ga0068860_100239423 Ga0068860_1002394233 208
101 3300005844 Ga0068862_100076173 Ga0068862_1000761733 208
102 3300005844 Ga0068862_100308854 Ga0068862_1003088542 208
103 3300006871 Ga0075434_100159143 Ga0075434_1001591433 208
104 3300006931 Ga0097620_100050112 Ga0097620_1000501124 208
105 3300009094 Ga0111539_11200814 Ga0111539_112008141 208
106 3300009176 Ga0105242_10688935 Ga0105242_106889352 208
107 3300009553 Ga0105249_10092530 Ga0105249_100925303 208
108 3300009553 Ga0105249_11021939 Ga0105249_110219392 208
109 3300013308 Ga0157375_10419192 Ga0157375_104191923 208
110 3300014326 Ga0157380_10231317 Ga0157380_102313171 208
111 3300017792 Ga0163161_10214259 Ga0163161_102142592 208
112 3300025908 Ga0207643_10037936 Ga0207643_100379363 208
113 3300025920 Ga0207649_10063546 Ga0207649_100635463 208
114 3300025940 Ga0207691_10040386 Ga0207691_100403864 208
115 3300025945 Ga0207679_10151238 Ga0207679_101512382 208
116 3300026041 Ga0207639_10210511 Ga0207639_102105112 208
117 3300026041 Ga0207639_10514032 Ga0207639_105140321 208
118 3300026075 Ga0207708_10014181 Ga0207708_100141814 208
119 3300026075 Ga0207708_10280486 Ga0207708_102804862 208
120 3300026095 Ga0207676_10027398 Ga0207676_100273984 208
121 3300026118 Ga0207675_100006094 Ga0207675_1000060944 208
122 3300026118 Ga0207675_100006419 Ga0207675_10000641913 208
123 3300028380 Ga0268265_10106839 Ga0268265_101068393 208
124 3300028380 Ga0268265_10453058 Ga0268265_104530582 208
125 3300028380 Ga0268265_10499085 Ga0268265_104990852 208
126 3300028381 Ga0268264_10092267 Ga0268264_100922672 208
127 3300028381 Ga0268264_10332787 Ga0268264_103327872 208
128 3300028794 Ga0307515_10026788 Ga0307515_100267883 208
129 3300031242 Ga0265329_10025516 Ga0265329_100255163 208
130 3300031548 Ga0307408_100040552 Ga0307408_1000405523 208
131 3300031548 Ga0307408_100200318 Ga0307408_1002003182 208
132 3300031711 Ga0265314_10060431 Ga0265314_100604313 208
133 3300031731 Ga0307405_10098914 Ga0307405_100989142 208
134 3300031824 Ga0307413_10000525 Ga0307413_100005257 208
135 3300031901 Ga0307406_10094907 Ga0307406_100949072 208
136 3300031903 Ga0307407_10003999 Ga0307407_100039997 208
137 3300031995 Ga0307409_100010145 Ga0307409_1000101455 208
138 3300031995 Ga0307409_100163097 Ga0307409_1001630973 208
139 3300031995 Ga0307409_100324843 Ga0307409_1003248432 208
140 3300032002 Ga0307416_100004232 Ga0307416_1000042326 208
141 3300032002 Ga0307416_100087493 Ga0307416_1000874933 208
142 3300032004 Ga0307414_10012002 Ga0307414_100120026 208
143 3300032005 Ga0307411_10002182 Ga0307411_100021825 208
144 3300032005 Ga0307411_10006514 Ga0307411_100065145 208
145 3300035172 Ga0373955_0013970 Ga0373955_0013970_695_1345 208
146 3300036401 Ga0373937_0209720 Ga0373937_0209720_427_1053 208
147 3300041453 Ga0451797_0459451 Ga0451797_0459451_512_1162 208
148 3300041458 Ga0451798_1011580 Ga0451798_1011580_568_1218 208
149 3300041460 Ga0451802_1947593 Ga0451802_1947593_3268_3918 208
150 3300041486 Ga0451807_0129515 Ga0451807_0129515_2578_3228 208
151 3300041494 Ga0451837_0939764 Ga0451837_0939764_1293_1943 208
152 3300041511 Ga0451855_1464634 Ga0451855_1464634_96_749 208
153 3300042004 Ga0439445_0017454 Ga0439445_0017454_813_1466 208
154 3300042117 Ga0450913_006632 Ga0450913_006632_85_738 208
155 3300042126 Ga0450888_000605 Ga0450888_000605_1002_1655 208
156 3300042129 Ga0450891_000309 Ga0450891_000309_768_1421 208
157 3300042137 Ga0450902_017625 Ga0450902_017625_258_911 208
158 3300042531 Ga0450918_000034 Ga0450918_000034_24786_25436 208
159 3300042876 Ga0451577_0099787 Ga0451577_0099787_500_1150 208
160 3300044712 Ga0453684_0148943 Ga0453684_0148943_380_1030 208
161 3300045051 Ga0451576_0025168 Ga0451576_0025168_4417_5067 208
162 3300046460 Ga0495638_0191523 Ga0495638_0191523_348_998 208
163 3300046513 Ga0495616_0001229 Ga0495616_0001229_1099_1749 208
164 3300046660 Ga0495625_0013181 Ga0495625_0013181_5537_6187 208
165 3300046660 Ga0495625_0146774 Ga0495625_0146774_38_688 208
166 3300048903 Ga0496100_0026018 Ga0496100_0026018_2271_2912 208
167 3300049520 Ga0501297_001234 Ga0501297_001234_1015_1668 208
168 3300049523 Ga0501300_004485 Ga0501300_004485_1334_1987 208
169 3300049662 Ga0501222_000756 Ga0501222_000756_1890_2543 208
170 3300049665 Ga0501227_071474 Ga0501227_071474_116_769 208
171 3300049668 Ga0501233_012729 Ga0501233_012729_21_674 208
172 3300049683 Ga0501253_003033 Ga0501253_003033_904_1557 208
173 3300049684 Ga0501255_000806 Ga0501255_000806_854_1507 208
174 3300049704 Ga0501221_000517 Ga0501221_000517_4925_5578 208
175 3300049766 Ga0501269_026290 Ga0501269_026290_70_723 208
176 3300050496 nmdc:mga07m45_93_c1 nmdc:mga07m45_93_c1_18787_19440 208
177 3300050511 nmdc:mga08y16_328556_c1 nmdc:mga08y16_328556_c1_51_701 208
178 3300053088 Ga0500644_0009902 Ga0500644_0009902_1667_2317 208
179 3300053153 Ga0500616_0011463 Ga0500616_0011463_2739_3383 208
180 3300003316 rootH1_10003216 rootH1_1000321616 209
181 3300003322 rootL2_10002048 rootL2_100020482 209
182 3300005347 Ga0070668_100065413 Ga0070668_1000654134 209
183 3300005353 Ga0070669_100082815 Ga0070669_1000828152 209
184 3300005356 Ga0070674_100197260 Ga0070674_1001972602 209
185 3300005365 Ga0070688_100049737 Ga0070688_1000497372 209
186 3300005459 Ga0068867_100423508 Ga0068867_1004235082 209
187 3300005618 Ga0068864_100517332 Ga0068864_1005173322 209
188 3300006353 Ga0075370_10173486 Ga0075370_101734862 209
189 3300006358 Ga0068871_100183402 Ga0068871_1001834022 209
190 3300006871 Ga0075434_100153127 Ga0075434_1001531273 209
191 3300009094 Ga0111539_10166724 Ga0111539_101667242 209
192 3300013308 Ga0157375_10872079 Ga0157375_108720792 209
193 3300014326 Ga0157380_10040064 Ga0157380_100400643 209
194 3300025923 Ga0207681_10155468 Ga0207681_101554683 209
195 3300025972 Ga0207668_10004330 Ga0207668_100043307 209
196 3300026089 Ga0207648_10040528 Ga0207648_100405286 209
197 3300026095 Ga0207676_10603737 Ga0207676_106037372 209
198 3300028380 Ga0268265_10184640 Ga0268265_101846402 209
199 3300035113 Ga0373936_0108957 Ga0373936_0108957_151_780 209
200 3300035172 Ga0373955_0030278 Ga0373955_0030278_73_702 209
201 3300035692 Ga0373935_0387188 Ga0373935_0387188_38_667 209
202 3300035724 Ga0373933_0325194 Ga0373933_0325194_69_698 209
203 3300036401 Ga0373937_0059200 Ga0373937_0059200_1424_2053 209
204 3300036401 Ga0373937_0245343 Ga0373937_0245343_88_717 209
205 3300037068 Ga0373925_0060497 Ga0373925_0060497_1269_1898 209
206 3300041512 Ga0451853_0624379 Ga0451853_0624379_13_669 209
207 3300045051 Ga0451576_0021175 Ga0451576_0021175_4388_5044 209
208 3300046543 Ga0495645_0018541 Ga0495645_0018541_3988_4617 209
209 3300048904 Ga0496101_0282933 Ga0496101_0282933_601_1248 209
210 3300050496 nmdc:mga07m45_139459_c1 nmdc:mga07m45_139459_c1_277_933 209
211 3300050513 nmdc:mga0rr50_8013_c1 nmdc:mga0rr50_8013_c1_5573_6220 209
212 3300005328 Ga0070676_10010963 Ga0070676_100109636 210
213 3300005331 Ga0070670_100028486 Ga0070670_1000284864 210
214 3300005334 Ga0068869_100001258 Ga0068869_1000012586 210
215 3300005340 Ga0070689_100081017 Ga0070689_1000810172 210
216 3300005345 Ga0070692_10077601 Ga0070692_100776011 210
217 3300005347 Ga0070668_100001957 Ga0070668_10000195713 210
218 3300005355 Ga0070671_100355246 Ga0070671_1003552462 210
219 3300005367 Ga0070667_100000537 Ga0070667_10000053729 210
220 3300005434 Ga0070709_10727809 Ga0070709_107278091 210
221 3300005456 Ga0070678_100376935 Ga0070678_1003769352 210
222 3300005457 Ga0070662_100075514 Ga0070662_1000755143 210
223 3300005457 Ga0070662_100488439 Ga0070662_1004884392 210
224 3300005459 Ga0068867_100011849 Ga0068867_1000118496 210
225 3300005459 Ga0068867_100017076 Ga0068867_1000170765 210
226 3300005459 Ga0068867_100352997 Ga0068867_1003529972 210
227 3300005539 Ga0068853_100024944 Ga0068853_1000249444 210
228 3300005543 Ga0070672_100150637 Ga0070672_1001506373 210
229 3300005549 Ga0070704_100110206 Ga0070704_1001102062 210
230 3300005577 Ga0068857_100001800 Ga0068857_10000180015 210
231 3300005615 Ga0070702_100067716 Ga0070702_1000677162 210
232 3300005617 Ga0068859_100000548 Ga0068859_10000054828 210
233 3300005617 Ga0068859_101148230 Ga0068859_1011482302 210
234 3300005618 Ga0068864_100000759 Ga0068864_10000075914 210
235 3300005719 Ga0068861_100001692 Ga0068861_10000169212 210
236 3300005841 Ga0068863_100002477 Ga0068863_10000247714 210
237 3300005841 Ga0068863_100472998 Ga0068863_1004729982 210
238 3300005842 Ga0068858_100038945 Ga0068858_1000389456 210
239 3300005844 Ga0068862_100003241 Ga0068862_10000324113 210
240 3300005983 Ga0081540_1013533 Ga0081540_10135334 210
241 3300006358 Ga0068871_100441896 Ga0068871_1004418962 210
242 3300006844 Ga0075428_100002872 Ga0075428_10000287222 210
243 3300006847 Ga0075431_100001468 Ga0075431_10000146824 210
244 3300006880 Ga0075429_100093494 Ga0075429_1000934941 210
245 3300006881 Ga0068865_100085032 Ga0068865_1000850322 210
246 3300006881 Ga0068865_100096792 Ga0068865_1000967922 210
247 3300006931 Ga0097620_100000548 Ga0097620_10000054828 210
248 3300006931 Ga0097620_101148334 Ga0097620_1011483342 210
249 3300009094 Ga0111539_10003134 Ga0111539_1000313421 210
250 3300009101 Ga0105247_10042203 Ga0105247_100422034 210
251 3300009147 Ga0114129_10001566 Ga0114129_1000156631 210
252 3300009174 Ga0105241_10371043 Ga0105241_103710431 210
253 3300009176 Ga0105242_10148426 Ga0105242_101484262 210
254 3300009177 Ga0105248_10009060 Ga0105248_100090608 210
255 3300009545 Ga0105237_10204634 Ga0105237_102046342 210
256 3300009553 Ga0105249_10300942 Ga0105249_103009422 210
257 3300013100 Ga0157373_10269897 Ga0157373_102698972 210
258 3300013297 Ga0157378_10079153 Ga0157378_100791532 210
259 3300013306 Ga0163162_10295960 Ga0163162_102959602 210
260 3300013307 Ga0157372_10476525 Ga0157372_104765253 210
261 3300013308 Ga0157375_10038446 Ga0157375_100384462 210
262 3300017792 Ga0163161_10067580 Ga0163161_100675802 210
263 3300025321 Ga0207656_10264257 Ga0207656_102642571 210
264 3300025899 Ga0207642_10149201 Ga0207642_101492012 210
265 3300025900 Ga0207710_10019811 Ga0207710_100198112 210
266 3300025906 Ga0207699_10511103 Ga0207699_105111032 210
267 3300025907 Ga0207645_10014722 Ga0207645_100147226 210
268 3300025908 Ga0207643_10034526 Ga0207643_100345264 210
269 3300025914 Ga0207671_10139784 Ga0207671_101397842 210
270 3300025931 Ga0207644_10228680 Ga0207644_102286802 210
271 3300025933 Ga0207706_10223969 Ga0207706_102239692 210
272 3300025933 Ga0207706_10239475 Ga0207706_102394752 210
273 3300025934 Ga0207686_10434218 Ga0207686_104342182 210
274 3300025936 Ga0207670_10081540 Ga0207670_100815403 210
275 3300025937 Ga0207669_10722320 Ga0207669_107223201 210
276 3300025938 Ga0207704_10050304 Ga0207704_100503043 210
277 3300025940 Ga0207691_10173810 Ga0207691_101738102 210
278 3300025941 Ga0207711_10007347 Ga0207711_100073478 210
279 3300025942 Ga0207689_10003820 Ga0207689_1000382014 210
280 3300025961 Ga0207712_10208263 Ga0207712_102082632 210
281 3300026035 Ga0207703_10000994 Ga0207703_1000099415 210
282 3300026089 Ga0207648_10006115 Ga0207648_1000611512 210
283 3300026116 Ga0207674_10002511 Ga0207674_1000251111 210
284 3300026118 Ga0207675_100001991 Ga0207675_10000199113 210
285 3300026118 Ga0207675_100127263 Ga0207675_1001272632 210
286 3300026121 Ga0207683_10124070 Ga0207683_101240702 210
287 3300026121 Ga0207683_10696537 Ga0207683_106965371 210
288 3300026142 Ga0207698_10972935 Ga0207698_109729352 210
289 3300027907 Ga0207428_10013315 Ga0207428_100133155 210
290 3300028381 Ga0268264_10000523 Ga0268264_1000052315 210
291 3300028381 Ga0268264_10113457 Ga0268264_101134572 210
292 3300031548 Ga0307408_100000006 Ga0307408_100000006337 210
293 3300044712 Ga0453684_1057083 Ga0453684_1057083_65_715 210
294 3300048906 Ga0496103_0107426 Ga0496103_0107426_790_1422 210
295 3300048911 Ga0496108_0266329 Ga0496108_0266329_811_1443 210
296 3300048912 Ga0496109_0003510 Ga0496109_0003510_5532_6164 210
297 3300049590 Ga0501074_0335658 Ga0501074_0335658_237_920 210
298 3300050507 nmdc:mga05p37_430_c1 nmdc:mga05p37_430_c1_25156_25824 210
299 3300050508 nmdc:mga09592_37127_c1 nmdc:mga09592_37127_c1_1654_2322 210
300 3300050510 nmdc:mga06r32_1291_c1 nmdc:mga06r32_1291_c1_2729_3397 210
301 3300050511 nmdc:mga08y16_1565_c1 nmdc:mga08y16_1565_c1_1574_2242 210
302 3300050512 nmdc:mga0n895_911144_c1 nmdc:mga0n895_911144_c1_117_767 210
303 3300001991 JGI24743J22301_10012326 JGI24743J22301_100123263 211
304 3300002076 JGI24749J21850_1023695 JGI24749J21850_10236952 211
305 3300002239 JGI24034J26672_10048157 JGI24034J26672_100481571 211
306 3300002244 JGI24742J22300_10057369 JGI24742J22300_100573691 211
307 3300005327 Ga0070658_10019632 Ga0070658_100196323 211
308 3300005327 Ga0070658_10218595 Ga0070658_102185952 211
309 3300005327 Ga0070658_10410322 Ga0070658_104103222 211
310 3300005328 Ga0070676_10000712 Ga0070676_100007122 211
311 3300005328 Ga0070676_10082019 Ga0070676_100820192 211
312 3300005329 Ga0070683_100010112 Ga0070683_1000101123 211
313 3300005329 Ga0070683_100285637 Ga0070683_1002856372 211
314 3300005329 Ga0070683_100375282 Ga0070683_1003752821 211
315 3300005330 Ga0070690_100001392 Ga0070690_1000013924 211
316 3300005330 Ga0070690_100003483 Ga0070690_1000034831 211
317 3300005330 Ga0070690_100018815 Ga0070690_1000188152 211
318 3300005330 Ga0070690_100448582 Ga0070690_1004485821 211
319 3300005331 Ga0070670_100046953 Ga0070670_1000469531 211
320 3300005331 Ga0070670_100059340 Ga0070670_1000593402 211
321 3300005331 Ga0070670_100205984 Ga0070670_1002059842 211
322 3300005331 Ga0070670_100269697 Ga0070670_1002696972 211
323 3300005333 Ga0070677_10030637 Ga0070677_100306372 211
324 3300005334 Ga0068869_100000631 Ga0068869_10000063111 211
325 3300005334 Ga0068869_100008561 Ga0068869_1000085613 211
326 3300005334 Ga0068869_100210289 Ga0068869_1002102892 211
327 3300005335 Ga0070666_10001286 Ga0070666_100012867 211
328 3300005335 Ga0070666_10013719 Ga0070666_100137196 211
329 3300005337 Ga0070682_100461479 Ga0070682_1004614792 211
330 3300005338 Ga0068868_100001544 Ga0068868_10000154414 211
331 3300005338 Ga0068868_100002946 Ga0068868_1000029466 211
332 3300005338 Ga0068868_100281599 Ga0068868_1002815992 211
333 3300005338 Ga0068868_100479627 Ga0068868_1004796272 211
334 3300005339 Ga0070660_100003674 Ga0070660_1000036746 211
335 3300005339 Ga0070660_100027048 Ga0070660_1000270484 211
336 3300005339 Ga0070660_100040566 Ga0070660_1000405663 211
337 3300005340 Ga0070689_100003108 Ga0070689_1000031084 211
338 3300005340 Ga0070689_100005522 Ga0070689_1000055226 211
339 3300005340 Ga0070689_100042402 Ga0070689_1000424023 211
340 3300005341 Ga0070691_10035517 Ga0070691_100355173 211
341 3300005343 Ga0070687_100009949 Ga0070687_1000099492 211
342 3300005343 Ga0070687_100028147 Ga0070687_1000281472 211
343 3300005343 Ga0070687_100265424 Ga0070687_1002654241 211
344 3300005344 Ga0070661_100009592 Ga0070661_1000095924 211
345 3300005344 Ga0070661_100032273 Ga0070661_1000322732 211
346 3300005344 Ga0070661_100068496 Ga0070661_1000684962 211
347 3300005344 Ga0070661_100119601 Ga0070661_1001196013 211
348 3300005344 Ga0070661_100184529 Ga0070661_1001845292 211
349 3300005344 Ga0070661_100210364 Ga0070661_1002103641 211
350 3300005345 Ga0070692_10010969 Ga0070692_100109693 211
351 3300005347 Ga0070668_100005291 Ga0070668_1000052914 211
352 3300005347 Ga0070668_100130810 Ga0070668_1001308103 211
353 3300005353 Ga0070669_100001265 Ga0070669_10000126515 211
354 3300005353 Ga0070669_100078882 Ga0070669_1000788823 211
355 3300005354 Ga0070675_100018807 Ga0070675_1000188072 211
356 3300005354 Ga0070675_100182643 Ga0070675_1001826432 211
357 3300005354 Ga0070675_100242682 Ga0070675_1002426822 211
358 3300005354 Ga0070675_100524603 Ga0070675_1005246032 211
359 3300005355 Ga0070671_100018529 Ga0070671_1000185297 211
360 3300005355 Ga0070671_100023505 Ga0070671_1000235056 211
361 3300005355 Ga0070671_100122018 Ga0070671_1001220183 211
362 3300005355 Ga0070671_100126289 Ga0070671_1001262894 211
363 3300005356 Ga0070674_100071357 Ga0070674_1000713572 211
364 3300005356 Ga0070674_100229909 Ga0070674_1002299092 211
365 3300005356 Ga0070674_100341933 Ga0070674_1003419332 211
366 3300005364 Ga0070673_100012387 Ga0070673_1000123873 211
367 3300005364 Ga0070673_100956517 Ga0070673_1009565171 211
368 3300005365 Ga0070688_100018907 Ga0070688_1000189073 211
369 3300005365 Ga0070688_100287089 Ga0070688_1002870891 211
370 3300005365 Ga0070688_100808024 Ga0070688_1008080241 211
371 3300005366 Ga0070659_100000738 Ga0070659_10000073818 211
372 3300005366 Ga0070659_100001702 Ga0070659_1000017022 211
373 3300005366 Ga0070659_100068711 Ga0070659_1000687113 211
374 3300005366 Ga0070659_100124765 Ga0070659_1001247652 211
375 3300005366 Ga0070659_100498199 Ga0070659_1004981992 211
376 3300005366 Ga0070659_100803268 Ga0070659_1008032681 211
377 3300005367 Ga0070667_100001294 Ga0070667_10000129413 211
378 3300005367 Ga0070667_100006565 Ga0070667_1000065655 211
379 3300005434 Ga0070709_10001554 Ga0070709_100015549 211
380 3300005434 Ga0070709_10023418 Ga0070709_100234183 211
381 3300005434 Ga0070709_10126273 Ga0070709_101262732 211
382 3300005435 Ga0070714_100011182 Ga0070714_1000111828 211
383 3300005435 Ga0070714_100241805 Ga0070714_1002418052 211
384 3300005435 Ga0070714_100571301 Ga0070714_1005713011 211
385 3300005436 Ga0070713_100000093 Ga0070713_10000009310 211
386 3300005436 Ga0070713_100022947 Ga0070713_1000229476 211
387 3300005436 Ga0070713_100073880 Ga0070713_1000738802 211
388 3300005437 Ga0070710_10002620 Ga0070710_100026206 211
389 3300005437 Ga0070710_10033776 Ga0070710_100337764 211
390 3300005437 Ga0070710_10164745 Ga0070710_101647451 211
391 3300005438 Ga0070701_10000512 Ga0070701_100005129 211
392 3300005438 Ga0070701_10004791 Ga0070701_100047915 211
393 3300005438 Ga0070701_10269498 Ga0070701_102694982 211
394 3300005439 Ga0070711_100015980 Ga0070711_1000159802 211
395 3300005439 Ga0070711_100043941 Ga0070711_1000439412 211
396 3300005441 Ga0070700_100000680 Ga0070700_1000006809 211
397 3300005441 Ga0070700_100077251 Ga0070700_1000772512 211
398 3300005444 Ga0070694_100279301 Ga0070694_1002793012 211
399 3300005445 Ga0070708_100000235 Ga0070708_10000023523 211
400 3300005445 Ga0070708_100132795 Ga0070708_1001327952 211
401 3300005445 Ga0070708_100234089 Ga0070708_1002340892 211
402 3300005455 Ga0070663_100006029 Ga0070663_1000060296 211
403 3300005455 Ga0070663_100007958 Ga0070663_1000079582 211
404 3300005455 Ga0070663_100026121 Ga0070663_1000261214 211
405 3300005456 Ga0070678_100000115 Ga0070678_10000011513 211
406 3300005456 Ga0070678_100011176 Ga0070678_1000111763 211
407 3300005456 Ga0070678_100205014 Ga0070678_1002050142 211
408 3300005456 Ga0070678_100424961 Ga0070678_1004249612 211
409 3300005457 Ga0070662_100001899 Ga0070662_1000018999 211
410 3300005457 Ga0070662_100109767 Ga0070662_1001097671 211
411 3300005457 Ga0070662_100398670 Ga0070662_1003986701 211
412 3300005458 Ga0070681_10159048 Ga0070681_101590483 211
413 3300005459 Ga0068867_100002089 Ga0068867_10000208914 211
414 3300005459 Ga0068867_100002384 Ga0068867_1000023849 211
415 3300005466 Ga0070685_10000280 Ga0070685_1000028015 211
416 3300005466 Ga0070685_10004000 Ga0070685_100040007 211
417 3300005467 Ga0070706_100003250 Ga0070706_10000325010 211
418 3300005471 Ga0070698_100038927 Ga0070698_1000389275 211
419 3300005471 Ga0070698_100457357 Ga0070698_1004573572 211
420 3300005518 Ga0070699_100021973 Ga0070699_1000219732 211
421 3300005530 Ga0070679_100319854 Ga0070679_1003198541 211
422 3300005535 Ga0070684_100127045 Ga0070684_1001270452 211
423 3300005535 Ga0070684_101079181 Ga0070684_1010791811 211
424 3300005539 Ga0068853_100004240 Ga0068853_1000042405 211
425 3300005539 Ga0068853_100100019 Ga0068853_1001000193 211
426 3300005539 Ga0068853_100172200 Ga0068853_1001722003 211
427 3300005539 Ga0068853_100216891 Ga0068853_1002168913 211
428 3300005539 Ga0068853_100305750 Ga0068853_1003057502 211
429 3300005539 Ga0068853_100810180 Ga0068853_1008101801 211
430 3300005543 Ga0070672_100000912 Ga0070672_10000091215 211
431 3300005543 Ga0070672_100025764 Ga0070672_1000257643 211
432 3300005544 Ga0070686_100000973 Ga0070686_10000097311 211
433 3300005544 Ga0070686_100059674 Ga0070686_1000596743 211
434 3300005546 Ga0070696_100014415 Ga0070696_1000144155 211
435 3300005546 Ga0070696_100023215 Ga0070696_1000232154 211
436 3300005547 Ga0070693_100204317 Ga0070693_1002043172 211
437 3300005548 Ga0070665_100010968 Ga0070665_1000109687 211
438 3300005548 Ga0070665_100022112 Ga0070665_1000221124 211
439 3300005548 Ga0070665_100258975 Ga0070665_1002589753 211
440 3300005563 Ga0068855_100001097 Ga0068855_10000109726 211
441 3300005563 Ga0068855_100023399 Ga0068855_1000233993 211
442 3300005563 Ga0068855_100440046 Ga0068855_1004400462 211
443 3300005564 Ga0070664_100003001 Ga0070664_10000300111 211
444 3300005564 Ga0070664_100010765 Ga0070664_1000107652 211
445 3300005564 Ga0070664_100028505 Ga0070664_1000285052 211
446 3300005564 Ga0070664_100062529 Ga0070664_1000625293 211
447 3300005577 Ga0068857_100121668 Ga0068857_1001216683 211
448 3300005577 Ga0068857_100385254 Ga0068857_1003852541 211
449 3300005578 Ga0068854_100023280 Ga0068854_1000232805 211
450 3300005578 Ga0068854_100049838 Ga0068854_1000498384 211
451 3300005614 Ga0068856_100003602 Ga0068856_1000036026 211
452 3300005614 Ga0068856_100004835 Ga0068856_10000483513 211
453 3300005614 Ga0068856_100066958 Ga0068856_1000669583 211
454 3300005614 Ga0068856_100139215 Ga0068856_1001392153 211
455 3300005615 Ga0070702_100001461 Ga0070702_1000014612 211
456 3300005615 Ga0070702_100068538 Ga0070702_1000685382 211
457 3300005615 Ga0070702_100094931 Ga0070702_1000949312 211
458 3300005615 Ga0070702_100231428 Ga0070702_1002314281 211
459 3300005616 Ga0068852_100023710 Ga0068852_1000237104 211
460 3300005616 Ga0068852_100125206 Ga0068852_1001252063 211
461 3300005616 Ga0068852_100135834 Ga0068852_1001358342 211
462 3300005616 Ga0068852_100322172 Ga0068852_1003221722 211
463 3300005617 Ga0068859_100003142 Ga0068859_1000031427 211
464 3300005617 Ga0068859_100007100 Ga0068859_10000710011 211
465 3300005617 Ga0068859_100024433 Ga0068859_1000244334 211
466 3300005618 Ga0068864_100004336 Ga0068864_1000043364 211
467 3300005618 Ga0068864_100006912 Ga0068864_1000069122 211
468 3300005718 Ga0068866_10000632 Ga0068866_100006327 211
469 3300005718 Ga0068866_10003761 Ga0068866_100037612 211
470 3300005718 Ga0068866_10032069 Ga0068866_100320692 211
471 3300005719 Ga0068861_100004985 Ga0068861_1000049855 211
472 3300005719 Ga0068861_100077602 Ga0068861_1000776022 211
473 3300005719 Ga0068861_100581050 Ga0068861_1005810502 211
474 3300005834 Ga0068851_10001169 Ga0068851_100011692 211
475 3300005834 Ga0068851_10004676 Ga0068851_100046763 211
476 3300005834 Ga0068851_10037191 Ga0068851_100371912 211
477 3300005834 Ga0068851_10055432 Ga0068851_100554322 211
478 3300005834 Ga0068851_10123578 Ga0068851_101235782 211
479 3300005840 Ga0068870_10010668 Ga0068870_100106684 211
480 3300005840 Ga0068870_10089571 Ga0068870_100895712 211
481 3300005840 Ga0068870_10157105 Ga0068870_101571052 211
482 3300005841 Ga0068863_100001304 Ga0068863_10000130417 211
483 3300005841 Ga0068863_100003845 Ga0068863_10000384514 211
484 3300005841 Ga0068863_100069978 Ga0068863_1000699784 211
485 3300005842 Ga0068858_100000652 Ga0068858_10000065226 211
486 3300005842 Ga0068858_100006770 Ga0068858_10000677013 211
487 3300005842 Ga0068858_100030416 Ga0068858_1000304164 211
488 3300005843 Ga0068860_100004322 Ga0068860_10000432214 211
489 3300005843 Ga0068860_100020811 Ga0068860_1000208117 211
490 3300005843 Ga0068860_100040991 Ga0068860_1000409912 211
491 3300005843 Ga0068860_100358405 Ga0068860_1003584052 211
492 3300005844 Ga0068862_100002384 Ga0068862_1000023849 211
493 3300005844 Ga0068862_100042079 Ga0068862_1000420792 211
494 3300005844 Ga0068862_100271715 Ga0068862_1002717152 211
495 3300005844 Ga0068862_100618267 Ga0068862_1006182672 211
496 3300005985 Ga0081539_10027713 Ga0081539_100277134 211
497 3300006048 Ga0075363_100443198 Ga0075363_1004431981 211
498 3300006163 Ga0070715_10000885 Ga0070715_100008857 211
499 3300006175 Ga0070712_100005914 Ga0070712_1000059144 211
500 3300006175 Ga0070712_100038639 Ga0070712_1000386393 211
501 3300006195 Ga0075366_10029069 Ga0075366_100290693 211
502 3300006237 Ga0097621_100002419 Ga0097621_1000024194 211
503 3300006237 Ga0097621_100002825 Ga0097621_1000028255 211
504 3300006237 Ga0097621_100020672 Ga0097621_1000206726 211
505 3300006237 Ga0097621_100265158 Ga0097621_1002651582 211
506 3300006358 Ga0068871_100001447 Ga0068871_10000144711 211
507 3300006358 Ga0068871_100005154 Ga0068871_1000051547 211
508 3300006358 Ga0068871_100108277 Ga0068871_1001082773 211
509 3300006844 Ga0075428_100063847 Ga0075428_1000638475 211
510 3300006871 Ga0075434_100056642 Ga0075434_1000566424 211
511 3300006871 Ga0075434_100360468 Ga0075434_1003604682 211
512 3300006871 Ga0075434_100578741 Ga0075434_1005787412 211
513 3300006880 Ga0075429_100030854 Ga0075429_1000308546 211
514 3300006881 Ga0068865_100000305 Ga0068865_10000030510 211
515 3300006881 Ga0068865_100006566 Ga0068865_1000065663 211
516 3300006881 Ga0068865_100053296 Ga0068865_1000532963 211
517 3300006931 Ga0097620_100003142 Ga0097620_1000031427 211
518 3300006931 Ga0097620_100007100 Ga0097620_10000710011 211
519 3300006931 Ga0097620_100024433 Ga0097620_1000244335 211
520 3300009093 Ga0105240_10014974 Ga0105240_100149742 211
521 3300009093 Ga0105240_10108406 Ga0105240_101084064 211
522 3300009093 Ga0105240_10174218 Ga0105240_101742182 211
523 3300009094 Ga0111539_10028863 Ga0111539_100288637 211
524 3300009094 Ga0111539_10192785 Ga0111539_101927853 211
525 3300009098 Ga0105245_10008300 Ga0105245_100083004 211
526 3300009098 Ga0105245_10950510 Ga0105245_109505101 211
527 3300009101 Ga0105247_10010870 Ga0105247_100108706 211
528 3300009147 Ga0114129_10103578 Ga0114129_101035782 211
529 3300009147 Ga0114129_10988474 Ga0114129_109884742 211
530 3300009147 Ga0114129_11331391 Ga0114129_113313911 211
531 3300009148 Ga0105243_10004538 Ga0105243_100045385 211
532 3300009174 Ga0105241_10006534 Ga0105241_100065346 211
533 3300009176 Ga0105242_10029601 Ga0105242_100296013 211
534 3300009176 Ga0105242_10079223 Ga0105242_100792232 211
535 3300009177 Ga0105248_10030473 Ga0105248_100304733 211
536 3300009177 Ga0105248_10034915 Ga0105248_100349155 211
537 3300009177 Ga0105248_10130909 Ga0105248_101309093 211
538 3300009177 Ga0105248_10131205 Ga0105248_101312053 211
539 3300009177 Ga0105248_10315236 Ga0105248_103152362 211
540 3300009545 Ga0105237_10251426 Ga0105237_102514262 211
541 3300009545 Ga0105237_10512691 Ga0105237_105126912 211
542 3300009545 Ga0105237_11121596 Ga0105237_111215961 211
543 3300009551 Ga0105238_10007180 Ga0105238_1000718011 211
544 3300009551 Ga0105238_10071679 Ga0105238_100716795 211
545 3300009553 Ga0105249_10009105 Ga0105249_100091055 211
546 3300009553 Ga0105249_10232227 Ga0105249_102322271 211
547 3300010375 Ga0105239_10021898 Ga0105239_100218984 211
548 3300010375 Ga0105239_10058956 Ga0105239_100589564 211
549 3300010375 Ga0105239_10119122 Ga0105239_101191222 211
550 3300010375 Ga0105239_10535735 Ga0105239_105357352 211
551 3300011119 Ga0105246_10065155 Ga0105246_100651552 211
552 3300011119 Ga0105246_10752466 Ga0105246_107524662 211
553 3300013100 Ga0157373_10005110 Ga0157373_100051104 211
554 3300013100 Ga0157373_10064475 Ga0157373_100644754 211
555 3300013102 Ga0157371_10000330 Ga0157371_1000033040 211
556 3300013102 Ga0157371_10132508 Ga0157371_101325083 211
557 3300013102 Ga0157371_10634718 Ga0157371_106347182 211
558 3300013104 Ga0157370_10027517 Ga0157370_100275173 211
559 3300013104 Ga0157370_10063967 Ga0157370_100639672 211
560 3300013105 Ga0157369_10017713 Ga0157369_100177136 211
561 3300013105 Ga0157369_10161662 Ga0157369_101616622 211
562 3300013105 Ga0157369_10232934 Ga0157369_102329344 211
563 3300013105 Ga0157369_10366923 Ga0157369_103669232 211
564 3300013105 Ga0157369_10496390 Ga0157369_104963902 211
565 3300013296 Ga0157374_10000286 Ga0157374_1000028622 211
566 3300013296 Ga0157374_10002810 Ga0157374_100028103 211
567 3300013296 Ga0157374_10040877 Ga0157374_100408774 211
568 3300013296 Ga0157374_10158128 Ga0157374_101581282 211
569 3300013296 Ga0157374_10236500 Ga0157374_102365002 211
570 3300013297 Ga0157378_10001140 Ga0157378_100011408 211
571 3300013297 Ga0157378_10056612 Ga0157378_100566123 211
572 3300013297 Ga0157378_10076042 Ga0157378_100760423 211
573 3300013297 Ga0157378_10123996 Ga0157378_101239963 211
574 3300013297 Ga0157378_10143688 Ga0157378_101436882 211
575 3300013306 Ga0163162_10003799 Ga0163162_100037994 211
576 3300013306 Ga0163162_10158951 Ga0163162_101589514 211
577 3300013306 Ga0163162_10161614 Ga0163162_101616143 211
578 3300013306 Ga0163162_11186080 Ga0163162_111860801 211
579 3300013307 Ga0157372_10018145 Ga0157372_100181457 211
580 3300013307 Ga0157372_10203107 Ga0157372_102031073 211
581 3300013307 Ga0157372_10247440 Ga0157372_102474403 211
582 3300013308 Ga0157375_10029021 Ga0157375_100290212 211
583 3300013308 Ga0157375_10061001 Ga0157375_100610014 211
584 3300014325 Ga0163163_10022213 Ga0163163_100222132 211
585 3300014325 Ga0163163_10035753 Ga0163163_100357535 211
586 3300014325 Ga0163163_10128168 Ga0163163_101281683 211
587 3300014326 Ga0157380_10000449 Ga0157380_1000044915 211
588 3300014326 Ga0157380_10066986 Ga0157380_100669863 211
589 3300014497 Ga0182008_10267819 Ga0182008_102678191 211
590 3300014745 Ga0157377_10214265 Ga0157377_102142652 211
591 3300014968 Ga0157379_10020080 Ga0157379_100200803 211
592 3300014968 Ga0157379_10034811 Ga0157379_100348114 211
593 3300014968 Ga0157379_10373771 Ga0157379_103737712 211
594 3300014969 Ga0157376_10008963 Ga0157376_100089636 211
595 3300014969 Ga0157376_10136242 Ga0157376_101362422 211
596 3300014969 Ga0157376_11057459 Ga0157376_110574592 211
597 3300017792 Ga0163161_10021490 Ga0163161_100214904 211
598 3300020081 Ga0206354_11167538 Ga0206354_111675382 211
599 3300025315 Ga0207697_10018755 Ga0207697_100187553 211
600 3300025321 Ga0207656_10004890 Ga0207656_100048904 211
601 3300025321 Ga0207656_10018064 Ga0207656_100180642 211
602 3300025321 Ga0207656_10173677 Ga0207656_101736772 211
603 3300025321 Ga0207656_10256049 Ga0207656_102560492 211
604 3300025893 Ga0207682_10001309 Ga0207682_1000130910 211
605 3300025898 Ga0207692_10119800 Ga0207692_101198002 211
606 3300025898 Ga0207692_10148269 Ga0207692_101482692 211
607 3300025899 Ga0207642_10000855 Ga0207642_1000085510 211
608 3300025900 Ga0207710_10261838 Ga0207710_102618381 211
609 3300025901 Ga0207688_10000064 Ga0207688_1000006425 211
610 3300025903 Ga0207680_10002662 Ga0207680_100026629 211
611 3300025903 Ga0207680_10008244 Ga0207680_100082445 211
612 3300025903 Ga0207680_10144850 Ga0207680_101448502 211
613 3300025906 Ga0207699_10022518 Ga0207699_100225183 211
614 3300025906 Ga0207699_10082855 Ga0207699_100828553 211
615 3300025906 Ga0207699_10106843 Ga0207699_101068433 211
616 3300025907 Ga0207645_10000517 Ga0207645_1000051731 211
617 3300025907 Ga0207645_10004266 Ga0207645_1000426610 211
618 3300025908 Ga0207643_10000593 Ga0207643_1000059313 211
619 3300025908 Ga0207643_10061840 Ga0207643_100618402 211
620 3300025908 Ga0207643_10079348 Ga0207643_100793482 211
621 3300025909 Ga0207705_10065087 Ga0207705_100650874 211
622 3300025909 Ga0207705_10290055 Ga0207705_102900552 211
623 3300025910 Ga0207684_10020548 Ga0207684_100205483 211
624 3300025911 Ga0207654_10012461 Ga0207654_100124613 211
625 3300025912 Ga0207707_10001948 Ga0207707_100019483 211
626 3300025912 Ga0207707_10177929 Ga0207707_101779292 211
627 3300025913 Ga0207695_10006723 Ga0207695_100067236 211
628 3300025913 Ga0207695_10191046 Ga0207695_101910462 211
629 3300025914 Ga0207671_10330991 Ga0207671_103309912 211
630 3300025915 Ga0207693_10003485 Ga0207693_100034859 211
631 3300025915 Ga0207693_10043597 Ga0207693_100435973 211
632 3300025916 Ga0207663_10013001 Ga0207663_100130013 211
633 3300025917 Ga0207660_10007884 Ga0207660_100078842 211
634 3300025918 Ga0207662_10004084 Ga0207662_100040841 211
635 3300025918 Ga0207662_10022451 Ga0207662_100224513 211
636 3300025918 Ga0207662_10046069 Ga0207662_100460693 211
637 3300025919 Ga0207657_10000745 Ga0207657_1000074515 211
638 3300025919 Ga0207657_10000927 Ga0207657_100009277 211
639 3300025919 Ga0207657_10033548 Ga0207657_100335484 211
640 3300025919 Ga0207657_10061986 Ga0207657_100619863 211
641 3300025920 Ga0207649_10046725 Ga0207649_100467252 211
642 3300025920 Ga0207649_10131544 Ga0207649_101315442 211
643 3300025920 Ga0207649_10235537 Ga0207649_102355372 211
644 3300025921 Ga0207652_10013940 Ga0207652_100139406 211
645 3300025921 Ga0207652_10169230 Ga0207652_101692302 211
646 3300025921 Ga0207652_10178783 Ga0207652_101787832 211
647 3300025921 Ga0207652_10218140 Ga0207652_102181402 211
648 3300025923 Ga0207681_10007743 Ga0207681_100077432 211
649 3300025923 Ga0207681_10083857 Ga0207681_100838572 211
650 3300025923 Ga0207681_10725148 Ga0207681_107251482 211
651 3300025924 Ga0207694_10016717 Ga0207694_100167175 211
652 3300025925 Ga0207650_10005701 Ga0207650_100057018 211
653 3300025925 Ga0207650_10012515 Ga0207650_100125153 211
654 3300025925 Ga0207650_10012972 Ga0207650_100129724 211
655 3300025925 Ga0207650_10038721 Ga0207650_100387213 211
656 3300025925 Ga0207650_10062656 Ga0207650_100626562 211
657 3300025925 Ga0207650_10276376 Ga0207650_102763762 211
658 3300025926 Ga0207659_10008481 Ga0207659_100084814 211
659 3300025926 Ga0207659_10039126 Ga0207659_100391263 211
660 3300025926 Ga0207659_10039639 Ga0207659_100396394 211
661 3300025926 Ga0207659_10180953 Ga0207659_101809532 211
662 3300025926 Ga0207659_10304532 Ga0207659_103045322 211
663 3300025926 Ga0207659_10415873 Ga0207659_104158732 211
664 3300025927 Ga0207687_10000800 Ga0207687_100008004 211
665 3300025927 Ga0207687_10478042 Ga0207687_104780422 211
666 3300025928 Ga0207700_10000073 Ga0207700_1000007348 211
667 3300025928 Ga0207700_10444260 Ga0207700_104442602 211
668 3300025929 Ga0207664_10015163 Ga0207664_100151634 211
669 3300025931 Ga0207644_10002067 Ga0207644_100020677 211
670 3300025931 Ga0207644_10014673 Ga0207644_100146736 211
671 3300025931 Ga0207644_10040602 Ga0207644_100406023 211
672 3300025931 Ga0207644_10048940 Ga0207644_100489402 211
673 3300025931 Ga0207644_10195795 Ga0207644_101957952 211
674 3300025931 Ga0207644_10771129 Ga0207644_107711292 211
675 3300025932 Ga0207690_10001061 Ga0207690_1000106114 211
676 3300025932 Ga0207690_10008488 Ga0207690_100084883 211
677 3300025932 Ga0207690_10128236 Ga0207690_101282362 211
678 3300025932 Ga0207690_10456793 Ga0207690_104567931 211
679 3300025932 Ga0207690_10469206 Ga0207690_104692062 211
680 3300025932 Ga0207690_10485170 Ga0207690_104851701 211
681 3300025933 Ga0207706_10000023 Ga0207706_100000239 211
682 3300025933 Ga0207706_10000585 Ga0207706_1000058526 211
683 3300025933 Ga0207706_10267134 Ga0207706_102671342 211
684 3300025933 Ga0207706_10962515 Ga0207706_109625151 211
685 3300025934 Ga0207686_10002242 Ga0207686_100022427 211
686 3300025934 Ga0207686_10623116 Ga0207686_106231162 211
687 3300025935 Ga0207709_10005847 Ga0207709_100058474 211
688 3300025936 Ga0207670_10015865 Ga0207670_100158654 211
689 3300025936 Ga0207670_10021052 Ga0207670_100210522 211
690 3300025936 Ga0207670_10063507 Ga0207670_100635073 211
691 3300025937 Ga0207669_10034323 Ga0207669_100343233 211
692 3300025938 Ga0207704_10001417 Ga0207704_100014176 211
693 3300025938 Ga0207704_10026988 Ga0207704_100269883 211
694 3300025938 Ga0207704_10067624 Ga0207704_100676242 211
695 3300025940 Ga0207691_10000688 Ga0207691_100006884 211
696 3300025940 Ga0207691_10013470 Ga0207691_100134707 211
697 3300025940 Ga0207691_10014621 Ga0207691_100146215 211
698 3300025941 Ga0207711_10000087 Ga0207711_1000008744 211
699 3300025941 Ga0207711_10022461 Ga0207711_100224616 211
700 3300025941 Ga0207711_10081565 Ga0207711_100815653 211
701 3300025942 Ga0207689_10000069 Ga0207689_1000006925 211
702 3300025942 Ga0207689_10000642 Ga0207689_1000064221 211
703 3300025942 Ga0207689_10027555 Ga0207689_100275555 211
704 3300025944 Ga0207661_10010000 Ga0207661_100100006 211
705 3300025945 Ga0207679_10013781 Ga0207679_100137816 211
706 3300025945 Ga0207679_10051343 Ga0207679_100513433 211
707 3300025945 Ga0207679_10067061 Ga0207679_100670613 211
708 3300025945 Ga0207679_10105109 Ga0207679_101051093 211
709 3300025945 Ga0207679_10174401 Ga0207679_101744012 211
710 3300025945 Ga0207679_10653644 Ga0207679_106536442 211
711 3300025949 Ga0207667_10001383 Ga0207667_1000138311 211
712 3300025949 Ga0207667_10008157 Ga0207667_100081572 211
713 3300025949 Ga0207667_10026225 Ga0207667_100262256 211
714 3300025949 Ga0207667_10299919 Ga0207667_102999193 211
715 3300025949 Ga0207667_10356438 Ga0207667_103564382 211
716 3300025960 Ga0207651_10007432 Ga0207651_100074325 211
717 3300025960 Ga0207651_10076905 Ga0207651_100769053 211
718 3300025960 Ga0207651_10080674 Ga0207651_100806743 211
719 3300025961 Ga0207712_10021014 Ga0207712_100210144 211
720 3300025972 Ga0207668_10013121 Ga0207668_100131214 211
721 3300025972 Ga0207668_10121321 Ga0207668_101213213 211
722 3300025981 Ga0207640_10093279 Ga0207640_100932792 211
723 3300025981 Ga0207640_10285338 Ga0207640_102853382 211
724 3300025986 Ga0207658_10025203 Ga0207658_100252034 211
725 3300025986 Ga0207658_10152481 Ga0207658_101524812 211
726 3300025986 Ga0207658_10247727 Ga0207658_102477272 211
727 3300026023 Ga0207677_10000700 Ga0207677_100007003 211
728 3300026023 Ga0207677_10007124 Ga0207677_100071244 211
729 3300026023 Ga0207677_10286087 Ga0207677_102860872 211
730 3300026023 Ga0207677_10360332 Ga0207677_103603322 211
731 3300026023 Ga0207677_10557167 Ga0207677_105571672 211
732 3300026035 Ga0207703_10004909 Ga0207703_1000490910 211
733 3300026035 Ga0207703_10005565 Ga0207703_100055656 211
734 3300026035 Ga0207703_10013743 Ga0207703_100137434 211
735 3300026035 Ga0207703_10018715 Ga0207703_100187155 211
736 3300026041 Ga0207639_10010939 Ga0207639_100109396 211
737 3300026041 Ga0207639_10014491 Ga0207639_100144913 211
738 3300026041 Ga0207639_10144669 Ga0207639_101446692 211
739 3300026041 Ga0207639_10397560 Ga0207639_103975602 211
740 3300026067 Ga0207678_10001787 Ga0207678_1000178710 211
741 3300026067 Ga0207678_10012488 Ga0207678_100124883 211
742 3300026067 Ga0207678_10058005 Ga0207678_100580052 211
743 3300026067 Ga0207678_10132633 Ga0207678_101326332 211
744 3300026067 Ga0207678_10296284 Ga0207678_102962842 211
745 3300026075 Ga0207708_10000102 Ga0207708_1000010247 211
746 3300026075 Ga0207708_10002194 Ga0207708_1000219413 211
747 3300026078 Ga0207702_10004398 Ga0207702_100043988 211
748 3300026078 Ga0207702_10020136 Ga0207702_100201365 211
749 3300026078 Ga0207702_10085787 Ga0207702_100857873 211
750 3300026088 Ga0207641_10683779 Ga0207641_106837791 211
751 3300026089 Ga0207648_10000048 Ga0207648_1000004852 211
752 3300026089 Ga0207648_10005941 Ga0207648_100059419 211
753 3300026089 Ga0207648_10006307 Ga0207648_100063073 211
754 3300026095 Ga0207676_10000140 Ga0207676_1000014014 211
755 3300026095 Ga0207676_10014793 Ga0207676_100147935 211
756 3300026095 Ga0207676_10244230 Ga0207676_102442302 211
757 3300026116 Ga0207674_10000429 Ga0207674_100004296 211
758 3300026116 Ga0207674_10004730 Ga0207674_1000473013 211
759 3300026116 Ga0207674_10115494 Ga0207674_101154943 211
760 3300026116 Ga0207674_10530958 Ga0207674_105309581 211
761 3300026118 Ga0207675_100000527 Ga0207675_10000052722 211
762 3300026118 Ga0207675_100005190 Ga0207675_1000051905 211
763 3300026118 Ga0207675_100096997 Ga0207675_1000969972 211
764 3300026121 Ga0207683_10000258 Ga0207683_100002584 211
765 3300026121 Ga0207683_10007413 Ga0207683_100074138 211
766 3300026121 Ga0207683_10019835 Ga0207683_100198354 211
767 3300026121 Ga0207683_10048403 Ga0207683_100484033 211
768 3300026121 Ga0207683_10585378 Ga0207683_105853782 211
769 3300026142 Ga0207698_10025921 Ga0207698_100259214 211
770 3300026142 Ga0207698_10027312 Ga0207698_100273123 211
771 3300026142 Ga0207698_10083504 Ga0207698_100835043 211
772 3300026142 Ga0207698_10176926 Ga0207698_101769263 211
773 3300026142 Ga0207698_10371191 Ga0207698_103711912 211
774 3300026142 Ga0207698_10474750 Ga0207698_104747502 211
775 3300026142 Ga0207698_10484567 Ga0207698_104845672 211
776 3300027682 Ga0209971_1006278 Ga0209971_10062783 211
777 3300027876 Ga0209974_10026864 Ga0209974_100268642 211
778 3300027907 Ga0207428_10012525 Ga0207428_100125252 211
779 3300028379 Ga0268266_10025724 Ga0268266_100257244 211
780 3300028379 Ga0268266_10106968 Ga0268266_101069682 211
781 3300028379 Ga0268266_10286865 Ga0268266_102868652 211
782 3300028380 Ga0268265_10015056 Ga0268265_100150563 211
783 3300028380 Ga0268265_10038563 Ga0268265_100385632 211
784 3300028381 Ga0268264_10008062 Ga0268264_100080625 211
785 3300028381 Ga0268264_10017643 Ga0268264_100176434 211
786 3300028381 Ga0268264_10843934 Ga0268264_108439341 211
787 3300031548 Ga0307408_100195641 Ga0307408_1001956413 211
788 3300031824 Ga0307413_10065374 Ga0307413_100653744 211
789 3300031852 Ga0307410_10013194 Ga0307410_100131946 211
790 3300031901 Ga0307406_10014179 Ga0307406_100141795 211
791 3300031903 Ga0307407_10006770 Ga0307407_100067704 211
792 3300031911 Ga0307412_10047662 Ga0307412_100476623 211
793 3300031995 Ga0307409_100016686 Ga0307409_1000166867 211
794 3300032002 Ga0307416_100014686 Ga0307416_1000146865 211
795 3300032004 Ga0307414_10120681 Ga0307414_101206813 211
796 3300032005 Ga0307411_10016744 Ga0307411_100167444 211
797 3300035086 Ga0373934_0148616 Ga0373934_0148616_235_882 211
798 3300035111 Ga0373923_0077260 Ga0373923_0077260_142_789 211
799 3300035113 Ga0373936_0017734 Ga0373936_0017734_1738_2388 211
800 3300035117 Ga0373953_0016078 Ga0373953_0016078_243_893 211
801 3300035118 Ga0373954_0000495 Ga0373954_0000495_142_792 211
802 3300035118 Ga0373954_0046201 Ga0373954_0046201_117_752 211
803 3300035119 Ga0373956_0017278 Ga0373956_0017278_874_1521 211
804 3300035120 Ga0373957_0010986 Ga0373957_0010986_1560_2210 211
805 3300035121 Ga0373960_0077176 Ga0373960_0077176_36_671 211
806 3300035170 Ga0373943_0212706 Ga0373943_0212706_421_1056 211
807 3300035172 Ga0373955_0002775 Ga0373955_0002775_6277_6924 211
808 3300035172 Ga0373955_0146636 Ga0373955_0146636_128_763 211
809 3300035172 Ga0373955_0219442 Ga0373955_0219442_423_1070 211
810 3300035410 Ga0373924_0009262 Ga0373924_0009262_2796_3446 211
811 3300035691 Ga0373931_0068163 Ga0373931_0068163_1125_1763 211
812 3300035692 Ga0373935_0414952 Ga0373935_0414952_57_692 211
813 3300035695 Ga0373927_0323704 Ga0373927_0323704_162_797 211
814 3300035724 Ga0373933_0007482 Ga0373933_0007482_3852_4502 211
815 3300035724 Ga0373933_0177656 Ga0373933_0177656_472_1107 211
816 3300035725 Ga0373947_0172210 Ga0373947_0172210_285_920 211
817 3300035725 Ga0373947_0176670 Ga0373947_0176670_569_1219 211
818 3300036401 Ga0373937_0003673 Ga0373937_0003673_7005_7652 211
819 3300036401 Ga0373937_0197746 Ga0373937_0197746_479_1129 211
820 3300036401 Ga0373937_0282294 Ga0373937_0282294_715_1350 211
821 3300036401 Ga0373937_0404930 Ga0373937_0404930_443_1078 211
822 3300037068 Ga0373925_0032323 Ga0373925_0032323_546_1181 211
823 3300037068 Ga0373925_0557647 Ga0373925_0557647_74_724 211
824 3300037312 Ga0395899_0094005 Ga0395899_0094005_87_725 211
825 3300037418 Ga0395900_0279153 Ga0395900_0279153_508_1152 211
826 3300037466 Ga0395898_0128534 Ga0395898_0128534_1320_1958 211
827 3300037466 Ga0395898_0245420 Ga0395898_0245420_735_1379 211
828 3300037471 Ga0395905_0101849 Ga0395905_0101849_1133_1771 211
829 3300037471 Ga0395905_0163713 Ga0395905_0163713_1061_1705 211
830 3300038443 Ga0395901_0215998 Ga0395901_0215998_869_1513 211
831 3300041486 Ga0451807_1798842 Ga0451807_1798842_618_1268 211
832 3300045836 Ga0466958_0154382 Ga0466958_0154382_509_1186 211
833 3300046462 Ga0495651_0332618 Ga0495651_0332618_233_880 211
834 3300046472 Ga0495580_0217320 Ga0495580_0217320_207_842 211
835 3300046477 Ga0495664_0056002 Ga0495664_0056002_456_1106 211
836 3300046477 Ga0495664_0069842 Ga0495664_0069842_502_1152 211
837 3300046539 Ga0495621_0031615 Ga0495621_0031615_524_1159 211
838 3300046679 Ga0495623_0043132 Ga0495623_0043132_1462_2112 211
839 3300046681 Ga0495647_0130193 Ga0495647_0130193_363_1001 211
840 3300047319 Ga0495674_0601374 Ga0495674_0601374_125_772 211
841 3300047444 Ga0495675_0167218 Ga0495675_0167218_410_1060 211
842 3300047471 Ga0495684_0433600 Ga0495684_0433600_161_811 211
843 3300048903 Ga0496100_0033781 Ga0496100_0033781_864_1499 211
844 3300048904 Ga0496101_0015013 Ga0496101_0015013_3190_3840 211
845 3300048904 Ga0496101_0241640 Ga0496101_0241640_426_1061 211
846 3300048905 Ga0496102_0056849 Ga0496102_0056849_2295_2930 211
847 3300048905 Ga0496102_0058024 Ga0496102_0058024_2029_2664 211
848 3300048906 Ga0496103_0075656 Ga0496103_0075656_1165_1800 211
849 3300048907 Ga0496104_0008001 Ga0496104_0008001_3696_4343 211
850 3300048907 Ga0496104_0026945 Ga0496104_0026945_538_1173 211
851 3300048908 Ga0496105_0012713 Ga0496105_0012713_1775_2410 211
852 3300048908 Ga0496105_0107189 Ga0496105_0107189_1361_2011 211
853 3300048909 Ga0496106_0000852 Ga0496106_0000852_17183_17818 211
854 3300048909 Ga0496106_0081744 Ga0496106_0081744_28_663 211
855 3300048910 Ga0496107_0021694 Ga0496107_0021694_899_1534 211
856 3300048910 Ga0496107_0067426 Ga0496107_0067426_1789_2436 211
857 3300048911 Ga0496108_0019587 Ga0496108_0019587_378_1013 211
858 3300048911 Ga0496108_0321395 Ga0496108_0321395_526_1161 211
859 3300048912 Ga0496109_0019713 Ga0496109_0019713_984_1631 211
860 3300048912 Ga0496109_0264746 Ga0496109_0264746_279_914 211
861 3300048912 Ga0496109_0477369 Ga0496109_0477369_390_1025 211
862 3300048913 Ga0496110_0092598 Ga0496110_0092598_344_979 211
863 3300048913 Ga0496110_0160414 Ga0496110_0160414_1105_1740 211
864 3300048915 Ga0496112_0005376 Ga0496112_0005376_4586_5233 211
865 3300048916 Ga0496113_0301136 Ga0496113_0301136_564_1208 211
866 3300048916 Ga0496113_0550787 Ga0496113_0550787_271_906 211
867 3300048917 Ga0496114_0120452 Ga0496114_0120452_1293_1928 211
868 3300048917 Ga0496114_0187330 Ga0496114_0187330_765_1415 211
869 3300048917 Ga0496114_0250926 Ga0496114_0250926_217_852 211
870 3300048917 Ga0496114_0627911 Ga0496114_0627911_116_751 211
871 3300048918 Ga0496115_0047387 Ga0496115_0047387_1462_2109 211
872 3300049571 Ga0501034_0000456 Ga0501034_0000456_62035_62673 211
873 3300049572 Ga0501036_0339697 Ga0501036_0339697_430_1101 211
874 3300049575 Ga0501039_0374436 Ga0501039_0374436_201_839 211
875 3300049584 Ga0501068_0000960 Ga0501068_0000960_3663_4301 211
876 3300049586 Ga0501070_0225770 Ga0501070_0225770_605_1243 211
877 3300049588 Ga0501072_0003561 Ga0501072_0003561_607_1245 211
878 3300049589 Ga0501073_0001375 Ga0501073_0001375_6180_6818 211
879 3300049593 Ga0501077_0190580 Ga0501077_0190580_634_1272 211
880 3300049742 Ga0501080_0001249 Ga0501080_0001249_8106_8744 211
881 3300049742 Ga0501080_0721341 Ga0501080_0721341_197_835 211
882 3300049744 Ga0501083_0209491 Ga0501083_0209491_409_1047 211
883 3300049823 Ga0501044_0440135 Ga0501044_0440135_505_1176 211
884 3300050493 nmdc:mga0k408_8363_c1 nmdc:mga0k408_8363_c1_4572_5210 211
885 3300050507 nmdc:mga05p37_46494_c1 nmdc:mga05p37_46494_c1_556_1200 211
886 3300050508 nmdc:mga09592_26270_c1 nmdc:mga09592_26270_c1_3713_4357 211
887 3300050511 nmdc:mga08y16_105543_c1 nmdc:mga08y16_105543_c1_641_1285 211
888 3300050511 nmdc:mga08y16_51927_c1 nmdc:mga08y16_51927_c1_3080_3715 211
889 3300050512 nmdc:mga0n895_346972_c1 nmdc:mga0n895_346972_c1_383_1018 211
890 3300050512 nmdc:mga0n895_459037_c1 nmdc:mga0n895_459037_c1_290_937 211
891 3300050512 nmdc:mga0n895_634708_c1 nmdc:mga0n895_634708_c1_83_718 211
892 3300050513 nmdc:mga0rr50_400513_c1 nmdc:mga0rr50_400513_c1_102_737 211
893 3300053077 Ga0495601_0073833 Ga0495601_0073833_502_1152 211
894 3300053084 Ga0495595_0182127 Ga0495595_0182127_140_775 211
895 3300053085 Ga0495619_0400538 Ga0495619_0400538_24_659 211
896 3300054114 Ga0501084_0156004 Ga0501084_0156004_1252_1890 211
897 3300060353 Ga0501082_0044702 Ga0501082_0044702_296_934 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

142

207

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

21

96

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

30

97

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

25

103

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

126

212

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9471 2 196
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9372 4 198
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9366 2 198
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9363 2 198
4f0c-assembly1.cif.gz_A-2 crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium 0.9359 1 194
ID Description Score Start End Superfamily
af_Q54JU2_4_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9708 4 81 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 7 75 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9639 7 80 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9584 2 77 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9581 4 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A536ZHK8-F1-model_v4 Glutathione S-transferase 0.9943 1 208 GO:0016740
AF-A0A537C7K6-F1-model_v4 Glutathione S-transferase family protein 0.9887 1 211 GO:0016740
AF-A0A2Z2NWW5-F1-model_v4 Glutathione S-transferase GST-4.5 (EC 2.5.1.18) 0.9818 21 207 GO:0004364
AF-A0A3N5HRF6-F1-model_v4 Glutathione S-transferase 0.9812 1 175 GO:0016740
AF-A0A3C1AKK6-F1-model_v4 deleted 0.9802 1 203

Feature Viewer

pLDDT pTM Quality
96.76 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map