F484942

General Info

Members Datasets Scaffolds Average Seq Length
894 350 894 115

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10266818|Ga0307405_102668182
Length 102
Sequence MPKIRVLPHAALCPQGAEIDAESGVSICDTLLANHIEIEHACEKQAACTTCHVIVRKGFDSLDDASEKEEDMLDKAKMAAEDLTIEIPKYTINYEREGGGKK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
230 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
231 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
232 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
239 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
283 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
284 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
293 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
323 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
327 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
328 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0.45
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10489792 3300005290 Bacteria 641
2 Ga0065715_11104991 3300005293 Bacteria 519
3 Ga0065707_10110299 3300005295 Bacteria 2435
4 Ga0065707_10209799 3300005295 Bacteria 1271
5 Ga0065707_10267281 3300005295 Bacteria 1081
6 Ga0065707_10279404 3300005295 Bacteria 1051
7 Ga0065707_10313736 3300005295 Bacteria 965
8 Ga0065707_10811619 3300005295 Bacteria 595
9 Ga0070676_10395485 3300005328 Bacteria 960
10 Ga0070683_101289846 3300005329 Bacteria 702
11 Ga0070690_100000048 3300005330 Bacteria 57196
12 Ga0070690_100346623 3300005330 Bacteria 1077
13 Ga0070690_100855288 3300005330 Bacteria 709
14 Ga0070670_100695653 3300005331 Bacteria 914
15 Ga0070670_101242777 3300005331 Bacteria 681
16 Ga0070677_10637978 3300005333 Bacteria 594
17 Ga0068869_100003924 3300005334 Bacteria 9183
18 Ga0068869_100776335 3300005334 Bacteria 822
19 Ga0070666_10070556 3300005335 Bacteria 2377
20 Ga0070680_100002906 3300005336 Bacteria 12727
21 Ga0070680_100057644 3300005336 Bacteria 3176
22 Ga0070680_100144219 3300005336 Bacteria 1997
23 Ga0070682_100059435 3300005337 Bacteria 2415
24 Ga0068868_100000169 3300005338 Bacteria 42949
25 Ga0070689_100052142 3300005340 Bacteria 3164
26 Ga0070689_100105537 3300005340 Bacteria 2234
27 Ga0070689_100222797 3300005340 Bacteria 1548
28 Ga0070689_100345415 3300005340 Bacteria 1247
29 Ga0070691_10005631 3300005341 Bacteria 5707
30 Ga0070691_10226632 3300005341 Bacteria 993
31 Ga0070691_10228333 3300005341 Bacteria 989
32 Ga0070687_100000112 3300005343 Bacteria 27473
33 Ga0070687_100058394 3300005343 Bacteria 2027
34 Ga0070687_100318314 3300005343 Bacteria 993
35 Ga0070687_100357092 3300005343 Bacteria 945
36 Ga0070687_100375502 3300005343 Bacteria 925
37 Ga0070687_100554930 3300005343 Bacteria 782
38 Ga0070692_10000771 3300005345 Bacteria 10540
39 Ga0070692_10004733 3300005345 Bacteria 5710
40 Ga0070692_10472927 3300005345 Bacteria 807
41 Ga0070692_11153104 3300005345 Bacteria 550
42 Ga0070668_100118907 3300005347 Bacteria 2110
43 Ga0070669_100070052 3300005353 Bacteria 2592
44 Ga0070669_100357508 3300005353 Bacteria 1187
45 Ga0070669_100573438 3300005353 Bacteria 943
46 Ga0070675_100056290 3300005354 Bacteria 3240
47 Ga0070671_100474898 3300005355 Bacteria 1074
48 Ga0070671_101382208 3300005355 Bacteria 622
49 Ga0070674_100019780 3300005356 Bacteria 4284
50 Ga0070674_100861481 3300005356 Bacteria 787
51 Ga0070674_100992213 3300005356 Bacteria 736
52 Ga0070674_101605794 3300005356 Bacteria 586
53 Ga0070673_101614351 3300005364 Bacteria 613
54 Ga0070673_101767120 3300005364 Bacteria 586
55 Ga0070688_100213291 3300005365 Bacteria 1357
56 Ga0070703_10372515 3300005406 Bacteria 615
57 Ga0070714_100185510 3300005435 Bacteria 1895
58 Ga0070710_10728486 3300005437 Bacteria 702
59 Ga0070701_10001982 3300005438 Bacteria 7754
60 Ga0070701_10020823 3300005438 Bacteria 3120
61 Ga0070711_101167953 3300005439 Bacteria 665
62 Ga0070705_100000275 3300005440 Bacteria 31164
63 Ga0070705_100005488 3300005440 Bacteria 6181
64 Ga0070705_100090996 3300005440 Bacteria 1900
65 Ga0070705_100195727 3300005440 Bacteria 1382
66 Ga0070705_100378924 3300005440 Bacteria 1041
67 Ga0070705_100563316 3300005440 Bacteria 876
68 Ga0070705_101053381 3300005440 Bacteria 663
69 Ga0070700_100000718 3300005441 Bacteria 16353
70 Ga0070700_100006936 3300005441 Bacteria 6083
71 Ga0070700_100159819 3300005441 Bacteria 1550
72 Ga0070700_100308089 3300005441 Bacteria 1159
73 Ga0070700_100312331 3300005441 Bacteria 1152
74 Ga0070700_100602125 3300005441 Bacteria 861
75 Ga0070700_101374856 3300005441 Bacteria 596
76 Ga0070700_101568565 3300005441 Bacteria 562
77 Ga0070694_100000608 3300005444 Bacteria 19748
78 Ga0070694_100009317 3300005444 Bacteria 6028
79 Ga0070694_100014517 3300005444 Bacteria 4932
80 Ga0070694_100141175 3300005444 Bacteria 1750
81 Ga0070694_100179831 3300005444 Bacteria 1564
82 Ga0070694_100267604 3300005444 Bacteria 1298
83 Ga0070694_100355163 3300005444 Bacteria 1136
84 Ga0070694_100367647 3300005444 Bacteria 1118
85 Ga0070694_100488581 3300005444 Bacteria 978
86 Ga0070694_100995358 3300005444 Bacteria 696
87 Ga0070708_101140782 3300005445 Bacteria 730
88 Ga0070708_101725016 3300005445 Bacteria 582
89 Ga0070678_100324300 3300005456 Bacteria 1316
90 Ga0070678_100590668 3300005456 Bacteria 990
91 Ga0070681_10000198 3300005458 Bacteria 47037
92 Ga0068867_100000568 3300005459 Bacteria 24458
93 Ga0068867_100023523 3300005459 Bacteria 4410
94 Ga0068867_101307236 3300005459 Bacteria 670
95 Ga0070685_11391110 3300005466 Bacteria 538
96 Ga0070685_11471537 3300005466 Bacteria 524
97 Ga0070706_100167580 3300005467 Bacteria 2051
98 Ga0070707_100571189 3300005468 Bacteria 1093
99 Ga0070707_100984659 3300005468 Bacteria 808
100 Ga0070698_100054920 3300005471 Bacteria 4042
101 Ga0070698_101668378 3300005471 Bacteria 590
102 Ga0070699_100095806 3300005518 Bacteria 2599
103 Ga0070699_100204649 3300005518 Bacteria 1756
104 Ga0070699_100258097 3300005518 Bacteria 1558
105 Ga0070699_100512930 3300005518 Bacteria 1090
106 Ga0070679_100024440 3300005530 Bacteria 5920
107 Ga0070679_100687178 3300005530 Bacteria 966
108 Ga0070679_101310155 3300005530 Bacteria 670
109 Ga0070679_102013320 3300005530 Bacteria 527
110 Ga0070684_100904293 3300005535 Bacteria 827
111 Ga0070697_100002931 3300005536 Bacteria 13126
112 Ga0070697_100095073 3300005536 Bacteria 2470
113 Ga0070697_101135835 3300005536 Bacteria 696
114 Ga0070697_101993232 3300005536 Bacteria 520
115 Ga0068853_100079777 3300005539 Bacteria 2863
116 Ga0070672_100467010 3300005543 Bacteria 1088
117 Ga0070686_100002218 3300005544 Bacteria 10728
118 Ga0070686_100028921 3300005544 Bacteria 3365
119 Ga0070686_100160293 3300005544 Bacteria 1584
120 Ga0070686_100244972 3300005544 Bacteria 1307
121 Ga0070686_100319207 3300005544 Bacteria 1158
122 Ga0070686_100572972 3300005544 Bacteria 886
123 Ga0070686_100721495 3300005544 Bacteria 797
124 Ga0070686_100900045 3300005544 Bacteria 720
125 Ga0070686_101073141 3300005544 Bacteria 664
126 Ga0070686_101615787 3300005544 Bacteria 549
127 Ga0070695_100000176 3300005545 Bacteria 30422
128 Ga0070695_100003592 3300005545 Bacteria 9056
129 Ga0070695_100029321 3300005545 Bacteria 3418
130 Ga0070695_100075647 3300005545 Bacteria 2216
131 Ga0070695_100260639 3300005545 Bacteria 1266
132 Ga0070695_100516992 3300005545 Bacteria 926
133 Ga0070695_100651696 3300005545 Bacteria 831
134 Ga0070695_100856214 3300005545 Bacteria 732
135 Ga0070695_101518489 3300005545 Bacteria 558
136 Ga0070696_100000137 3300005546 Bacteria 39854
137 Ga0070696_100001735 3300005546 Bacteria 14279
138 Ga0070696_100067694 3300005546 Bacteria 2506
139 Ga0070696_100259271 3300005546 Bacteria 1318
140 Ga0070696_100395783 3300005546 Bacteria 1080
141 Ga0070696_100408338 3300005546 Bacteria 1064
142 Ga0070696_100579076 3300005546 Bacteria 903
143 Ga0070696_100836439 3300005546 Bacteria 760
144 Ga0070696_100900886 3300005546 Bacteria 734
145 Ga0070693_100001113 3300005547 Bacteria 12062
146 Ga0070693_100076425 3300005547 Bacteria 1985
147 Ga0070704_100000057 3300005549 Bacteria 36313
148 Ga0070704_100046477 3300005549 Bacteria 3027
149 Ga0070704_100060605 3300005549 Bacteria 2704
150 Ga0070704_100100059 3300005549 Bacteria 2182
151 Ga0070704_100110016 3300005549 Bacteria 2095
152 Ga0068855_100118320 3300005563 Bacteria 3034
153 Ga0068857_100535415 3300005577 Bacteria 1102
154 Ga0068854_100797180 3300005578 Bacteria 823
155 Ga0068856_100175279 3300005614 Bacteria 2157
156 Ga0068856_100362114 3300005614 Bacteria 1469
157 Ga0068856_101171182 3300005614 Bacteria 785
158 Ga0070702_100000016 3300005615 Bacteria 48066
159 Ga0070702_100230352 3300005615 Bacteria 1244
160 Ga0070702_100674737 3300005615 Bacteria 785
161 Ga0068852_100053098 3300005616 Bacteria 3487
162 Ga0068859_100011860 3300005617 Bacteria 8754
163 Ga0068859_100019288 3300005617 Bacteria 6852
164 Ga0068859_100028423 3300005617 Bacteria 5605
165 Ga0068859_100520407 3300005617 Bacteria 1285
166 Ga0068859_101038106 3300005617 Bacteria 901
167 Ga0068859_101151732 3300005617 Bacteria 854
168 Ga0068859_101809460 3300005617 Bacteria 674
169 Ga0068864_100025516 3300005618 Bacteria 4979
170 Ga0068866_10000914 3300005718 Bacteria 12952
171 Ga0068866_10452638 3300005718 Bacteria 840
172 Ga0068861_100000199 3300005719 Bacteria 32165
173 Ga0068861_100021205 3300005719 Bacteria 4669
174 Ga0068861_100704402 3300005719 Bacteria 939
175 Ga0068861_101058305 3300005719 Bacteria 778
176 Ga0068870_10793039 3300005840 Bacteria 661
177 Ga0068870_11174522 3300005840 Bacteria 555
178 Ga0068863_100084048 3300005841 Bacteria 3017
179 Ga0068863_100759325 3300005841 Bacteria 966
180 Ga0068858_100003393 3300005842 Bacteria 15847
181 Ga0068858_100387156 3300005842 Bacteria 1342
182 Ga0068858_100534859 3300005842 Bacteria 1134
183 Ga0068860_100001230 3300005843 Bacteria 27942
184 Ga0068860_100212273 3300005843 Bacteria 1878
185 Ga0068860_101534762 3300005843 Bacteria 688
186 Ga0068862_100010417 3300005844 Bacteria 7676
187 Ga0068862_100032132 3300005844 Bacteria 4434
188 Ga0068862_100149773 3300005844 Bacteria 2076
189 Ga0068862_100278266 3300005844 Bacteria 1533
190 Ga0068862_100600397 3300005844 Bacteria 1057
191 Ga0081538_10160025 3300005981 Bacteria 1002
192 Ga0081539_10000842 3300005985 Bacteria 58746
193 Ga0075364_10247712 3300006051 Bacteria 1211
194 Ga0075364_10729198 3300006051 Bacteria 676
195 Ga0070715_10081179 3300006163 Bacteria 1472
196 Ga0070715_10439900 3300006163 Bacteria 734
197 Ga0070715_10538208 3300006163 Bacteria 675
198 Ga0070716_100555142 3300006173 Bacteria 857
199 Ga0070716_100894593 3300006173 Bacteria 695
200 Ga0070712_101175719 3300006175 Bacteria 667
201 Ga0075366_10008600 3300006195 Bacteria 5683
202 Ga0097621_100001888 3300006237 Bacteria 14313
203 Ga0097621_100015589 3300006237 Bacteria 5724
204 Ga0097621_100570193 3300006237 Bacteria 1032
205 Ga0068871_100000120 3300006358 Bacteria 49031
206 Ga0068871_100003000 3300006358 Bacteria 11579
207 Ga0075428_100013129 3300006844 Bacteria 9212
208 Ga0075428_100025250 3300006844 Bacteria 6576
209 Ga0075428_100060247 3300006844 Bacteria 4157
210 Ga0075428_100251107 3300006844 Bacteria 1906
211 Ga0075430_100008695 3300006846 Bacteria 8567
212 Ga0075430_100049636 3300006846 Bacteria 3541
213 Ga0075430_100742838 3300006846 Bacteria 809
214 Ga0075431_100013334 3300006847 Bacteria 8307
215 Ga0075431_100146517 3300006847 Bacteria 2433
216 Ga0075431_100351111 3300006847 Bacteria 1483
217 Ga0075431_100700496 3300006847 Bacteria 990
218 Ga0075431_100742305 3300006847 Bacteria 957
219 Ga0075431_100762845 3300006847 Bacteria 942
220 Ga0075431_100832103 3300006847 Bacteria 895
221 Ga0075431_102108306 3300006847 Bacteria 518
222 Ga0075433_10014942 3300006852 Bacteria 6354
223 Ga0075433_10042272 3300006852 Bacteria 3953
224 Ga0075433_10160924 3300006852 Bacteria 1998
225 Ga0075433_10778163 3300006852 Bacteria 837
226 Ga0075433_11223104 3300006852 Bacteria 652
227 Ga0075434_100000073 3300006871 Bacteria 52987
228 Ga0075434_100001176 3300006871 Bacteria 21677
229 Ga0075434_100019885 3300006871 Bacteria 6503
230 Ga0075434_100485931 3300006871 Bacteria 1256
231 Ga0075434_102139299 3300006871 Bacteria 564
232 Ga0075429_100000080 3300006880 Bacteria 49555
233 Ga0075429_100001130 3300006880 Bacteria 21515
234 Ga0075429_100043946 3300006880 Bacteria 3886
235 Ga0075429_100168323 3300006880 Bacteria 1920
236 Ga0075429_100428394 3300006880 Bacteria 1159
237 Ga0075429_100678858 3300006880 Bacteria 902
238 Ga0075429_100737243 3300006880 Bacteria 863
239 Ga0075429_100822042 3300006880 Bacteria 813
240 Ga0075429_101138282 3300006880 Bacteria 681
241 Ga0068865_100001461 3300006881 Bacteria 13771
242 Ga0068865_100029927 3300006881 Bacteria 3617
243 Ga0068865_100811787 3300006881 Bacteria 808
244 Ga0075436_100000205 3300006914 Bacteria 36621
245 Ga0075436_100004890 3300006914 Bacteria 9208
246 Ga0075436_100038706 3300006914 Bacteria 3291
247 Ga0075436_100058404 3300006914 Bacteria 2664
248 Ga0075436_100498424 3300006914 Bacteria 891
249 Ga0075436_100515462 3300006914 Bacteria 876
250 Ga0075436_100558744 3300006914 Bacteria 841
251 Ga0097620_100011861 3300006931 Bacteria 8754
252 Ga0097620_100019288 3300006931 Bacteria 6852
253 Ga0097620_100028423 3300006931 Bacteria 5605
254 Ga0097620_100520376 3300006931 Bacteria 1285
255 Ga0097620_101038090 3300006931 Bacteria 901
256 Ga0097620_101151728 3300006931 Bacteria 854
257 Ga0097620_101809470 3300006931 Bacteria 674
258 Ga0075435_100006291 3300007076 Bacteria 8385
259 Ga0075435_100007630 3300007076 Bacteria 7725
260 Ga0075435_100140284 3300007076 Bacteria 2027
261 Ga0075435_100239981 3300007076 Bacteria 1541
262 Ga0075435_100328058 3300007076 Bacteria 1310
263 Ga0075435_101752918 3300007076 Bacteria 545
264 Ga0099794_10043743 3300007265 Bacteria 2138
265 Ga0099794_10066967 3300007265 Bacteria 1753
266 Ga0099794_10363308 3300007265 Bacteria 754
267 Ga0099794_10438859 3300007265 Bacteria 684
268 Ga0105250_10020860 3300009092 Bacteria 2645
269 Ga0111539_10037024 3300009094 Bacteria 5895
270 Ga0111539_10050653 3300009094 Bacteria 4947
271 Ga0111539_10065584 3300009094 Bacteria 4289
272 Ga0111539_10131269 3300009094 Bacteria 2933
273 Ga0111539_10168418 3300009094 Bacteria 2560
274 Ga0111539_10222278 3300009094 Bacteria 2199
275 Ga0111539_10551503 3300009094 Bacteria 1342
276 Ga0111539_11095879 3300009094 Bacteria 925
277 Ga0111539_11967183 3300009094 Bacteria 678
278 Ga0111539_13145343 3300009094 Bacteria 532
279 Ga0111539_13348128 3300009094 Bacteria 516
280 Ga0105245_10000259 3300009098 Bacteria 50388
281 Ga0105245_11512819 3300009098 Bacteria 722
282 Ga0105245_12959604 3300009098 Bacteria 526
283 Ga0114129_10002101 3300009147 Bacteria 27413
284 Ga0114129_10032898 3300009147 Bacteria 7327
285 Ga0114129_10373021 3300009147 Bacteria 1885
286 Ga0114129_10515058 3300009147 Bacteria 1560
287 Ga0114129_10731066 3300009147 Bacteria 1269
288 Ga0114129_10999632 3300009147 Bacteria 1053
289 Ga0114129_11630562 3300009147 Bacteria 789
290 Ga0105243_10003095 3300009148 Bacteria 13686
291 Ga0105243_10045531 3300009148 Bacteria 3448
292 Ga0105243_12071974 3300009148 Bacteria 604
293 Ga0105243_12402752 3300009148 Bacteria 565
294 Ga0105241_10010209 3300009174 Bacteria 6897
295 Ga0105242_10036544 3300009176 Bacteria 3941
296 Ga0105242_10209160 3300009176 Bacteria 1737
297 Ga0105242_11564528 3300009176 Bacteria 692
298 Ga0105248_10559731 3300009177 Bacteria 1290
299 Ga0105248_10888186 3300009177 Bacteria 1006
300 Ga0105238_12744922 3300009551 Bacteria 529
301 Ga0105249_10001070 3300009553 Bacteria 24290
302 Ga0105249_10377074 3300009553 Bacteria 1444
303 Ga0105249_12816224 3300009553 Bacteria 558
304 Ga0105249_13480936 3300009553 Bacteria 507
305 Ga0105239_11866616 3300010375 Bacteria 697
306 Ga0105246_10835144 3300011119 Bacteria 820
307 Ga0157339_1040404 3300012505 Bacteria 583
308 Ga0157378_10000576 3300013297 Bacteria 34686
309 Ga0157378_11059085 3300013297 Bacteria 847
310 Ga0157378_12059457 3300013297 Bacteria 621
311 Ga0163162_10199606 3300013306 Bacteria 2129
312 Ga0157372_10981400 3300013307 Bacteria 979
313 Ga0157375_10093020 3300013308 Bacteria 3080
314 Ga0157380_10011328 3300014326 Bacteria 6441
315 Ga0157380_10170367 3300014326 Bacteria 1902
316 Ga0157380_10537147 3300014326 Bacteria 1144
317 Ga0157380_12109104 3300014326 Bacteria 627
318 Ga0157377_10426969 3300014745 Bacteria 909
319 Ga0157379_11570464 3300014968 Bacteria 642
320 Ga0157376_10003705 3300014969 Bacteria 10559
321 Ga0157376_10070012 3300014969 Bacteria 2976
322 Ga0207696_1115335 3300025711 Bacteria 726
323 Ga0207653_10053692 3300025885 Bacteria 1346
324 Ga0207653_10072326 3300025885 Bacteria 1180
325 Ga0207692_10571143 3300025898 Bacteria 724
326 Ga0207642_10124344 3300025899 Bacteria 1336
327 Ga0207642_10183429 3300025899 Bacteria 1142
328 Ga0207688_10103278 3300025901 Bacteria 1648
329 Ga0207688_10325951 3300025901 Bacteria 943
330 Ga0207647_10784874 3300025904 Bacteria 513
331 Ga0207685_10032127 3300025905 Bacteria 1886
332 Ga0207699_10823002 3300025906 Bacteria 683
333 Ga0207645_10053737 3300025907 Bacteria 2574
334 Ga0207645_10366205 3300025907 Bacteria 966
335 Ga0207643_10103236 3300025908 Bacteria 1673
336 Ga0207684_10398182 3300025910 Bacteria 1184
337 Ga0207684_10736824 3300025910 Bacteria 836
338 Ga0207684_11521226 3300025910 Bacteria 544
339 Ga0207654_10004685 3300025911 Bacteria 6919
340 Ga0207707_10003333 3300025912 Bacteria 14259
341 Ga0207663_10655419 3300025916 Bacteria 829
342 Ga0207660_10001340 3300025917 Bacteria 16476
343 Ga0207660_10020821 3300025917 Bacteria 4408
344 Ga0207660_10655257 3300025917 Bacteria 856
345 Ga0207662_10000106 3300025918 Bacteria 40137
346 Ga0207662_10064715 3300025918 Bacteria 2200
347 Ga0207662_10070983 3300025918 Bacteria 2107
348 Ga0207662_10274069 3300025918 Bacteria 1114
349 Ga0207652_10007736 3300025921 Bacteria 8632
350 Ga0207652_10030844 3300025921 Bacteria 4494
351 Ga0207646_10406772 3300025922 Bacteria 1229
352 Ga0207646_10427740 3300025922 Bacteria 1195
353 Ga0207681_10006318 3300025923 Bacteria 7273
354 Ga0207681_11729119 3300025923 Bacteria 522
355 Ga0207659_10062589 3300025926 Bacteria 2686
356 Ga0207659_10089394 3300025926 Bacteria 2297
357 Ga0207644_10486154 3300025931 Bacteria 1017
358 Ga0207706_10766185 3300025933 Bacteria 821
359 Ga0207686_10000883 3300025934 Bacteria 18123
360 Ga0207686_10557776 3300025934 Bacteria 896
361 Ga0207709_10003980 3300025935 Bacteria 8621
362 Ga0207709_10007609 3300025935 Bacteria 6011
363 Ga0207670_10067768 3300025936 Bacteria 2456
364 Ga0207670_10418035 3300025936 Bacteria 1075
365 Ga0207670_10752244 3300025936 Bacteria 809
366 Ga0207670_11186945 3300025936 Bacteria 646
367 Ga0207669_10003349 3300025937 Bacteria 6939
368 Ga0207669_10811645 3300025937 Bacteria 776
369 Ga0207704_10000434 3300025938 Bacteria 18663
370 Ga0207704_10007398 3300025938 Bacteria 5185
371 Ga0207704_10180508 3300025938 Bacteria 1525
372 Ga0207665_10327019 3300025939 Bacteria 1152
373 Ga0207665_10880138 3300025939 Bacteria 710
374 Ga0207691_10119742 3300025940 Bacteria 2334
375 Ga0207689_10000376 3300025942 Bacteria 41990
376 Ga0207689_10371845 3300025942 Bacteria 1189
377 Ga0207689_10435302 3300025942 Bacteria 1095
378 Ga0207689_11464904 3300025942 Bacteria 571
379 Ga0207661_10179401 3300025944 Bacteria 1849
380 Ga0207667_10134989 3300025949 Bacteria 2541
381 Ga0207651_11016019 3300025960 Bacteria 741
382 Ga0207651_11102964 3300025960 Bacteria 711
383 Ga0207712_10005157 3300025961 Bacteria 8264
384 Ga0207712_10225900 3300025961 Bacteria 1500
385 Ga0207668_10037290 3300025972 Bacteria 3252
386 Ga0207640_10060273 3300025981 Bacteria 2507
387 Ga0207640_11529530 3300025981 Bacteria 600
388 Ga0207677_10004790 3300026023 Bacteria 7300
389 Ga0207677_10653886 3300026023 Bacteria 928
390 Ga0207703_10001886 3300026035 Bacteria 18616
391 Ga0207703_10031708 3300026035 Bacteria 4180
392 Ga0207703_11784423 3300026035 Bacteria 591
393 Ga0207639_10050531 3300026041 Bacteria 3158
394 Ga0207708_10000239 3300026075 Bacteria 43452
395 Ga0207708_10006009 3300026075 Bacteria 8996
396 Ga0207708_10036334 3300026075 Bacteria 3750
397 Ga0207708_10246018 3300026075 Bacteria 1440
398 Ga0207708_11269594 3300026075 Bacteria 645
399 Ga0207702_10056135 3300026078 Bacteria 3342
400 Ga0207702_10261003 3300026078 Bacteria 1631
401 Ga0207702_10897698 3300026078 Bacteria 878
402 Ga0207641_10042652 3300026088 Bacteria 3807
403 Ga0207641_10474389 3300026088 Bacteria 1212
404 Ga0207648_10000369 3300026089 Bacteria 49386
405 Ga0207648_10002987 3300026089 Bacteria 17871
406 Ga0207648_11293123 3300026089 Bacteria 685
407 Ga0207676_10049205 3300026095 Bacteria 3277
408 Ga0207676_11565246 3300026095 Bacteria 657
409 Ga0207674_10174419 3300026116 Bacteria 2102
410 Ga0207674_10462949 3300026116 Bacteria 1225
411 Ga0207675_100000651 3300026118 Bacteria 34173
412 Ga0207675_100002559 3300026118 Bacteria 18014
413 Ga0207675_100492840 3300026118 Bacteria 1219
414 Ga0207675_100638682 3300026118 Bacteria 1070
415 Ga0207675_100861044 3300026118 Bacteria 921
416 Ga0207675_101248408 3300026118 Bacteria 763
417 Ga0207683_10091937 3300026121 Bacteria 2703
418 Ga0207683_10628706 3300026121 Bacteria 994
419 Ga0207698_10047953 3300026142 Bacteria 3240
420 Ga0209969_1028833 3300027360 Bacteria 845
421 Ga0209967_1005806 3300027364 Bacteria 1667
422 Ga0209967_1006851 3300027364 Bacteria 1552
423 Ga0209967_1007443 3300027364 Bacteria 1497
424 Ga0209981_1009968 3300027378 Bacteria 1302
425 Ga0209981_1037131 3300027378 Bacteria 723
426 Ga0209996_1022515 3300027395 Bacteria 892
427 Ga0209996_1042690 3300027395 Bacteria 676
428 Ga0210000_1005614 3300027462 Bacteria 1821
429 Ga0210000_1009349 3300027462 Bacteria 1442
430 Ga0210000_1016142 3300027462 Bacteria 1127
431 Ga0209995_1010851 3300027471 Bacteria 1480
432 Ga0209995_1012130 3300027471 Bacteria 1404
433 Ga0209968_1007653 3300027526 Bacteria 1636
434 Ga0209999_1004248 3300027543 Bacteria 2578
435 Ga0209999_1031217 3300027543 Bacteria 989
436 Ga0209999_1083453 3300027543 Bacteria 617
437 Ga0209982_1049402 3300027552 Bacteria 677
438 Ga0209970_1041651 3300027614 Bacteria 818
439 Ga0209970_1099545 3300027614 Bacteria 555
440 Ga0209983_1136672 3300027665 Bacteria 561
441 Ga0209983_1161936 3300027665 Bacteria 513
442 Ga0209588_1056698 3300027671 Bacteria 1266
443 Ga0209971_1006528 3300027682 Bacteria 2759
444 Ga0209971_1105422 3300027682 Bacteria 691
445 Ga0209966_1023390 3300027695 Bacteria 1214
446 Ga0209966_1042642 3300027695 Bacteria 949
447 Ga0209974_10011132 3300027876 Bacteria 3026
448 Ga0209974_10138771 3300027876 Bacteria 871
449 Ga0207428_10010784 3300027907 Bacteria 8147
450 Ga0207428_10019374 3300027907 Bacteria 5803
451 Ga0207428_10201221 3300027907 Bacteria 1498
452 Ga0207428_10286072 3300027907 Bacteria 1223
453 Ga0207428_10322863 3300027907 Bacteria 1140
454 Ga0207428_10404566 3300027907 Bacteria 999
455 Ga0268265_10000781 3300028380 Bacteria 30469
456 Ga0268265_10001333 3300028380 Bacteria 21108
457 Ga0268265_10172111 3300028380 Bacteria 1852
458 Ga0268265_10539870 3300028380 Bacteria 1105
459 Ga0268265_11132614 3300028380 Bacteria 778
460 Ga0268265_12016389 3300028380 Bacteria 584
461 Ga0268264_10001450 3300028381 Bacteria 22200
462 Ga0268264_10358617 3300028381 Bacteria 1390
463 Ga0268264_10617457 3300028381 Bacteria 1070
464 Ga0268264_11581433 3300028381 Bacteria 666
465 Ga0307408_100217170 3300031548 Bacteria 1558
466 Ga0307408_100328650 3300031548 Bacteria 1290
467 Ga0307408_100397344 3300031548 Bacteria 1183
468 Ga0307408_100483338 3300031548 Bacteria 1081
469 Ga0307408_100499765 3300031548 Bacteria 1064
470 Ga0307408_100558767 3300031548 Bacteria 1011
471 Ga0307408_100961731 3300031548 Bacteria 785
472 Ga0307405_10266818 3300031731 Bacteria 1282
473 Ga0307405_10471668 3300031731 Bacteria 1000
474 Ga0307410_11276436 3300031852 Bacteria 642
475 Ga0307410_12032337 3300031852 Bacteria 513
476 Ga0307406_10254138 3300031901 Bacteria 1326
477 Ga0307406_10660434 3300031901 Bacteria 869
478 Ga0307407_10210867 3300031903 Bacteria 1308
479 Ga0307412_10408092 3300031911 Bacteria 1108
480 Ga0307412_10843877 3300031911 Bacteria 799
481 Ga0307409_100169468 3300031995 Bacteria 1920
482 Ga0307409_100466699 3300031995 Bacteria 1222
483 Ga0307416_100143175 3300032002 Bacteria 2177
484 Ga0307416_100191358 3300032002 Bacteria 1930
485 Ga0307416_100323996 3300032002 Bacteria 1545
486 Ga0307416_100359490 3300032002 Bacteria 1477
487 Ga0307416_100689954 3300032002 Bacteria 1109
488 Ga0307416_101345812 3300032002 Bacteria 820
489 Ga0307416_102700765 3300032002 Bacteria 593
490 Ga0307411_10022035 3300032005 Bacteria 3743
491 Ga0307411_10151900 3300032005 Bacteria 1722
492 Ga0373930_0160468 3300034816 Bacteria 568
493 Ga0373930_0160800 3300034816 Bacteria 568
494 Ga0373948_0011088 3300034817 Bacteria 1586
495 Ga0373950_0059922 3300034818 Bacteria 763
496 Ga0373958_0024227 3300034819 Bacteria 1147
497 Ga0373958_0100025 3300034819 Bacteria 679
498 Ga0373959_0005843 3300034820 Bacteria 2027
499 Ga0373938_0003713 3300034957 Bacteria 2516
500 Ga0373938_0126471 3300034957 Bacteria 663
501 Ga0373938_0185876 3300034957 Bacteria 569
502 Ga0373926_0000230 3300035083 Bacteria 13313
503 Ga0373928_0022347 3300035084 Bacteria 1341
504 Ga0373929_0032794 3300035085 Bacteria 1119
505 Ga0373934_0251967 3300035086 Bacteria 730
506 Ga0373940_0027896 3300035088 Bacteria 1487
507 Ga0373944_0001903 3300035089 Bacteria 5278
508 Ga0373944_0262287 3300035089 Bacteria 640
509 Ga0373949_0053680 3300035090 Bacteria 1021
510 Ga0373951_0090467 3300035091 Bacteria 802
511 Ga0373952_0069643 3300035092 Bacteria 877
512 Ga0373952_0092566 3300035092 Bacteria 787
513 Ga0373923_0288232 3300035111 Bacteria 775
514 Ga0373932_0005565 3300035112 Bacteria 2963
515 Ga0373932_0265155 3300035112 Bacteria 631
516 Ga0373936_0018435 3300035113 Bacteria 2696
517 Ga0373939_0044852 3300035114 Bacteria 1347
518 Ga0373939_0265225 3300035114 Bacteria 673
519 Ga0373941_0018284 3300035115 Bacteria 1934
520 Ga0373941_0039893 3300035115 Bacteria 1445
521 Ga0373945_0004779 3300035116 Bacteria 4312
522 Ga0373945_0137355 3300035116 Bacteria 983
523 Ga0373945_0521942 3300035116 Bacteria 531
524 Ga0373953_0021780 3300035117 Bacteria 2409
525 Ga0373954_0000087 3300035118 Bacteria 31710
526 Ga0373956_0066543 3300035119 Bacteria 1639
527 Ga0373957_0313502 3300035120 Bacteria 666
528 Ga0373960_0023136 3300035121 Bacteria 1671
529 Ga0373943_0020057 3300035170 Bacteria 3078
530 Ga0373943_0176629 3300035170 Bacteria 1171
531 Ga0373943_0811787 3300035170 Bacteria 557
532 Ga0373946_0005892 3300035171 Bacteria 4440
533 Ga0373955_0090832 3300035172 Bacteria 1740
534 Ga0373955_0899204 3300035172 Bacteria 545
535 Ga0373942_0004862 3300035207 Bacteria 3116
536 Ga0373942_0078048 3300035207 Bacteria 978
537 Ga0373942_0183233 3300035207 Bacteria 687
538 Ga0373961_0008933 3300035241 Bacteria 2444
539 Ga0373961_0134635 3300035241 Bacteria 830
540 Ga0373961_0432326 3300035241 Bacteria 510
541 Ga0373962_0082296 3300035242 Bacteria 979
542 Ga0373962_0124605 3300035242 Bacteria 825
543 Ga0373962_0221692 3300035242 Bacteria 647
544 Ga0373924_0014361 3300035410 Bacteria 2992
545 Ga0373924_0059852 3300035410 Bacteria 1592
546 Ga0373924_0097248 3300035410 Bacteria 1264
547 Ga0373924_0108202 3300035410 Bacteria 1200
548 Ga0373931_0002129 3300035691 Bacteria 8722
549 Ga0373931_0004456 3300035691 Bacteria 6400
550 Ga0373931_0014988 3300035691 Bacteria 3798
551 Ga0373931_0128940 3300035691 Bacteria 1454
552 Ga0373935_0010817 3300035692 Bacteria 5482
553 Ga0373935_0010842 3300035692 Bacteria 5474
554 Ga0373935_0094772 3300035692 Bacteria 1959
555 Ga0373927_0023238 3300035695 Bacteria 4061
556 Ga0373927_0038778 3300035695 Bacteria 3093
557 Ga0373927_0136658 3300035695 Bacteria 1602
558 Ga0373927_0445904 3300035695 Bacteria 855
559 Ga0373933_0003173 3300035724 Bacteria 9182
560 Ga0373933_0027928 3300035724 Bacteria 3253
561 Ga0373947_0036854 3300035725 Bacteria 2900
562 Ga0373947_0046108 3300035725 Bacteria 2609
563 Ga0373937_0000296 3300036401 Bacteria 47231
564 Ga0373937_0018367 3300036401 Bacteria 6244
565 Ga0373937_0115160 3300036401 Bacteria 2503
566 Ga0373937_0226652 3300036401 Bacteria 1759
567 Ga0373937_0340309 3300036401 Bacteria 1421
568 Ga0373937_0570520 3300036401 Bacteria 1075
569 Ga0373937_0856988 3300036401 Bacteria 857
570 Ga0373937_1364362 3300036401 Bacteria 657
571 Ga0373925_0007563 3300037068 Bacteria 7915
572 Ga0373925_0212145 3300037068 Bacteria 1542
573 Ga0439436_0149396 3300041404 Bacteria 659
574 Ga0439439_0021515 3300041406 Bacteria 1608
575 Ga0439453_0033996 3300041408 Bacteria 977
576 Ga0439461_0002899 3300041410 Bacteria 2780
577 Ga0451802_0411675 3300041460 Bacteria 671
578 Ga0451807_0142877 3300041486 Bacteria 984
579 Ga0451807_1785507 3300041486 Bacteria 512
580 Ga0451845_0620846 3300041501 Bacteria 749
581 Ga0439441_000488 3300042001 Bacteria 4310
582 Ga0439441_029634 3300042001 Bacteria 1054
583 Ga0439441_045240 3300042001 Bacteria 893
584 Ga0439441_081579 3300042001 Bacteria 705
585 Ga0439441_147161 3300042001 Bacteria 553
586 Ga0439443_036387 3300042003 Bacteria 828
587 Ga0439451_031250 3300042009 Bacteria 1070
588 Ga0439462_0012540 3300042015 Bacteria 2166
589 Ga0450923_114106 3300042125 Bacteria 633
590 Ga0439446_0004777 3300042156 Bacteria 3451
591 Ga0439446_0111205 3300042156 Bacteria 874
592 Ga0439434_0000076 3300042435 Bacteria 24744
593 Ga0439434_0103290 3300042435 Bacteria 919
594 Ga0439435_0001056 3300042436 Bacteria 4863
595 Ga0439435_0098919 3300042436 Bacteria 894
596 Ga0439444_0021720 3300042437 Bacteria 1138
597 Ga0450893_0058995 3300042532 Bacteria 730
598 Ga0451577_0015044 3300042876 Bacteria 7198
599 Ga0451577_0547198 3300042876 Bacteria 1051
600 Ga0453683_0536007 3300044673 Bacteria 761
601 Ga0466965_0132417 3300044683 Bacteria 1294
602 Ga0451576_0017229 3300045051 Bacteria 7947
603 Ga0451576_0033552 3300045051 Bacteria 5456
604 Ga0451576_0045166 3300045051 Bacteria 4641
605 Ga0451576_0090352 3300045051 Bacteria 3185
606 Ga0451576_0214293 3300045051 Bacteria 2011
607 Ga0451576_0406018 3300045051 Bacteria 1428
608 Ga0451576_1310889 3300045051 Bacteria 755
609 Ga0451576_1717735 3300045051 Bacteria 650
610 Ga0451576_1899017 3300045051 Bacteria 614
611 Ga0451576_2176584 3300045051 Bacteria 570
612 Ga0466958_0467474 3300045836 Bacteria 817
613 Ga0466967_0113879 3300045976 Bacteria 2489
614 Ga0495592_0001592 3300046454 Bacteria 15869
615 Ga0495603_0005705 3300046455 Bacteria 7441
616 Ga0495629_0268868 3300046459 Bacteria 1171
617 Ga0495629_1087947 3300046459 Bacteria 517
618 Ga0495651_0242044 3300046462 Bacteria 1237
619 Ga0495651_0980578 3300046462 Bacteria 514
620 Ga0495653_0047055 3300046463 Bacteria 3338
621 Ga0495653_0292991 3300046463 Bacteria 1064
622 Ga0495653_0303011 3300046463 Bacteria 1041
623 Ga0495582_0034547 3300046473 Bacteria 2779
624 Ga0495582_0088203 3300046473 Bacteria 1728
625 Ga0495639_0005524 3300046475 Bacteria 5442
626 Ga0495639_0422330 3300046475 Bacteria 675
627 Ga0495662_0030769 3300046476 Bacteria 2591
628 Ga0495662_0043033 3300046476 Bacteria 2180
629 Ga0495664_0310021 3300046477 Bacteria 952
630 Ga0495664_0434049 3300046477 Bacteria 787
631 Ga0495608_0007794 3300046511 Bacteria 7537
632 Ga0495608_0099837 3300046511 Bacteria 1872
633 Ga0495618_0140076 3300046514 Bacteria 1547
634 Ga0495628_0003126 3300046516 Bacteria 14870
635 Ga0495628_0252617 3300046516 Bacteria 1316
636 Ga0495630_0073248 3300046517 Bacteria 2579
637 Ga0495630_0526424 3300046517 Bacteria 906
638 Ga0495630_0618846 3300046517 Bacteria 830
639 Ga0495630_0679615 3300046517 Bacteria 788
640 Ga0495666_0013837 3300046526 Bacteria 4023
641 Ga0495666_0025168 3300046526 Bacteria 2941
642 Ga0495652_0257177 3300046529 Bacteria 1291
643 Ga0495652_0440638 3300046529 Bacteria 914
644 Ga0495652_0647059 3300046529 Bacteria 716
645 Ga0495665_0629153 3300046531 Bacteria 535
646 Ga0495640_0009959 3300046533 Bacteria 7369
647 Ga0495640_0065335 3300046533 Bacteria 2457
648 Ga0495586_0016693 3300046535 Bacteria 3904
649 Ga0495586_0055967 3300046535 Bacteria 2138
650 Ga0495587_0109857 3300046536 Bacteria 1584
651 Ga0495587_0118678 3300046536 Bacteria 1515
652 Ga0495587_0451617 3300046536 Bacteria 712
653 Ga0495598_0052961 3300046537 Bacteria 1228
654 Ga0495621_0111561 3300046539 Bacteria 1049
655 Ga0495621_0123251 3300046539 Bacteria 1003
656 Ga0495622_0019198 3300046557 Bacteria 3183
657 Ga0495622_0120892 3300046557 Bacteria 1196
658 Ga0495667_0013563 3300046559 Bacteria 5513
659 Ga0495667_0152297 3300046559 Bacteria 1489
660 Ga0495634_0020851 3300046642 Bacteria 4642
661 Ga0495625_0014493 3300046660 Bacteria 6286
662 Ga0495635_0117809 3300046663 Bacteria 1812
663 Ga0495659_0011438 3300046664 Bacteria 2858
664 Ga0495657_0418123 3300046675 Bacteria 787
665 Ga0495599_0022373 3300046678 Bacteria 3946
666 Ga0495623_0185607 3300046679 Bacteria 1205
667 Ga0495647_0001395 3300046681 Bacteria 7454
668 Ga0495647_0087604 3300046681 Bacteria 1272
669 Ga0495658_0003610 3300046683 Bacteria 7661
670 Ga0495658_0292223 3300046683 Bacteria 1030
671 Ga0495669_0110952 3300046684 Bacteria 1280
672 Ga0495669_0334554 3300046684 Bacteria 731
673 Ga0495613_0047127 3300046689 Bacteria 3184
674 Ga0495624_0065340 3300046690 Bacteria 2273
675 Ga0495624_0497953 3300046690 Bacteria 729
676 Ga0495600_0351907 3300046809 Bacteria 922
677 Ga0495581_0243478 3300047315 Bacteria 1052
678 Ga0495581_0297970 3300047315 Bacteria 942
679 Ga0495581_0835619 3300047315 Bacteria 527
680 Ga0495604_0008726 3300047317 Bacteria 8014
681 Ga0495636_0012828 3300047318 Bacteria 3320
682 Ga0495636_0421976 3300047318 Bacteria 638
683 Ga0495636_0627829 3300047318 Bacteria 527
684 Ga0495674_0532266 3300047319 Bacteria 937
685 Ga0495680_0001252 3300047322 Bacteria 27832
686 Ga0495680_0061033 3300047322 Bacteria 2902
687 Ga0495680_0349761 3300047322 Bacteria 1029
688 Ga0495675_0011335 3300047444 Bacteria 5596
689 Ga0495593_0008922 3300047673 Bacteria 5819
690 Ga0495593_0186440 3300047673 Bacteria 1044
691 Ga0495602_1137740 3300048088 Bacteria 510
692 Ga0495614_0382755 3300048089 Bacteria 659
693 Ga0496106_0159383 3300048909 Bacteria 1784
694 Ga0501291_053309 3300049514 Bacteria 742
695 Ga0501298_040277 3300049521 Bacteria 946
696 Ga0501299_113300 3300049522 Bacteria 644
697 Ga0501303_017067 3300049526 Bacteria 741
698 Ga0501303_047458 3300049526 Bacteria 555
699 Ga0501031_0059330 3300049568 Bacteria 2493
700 Ga0501031_0204174 3300049568 Bacteria 1289
701 Ga0501031_0612243 3300049568 Bacteria 700
702 Ga0501032_0086786 3300049569 Bacteria 2079
703 Ga0501032_0567680 3300049569 Bacteria 723
704 Ga0501033_0011373 3300049570 Bacteria 6810
705 Ga0501033_0264915 3300049570 Bacteria 1216
706 Ga0501036_0001921 3300049572 Bacteria 16137
707 Ga0501036_0085385 3300049572 Bacteria 2668
708 Ga0501036_0391362 3300049572 Bacteria 1160
709 Ga0501036_0547806 3300049572 Bacteria 961
710 Ga0501037_0013201 3300049573 Bacteria 6089
711 Ga0501037_0523020 3300049573 Bacteria 803
712 Ga0501038_0004982 3300049574 Bacteria 12341
713 Ga0501038_0923941 3300049574 Bacteria 643
714 Ga0501039_0000477 3300049575 Bacteria 28990
715 Ga0501039_0024671 3300049575 Bacteria 4619
716 Ga0501039_0027089 3300049575 Bacteria 4408
717 Ga0501039_0033414 3300049575 Bacteria 3966
718 Ga0501040_0000052 3300049576 Bacteria 54195
719 Ga0501040_0005360 3300049576 Bacteria 8294
720 Ga0501040_0113809 3300049576 Bacteria 1893
721 Ga0501040_0205892 3300049576 Bacteria 1398
722 Ga0501041_0000038 3300049577 Bacteria 44285
723 Ga0501041_0015649 3300049577 Bacteria 4506
724 Ga0501041_0015993 3300049577 Bacteria 4459
725 Ga0501041_0240071 3300049577 Bacteria 1139
726 Ga0501041_0430517 3300049577 Bacteria 837
727 Ga0501042_0000048 3300049578 Bacteria 40877
728 Ga0501042_0111133 3300049578 Bacteria 1973
729 Ga0501042_1127447 3300049578 Bacteria 572
730 Ga0501043_0043047 3300049579 Bacteria 3549
731 Ga0501043_0630625 3300049579 Bacteria 789
732 Ga0501046_0000271 3300049580 Bacteria 52841
733 Ga0501046_0012984 3300049580 Bacteria 7072
734 Ga0501046_0131158 3300049580 Bacteria 1901
735 Ga0501046_1092793 3300049580 Bacteria 551
736 Ga0501046_1170956 3300049580 Bacteria 529
737 Ga0501047_0136139 3300049581 Bacteria 2337
738 Ga0501048_0000378 3300049582 Bacteria 30854
739 Ga0501048_0010966 3300049582 Bacteria 6761
740 Ga0501048_0525886 3300049582 Bacteria 848
741 Ga0501048_0536037 3300049582 Bacteria 840
742 Ga0501048_1117835 3300049582 Bacteria 567
743 Ga0501067_0831696 3300049583 Bacteria 520
744 Ga0501068_0014809 3300049584 Bacteria 4464
745 Ga0501068_0086419 3300049584 Bacteria 1931
746 Ga0501069_0123294 3300049585 Bacteria 1481
747 Ga0501069_0541180 3300049585 Bacteria 696
748 Ga0501070_0159893 3300049586 Bacteria 1857
749 Ga0501070_0951507 3300049586 Bacteria 668
750 Ga0501071_0007914 3300049587 Bacteria 7009
751 Ga0501071_0078414 3300049587 Bacteria 2414
752 Ga0501071_0128234 3300049587 Bacteria 1884
753 Ga0501072_0008011 3300049588 Bacteria 8018
754 Ga0501072_0009822 3300049588 Bacteria 7274
755 Ga0501072_0098053 3300049588 Bacteria 2329
756 Ga0501072_0214228 3300049588 Bacteria 1535
757 Ga0501072_0480438 3300049588 Bacteria 983
758 Ga0501072_0488477 3300049588 Bacteria 974
759 Ga0501073_0204289 3300049589 Bacteria 1366
760 Ga0501073_1004475 3300049589 Bacteria 574
761 Ga0501074_0007335 3300049590 Bacteria 7972
762 Ga0501074_0066914 3300049590 Bacteria 2584
763 Ga0501074_0206844 3300049590 Bacteria 1398
764 Ga0501074_0472188 3300049590 Bacteria 889
765 Ga0501074_0636217 3300049590 Bacteria 754
766 Ga0501074_0966257 3300049590 Bacteria 599
767 Ga0501075_0000180 3300049591 Bacteria 32596
768 Ga0501075_0027409 3300049591 Bacteria 4199
769 Ga0501075_0059419 3300049591 Bacteria 2880
770 Ga0501075_0114208 3300049591 Bacteria 2053
771 Ga0501075_0148471 3300049591 Bacteria 1787
772 Ga0501075_0550868 3300049591 Bacteria 880
773 Ga0501076_0000290 3300049592 Bacteria 31327
774 Ga0501076_0000319 3300049592 Bacteria 29725
775 Ga0501076_0103371 3300049592 Bacteria 2298
776 Ga0501076_0195588 3300049592 Bacteria 1651
777 Ga0501076_0698239 3300049592 Bacteria 838
778 Ga0501076_0893114 3300049592 Bacteria 733
779 Ga0501077_0000222 3300049593 Bacteria 33397
780 Ga0501077_0104746 3300049593 Bacteria 1793
781 Ga0501077_0773240 3300049593 Bacteria 617
782 Ga0501217_116597 3300049661 Bacteria 772
783 Ga0501217_194514 3300049661 Bacteria 629
784 Ga0501233_243369 3300049668 Bacteria 538
785 Ga0501225_0046507 3300049705 Bacteria 1203
786 Ga0501225_0274658 3300049705 Bacteria 562
787 Ga0501079_0000061 3300049741 Bacteria 48925
788 Ga0501079_0047873 3300049741 Bacteria 3299
789 Ga0501079_0557856 3300049741 Bacteria 901
790 Ga0501080_0041403 3300049742 Bacteria 4293
791 Ga0501080_0104562 3300049742 Bacteria 2626
792 Ga0501080_0311821 3300049742 Bacteria 1426
793 Ga0501080_0341293 3300049742 Bacteria 1353
794 Ga0501080_1078142 3300049742 Bacteria 694
795 Ga0501081_0000110 3300049743 Bacteria 34989
796 Ga0501081_0005740 3300049743 Bacteria 8036
797 Ga0501081_1178339 3300049743 Bacteria 580
798 Ga0501083_0081556 3300049744 Bacteria 2144
799 Ga0501083_0112833 3300049744 Bacteria 1786
800 Ga0501283_029251 3300049779 Bacteria 917
801 Ga0501035_0021364 3300049822 Bacteria 5950
802 Ga0501035_0802186 3300049822 Bacteria 752
803 Ga0501044_0046768 3300049823 Bacteria 4479
804 Ga0501044_0663837 3300049823 Bacteria 931
805 Ga0501044_1309375 3300049823 Bacteria 591
806 Ga0501045_0000038 3300049824 Bacteria 55579
807 Ga0501045_0169461 3300049824 Bacteria 1626
808 Ga0501045_0251721 3300049824 Bacteria 1315
809 Ga0501212_092899 3300049851 Bacteria 559
810 nmdc:mga0k408_7255_c1 3300050493 Bacteria 5924
811 nmdc:mga05p37_1298538_c1 3300050507 Bacteria 742
812 nmdc:mga05p37_2835_c1 3300050507 Bacteria 20152
813 nmdc:mga05p37_724826_c1 3300050507 Bacteria 1100
814 nmdc:mga05p37_74156_c1 3300050507 Bacteria 4188
815 nmdc:mga05p37_803_c1 3300050507 Bacteria 35042
816 nmdc:mga05p37_869553_c1 3300050507 Bacteria 976
817 nmdc:mga09592_107109_c1 3300050508 Bacteria 2398
818 nmdc:mga09592_15465_c1 3300050508 Bacteria 6236
819 nmdc:mga09592_225263_c1 3300050508 Bacteria 1625
820 nmdc:mga09592_297287_c1 3300050508 Bacteria 1400
821 nmdc:mga09592_44_c1 3300050508 Bacteria 69981
822 nmdc:mga09592_607708_c1 3300050508 Bacteria 936
823 nmdc:mga09592_719365_c1 3300050508 Bacteria 849
824 nmdc:mga0qj67_10164_c1 3300050509 Bacteria 7025
825 nmdc:mga0qj67_131916_c1 3300050509 Bacteria 2024
826 nmdc:mga0qj67_169646_c1 3300050509 Bacteria 1772
827 nmdc:mga0qj67_17987_c1 3300050509 Bacteria 5382
828 nmdc:mga0qj67_33460_c1 3300050509 Bacteria 4011
829 nmdc:mga0qj67_695609_c1 3300050509 Bacteria 809
830 nmdc:mga06r32_144284_c1 3300050510 Bacteria 2358
831 nmdc:mga06r32_1804616_c1 3300050510 Bacteria 547
832 nmdc:mga06r32_200984_c1 3300050510 Bacteria 1981
833 nmdc:mga06r32_213064_c1 3300050510 Bacteria 1920
834 nmdc:mga06r32_344765_c1 3300050510 Bacteria 1474
835 nmdc:mga06r32_41056_c1 3300050510 Bacteria 4394
836 nmdc:mga06r32_811139_c1 3300050510 Bacteria 896
837 nmdc:mga08y16_100735_c1 3300050511 Bacteria 3008
838 nmdc:mga08y16_131646_c1 3300050511 Bacteria 2601
839 nmdc:mga08y16_188039_c1 3300050511 Bacteria 2143
840 nmdc:mga08y16_48362_c1 3300050511 Bacteria 4452
841 nmdc:mga08y16_484157_c1 3300050511 Bacteria 1259
842 nmdc:mga08y16_552806_c1 3300050511 Bacteria 1165
843 nmdc:mga08y16_599224_c1 3300050511 Bacteria 1111
844 nmdc:mga08y16_63695_c1 3300050511 Bacteria 3851
845 nmdc:mga08y16_671179_c1 3300050511 Bacteria 1039
846 nmdc:mga0n895_1797334_c1 3300050512 Bacteria 574
847 nmdc:mga0n895_356505_c1 3300050512 Bacteria 1481
848 nmdc:mga0n895_582_c1 3300050512 Bacteria 25135
849 nmdc:mga0n895_649792_c1 3300050512 Bacteria 1054
850 nmdc:mga0n895_999934_c1 3300050512 Bacteria 818
851 nmdc:mga0rr50_132437_c1 3300050513 Bacteria 1998
852 nmdc:mga0rr50_1494207_c1 3300050513 Bacteria 571
853 nmdc:mga0rr50_19252_c1 3300050513 Bacteria 4603
854 nmdc:mga0rr50_3282_c1 3300050513 Bacteria 9282
855 nmdc:mga0rr50_536725_c1 3300050513 Bacteria 996
856 nmdc:mga0rr50_5530_c2 3300050513 Bacteria 6785
857 nmdc:mga0rr50_573443_c1 3300050513 Bacteria 961
858 nmdc:mga0rr50_695280_c1 3300050513 Bacteria 868
859 nmdc:mga0rr50_825899_c1 3300050513 Bacteria 791
860 nmdc:mga08x19_1243641_c1 3300050514 Bacteria 528
861 nmdc:mga08x19_1858_c1 3300050514 Bacteria 12938
862 nmdc:mga08x19_40646_c1 3300050514 Bacteria 2960
863 nmdc:mga08x19_530202_c1 3300050514 Bacteria 832
864 nmdc:mga08x19_573139_c1 3300050514 Bacteria 799
865 nmdc:mga08x19_74217_c1 3300050514 Bacteria 2222
866 nmdc:mga08x19_91610_c1 3300050514 Bacteria 2007
867 nmdc:mga08x19_98427_c1 3300050514 Bacteria 1938
868 nmdc:mga0a205_1044103_c1 3300050515 Bacteria 664
869 nmdc:mga0a205_1261800_c1 3300050515 Bacteria 587
870 nmdc:mga0a205_1416772_c1 3300050515 Bacteria 543
871 nmdc:mga0a205_18247_c1 3300050515 Bacteria 6592
872 nmdc:mga0a205_252698_c1 3300050515 Bacteria 1642
873 nmdc:mga0a205_34658_c1 3300050515 Bacteria 4844
874 nmdc:mga0a205_357921_c1 3300050515 Bacteria 1326
875 nmdc:mga0a205_740623_c1 3300050515 Bacteria 832
876 Ga0495601_0102515 3300053077 Bacteria 1849
877 Ga0495601_0349746 3300053077 Bacteria 961
878 Ga0495595_0335685 3300053084 Bacteria 762
879 Ga0495619_0621237 3300053085 Bacteria 738
880 Ga0501084_0005924 3300054114 Bacteria 10067
881 Ga0501084_0073589 3300054114 Bacteria 2861
882 Ga0501084_0848067 3300054114 Bacteria 769
883 Ga0501084_0982310 3300054114 Bacteria 710
884 Ga0501084_1073356 3300054114 Bacteria 676
885 Ga0590071_023052 3300059421 Bacteria 1470
886 Ga0590077_063350 3300059426 Bacteria 840
887 Ga0590077_082449 3300059426 Bacteria 741
888 Ga0501082_0000430 3300060353 Bacteria 37227
889 Ga0501082_0014186 3300060353 Bacteria 6858
890 Ga0501082_0665818 3300060353 Bacteria 911
891 Ga0501082_1827029 3300060353 Bacteria 530
892 Ga0530510_0000186 3300061734 Bacteria 37940
893 Ga0530510_0001727 3300061734 Bacteria 14851
894 Ga0530510_0774213 3300061734 Bacteria 732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10266818 Ga0307405_102668182 101
2 3300046459 Ga0495629_0268868 Ga0495629_0268868_103_414 103
3 3300046463 Ga0495653_0303011 Ga0495653_0303011_102_413 103
4 3300046477 Ga0495664_0434049 Ga0495664_0434049_195_506 103
5 3300046517 Ga0495630_0526424 Ga0495630_0526424_88_399 103
6 3300046529 Ga0495652_0647059 Ga0495652_0647059_40_351 103
7 3300046535 Ga0495586_0016693 Ga0495586_0016693_2977_3288 103
8 3300046536 Ga0495587_0118678 Ga0495587_0118678_216_527 103
9 3300046557 Ga0495622_0019198 Ga0495622_0019198_1734_2045 103
10 3300046660 Ga0495625_0014493 Ga0495625_0014493_70_381 103
11 3300046809 Ga0495600_0351907 Ga0495600_0351907_71_382 103
12 3300047315 Ga0495581_0297970 Ga0495581_0297970_505_816 103
13 3300047322 Ga0495680_0349761 Ga0495680_0349761_611_922 103
14 3300047444 Ga0495675_0011335 Ga0495675_0011335_2125_2436 103
15 3300047673 Ga0495593_0008922 Ga0495593_0008922_796_1107 103
16 3300048089 Ga0495614_0382755 Ga0495614_0382755_124_435 103
17 3300009176 Ga0105242_11564528 Ga0105242_115645282 105
18 3300049526 Ga0501303_017067 Ga0501303_017067_387_704 105
19 3300005331 Ga0070670_100695653 Ga0070670_1006956532 106
20 3300036401 Ga0373937_0856988 Ga0373937_0856988_330_677 106
21 3300046462 Ga0495651_0242044 Ga0495651_0242044_261_608 106
22 3300046529 Ga0495652_0257177 Ga0495652_0257177_913_1260 106
23 3300046536 Ga0495587_0451617 Ga0495587_0451617_124_471 106
24 3300005343 Ga0070687_100357092 Ga0070687_1003570923 109
25 3300005364 Ga0070673_101614351 Ga0070673_1016143511 109
26 3300006852 Ga0075433_11223104 Ga0075433_112231042 109
27 3300009094 Ga0111539_10050653 Ga0111539_100506537 109
28 3300025918 Ga0207662_10274069 Ga0207662_102740694 109
29 3300025960 Ga0207651_11102964 Ga0207651_111029642 109
30 3300027907 Ga0207428_10404566 Ga0207428_104045662 109
31 3300049589 Ga0501073_1004475 Ga0501073_1004475_98_427 109
32 3300049742 Ga0501080_0104562 Ga0501080_0104562_502_831 109
33 3300050511 nmdc:mga08y16_671179_c1 nmdc:mga08y16_671179_c1_490_837 109
34 3300050515 nmdc:mga0a205_1044103_c1 nmdc:mga0a205_1044103_c1_135_482 109
35 3300005293 Ga0065715_11104991 Ga0065715_111049911 110
36 3300005333 Ga0070677_10637978 Ga0070677_106379781 110
37 3300042876 Ga0451577_0547198 Ga0451577_0547198_689_1021 110
38 3300046539 Ga0495621_0123251 Ga0495621_0123251_661_993 110
39 3300049593 Ga0501077_0773240 Ga0501077_0773240_14_352 110
40 3300054114 Ga0501084_0073589 Ga0501084_0073589_14_352 110
41 3300005842 Ga0068858_100387156 Ga0068858_1003871563 112
42 3300026035 Ga0207703_11784423 Ga0207703_117844232 112
43 3300035092 Ga0373952_0092566 Ga0373952_0092566_149_487 112
44 3300049824 Ga0501045_0251721 Ga0501045_0251721_318_656 112
45 3300006051 Ga0075364_10247712 Ga0075364_102477123 113
46 3300006195 Ga0075366_10008600 Ga0075366_100086006 113
47 3300025885 Ga0207653_10072326 Ga0207653_100723264 113
48 3300050493 nmdc:mga0k408_7255_c1 nmdc:mga0k408_7255_c1_4646_4987 113
49 3300005295 Ga0065707_10209799 Ga0065707_102097992 115
50 3300005295 Ga0065707_10267281 Ga0065707_102672812 115
51 3300005295 Ga0065707_10279404 Ga0065707_102794042 115
52 3300005295 Ga0065707_10313736 Ga0065707_103137362 115
53 3300005295 Ga0065707_10811619 Ga0065707_108116192 115
54 3300005330 Ga0070690_100346623 Ga0070690_1003466234 115
55 3300005331 Ga0070670_101242777 Ga0070670_1012427771 115
56 3300005334 Ga0068869_100776335 Ga0068869_1007763351 115
57 3300005336 Ga0070680_100057644 Ga0070680_1000576444 115
58 3300005336 Ga0070680_100144219 Ga0070680_1001442194 115
59 3300005340 Ga0070689_100222797 Ga0070689_1002227974 115
60 3300005340 Ga0070689_100345415 Ga0070689_1003454154 115
61 3300005341 Ga0070691_10226632 Ga0070691_102266322 115
62 3300005341 Ga0070691_10228333 Ga0070691_102283332 115
63 3300005343 Ga0070687_100318314 Ga0070687_1003183142 115
64 3300005343 Ga0070687_100554930 Ga0070687_1005549302 115
65 3300005345 Ga0070692_10004733 Ga0070692_100047333 115
66 3300005345 Ga0070692_10472927 Ga0070692_104729271 115
67 3300005345 Ga0070692_11153104 Ga0070692_111531041 115
68 3300005347 Ga0070668_100118907 Ga0070668_1001189073 115
69 3300005353 Ga0070669_100070052 Ga0070669_1000700522 115
70 3300005353 Ga0070669_100357508 Ga0070669_1003575082 115
71 3300005354 Ga0070675_100056290 Ga0070675_1000562904 115
72 3300005355 Ga0070671_101382208 Ga0070671_1013822082 115
73 3300005356 Ga0070674_100019780 Ga0070674_1000197802 115
74 3300005356 Ga0070674_100992213 Ga0070674_1009922132 115
75 3300005356 Ga0070674_101605794 Ga0070674_1016057941 115
76 3300005364 Ga0070673_101767120 Ga0070673_1017671202 115
77 3300005406 Ga0070703_10372515 Ga0070703_103725152 115
78 3300005435 Ga0070714_100185510 Ga0070714_1001855104 115
79 3300005438 Ga0070701_10020823 Ga0070701_100208234 115
80 3300005440 Ga0070705_100005488 Ga0070705_1000054882 115
81 3300005440 Ga0070705_100090996 Ga0070705_1000909962 115
82 3300005440 Ga0070705_100195727 Ga0070705_1001957272 115
83 3300005440 Ga0070705_100378924 Ga0070705_1003789242 115
84 3300005440 Ga0070705_100563316 Ga0070705_1005633163 115
85 3300005440 Ga0070705_101053381 Ga0070705_1010533812 115
86 3300005441 Ga0070700_100006936 Ga0070700_1000069362 115
87 3300005441 Ga0070700_100308089 Ga0070700_1003080892 115
88 3300005441 Ga0070700_100312331 Ga0070700_1003123311 115
89 3300005441 Ga0070700_100602125 Ga0070700_1006021253 115
90 3300005441 Ga0070700_101374856 Ga0070700_1013748562 115
91 3300005441 Ga0070700_101568565 Ga0070700_1015685652 115
92 3300005444 Ga0070694_100009317 Ga0070694_1000093177 115
93 3300005444 Ga0070694_100014517 Ga0070694_1000145174 115
94 3300005444 Ga0070694_100141175 Ga0070694_1001411752 115
95 3300005444 Ga0070694_100179831 Ga0070694_1001798312 115
96 3300005444 Ga0070694_100267604 Ga0070694_1002676041 115
97 3300005444 Ga0070694_100355163 Ga0070694_1003551633 115
98 3300005444 Ga0070694_100367647 Ga0070694_1003676473 115
99 3300005444 Ga0070694_100995358 Ga0070694_1009953582 115
100 3300005445 Ga0070708_101140782 Ga0070708_1011407822 115
101 3300005445 Ga0070708_101725016 Ga0070708_1017250162 115
102 3300005456 Ga0070678_100324300 Ga0070678_1003243003 115
103 3300005458 Ga0070681_10000198 Ga0070681_1000019833 115
104 3300005459 Ga0068867_100023523 Ga0068867_1000235234 115
105 3300005459 Ga0068867_101307236 Ga0068867_1013072362 115
106 3300005466 Ga0070685_11391110 Ga0070685_113911102 115
107 3300005466 Ga0070685_11471537 Ga0070685_114715371 115
108 3300005467 Ga0070706_100167580 Ga0070706_1001675802 115
109 3300005468 Ga0070707_100571189 Ga0070707_1005711892 115
110 3300005468 Ga0070707_100984659 Ga0070707_1009846592 115
111 3300005471 Ga0070698_100054920 Ga0070698_1000549203 115
112 3300005471 Ga0070698_101668378 Ga0070698_1016683781 115
113 3300005518 Ga0070699_100095806 Ga0070699_1000958064 115
114 3300005518 Ga0070699_100258097 Ga0070699_1002580972 115
115 3300005518 Ga0070699_100512930 Ga0070699_1005129302 115
116 3300005530 Ga0070679_100687178 Ga0070679_1006871782 115
117 3300005530 Ga0070679_101310155 Ga0070679_1013101551 115
118 3300005530 Ga0070679_102013320 Ga0070679_1020133201 115
119 3300005536 Ga0070697_100002931 Ga0070697_10000293117 115
120 3300005536 Ga0070697_100095073 Ga0070697_1000950732 115
121 3300005536 Ga0070697_101135835 Ga0070697_1011358351 115
122 3300005536 Ga0070697_101993232 Ga0070697_1019932321 115
123 3300005543 Ga0070672_100467010 Ga0070672_1004670103 115
124 3300005544 Ga0070686_100028921 Ga0070686_1000289214 115
125 3300005544 Ga0070686_100244972 Ga0070686_1002449723 115
126 3300005544 Ga0070686_100572972 Ga0070686_1005729722 115
127 3300005544 Ga0070686_100721495 Ga0070686_1007214952 115
128 3300005544 Ga0070686_101073141 Ga0070686_1010731411 115
129 3300005544 Ga0070686_101615787 Ga0070686_1016157871 115
130 3300005545 Ga0070695_100003592 Ga0070695_1000035924 115
131 3300005545 Ga0070695_100029321 Ga0070695_1000293212 115
132 3300005545 Ga0070695_100260639 Ga0070695_1002606392 115
133 3300005545 Ga0070695_100651696 Ga0070695_1006516962 115
134 3300005545 Ga0070695_100856214 Ga0070695_1008562141 115
135 3300005545 Ga0070695_101518489 Ga0070695_1015184891 115
136 3300005546 Ga0070696_100067694 Ga0070696_1000676942 115
137 3300005546 Ga0070696_100259271 Ga0070696_1002592712 115
138 3300005546 Ga0070696_100395783 Ga0070696_1003957831 115
139 3300005546 Ga0070696_100408338 Ga0070696_1004083382 115
140 3300005546 Ga0070696_100579076 Ga0070696_1005790761 115
141 3300005549 Ga0070704_100046477 Ga0070704_1000464774 115
142 3300005549 Ga0070704_100060605 Ga0070704_1000606052 115
143 3300005549 Ga0070704_100100059 Ga0070704_1001000593 115
144 3300005549 Ga0070704_100110016 Ga0070704_1001100162 115
145 3300005577 Ga0068857_100535415 Ga0068857_1005354152 115
146 3300005614 Ga0068856_101171182 Ga0068856_1011711822 115
147 3300005615 Ga0070702_100230352 Ga0070702_1002303522 115
148 3300005617 Ga0068859_100019288 Ga0068859_1000192886 115
149 3300005617 Ga0068859_100028423 Ga0068859_1000284234 115
150 3300005617 Ga0068859_101038106 Ga0068859_1010381063 115
151 3300005617 Ga0068859_101151732 Ga0068859_1011517323 115
152 3300005617 Ga0068859_101809460 Ga0068859_1018094602 115
153 3300005718 Ga0068866_10452638 Ga0068866_104526382 115
154 3300005719 Ga0068861_100021205 Ga0068861_1000212054 115
155 3300005719 Ga0068861_100704402 Ga0068861_1007044022 115
156 3300005719 Ga0068861_101058305 Ga0068861_1010583052 115
157 3300005840 Ga0068870_10793039 Ga0068870_107930391 115
158 3300005840 Ga0068870_11174522 Ga0068870_111745222 115
159 3300005841 Ga0068863_100759325 Ga0068863_1007593252 115
160 3300005843 Ga0068860_101534762 Ga0068860_1015347621 115
161 3300005844 Ga0068862_100032132 Ga0068862_1000321324 115
162 3300005844 Ga0068862_100149773 Ga0068862_1001497732 115
163 3300005844 Ga0068862_100278266 Ga0068862_1002782662 115
164 3300005844 Ga0068862_100600397 Ga0068862_1006003972 115
165 3300005981 Ga0081538_10160025 Ga0081538_101600252 115
166 3300005985 Ga0081539_10000842 Ga0081539_1000084249 115
167 3300006051 Ga0075364_10729198 Ga0075364_107291982 115
168 3300006163 Ga0070715_10538208 Ga0070715_105382082 115
169 3300006173 Ga0070716_100894593 Ga0070716_1008945932 115
170 3300006175 Ga0070712_101175719 Ga0070712_1011757191 115
171 3300006237 Ga0097621_100570193 Ga0097621_1005701932 115
172 3300006844 Ga0075428_100060247 Ga0075428_1000602475 115
173 3300006844 Ga0075428_100251107 Ga0075428_1002511072 115
174 3300006846 Ga0075430_100049636 Ga0075430_1000496365 115
175 3300006846 Ga0075430_100742838 Ga0075430_1007428382 115
176 3300006847 Ga0075431_100013334 Ga0075431_10001333410 115
177 3300006847 Ga0075431_100146517 Ga0075431_1001465172 115
178 3300006847 Ga0075431_100351111 Ga0075431_1003511112 115
179 3300006847 Ga0075431_100700496 Ga0075431_1007004962 115
180 3300006847 Ga0075431_100832103 Ga0075431_1008321032 115
181 3300006847 Ga0075431_102108306 Ga0075431_1021083062 115
182 3300006852 Ga0075433_10042272 Ga0075433_100422725 115
183 3300006871 Ga0075434_100000073 Ga0075434_10000007329 115
184 3300006871 Ga0075434_100019885 Ga0075434_1000198856 115
185 3300006871 Ga0075434_100485931 Ga0075434_1004859313 115
186 3300006871 Ga0075434_102139299 Ga0075434_1021392992 115
187 3300006880 Ga0075429_100000080 Ga0075429_10000008037 115
188 3300006880 Ga0075429_100168323 Ga0075429_1001683232 115
189 3300006880 Ga0075429_100678858 Ga0075429_1006788581 115
190 3300006880 Ga0075429_100737243 Ga0075429_1007372431 115
191 3300006880 Ga0075429_100822042 Ga0075429_1008220423 115
192 3300006880 Ga0075429_101138282 Ga0075429_1011382822 115
193 3300006881 Ga0068865_100029927 Ga0068865_1000299272 115
194 3300006881 Ga0068865_100811787 Ga0068865_1008117872 115
195 3300006914 Ga0075436_100000205 Ga0075436_10000020513 115
196 3300006914 Ga0075436_100038706 Ga0075436_1000387062 115
197 3300006914 Ga0075436_100058404 Ga0075436_1000584042 115
198 3300006914 Ga0075436_100498424 Ga0075436_1004984242 115
199 3300006914 Ga0075436_100515462 Ga0075436_1005154621 115
200 3300006914 Ga0075436_100558744 Ga0075436_1005587442 115
201 3300006931 Ga0097620_100019288 Ga0097620_1000192886 115
202 3300006931 Ga0097620_100028423 Ga0097620_1000284236 115
203 3300006931 Ga0097620_101038090 Ga0097620_1010380903 115
204 3300006931 Ga0097620_101151728 Ga0097620_1011517283 115
205 3300006931 Ga0097620_101809470 Ga0097620_1018094701 115
206 3300007076 Ga0075435_100006291 Ga0075435_1000062915 115
207 3300007076 Ga0075435_100140284 Ga0075435_1001402845 115
208 3300007076 Ga0075435_100328058 Ga0075435_1003280582 115
209 3300007076 Ga0075435_101752918 Ga0075435_1017529181 115
210 3300009094 Ga0111539_10065584 Ga0111539_100655846 115
211 3300009094 Ga0111539_10131269 Ga0111539_101312692 115
212 3300009094 Ga0111539_10168418 Ga0111539_101684182 115
213 3300009094 Ga0111539_10551503 Ga0111539_105515032 115
214 3300009094 Ga0111539_11095879 Ga0111539_110958792 115
215 3300009094 Ga0111539_11967183 Ga0111539_119671831 115
216 3300009094 Ga0111539_13348128 Ga0111539_133481282 115
217 3300009098 Ga0105245_12959604 Ga0105245_129596042 115
218 3300009147 Ga0114129_10032898 Ga0114129_100328985 115
219 3300009147 Ga0114129_10373021 Ga0114129_103730212 115
220 3300009147 Ga0114129_10515058 Ga0114129_105150582 115
221 3300009147 Ga0114129_10999632 Ga0114129_109996322 115
222 3300009147 Ga0114129_11630562 Ga0114129_116305622 115
223 3300009148 Ga0105243_10045531 Ga0105243_100455312 115
224 3300009148 Ga0105243_12071974 Ga0105243_120719742 115
225 3300009148 Ga0105243_12402752 Ga0105243_124027521 115
226 3300009176 Ga0105242_10209160 Ga0105242_102091602 115
227 3300009553 Ga0105249_10377074 Ga0105249_103770742 115
228 3300009553 Ga0105249_12816224 Ga0105249_128162241 115
229 3300009553 Ga0105249_13480936 Ga0105249_134809361 115
230 3300013297 Ga0157378_11059085 Ga0157378_110590852 115
231 3300013297 Ga0157378_12059457 Ga0157378_120594572 115
232 3300014326 Ga0157380_10011328 Ga0157380_100113283 115
233 3300014326 Ga0157380_12109104 Ga0157380_121091042 115
234 3300014745 Ga0157377_10426969 Ga0157377_104269692 115
235 3300025899 Ga0207642_10124344 Ga0207642_101243442 115
236 3300025901 Ga0207688_10325951 Ga0207688_103259513 115
237 3300025907 Ga0207645_10053737 Ga0207645_100537373 115
238 3300025908 Ga0207643_10103236 Ga0207643_101032362 115
239 3300025910 Ga0207684_10398182 Ga0207684_103981822 115
240 3300025910 Ga0207684_10736824 Ga0207684_107368242 115
241 3300025912 Ga0207707_10003333 Ga0207707_1000333314 115
242 3300025916 Ga0207663_10655419 Ga0207663_106554192 115
243 3300025917 Ga0207660_10020821 Ga0207660_100208214 115
244 3300025917 Ga0207660_10655257 Ga0207660_106552572 115
245 3300025918 Ga0207662_10064715 Ga0207662_100647154 115
246 3300025918 Ga0207662_10070983 Ga0207662_100709832 115
247 3300025921 Ga0207652_10030844 Ga0207652_100308442 115
248 3300025922 Ga0207646_10427740 Ga0207646_104277402 115
249 3300025923 Ga0207681_10006318 Ga0207681_100063188 115
250 3300025923 Ga0207681_11729119 Ga0207681_117291192 115
251 3300025926 Ga0207659_10062589 Ga0207659_100625892 115
252 3300025933 Ga0207706_10766185 Ga0207706_107661853 115
253 3300025934 Ga0207686_10557776 Ga0207686_105577762 115
254 3300025935 Ga0207709_10007609 Ga0207709_100076096 115
255 3300025936 Ga0207670_10418035 Ga0207670_104180354 115
256 3300025936 Ga0207670_10752244 Ga0207670_107522442 115
257 3300025937 Ga0207669_10003349 Ga0207669_100033498 115
258 3300025937 Ga0207669_10811645 Ga0207669_108116452 115
259 3300025938 Ga0207704_10007398 Ga0207704_100073985 115
260 3300025938 Ga0207704_10180508 Ga0207704_101805083 115
261 3300025939 Ga0207665_10327019 Ga0207665_103270192 115
262 3300025939 Ga0207665_10880138 Ga0207665_108801382 115
263 3300025940 Ga0207691_10119742 Ga0207691_101197422 115
264 3300025942 Ga0207689_10371845 Ga0207689_103718452 115
265 3300025942 Ga0207689_10435302 Ga0207689_104353023 115
266 3300025942 Ga0207689_11464904 Ga0207689_114649042 115
267 3300025960 Ga0207651_11016019 Ga0207651_110160192 115
268 3300025961 Ga0207712_10225900 Ga0207712_102259003 115
269 3300025972 Ga0207668_10037290 Ga0207668_100372904 115
270 3300026023 Ga0207677_10653886 Ga0207677_106538862 115
271 3300026075 Ga0207708_10006009 Ga0207708_100060098 115
272 3300026075 Ga0207708_10036334 Ga0207708_100363342 115
273 3300026075 Ga0207708_10246018 Ga0207708_102460183 115
274 3300026075 Ga0207708_11269594 Ga0207708_112695942 115
275 3300026078 Ga0207702_10897698 Ga0207702_108976982 115
276 3300026089 Ga0207648_10002987 Ga0207648_100029876 115
277 3300026089 Ga0207648_11293123 Ga0207648_112931231 115
278 3300026095 Ga0207676_11565246 Ga0207676_115652462 115
279 3300026116 Ga0207674_10174419 Ga0207674_101744191 115
280 3300026116 Ga0207674_10462949 Ga0207674_104629493 115
281 3300026118 Ga0207675_100000651 Ga0207675_1000006517 115
282 3300026118 Ga0207675_100638682 Ga0207675_1006386822 115
283 3300026118 Ga0207675_100861044 Ga0207675_1008610443 115
284 3300026118 Ga0207675_101248408 Ga0207675_1012484082 115
285 3300026121 Ga0207683_10091937 Ga0207683_100919371 115
286 3300027360 Ga0209969_1028833 Ga0209969_10288332 115
287 3300027364 Ga0209967_1005806 Ga0209967_10058063 115
288 3300027364 Ga0209967_1006851 Ga0209967_10068514 115
289 3300027364 Ga0209967_1007443 Ga0209967_10074432 115
290 3300027378 Ga0209981_1009968 Ga0209981_10099682 115
291 3300027378 Ga0209981_1037131 Ga0209981_10371311 115
292 3300027395 Ga0209996_1022515 Ga0209996_10225152 115
293 3300027395 Ga0209996_1042690 Ga0209996_10426901 115
294 3300027462 Ga0210000_1005614 Ga0210000_10056142 115
295 3300027462 Ga0210000_1009349 Ga0210000_10093493 115
296 3300027462 Ga0210000_1016142 Ga0210000_10161423 115
297 3300027471 Ga0209995_1010851 Ga0209995_10108514 115
298 3300027471 Ga0209995_1012130 Ga0209995_10121303 115
299 3300027526 Ga0209968_1007653 Ga0209968_10076533 115
300 3300027543 Ga0209999_1004248 Ga0209999_10042485 115
301 3300027543 Ga0209999_1031217 Ga0209999_10312172 115
302 3300027543 Ga0209999_1083453 Ga0209999_10834532 115
303 3300027552 Ga0209982_1049402 Ga0209982_10494022 115
304 3300027614 Ga0209970_1041651 Ga0209970_10416512 115
305 3300027614 Ga0209970_1099545 Ga0209970_10995452 115
306 3300027665 Ga0209983_1136672 Ga0209983_11366722 115
307 3300027665 Ga0209983_1161936 Ga0209983_11619362 115
308 3300027682 Ga0209971_1006528 Ga0209971_10065282 115
309 3300027682 Ga0209971_1105422 Ga0209971_11054222 115
310 3300027695 Ga0209966_1023390 Ga0209966_10233902 115
311 3300027695 Ga0209966_1042642 Ga0209966_10426422 115
312 3300027876 Ga0209974_10011132 Ga0209974_100111324 115
313 3300027876 Ga0209974_10138771 Ga0209974_101387712 115
314 3300027907 Ga0207428_10019374 Ga0207428_100193745 115
315 3300027907 Ga0207428_10286072 Ga0207428_102860722 115
316 3300027907 Ga0207428_10322863 Ga0207428_103228632 115
317 3300028380 Ga0268265_10000781 Ga0268265_1000078122 115
318 3300028380 Ga0268265_10172111 Ga0268265_101721112 115
319 3300028380 Ga0268265_10539870 Ga0268265_105398702 115
320 3300028380 Ga0268265_11132614 Ga0268265_111326142 115
321 3300028380 Ga0268265_12016389 Ga0268265_120163891 115
322 3300028381 Ga0268264_10358617 Ga0268264_103586172 115
323 3300031548 Ga0307408_100217170 Ga0307408_1002171704 115
324 3300031548 Ga0307408_100328650 Ga0307408_1003286503 115
325 3300031548 Ga0307408_100397344 Ga0307408_1003973442 115
326 3300031548 Ga0307408_100483338 Ga0307408_1004833383 115
327 3300031548 Ga0307408_100499765 Ga0307408_1004997652 115
328 3300031548 Ga0307408_100558767 Ga0307408_1005587673 115
329 3300031548 Ga0307408_100961731 Ga0307408_1009617313 115
330 3300031731 Ga0307405_10471668 Ga0307405_104716683 115
331 3300031852 Ga0307410_12032337 Ga0307410_120323371 115
332 3300031901 Ga0307406_10254138 Ga0307406_102541382 115
333 3300031901 Ga0307406_10660434 Ga0307406_106604342 115
334 3300031903 Ga0307407_10210867 Ga0307407_102108672 115
335 3300031911 Ga0307412_10408092 Ga0307412_104080921 115
336 3300031911 Ga0307412_10843877 Ga0307412_108438772 115
337 3300031995 Ga0307409_100169468 Ga0307409_1001694682 115
338 3300031995 Ga0307409_100466699 Ga0307409_1004666993 115
339 3300032002 Ga0307416_100143175 Ga0307416_1001431753 115
340 3300032002 Ga0307416_100191358 Ga0307416_1001913582 115
341 3300032002 Ga0307416_100323996 Ga0307416_1003239962 115
342 3300032002 Ga0307416_100359490 Ga0307416_1003594904 115
343 3300032002 Ga0307416_100689954 Ga0307416_1006899542 115
344 3300032002 Ga0307416_101345812 Ga0307416_1013458121 115
345 3300032005 Ga0307411_10022035 Ga0307411_100220353 115
346 3300032005 Ga0307411_10151900 Ga0307411_101519004 115
347 3300034816 Ga0373930_0160800 Ga0373930_0160800_93_440 115
348 3300034957 Ga0373938_0126471 Ga0373938_0126471_140_487 115
349 3300035086 Ga0373934_0251967 Ga0373934_0251967_78_425 115
350 3300035114 Ga0373939_0044852 Ga0373939_0044852_97_444 115
351 3300035207 Ga0373942_0183233 Ga0373942_0183233_68_415 115
352 3300035410 Ga0373924_0108202 Ga0373924_0108202_77_424 115
353 3300035691 Ga0373931_0128940 Ga0373931_0128940_796_1143 115
354 3300035692 Ga0373935_0010817 Ga0373935_0010817_1321_1668 115
355 3300035695 Ga0373927_0038778 Ga0373927_0038778_818_1165 115
356 3300036401 Ga0373937_0115160 Ga0373937_0115160_1189_1536 115
357 3300036401 Ga0373937_0226652 Ga0373937_0226652_1081_1428 115
358 3300036401 Ga0373937_0340309 Ga0373937_0340309_98_445 115
359 3300036401 Ga0373937_0570520 Ga0373937_0570520_169_516 115
360 3300036401 Ga0373937_1364362 Ga0373937_1364362_291_638 115
361 3300037068 Ga0373925_0007563 Ga0373925_0007563_4572_4919 115
362 3300041404 Ga0439436_0149396 Ga0439436_0149396_207_554 115
363 3300041406 Ga0439439_0021515 Ga0439439_0021515_655_1002 115
364 3300041408 Ga0439453_0033996 Ga0439453_0033996_564_911 115
365 3300041410 Ga0439461_0002899 Ga0439461_0002899_1713_2060 115
366 3300041460 Ga0451802_0411675 Ga0451802_0411675_37_384 115
367 3300041486 Ga0451807_0142877 Ga0451807_0142877_552_899 115
368 3300041486 Ga0451807_1785507 Ga0451807_1785507_28_375 115
369 3300041501 Ga0451845_0620846 Ga0451845_0620846_31_378 115
370 3300042001 Ga0439441_000488 Ga0439441_000488_836_1189 115
371 3300042001 Ga0439441_029634 Ga0439441_029634_585_932 115
372 3300042001 Ga0439441_045240 Ga0439441_045240_65_412 115
373 3300042001 Ga0439441_081579 Ga0439441_081579_170_517 115
374 3300042001 Ga0439441_147161 Ga0439441_147161_86_436 115
375 3300042003 Ga0439443_036387 Ga0439443_036387_412_765 115
376 3300042009 Ga0439451_031250 Ga0439451_031250_224_577 115
377 3300042015 Ga0439462_0012540 Ga0439462_0012540_97_444 115
378 3300042125 Ga0450923_114106 Ga0450923_114106_65_412 115
379 3300042156 Ga0439446_0004777 Ga0439446_0004777_2964_3311 115
380 3300042156 Ga0439446_0111205 Ga0439446_0111205_44_391 115
381 3300042435 Ga0439434_0000076 Ga0439434_0000076_3204_3551 115
382 3300042435 Ga0439434_0103290 Ga0439434_0103290_312_659 115
383 3300042436 Ga0439435_0001056 Ga0439435_0001056_3108_3455 115
384 3300042436 Ga0439435_0098919 Ga0439435_0098919_505_858 115
385 3300042437 Ga0439444_0021720 Ga0439444_0021720_110_457 115
386 3300044673 Ga0453683_0536007 Ga0453683_0536007_164_511 115
387 3300044683 Ga0466965_0132417 Ga0466965_0132417_858_1205 115
388 3300045051 Ga0451576_0017229 Ga0451576_0017229_4737_5084 115
389 3300045051 Ga0451576_0045166 Ga0451576_0045166_3139_3486 115
390 3300045051 Ga0451576_0214293 Ga0451576_0214293_1191_1538 115
391 3300045051 Ga0451576_1310889 Ga0451576_1310889_284_631 115
392 3300045051 Ga0451576_2176584 Ga0451576_2176584_158_505 115
393 3300045836 Ga0466958_0467474 Ga0466958_0467474_189_536 115
394 3300045976 Ga0466967_0113879 Ga0466967_0113879_1045_1392 115
395 3300046454 Ga0495592_0001592 Ga0495592_0001592_6332_6679 115
396 3300046459 Ga0495629_1087947 Ga0495629_1087947_55_402 115
397 3300046462 Ga0495651_0980578 Ga0495651_0980578_155_502 115
398 3300046463 Ga0495653_0047055 Ga0495653_0047055_1868_2215 115
399 3300046473 Ga0495582_0088203 Ga0495582_0088203_598_945 115
400 3300046475 Ga0495639_0422330 Ga0495639_0422330_231_578 115
401 3300046476 Ga0495662_0030769 Ga0495662_0030769_1236_1583 115
402 3300046476 Ga0495662_0043033 Ga0495662_0043033_1074_1421 115
403 3300046477 Ga0495664_0310021 Ga0495664_0310021_554_901 115
404 3300046511 Ga0495608_0007794 Ga0495608_0007794_3328_3675 115
405 3300046514 Ga0495618_0140076 Ga0495618_0140076_535_882 115
406 3300046516 Ga0495628_0003126 Ga0495628_0003126_3066_3413 115
407 3300046516 Ga0495628_0252617 Ga0495628_0252617_571_918 115
408 3300046517 Ga0495630_0073248 Ga0495630_0073248_74_421 115
409 3300046517 Ga0495630_0618846 Ga0495630_0618846_62_409 115
410 3300046526 Ga0495666_0025168 Ga0495666_0025168_1831_2178 115
411 3300046529 Ga0495652_0440638 Ga0495652_0440638_114_461 115
412 3300046533 Ga0495640_0009959 Ga0495640_0009959_3771_4118 115
413 3300046533 Ga0495640_0065335 Ga0495640_0065335_1722_2069 115
414 3300046535 Ga0495586_0055967 Ga0495586_0055967_15_362 115
415 3300046536 Ga0495587_0109857 Ga0495587_0109857_154_501 115
416 3300046537 Ga0495598_0052961 Ga0495598_0052961_157_504 115
417 3300046539 Ga0495621_0111561 Ga0495621_0111561_178_525 115
418 3300046559 Ga0495667_0013563 Ga0495667_0013563_3877_4224 115
419 3300046642 Ga0495634_0020851 Ga0495634_0020851_2966_3313 115
420 3300046663 Ga0495635_0117809 Ga0495635_0117809_773_1120 115
421 3300046678 Ga0495599_0022373 Ga0495599_0022373_2277_2624 115
422 3300046681 Ga0495647_0087604 Ga0495647_0087604_614_961 115
423 3300046683 Ga0495658_0292223 Ga0495658_0292223_241_588 115
424 3300046684 Ga0495669_0334554 Ga0495669_0334554_214_561 115
425 3300046689 Ga0495613_0047127 Ga0495613_0047127_1879_2226 115
426 3300046690 Ga0495624_0065340 Ga0495624_0065340_552_899 115
427 3300047315 Ga0495581_0243478 Ga0495581_0243478_457_804 115
428 3300047315 Ga0495581_0835619 Ga0495581_0835619_105_452 115
429 3300047317 Ga0495604_0008726 Ga0495604_0008726_4129_4476 115
430 3300047318 Ga0495636_0012828 Ga0495636_0012828_395_742 115
431 3300047318 Ga0495636_0421976 Ga0495636_0421976_226_573 115
432 3300047318 Ga0495636_0627829 Ga0495636_0627829_136_483 115
433 3300047319 Ga0495674_0532266 Ga0495674_0532266_428_775 115
434 3300047322 Ga0495680_0001252 Ga0495680_0001252_11638_11985 115
435 3300047673 Ga0495593_0186440 Ga0495593_0186440_587_934 115
436 3300048088 Ga0495602_1137740 Ga0495602_1137740_30_377 115
437 3300049514 Ga0501291_053309 Ga0501291_053309_219_566 115
438 3300049521 Ga0501298_040277 Ga0501298_040277_282_629 115
439 3300049522 Ga0501299_113300 Ga0501299_113300_240_587 115
440 3300049526 Ga0501303_047458 Ga0501303_047458_72_419 115
441 3300049568 Ga0501031_0059330 Ga0501031_0059330_732_1079 115
442 3300049569 Ga0501032_0086786 Ga0501032_0086786_568_915 115
443 3300049570 Ga0501033_0011373 Ga0501033_0011373_1257_1604 115
444 3300049570 Ga0501033_0264915 Ga0501033_0264915_11_358 115
445 3300049572 Ga0501036_0001921 Ga0501036_0001921_10479_10826 115
446 3300049572 Ga0501036_0085385 Ga0501036_0085385_1855_2208 115
447 3300049572 Ga0501036_0547806 Ga0501036_0547806_117_464 115
448 3300049573 Ga0501037_0013201 Ga0501037_0013201_4532_4879 115
449 3300049574 Ga0501038_0004982 Ga0501038_0004982_4033_4380 115
450 3300049574 Ga0501038_0923941 Ga0501038_0923941_94_441 115
451 3300049575 Ga0501039_0000477 Ga0501039_0000477_18893_19240 115
452 3300049575 Ga0501039_0024671 Ga0501039_0024671_3880_4233 115
453 3300049575 Ga0501039_0027089 Ga0501039_0027089_522_869 115
454 3300049575 Ga0501039_0033414 Ga0501039_0033414_1102_1455 115
455 3300049576 Ga0501040_0000052 Ga0501040_0000052_27039_27386 115
456 3300049576 Ga0501040_0005360 Ga0501040_0005360_7817_8170 115
457 3300049576 Ga0501040_0113809 Ga0501040_0113809_336_683 115
458 3300049577 Ga0501041_0000038 Ga0501041_0000038_27269_27616 115
459 3300049577 Ga0501041_0015649 Ga0501041_0015649_3656_4003 115
460 3300049577 Ga0501041_0240071 Ga0501041_0240071_318_671 115
461 3300049577 Ga0501041_0430517 Ga0501041_0430517_338_685 115
462 3300049578 Ga0501042_0000048 Ga0501042_0000048_22703_23050 115
463 3300049578 Ga0501042_0111133 Ga0501042_0111133_532_879 115
464 3300049579 Ga0501043_0043047 Ga0501043_0043047_1122_1469 115
465 3300049579 Ga0501043_0630625 Ga0501043_0630625_414_767 115
466 3300049580 Ga0501046_0000271 Ga0501046_0000271_25629_25976 115
467 3300049580 Ga0501046_0012984 Ga0501046_0012984_4853_5206 115
468 3300049580 Ga0501046_1170956 Ga0501046_1170956_23_370 115
469 3300049581 Ga0501047_0136139 Ga0501047_0136139_799_1146 115
470 3300049582 Ga0501048_0000378 Ga0501048_0000378_3769_4116 115
471 3300049582 Ga0501048_0010966 Ga0501048_0010966_2043_2396 115
472 3300049582 Ga0501048_0536037 Ga0501048_0536037_358_705 115
473 3300049583 Ga0501067_0831696 Ga0501067_0831696_37_384 115
474 3300049584 Ga0501068_0014809 Ga0501068_0014809_1123_1470 115
475 3300049584 Ga0501068_0086419 Ga0501068_0086419_87_440 115
476 3300049585 Ga0501069_0123294 Ga0501069_0123294_618_965 115
477 3300049585 Ga0501069_0541180 Ga0501069_0541180_142_489 115
478 3300049586 Ga0501070_0159893 Ga0501070_0159893_233_580 115
479 3300049586 Ga0501070_0951507 Ga0501070_0951507_181_528 115
480 3300049587 Ga0501071_0007914 Ga0501071_0007914_5351_5698 115
481 3300049587 Ga0501071_0128234 Ga0501071_0128234_596_943 115
482 3300049588 Ga0501072_0008011 Ga0501072_0008011_3950_4303 115
483 3300049588 Ga0501072_0009822 Ga0501072_0009822_5743_6090 115
484 3300049588 Ga0501072_0214228 Ga0501072_0214228_382_729 115
485 3300049588 Ga0501072_0488477 Ga0501072_0488477_607_954 115
486 3300049589 Ga0501073_0204289 Ga0501073_0204289_313_666 115
487 3300049590 Ga0501074_0007335 Ga0501074_0007335_6431_6778 115
488 3300049590 Ga0501074_0066914 Ga0501074_0066914_59_412 115
489 3300049590 Ga0501074_0472188 Ga0501074_0472188_165_512 115
490 3300049590 Ga0501074_0636217 Ga0501074_0636217_119_466 115
491 3300049590 Ga0501074_0966257 Ga0501074_0966257_63_410 115
492 3300049591 Ga0501075_0000180 Ga0501075_0000180_5540_5887 115
493 3300049591 Ga0501075_0027409 Ga0501075_0027409_2158_2511 115
494 3300049591 Ga0501075_0148471 Ga0501075_0148471_673_1026 115
495 3300049591 Ga0501075_0550868 Ga0501075_0550868_342_689 115
496 3300049592 Ga0501076_0000290 Ga0501076_0000290_25832_26185 115
497 3300049592 Ga0501076_0000319 Ga0501076_0000319_5782_6129 115
498 3300049592 Ga0501076_0195588 Ga0501076_0195588_65_418 115
499 3300049592 Ga0501076_0698239 Ga0501076_0698239_470_823 115
500 3300049592 Ga0501076_0893114 Ga0501076_0893114_206_553 115
501 3300049593 Ga0501077_0000222 Ga0501077_0000222_14077_14424 115
502 3300049593 Ga0501077_0104746 Ga0501077_0104746_1347_1694 115
503 3300049661 Ga0501217_116597 Ga0501217_116597_140_487 115
504 3300049661 Ga0501217_194514 Ga0501217_194514_171_518 115
505 3300049668 Ga0501233_243369 Ga0501233_243369_122_469 115
506 3300049705 Ga0501225_0046507 Ga0501225_0046507_729_1076 115
507 3300049705 Ga0501225_0274658 Ga0501225_0274658_148_495 115
508 3300049741 Ga0501079_0000061 Ga0501079_0000061_21937_22284 115
509 3300049741 Ga0501079_0047873 Ga0501079_0047873_495_848 115
510 3300049741 Ga0501079_0557856 Ga0501079_0557856_365_718 115
511 3300049742 Ga0501080_0041403 Ga0501080_0041403_2585_2932 115
512 3300049742 Ga0501080_0311821 Ga0501080_0311821_238_591 115
513 3300049742 Ga0501080_0341293 Ga0501080_0341293_259_612 115
514 3300049742 Ga0501080_1078142 Ga0501080_1078142_25_372 115
515 3300049743 Ga0501081_0000110 Ga0501081_0000110_27114_27461 115
516 3300049743 Ga0501081_0005740 Ga0501081_0005740_2820_3173 115
517 3300049743 Ga0501081_1178339 Ga0501081_1178339_184_531 115
518 3300049744 Ga0501083_0081556 Ga0501083_0081556_903_1250 115
519 3300049744 Ga0501083_0112833 Ga0501083_0112833_344_697 115
520 3300049779 Ga0501283_029251 Ga0501283_029251_72_425 115
521 3300049822 Ga0501035_0021364 Ga0501035_0021364_3613_3960 115
522 3300049823 Ga0501044_0046768 Ga0501044_0046768_2866_3213 115
523 3300049823 Ga0501044_0663837 Ga0501044_0663837_155_508 115
524 3300049824 Ga0501045_0000038 Ga0501045_0000038_38561_38908 115
525 3300049824 Ga0501045_0169461 Ga0501045_0169461_206_559 115
526 3300049851 Ga0501212_092899 Ga0501212_092899_78_425 115
527 3300050507 nmdc:mga05p37_724826_c1 nmdc:mga05p37_724826_c1_118_465 115
528 3300050507 nmdc:mga05p37_803_c1 nmdc:mga05p37_803_c1_22583_22933 115
529 3300050507 nmdc:mga05p37_869553_c1 nmdc:mga05p37_869553_c1_405_752 115
530 3300050508 nmdc:mga09592_107109_c1 nmdc:mga09592_107109_c1_771_1118 115
531 3300050508 nmdc:mga09592_225263_c1 nmdc:mga09592_225263_c1_944_1291 115
532 3300050508 nmdc:mga09592_44_c1 nmdc:mga09592_44_c1_38749_39099 115
533 3300050508 nmdc:mga09592_607708_c1 nmdc:mga09592_607708_c1_169_516 115
534 3300050509 nmdc:mga0qj67_10164_c1 nmdc:mga0qj67_10164_c1_2832_3179 115
535 3300050509 nmdc:mga0qj67_131916_c1 nmdc:mga0qj67_131916_c1_1620_1967 115
536 3300050509 nmdc:mga0qj67_169646_c1 nmdc:mga0qj67_169646_c1_1101_1448 115
537 3300050509 nmdc:mga0qj67_17987_c1 nmdc:mga0qj67_17987_c1_3106_3453 115
538 3300050509 nmdc:mga0qj67_695609_c1 nmdc:mga0qj67_695609_c1_359_706 115
539 3300050510 nmdc:mga06r32_144284_c1 nmdc:mga06r32_144284_c1_1098_1448 115
540 3300050510 nmdc:mga06r32_1804616_c1 nmdc:mga06r32_1804616_c1_172_519 115
541 3300050510 nmdc:mga06r32_213064_c1 nmdc:mga06r32_213064_c1_234_581 115
542 3300050510 nmdc:mga06r32_344765_c1 nmdc:mga06r32_344765_c1_615_962 115
543 3300050510 nmdc:mga06r32_811139_c1 nmdc:mga06r32_811139_c1_298_645 115
544 3300050511 nmdc:mga08y16_100735_c1 nmdc:mga08y16_100735_c1_88_435 115
545 3300050511 nmdc:mga08y16_188039_c1 nmdc:mga08y16_188039_c1_459_806 115
546 3300050511 nmdc:mga08y16_484157_c1 nmdc:mga08y16_484157_c1_772_1119 115
547 3300050511 nmdc:mga08y16_552806_c1 nmdc:mga08y16_552806_c1_578_925 115
548 3300050511 nmdc:mga08y16_599224_c1 nmdc:mga08y16_599224_c1_554_901 115
549 3300050511 nmdc:mga08y16_63695_c1 nmdc:mga08y16_63695_c1_2523_2870 115
550 3300050512 nmdc:mga0n895_1797334_c1 nmdc:mga0n895_1797334_c1_84_431 115
551 3300050512 nmdc:mga0n895_356505_c1 nmdc:mga0n895_356505_c1_555_902 115
552 3300050512 nmdc:mga0n895_582_c1 nmdc:mga0n895_582_c1_2701_3048 115
553 3300050512 nmdc:mga0n895_999934_c1 nmdc:mga0n895_999934_c1_159_506 115
554 3300050513 nmdc:mga0rr50_132437_c1 nmdc:mga0rr50_132437_c1_1050_1397 115
555 3300050513 nmdc:mga0rr50_1494207_c1 nmdc:mga0rr50_1494207_c1_186_533 115
556 3300050513 nmdc:mga0rr50_3282_c1 nmdc:mga0rr50_3282_c1_5106_5453 115
557 3300050513 nmdc:mga0rr50_536725_c1 nmdc:mga0rr50_536725_c1_505_852 115
558 3300050513 nmdc:mga0rr50_573443_c1 nmdc:mga0rr50_573443_c1_522_869 115
559 3300050513 nmdc:mga0rr50_695280_c1 nmdc:mga0rr50_695280_c1_330_677 115
560 3300050513 nmdc:mga0rr50_825899_c1 nmdc:mga0rr50_825899_c1_313_660 115
561 3300050514 nmdc:mga08x19_1243641_c1 nmdc:mga08x19_1243641_c1_152_499 115
562 3300050514 nmdc:mga08x19_1858_c1 nmdc:mga08x19_1858_c1_4028_4375 115
563 3300050514 nmdc:mga08x19_40646_c1 nmdc:mga08x19_40646_c1_358_705 115
564 3300050514 nmdc:mga08x19_530202_c1 nmdc:mga08x19_530202_c1_369_716 115
565 3300050514 nmdc:mga08x19_573139_c1 nmdc:mga08x19_573139_c1_165_512 115
566 3300050514 nmdc:mga08x19_74217_c1 nmdc:mga08x19_74217_c1_36_383 115
567 3300050514 nmdc:mga08x19_91610_c1 nmdc:mga08x19_91610_c1_892_1239 115
568 3300050515 nmdc:mga0a205_1261800_c1 nmdc:mga0a205_1261800_c1_97_444 115
569 3300050515 nmdc:mga0a205_1416772_c1 nmdc:mga0a205_1416772_c1_128_475 115
570 3300050515 nmdc:mga0a205_18247_c1 nmdc:mga0a205_18247_c1_6047_6394 115
571 3300050515 nmdc:mga0a205_740623_c1 nmdc:mga0a205_740623_c1_132_482 115
572 3300053077 Ga0495601_0102515 Ga0495601_0102515_950_1297 115
573 3300053077 Ga0495601_0349746 Ga0495601_0349746_181_528 115
574 3300053084 Ga0495595_0335685 Ga0495595_0335685_39_386 115
575 3300053085 Ga0495619_0621237 Ga0495619_0621237_267_614 115
576 3300054114 Ga0501084_0005924 Ga0501084_0005924_5757_6104 115
577 3300054114 Ga0501084_0982310 Ga0501084_0982310_186_533 115
578 3300059426 Ga0590077_063350 Ga0590077_063350_175_522 115
579 3300059426 Ga0590077_082449 Ga0590077_082449_242_589 115
580 3300060353 Ga0501082_0000430 Ga0501082_0000430_17986_18333 115
581 3300060353 Ga0501082_0014186 Ga0501082_0014186_5537_5890 115
582 3300060353 Ga0501082_1827029 Ga0501082_1827029_75_428 115
583 3300061734 Ga0530510_0000186 Ga0530510_0000186_11863_12210 115
584 3300061734 Ga0530510_0001727 Ga0530510_0001727_11888_12241 115
585 3300061734 Ga0530510_0774213 Ga0530510_0774213_278_625 115
586 3300005290 Ga0065712_10489792 Ga0065712_104897921 116
587 3300005295 Ga0065707_10110299 Ga0065707_101102992 116
588 3300005328 Ga0070676_10395485 Ga0070676_103954852 116
589 3300005329 Ga0070683_101289846 Ga0070683_1012898461 116
590 3300005330 Ga0070690_100000048 Ga0070690_10000004820 116
591 3300005330 Ga0070690_100855288 Ga0070690_1008552881 116
592 3300005334 Ga0068869_100003924 Ga0068869_1000039244 116
593 3300005335 Ga0070666_10070556 Ga0070666_100705562 116
594 3300005336 Ga0070680_100002906 Ga0070680_1000029069 116
595 3300005337 Ga0070682_100059435 Ga0070682_1000594355 116
596 3300005338 Ga0068868_100000169 Ga0068868_10000016932 116
597 3300005340 Ga0070689_100052142 Ga0070689_1000521427 116
598 3300005340 Ga0070689_100105537 Ga0070689_1001055372 116
599 3300005341 Ga0070691_10005631 Ga0070691_100056316 116
600 3300005343 Ga0070687_100000112 Ga0070687_1000001127 116
601 3300005343 Ga0070687_100058394 Ga0070687_1000583942 116
602 3300005343 Ga0070687_100375502 Ga0070687_1003755023 116
603 3300005345 Ga0070692_10000771 Ga0070692_1000077117 116
604 3300005353 Ga0070669_100573438 Ga0070669_1005734382 116
605 3300005355 Ga0070671_100474898 Ga0070671_1004748982 116
606 3300005356 Ga0070674_100861481 Ga0070674_1008614812 116
607 3300005365 Ga0070688_100213291 Ga0070688_1002132911 116
608 3300005437 Ga0070710_10728486 Ga0070710_107284862 116
609 3300005438 Ga0070701_10001982 Ga0070701_100019822 116
610 3300005439 Ga0070711_101167953 Ga0070711_1011679532 116
611 3300005440 Ga0070705_100000275 Ga0070705_1000002754 116
612 3300005441 Ga0070700_100000718 Ga0070700_10000071820 116
613 3300005441 Ga0070700_100159819 Ga0070700_1001598192 116
614 3300005444 Ga0070694_100000608 Ga0070694_10000060825 116
615 3300005444 Ga0070694_100488581 Ga0070694_1004885812 116
616 3300005456 Ga0070678_100590668 Ga0070678_1005906682 116
617 3300005459 Ga0068867_100000568 Ga0068867_10000056825 116
618 3300005518 Ga0070699_100204649 Ga0070699_1002046493 116
619 3300005530 Ga0070679_100024440 Ga0070679_1000244402 116
620 3300005535 Ga0070684_100904293 Ga0070684_1009042932 116
621 3300005539 Ga0068853_100079777 Ga0068853_1000797773 116
622 3300005544 Ga0070686_100002218 Ga0070686_10000221814 116
623 3300005544 Ga0070686_100160293 Ga0070686_1001602932 116
624 3300005544 Ga0070686_100319207 Ga0070686_1003192072 116
625 3300005544 Ga0070686_100900045 Ga0070686_1009000452 116
626 3300005545 Ga0070695_100000176 Ga0070695_10000017619 116
627 3300005545 Ga0070695_100075647 Ga0070695_1000756475 116
628 3300005545 Ga0070695_100516992 Ga0070695_1005169922 116
629 3300005546 Ga0070696_100000137 Ga0070696_10000013717 116
630 3300005546 Ga0070696_100001735 Ga0070696_1000017352 116
631 3300005546 Ga0070696_100836439 Ga0070696_1008364392 116
632 3300005546 Ga0070696_100900886 Ga0070696_1009008862 116
633 3300005547 Ga0070693_100001113 Ga0070693_1000011136 116
634 3300005547 Ga0070693_100076425 Ga0070693_1000764253 116
635 3300005549 Ga0070704_100000057 Ga0070704_10000005731 116
636 3300005563 Ga0068855_100118320 Ga0068855_1001183202 116
637 3300005578 Ga0068854_100797180 Ga0068854_1007971802 116
638 3300005614 Ga0068856_100175279 Ga0068856_1001752793 116
639 3300005614 Ga0068856_100362114 Ga0068856_1003621142 116
640 3300005615 Ga0070702_100000016 Ga0070702_10000001625 116
641 3300005615 Ga0070702_100674737 Ga0070702_1006747372 116
642 3300005616 Ga0068852_100053098 Ga0068852_1000530984 116
643 3300005617 Ga0068859_100011860 Ga0068859_10001186013 116
644 3300005617 Ga0068859_100520407 Ga0068859_1005204073 116
645 3300005618 Ga0068864_100025516 Ga0068864_1000255162 116
646 3300005718 Ga0068866_10000914 Ga0068866_100009144 116
647 3300005719 Ga0068861_100000199 Ga0068861_10000019926 116
648 3300005841 Ga0068863_100084048 Ga0068863_1000840486 116
649 3300005842 Ga0068858_100003393 Ga0068858_1000033936 116
650 3300005842 Ga0068858_100534859 Ga0068858_1005348593 116
651 3300005843 Ga0068860_100001230 Ga0068860_10000123027 116
652 3300005843 Ga0068860_100212273 Ga0068860_1002122732 116
653 3300005844 Ga0068862_100010417 Ga0068862_1000104176 116
654 3300006163 Ga0070715_10081179 Ga0070715_100811794 116
655 3300006163 Ga0070715_10439900 Ga0070715_104399002 116
656 3300006173 Ga0070716_100555142 Ga0070716_1005551422 116
657 3300006237 Ga0097621_100001888 Ga0097621_1000018882 116
658 3300006237 Ga0097621_100015589 Ga0097621_1000155892 116
659 3300006358 Ga0068871_100000120 Ga0068871_10000012042 116
660 3300006358 Ga0068871_100003000 Ga0068871_10000300011 116
661 3300006844 Ga0075428_100013129 Ga0075428_1000131292 116
662 3300006844 Ga0075428_100025250 Ga0075428_10002525012 116
663 3300006846 Ga0075430_100008695 Ga0075430_1000086956 116
664 3300006847 Ga0075431_100742305 Ga0075431_1007423052 116
665 3300006847 Ga0075431_100762845 Ga0075431_1007628452 116
666 3300006852 Ga0075433_10014942 Ga0075433_100149428 116
667 3300006852 Ga0075433_10160924 Ga0075433_101609242 116
668 3300006852 Ga0075433_10778163 Ga0075433_107781632 116
669 3300006871 Ga0075434_100001176 Ga0075434_10000117614 116
670 3300006880 Ga0075429_100001130 Ga0075429_10000113026 116
671 3300006880 Ga0075429_100043946 Ga0075429_1000439467 116
672 3300006880 Ga0075429_100428394 Ga0075429_1004283942 116
673 3300006881 Ga0068865_100001461 Ga0068865_10000146113 116
674 3300006914 Ga0075436_100004890 Ga0075436_10000489014 116
675 3300006931 Ga0097620_100011861 Ga0097620_10001186113 116
676 3300006931 Ga0097620_100520376 Ga0097620_1005203763 116
677 3300007076 Ga0075435_100007630 Ga0075435_10000763011 116
678 3300007076 Ga0075435_100239981 Ga0075435_1002399814 116
679 3300007265 Ga0099794_10043743 Ga0099794_100437433 116
680 3300007265 Ga0099794_10066967 Ga0099794_100669672 116
681 3300007265 Ga0099794_10363308 Ga0099794_103633082 116
682 3300007265 Ga0099794_10438859 Ga0099794_104388592 116
683 3300009092 Ga0105250_10020860 Ga0105250_100208602 116
684 3300009094 Ga0111539_10037024 Ga0111539_100370242 116
685 3300009094 Ga0111539_10222278 Ga0111539_102222782 116
686 3300009094 Ga0111539_13145343 Ga0111539_131453432 116
687 3300009098 Ga0105245_10000259 Ga0105245_1000025926 116
688 3300009098 Ga0105245_11512819 Ga0105245_115128192 116
689 3300009147 Ga0114129_10002101 Ga0114129_1000210127 116
690 3300009147 Ga0114129_10731066 Ga0114129_107310662 116
691 3300009148 Ga0105243_10003095 Ga0105243_100030952 116
692 3300009174 Ga0105241_10010209 Ga0105241_100102095 116
693 3300009176 Ga0105242_10036544 Ga0105242_100365443 116
694 3300009177 Ga0105248_10559731 Ga0105248_105597311 116
695 3300009177 Ga0105248_10888186 Ga0105248_108881861 116
696 3300009551 Ga0105238_12744922 Ga0105238_127449222 116
697 3300009553 Ga0105249_10001070 Ga0105249_1000107024 116
698 3300010375 Ga0105239_11866616 Ga0105239_118666162 116
699 3300011119 Ga0105246_10835144 Ga0105246_108351442 116
700 3300012505 Ga0157339_1040404 Ga0157339_10404042 116
701 3300013297 Ga0157378_10000576 Ga0157378_1000057624 116
702 3300013306 Ga0163162_10199606 Ga0163162_101996062 116
703 3300013307 Ga0157372_10981400 Ga0157372_109814002 116
704 3300013308 Ga0157375_10093020 Ga0157375_100930202 116
705 3300014326 Ga0157380_10170367 Ga0157380_101703673 116
706 3300014326 Ga0157380_10537147 Ga0157380_105371472 116
707 3300014968 Ga0157379_11570464 Ga0157379_115704641 116
708 3300014969 Ga0157376_10003705 Ga0157376_1000370516 116
709 3300014969 Ga0157376_10070012 Ga0157376_100700125 116
710 3300025711 Ga0207696_1115335 Ga0207696_11153353 116
711 3300025885 Ga0207653_10053692 Ga0207653_100536922 116
712 3300025898 Ga0207692_10571143 Ga0207692_105711432 116
713 3300025899 Ga0207642_10183429 Ga0207642_101834292 116
714 3300025901 Ga0207688_10103278 Ga0207688_101032782 116
715 3300025904 Ga0207647_10784874 Ga0207647_107848742 116
716 3300025905 Ga0207685_10032127 Ga0207685_100321272 116
717 3300025906 Ga0207699_10823002 Ga0207699_108230022 116
718 3300025907 Ga0207645_10366205 Ga0207645_103662053 116
719 3300025910 Ga0207684_11521226 Ga0207684_115212262 116
720 3300025911 Ga0207654_10004685 Ga0207654_100046859 116
721 3300025917 Ga0207660_10001340 Ga0207660_1000134022 116
722 3300025918 Ga0207662_10000106 Ga0207662_1000010646 116
723 3300025921 Ga0207652_10007736 Ga0207652_100077362 116
724 3300025922 Ga0207646_10406772 Ga0207646_104067722 116
725 3300025926 Ga0207659_10089394 Ga0207659_100893942 116
726 3300025931 Ga0207644_10486154 Ga0207644_104861541 116
727 3300025934 Ga0207686_10000883 Ga0207686_100008832 116
728 3300025935 Ga0207709_10003980 Ga0207709_1000398012 116
729 3300025936 Ga0207670_10067768 Ga0207670_100677685 116
730 3300025936 Ga0207670_11186945 Ga0207670_111869451 116
731 3300025938 Ga0207704_10000434 Ga0207704_100004343 116
732 3300025942 Ga0207689_10000376 Ga0207689_1000037631 116
733 3300025944 Ga0207661_10179401 Ga0207661_101794012 116
734 3300025949 Ga0207667_10134989 Ga0207667_101349892 116
735 3300025961 Ga0207712_10005157 Ga0207712_1000515716 116
736 3300025981 Ga0207640_10060273 Ga0207640_100602736 116
737 3300025981 Ga0207640_11529530 Ga0207640_115295302 116
738 3300026023 Ga0207677_10004790 Ga0207677_100047902 116
739 3300026035 Ga0207703_10001886 Ga0207703_1000188621 116
740 3300026035 Ga0207703_10031708 Ga0207703_100317082 116
741 3300026041 Ga0207639_10050531 Ga0207639_100505313 116
742 3300026075 Ga0207708_10000239 Ga0207708_1000023941 116
743 3300026078 Ga0207702_10056135 Ga0207702_100561353 116
744 3300026078 Ga0207702_10261003 Ga0207702_102610033 116
745 3300026088 Ga0207641_10042652 Ga0207641_100426528 116
746 3300026088 Ga0207641_10474389 Ga0207641_104743894 116
747 3300026089 Ga0207648_10000369 Ga0207648_1000036926 116
748 3300026095 Ga0207676_10049205 Ga0207676_100492055 116
749 3300026118 Ga0207675_100002559 Ga0207675_10000255924 116
750 3300026118 Ga0207675_100492840 Ga0207675_1004928401 116
751 3300026121 Ga0207683_10628706 Ga0207683_106287062 116
752 3300026142 Ga0207698_10047953 Ga0207698_100479531 116
753 3300027671 Ga0209588_1056698 Ga0209588_10566982 116
754 3300027907 Ga0207428_10010784 Ga0207428_1001078411 116
755 3300027907 Ga0207428_10201221 Ga0207428_102012213 116
756 3300028380 Ga0268265_10001333 Ga0268265_100013335 116
757 3300028381 Ga0268264_10001450 Ga0268264_100014506 116
758 3300028381 Ga0268264_10617457 Ga0268264_106174573 116
759 3300028381 Ga0268264_11581433 Ga0268264_115814332 116
760 3300031852 Ga0307410_11276436 Ga0307410_112764362 116
761 3300032002 Ga0307416_102700765 Ga0307416_1027007652 116
762 3300034816 Ga0373930_0160468 Ga0373930_0160468_170_520 116
763 3300034817 Ga0373948_0011088 Ga0373948_0011088_395_745 116
764 3300034818 Ga0373950_0059922 Ga0373950_0059922_355_705 116
765 3300034819 Ga0373958_0024227 Ga0373958_0024227_45_395 116
766 3300034819 Ga0373958_0100025 Ga0373958_0100025_104_454 116
767 3300034820 Ga0373959_0005843 Ga0373959_0005843_657_1007 116
768 3300034957 Ga0373938_0003713 Ga0373938_0003713_940_1290 116
769 3300034957 Ga0373938_0185876 Ga0373938_0185876_116_466 116
770 3300035083 Ga0373926_0000230 Ga0373926_0000230_6587_6937 116
771 3300035084 Ga0373928_0022347 Ga0373928_0022347_114_464 116
772 3300035085 Ga0373929_0032794 Ga0373929_0032794_183_533 116
773 3300035088 Ga0373940_0027896 Ga0373940_0027896_284_634 116
774 3300035089 Ga0373944_0001903 Ga0373944_0001903_3975_4325 116
775 3300035089 Ga0373944_0262287 Ga0373944_0262287_104_454 116
776 3300035090 Ga0373949_0053680 Ga0373949_0053680_585_935 116
777 3300035091 Ga0373951_0090467 Ga0373951_0090467_399_749 116
778 3300035092 Ga0373952_0069643 Ga0373952_0069643_273_623 116
779 3300035111 Ga0373923_0288232 Ga0373923_0288232_20_370 116
780 3300035112 Ga0373932_0005565 Ga0373932_0005565_1192_1542 116
781 3300035112 Ga0373932_0265155 Ga0373932_0265155_160_510 116
782 3300035113 Ga0373936_0018435 Ga0373936_0018435_1019_1369 116
783 3300035114 Ga0373939_0265225 Ga0373939_0265225_258_608 116
784 3300035115 Ga0373941_0018284 Ga0373941_0018284_186_536 116
785 3300035115 Ga0373941_0039893 Ga0373941_0039893_238_588 116
786 3300035116 Ga0373945_0004779 Ga0373945_0004779_1498_1848 116
787 3300035116 Ga0373945_0137355 Ga0373945_0137355_379_729 116
788 3300035116 Ga0373945_0521942 Ga0373945_0521942_100_450 116
789 3300035117 Ga0373953_0021780 Ga0373953_0021780_431_790 116
790 3300035118 Ga0373954_0000087 Ga0373954_0000087_22471_22830 116
791 3300035119 Ga0373956_0066543 Ga0373956_0066543_158_508 116
792 3300035120 Ga0373957_0313502 Ga0373957_0313502_133_483 116
793 3300035121 Ga0373960_0023136 Ga0373960_0023136_827_1177 116
794 3300035170 Ga0373943_0020057 Ga0373943_0020057_2359_2709 116
795 3300035170 Ga0373943_0176629 Ga0373943_0176629_402_752 116
796 3300035170 Ga0373943_0811787 Ga0373943_0811787_173_523 116
797 3300035171 Ga0373946_0005892 Ga0373946_0005892_2117_2467 116
798 3300035172 Ga0373955_0090832 Ga0373955_0090832_662_1021 116
799 3300035172 Ga0373955_0899204 Ga0373955_0899204_67_417 116
800 3300035207 Ga0373942_0004862 Ga0373942_0004862_2302_2652 116
801 3300035207 Ga0373942_0078048 Ga0373942_0078048_199_549 116
802 3300035241 Ga0373961_0008933 Ga0373961_0008933_204_554 116
803 3300035241 Ga0373961_0134635 Ga0373961_0134635_36_386 116
804 3300035241 Ga0373961_0432326 Ga0373961_0432326_100_450 116
805 3300035242 Ga0373962_0082296 Ga0373962_0082296_27_377 116
806 3300035242 Ga0373962_0124605 Ga0373962_0124605_433_783 116
807 3300035242 Ga0373962_0221692 Ga0373962_0221692_75_425 116
808 3300035410 Ga0373924_0014361 Ga0373924_0014361_839_1189 116
809 3300035410 Ga0373924_0059852 Ga0373924_0059852_512_862 116
810 3300035410 Ga0373924_0097248 Ga0373924_0097248_102_461 116
811 3300035691 Ga0373931_0002129 Ga0373931_0002129_7108_7458 116
812 3300035691 Ga0373931_0004456 Ga0373931_0004456_5751_6101 116
813 3300035691 Ga0373931_0014988 Ga0373931_0014988_2993_3343 116
814 3300035692 Ga0373935_0010842 Ga0373935_0010842_3797_4147 116
815 3300035692 Ga0373935_0094772 Ga0373935_0094772_1328_1678 116
816 3300035695 Ga0373927_0023238 Ga0373927_0023238_391_741 116
817 3300035695 Ga0373927_0136658 Ga0373927_0136658_662_1012 116
818 3300035695 Ga0373927_0445904 Ga0373927_0445904_267_620 116
819 3300035724 Ga0373933_0003173 Ga0373933_0003173_2833_3192 116
820 3300035724 Ga0373933_0027928 Ga0373933_0027928_977_1327 116
821 3300035725 Ga0373947_0036854 Ga0373947_0036854_1174_1524 116
822 3300035725 Ga0373947_0046108 Ga0373947_0046108_954_1304 116
823 3300036401 Ga0373937_0000296 Ga0373937_0000296_21911_22270 116
824 3300036401 Ga0373937_0018367 Ga0373937_0018367_2159_2509 116
825 3300037068 Ga0373925_0212145 Ga0373925_0212145_392_742 116
826 3300042532 Ga0450893_0058995 Ga0450893_0058995_197_547 116
827 3300042876 Ga0451577_0015044 Ga0451577_0015044_4867_5217 116
828 3300045051 Ga0451576_0033552 Ga0451576_0033552_211_561 116
829 3300045051 Ga0451576_0090352 Ga0451576_0090352_695_1045 116
830 3300045051 Ga0451576_0406018 Ga0451576_0406018_937_1287 116
831 3300045051 Ga0451576_1717735 Ga0451576_1717735_245_595 116
832 3300045051 Ga0451576_1899017 Ga0451576_1899017_148_498 116
833 3300046455 Ga0495603_0005705 Ga0495603_0005705_316_666 116
834 3300046463 Ga0495653_0292991 Ga0495653_0292991_220_570 116
835 3300046473 Ga0495582_0034547 Ga0495582_0034547_1448_1798 116
836 3300046475 Ga0495639_0005524 Ga0495639_0005524_426_776 116
837 3300046511 Ga0495608_0099837 Ga0495608_0099837_1310_1669 116
838 3300046517 Ga0495630_0679615 Ga0495630_0679615_10_360 116
839 3300046526 Ga0495666_0013837 Ga0495666_0013837_697_1047 116
840 3300046531 Ga0495665_0629153 Ga0495665_0629153_61_411 116
841 3300046557 Ga0495622_0120892 Ga0495622_0120892_629_979 116
842 3300046559 Ga0495667_0152297 Ga0495667_0152297_856_1206 116
843 3300046664 Ga0495659_0011438 Ga0495659_0011438_1498_1848 116
844 3300046675 Ga0495657_0418123 Ga0495657_0418123_375_734 116
845 3300046679 Ga0495623_0185607 Ga0495623_0185607_694_1053 116
846 3300046681 Ga0495647_0001395 Ga0495647_0001395_5818_6168 116
847 3300046683 Ga0495658_0003610 Ga0495658_0003610_4389_4739 116
848 3300046684 Ga0495669_0110952 Ga0495669_0110952_721_1071 116
849 3300046690 Ga0495624_0497953 Ga0495624_0497953_337_687 116
850 3300047322 Ga0495680_0061033 Ga0495680_0061033_399_749 116
851 3300048909 Ga0496106_0159383 Ga0496106_0159383_497_847 116
852 3300049568 Ga0501031_0204174 Ga0501031_0204174_11_361 116
853 3300049568 Ga0501031_0612243 Ga0501031_0612243_73_423 116
854 3300049569 Ga0501032_0567680 Ga0501032_0567680_268_621 116
855 3300049572 Ga0501036_0391362 Ga0501036_0391362_131_484 116
856 3300049573 Ga0501037_0523020 Ga0501037_0523020_20_370 116
857 3300049576 Ga0501040_0205892 Ga0501040_0205892_161_511 116
858 3300049577 Ga0501041_0015993 Ga0501041_0015993_3531_3884 116
859 3300049578 Ga0501042_1127447 Ga0501042_1127447_121_471 116
860 3300049580 Ga0501046_0131158 Ga0501046_0131158_104_457 116
861 3300049580 Ga0501046_1092793 Ga0501046_1092793_60_410 116
862 3300049582 Ga0501048_0525886 Ga0501048_0525886_194_547 116
863 3300049582 Ga0501048_1117835 Ga0501048_1117835_25_375 116
864 3300049587 Ga0501071_0078414 Ga0501071_0078414_146_499 116
865 3300049588 Ga0501072_0098053 Ga0501072_0098053_1578_1931 116
866 3300049588 Ga0501072_0480438 Ga0501072_0480438_39_389 116
867 3300049590 Ga0501074_0206844 Ga0501074_0206844_725_1075 116
868 3300049591 Ga0501075_0059419 Ga0501075_0059419_1197_1547 116
869 3300049591 Ga0501075_0114208 Ga0501075_0114208_1657_2010 116
870 3300049592 Ga0501076_0103371 Ga0501076_0103371_214_564 116
871 3300049822 Ga0501035_0802186 Ga0501035_0802186_91_444 116
872 3300049823 Ga0501044_1309375 Ga0501044_1309375_119_469 116
873 3300050507 nmdc:mga05p37_1298538_c1 nmdc:mga05p37_1298538_c1_219_569 116
874 3300050507 nmdc:mga05p37_2835_c1 nmdc:mga05p37_2835_c1_13877_14227 116
875 3300050507 nmdc:mga05p37_74156_c1 nmdc:mga05p37_74156_c1_3221_3571 116
876 3300050508 nmdc:mga09592_15465_c1 nmdc:mga09592_15465_c1_2899_3249 116
877 3300050508 nmdc:mga09592_297287_c1 nmdc:mga09592_297287_c1_510_860 116
878 3300050508 nmdc:mga09592_719365_c1 nmdc:mga09592_719365_c1_36_386 116
879 3300050509 nmdc:mga0qj67_33460_c1 nmdc:mga0qj67_33460_c1_654_1004 116
880 3300050510 nmdc:mga06r32_200984_c1 nmdc:mga06r32_200984_c1_544_894 116
881 3300050510 nmdc:mga06r32_41056_c1 nmdc:mga06r32_41056_c1_3400_3750 116
882 3300050511 nmdc:mga08y16_131646_c1 nmdc:mga08y16_131646_c1_1042_1392 116
883 3300050511 nmdc:mga08y16_48362_c1 nmdc:mga08y16_48362_c1_1493_1843 116
884 3300050512 nmdc:mga0n895_649792_c1 nmdc:mga0n895_649792_c1_600_950 116
885 3300050513 nmdc:mga0rr50_19252_c1 nmdc:mga0rr50_19252_c1_794_1144 116
886 3300050513 nmdc:mga0rr50_5530_c2 nmdc:mga0rr50_5530_c2_1399_1749 116
887 3300050514 nmdc:mga08x19_98427_c1 nmdc:mga08x19_98427_c1_988_1338 116
888 3300050515 nmdc:mga0a205_252698_c1 nmdc:mga0a205_252698_c1_642_992 116
889 3300050515 nmdc:mga0a205_34658_c1 nmdc:mga0a205_34658_c1_3132_3482 116
890 3300050515 nmdc:mga0a205_357921_c1 nmdc:mga0a205_357921_c1_231_581 116
891 3300054114 Ga0501084_0848067 Ga0501084_0848067_239_589 116
892 3300054114 Ga0501084_1073356 Ga0501084_1073356_312_665 116
893 3300059421 Ga0590071_023052 Ga0590071_023052_57_407 116
894 3300060353 Ga0501082_0665818 Ga0501082_0665818_181_534 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

10

84

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.8867 2 109
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.883 1 106
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.879 2 109
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.8531 1 106
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.8267 2 104
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9 2 107 3.10.20.30
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8688 2 107 3.10.20.30
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7968 2 104 3.10.20.30
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.793 2 106 3.10.20.30
1krhB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7918 2 100 3.10.20.30

Feature Viewer

pLDDT pTM Quality
80.46 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map