F484942
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 894 | 350 | 894 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10266818|Ga0307405_102668182 |
| Length | 102 |
| Sequence | MPKIRVLPHAALCPQGAEIDAESGVSICDTLLANHIEIEHACEKQAACTTCHVIVRKGFDSLDDASEKEEDMLDKAKMAAEDLTIEIPKYTINYEREGGGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 230 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 231 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 232 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 233 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 234 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 238 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 239 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 322 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 348 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.45 |
| Nodule | 0 |
| Rhizoplane | 0.45 |
| Rhizosphere | 98.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10489792 | 3300005290 | Bacteria | 641 |
| 2 | Ga0065715_11104991 | 3300005293 | Bacteria | 519 |
| 3 | Ga0065707_10110299 | 3300005295 | Bacteria | 2435 |
| 4 | Ga0065707_10209799 | 3300005295 | Bacteria | 1271 |
| 5 | Ga0065707_10267281 | 3300005295 | Bacteria | 1081 |
| 6 | Ga0065707_10279404 | 3300005295 | Bacteria | 1051 |
| 7 | Ga0065707_10313736 | 3300005295 | Bacteria | 965 |
| 8 | Ga0065707_10811619 | 3300005295 | Bacteria | 595 |
| 9 | Ga0070676_10395485 | 3300005328 | Bacteria | 960 |
| 10 | Ga0070683_101289846 | 3300005329 | Bacteria | 702 |
| 11 | Ga0070690_100000048 | 3300005330 | Bacteria | 57196 |
| 12 | Ga0070690_100346623 | 3300005330 | Bacteria | 1077 |
| 13 | Ga0070690_100855288 | 3300005330 | Bacteria | 709 |
| 14 | Ga0070670_100695653 | 3300005331 | Bacteria | 914 |
| 15 | Ga0070670_101242777 | 3300005331 | Bacteria | 681 |
| 16 | Ga0070677_10637978 | 3300005333 | Bacteria | 594 |
| 17 | Ga0068869_100003924 | 3300005334 | Bacteria | 9183 |
| 18 | Ga0068869_100776335 | 3300005334 | Bacteria | 822 |
| 19 | Ga0070666_10070556 | 3300005335 | Bacteria | 2377 |
| 20 | Ga0070680_100002906 | 3300005336 | Bacteria | 12727 |
| 21 | Ga0070680_100057644 | 3300005336 | Bacteria | 3176 |
| 22 | Ga0070680_100144219 | 3300005336 | Bacteria | 1997 |
| 23 | Ga0070682_100059435 | 3300005337 | Bacteria | 2415 |
| 24 | Ga0068868_100000169 | 3300005338 | Bacteria | 42949 |
| 25 | Ga0070689_100052142 | 3300005340 | Bacteria | 3164 |
| 26 | Ga0070689_100105537 | 3300005340 | Bacteria | 2234 |
| 27 | Ga0070689_100222797 | 3300005340 | Bacteria | 1548 |
| 28 | Ga0070689_100345415 | 3300005340 | Bacteria | 1247 |
| 29 | Ga0070691_10005631 | 3300005341 | Bacteria | 5707 |
| 30 | Ga0070691_10226632 | 3300005341 | Bacteria | 993 |
| 31 | Ga0070691_10228333 | 3300005341 | Bacteria | 989 |
| 32 | Ga0070687_100000112 | 3300005343 | Bacteria | 27473 |
| 33 | Ga0070687_100058394 | 3300005343 | Bacteria | 2027 |
| 34 | Ga0070687_100318314 | 3300005343 | Bacteria | 993 |
| 35 | Ga0070687_100357092 | 3300005343 | Bacteria | 945 |
| 36 | Ga0070687_100375502 | 3300005343 | Bacteria | 925 |
| 37 | Ga0070687_100554930 | 3300005343 | Bacteria | 782 |
| 38 | Ga0070692_10000771 | 3300005345 | Bacteria | 10540 |
| 39 | Ga0070692_10004733 | 3300005345 | Bacteria | 5710 |
| 40 | Ga0070692_10472927 | 3300005345 | Bacteria | 807 |
| 41 | Ga0070692_11153104 | 3300005345 | Bacteria | 550 |
| 42 | Ga0070668_100118907 | 3300005347 | Bacteria | 2110 |
| 43 | Ga0070669_100070052 | 3300005353 | Bacteria | 2592 |
| 44 | Ga0070669_100357508 | 3300005353 | Bacteria | 1187 |
| 45 | Ga0070669_100573438 | 3300005353 | Bacteria | 943 |
| 46 | Ga0070675_100056290 | 3300005354 | Bacteria | 3240 |
| 47 | Ga0070671_100474898 | 3300005355 | Bacteria | 1074 |
| 48 | Ga0070671_101382208 | 3300005355 | Bacteria | 622 |
| 49 | Ga0070674_100019780 | 3300005356 | Bacteria | 4284 |
| 50 | Ga0070674_100861481 | 3300005356 | Bacteria | 787 |
| 51 | Ga0070674_100992213 | 3300005356 | Bacteria | 736 |
| 52 | Ga0070674_101605794 | 3300005356 | Bacteria | 586 |
| 53 | Ga0070673_101614351 | 3300005364 | Bacteria | 613 |
| 54 | Ga0070673_101767120 | 3300005364 | Bacteria | 586 |
| 55 | Ga0070688_100213291 | 3300005365 | Bacteria | 1357 |
| 56 | Ga0070703_10372515 | 3300005406 | Bacteria | 615 |
| 57 | Ga0070714_100185510 | 3300005435 | Bacteria | 1895 |
| 58 | Ga0070710_10728486 | 3300005437 | Bacteria | 702 |
| 59 | Ga0070701_10001982 | 3300005438 | Bacteria | 7754 |
| 60 | Ga0070701_10020823 | 3300005438 | Bacteria | 3120 |
| 61 | Ga0070711_101167953 | 3300005439 | Bacteria | 665 |
| 62 | Ga0070705_100000275 | 3300005440 | Bacteria | 31164 |
| 63 | Ga0070705_100005488 | 3300005440 | Bacteria | 6181 |
| 64 | Ga0070705_100090996 | 3300005440 | Bacteria | 1900 |
| 65 | Ga0070705_100195727 | 3300005440 | Bacteria | 1382 |
| 66 | Ga0070705_100378924 | 3300005440 | Bacteria | 1041 |
| 67 | Ga0070705_100563316 | 3300005440 | Bacteria | 876 |
| 68 | Ga0070705_101053381 | 3300005440 | Bacteria | 663 |
| 69 | Ga0070700_100000718 | 3300005441 | Bacteria | 16353 |
| 70 | Ga0070700_100006936 | 3300005441 | Bacteria | 6083 |
| 71 | Ga0070700_100159819 | 3300005441 | Bacteria | 1550 |
| 72 | Ga0070700_100308089 | 3300005441 | Bacteria | 1159 |
| 73 | Ga0070700_100312331 | 3300005441 | Bacteria | 1152 |
| 74 | Ga0070700_100602125 | 3300005441 | Bacteria | 861 |
| 75 | Ga0070700_101374856 | 3300005441 | Bacteria | 596 |
| 76 | Ga0070700_101568565 | 3300005441 | Bacteria | 562 |
| 77 | Ga0070694_100000608 | 3300005444 | Bacteria | 19748 |
| 78 | Ga0070694_100009317 | 3300005444 | Bacteria | 6028 |
| 79 | Ga0070694_100014517 | 3300005444 | Bacteria | 4932 |
| 80 | Ga0070694_100141175 | 3300005444 | Bacteria | 1750 |
| 81 | Ga0070694_100179831 | 3300005444 | Bacteria | 1564 |
| 82 | Ga0070694_100267604 | 3300005444 | Bacteria | 1298 |
| 83 | Ga0070694_100355163 | 3300005444 | Bacteria | 1136 |
| 84 | Ga0070694_100367647 | 3300005444 | Bacteria | 1118 |
| 85 | Ga0070694_100488581 | 3300005444 | Bacteria | 978 |
| 86 | Ga0070694_100995358 | 3300005444 | Bacteria | 696 |
| 87 | Ga0070708_101140782 | 3300005445 | Bacteria | 730 |
| 88 | Ga0070708_101725016 | 3300005445 | Bacteria | 582 |
| 89 | Ga0070678_100324300 | 3300005456 | Bacteria | 1316 |
| 90 | Ga0070678_100590668 | 3300005456 | Bacteria | 990 |
| 91 | Ga0070681_10000198 | 3300005458 | Bacteria | 47037 |
| 92 | Ga0068867_100000568 | 3300005459 | Bacteria | 24458 |
| 93 | Ga0068867_100023523 | 3300005459 | Bacteria | 4410 |
| 94 | Ga0068867_101307236 | 3300005459 | Bacteria | 670 |
| 95 | Ga0070685_11391110 | 3300005466 | Bacteria | 538 |
| 96 | Ga0070685_11471537 | 3300005466 | Bacteria | 524 |
| 97 | Ga0070706_100167580 | 3300005467 | Bacteria | 2051 |
| 98 | Ga0070707_100571189 | 3300005468 | Bacteria | 1093 |
| 99 | Ga0070707_100984659 | 3300005468 | Bacteria | 808 |
| 100 | Ga0070698_100054920 | 3300005471 | Bacteria | 4042 |
| 101 | Ga0070698_101668378 | 3300005471 | Bacteria | 590 |
| 102 | Ga0070699_100095806 | 3300005518 | Bacteria | 2599 |
| 103 | Ga0070699_100204649 | 3300005518 | Bacteria | 1756 |
| 104 | Ga0070699_100258097 | 3300005518 | Bacteria | 1558 |
| 105 | Ga0070699_100512930 | 3300005518 | Bacteria | 1090 |
| 106 | Ga0070679_100024440 | 3300005530 | Bacteria | 5920 |
| 107 | Ga0070679_100687178 | 3300005530 | Bacteria | 966 |
| 108 | Ga0070679_101310155 | 3300005530 | Bacteria | 670 |
| 109 | Ga0070679_102013320 | 3300005530 | Bacteria | 527 |
| 110 | Ga0070684_100904293 | 3300005535 | Bacteria | 827 |
| 111 | Ga0070697_100002931 | 3300005536 | Bacteria | 13126 |
| 112 | Ga0070697_100095073 | 3300005536 | Bacteria | 2470 |
| 113 | Ga0070697_101135835 | 3300005536 | Bacteria | 696 |
| 114 | Ga0070697_101993232 | 3300005536 | Bacteria | 520 |
| 115 | Ga0068853_100079777 | 3300005539 | Bacteria | 2863 |
| 116 | Ga0070672_100467010 | 3300005543 | Bacteria | 1088 |
| 117 | Ga0070686_100002218 | 3300005544 | Bacteria | 10728 |
| 118 | Ga0070686_100028921 | 3300005544 | Bacteria | 3365 |
| 119 | Ga0070686_100160293 | 3300005544 | Bacteria | 1584 |
| 120 | Ga0070686_100244972 | 3300005544 | Bacteria | 1307 |
| 121 | Ga0070686_100319207 | 3300005544 | Bacteria | 1158 |
| 122 | Ga0070686_100572972 | 3300005544 | Bacteria | 886 |
| 123 | Ga0070686_100721495 | 3300005544 | Bacteria | 797 |
| 124 | Ga0070686_100900045 | 3300005544 | Bacteria | 720 |
| 125 | Ga0070686_101073141 | 3300005544 | Bacteria | 664 |
| 126 | Ga0070686_101615787 | 3300005544 | Bacteria | 549 |
| 127 | Ga0070695_100000176 | 3300005545 | Bacteria | 30422 |
| 128 | Ga0070695_100003592 | 3300005545 | Bacteria | 9056 |
| 129 | Ga0070695_100029321 | 3300005545 | Bacteria | 3418 |
| 130 | Ga0070695_100075647 | 3300005545 | Bacteria | 2216 |
| 131 | Ga0070695_100260639 | 3300005545 | Bacteria | 1266 |
| 132 | Ga0070695_100516992 | 3300005545 | Bacteria | 926 |
| 133 | Ga0070695_100651696 | 3300005545 | Bacteria | 831 |
| 134 | Ga0070695_100856214 | 3300005545 | Bacteria | 732 |
| 135 | Ga0070695_101518489 | 3300005545 | Bacteria | 558 |
| 136 | Ga0070696_100000137 | 3300005546 | Bacteria | 39854 |
| 137 | Ga0070696_100001735 | 3300005546 | Bacteria | 14279 |
| 138 | Ga0070696_100067694 | 3300005546 | Bacteria | 2506 |
| 139 | Ga0070696_100259271 | 3300005546 | Bacteria | 1318 |
| 140 | Ga0070696_100395783 | 3300005546 | Bacteria | 1080 |
| 141 | Ga0070696_100408338 | 3300005546 | Bacteria | 1064 |
| 142 | Ga0070696_100579076 | 3300005546 | Bacteria | 903 |
| 143 | Ga0070696_100836439 | 3300005546 | Bacteria | 760 |
| 144 | Ga0070696_100900886 | 3300005546 | Bacteria | 734 |
| 145 | Ga0070693_100001113 | 3300005547 | Bacteria | 12062 |
| 146 | Ga0070693_100076425 | 3300005547 | Bacteria | 1985 |
| 147 | Ga0070704_100000057 | 3300005549 | Bacteria | 36313 |
| 148 | Ga0070704_100046477 | 3300005549 | Bacteria | 3027 |
| 149 | Ga0070704_100060605 | 3300005549 | Bacteria | 2704 |
| 150 | Ga0070704_100100059 | 3300005549 | Bacteria | 2182 |
| 151 | Ga0070704_100110016 | 3300005549 | Bacteria | 2095 |
| 152 | Ga0068855_100118320 | 3300005563 | Bacteria | 3034 |
| 153 | Ga0068857_100535415 | 3300005577 | Bacteria | 1102 |
| 154 | Ga0068854_100797180 | 3300005578 | Bacteria | 823 |
| 155 | Ga0068856_100175279 | 3300005614 | Bacteria | 2157 |
| 156 | Ga0068856_100362114 | 3300005614 | Bacteria | 1469 |
| 157 | Ga0068856_101171182 | 3300005614 | Bacteria | 785 |
| 158 | Ga0070702_100000016 | 3300005615 | Bacteria | 48066 |
| 159 | Ga0070702_100230352 | 3300005615 | Bacteria | 1244 |
| 160 | Ga0070702_100674737 | 3300005615 | Bacteria | 785 |
| 161 | Ga0068852_100053098 | 3300005616 | Bacteria | 3487 |
| 162 | Ga0068859_100011860 | 3300005617 | Bacteria | 8754 |
| 163 | Ga0068859_100019288 | 3300005617 | Bacteria | 6852 |
| 164 | Ga0068859_100028423 | 3300005617 | Bacteria | 5605 |
| 165 | Ga0068859_100520407 | 3300005617 | Bacteria | 1285 |
| 166 | Ga0068859_101038106 | 3300005617 | Bacteria | 901 |
| 167 | Ga0068859_101151732 | 3300005617 | Bacteria | 854 |
| 168 | Ga0068859_101809460 | 3300005617 | Bacteria | 674 |
| 169 | Ga0068864_100025516 | 3300005618 | Bacteria | 4979 |
| 170 | Ga0068866_10000914 | 3300005718 | Bacteria | 12952 |
| 171 | Ga0068866_10452638 | 3300005718 | Bacteria | 840 |
| 172 | Ga0068861_100000199 | 3300005719 | Bacteria | 32165 |
| 173 | Ga0068861_100021205 | 3300005719 | Bacteria | 4669 |
| 174 | Ga0068861_100704402 | 3300005719 | Bacteria | 939 |
| 175 | Ga0068861_101058305 | 3300005719 | Bacteria | 778 |
| 176 | Ga0068870_10793039 | 3300005840 | Bacteria | 661 |
| 177 | Ga0068870_11174522 | 3300005840 | Bacteria | 555 |
| 178 | Ga0068863_100084048 | 3300005841 | Bacteria | 3017 |
| 179 | Ga0068863_100759325 | 3300005841 | Bacteria | 966 |
| 180 | Ga0068858_100003393 | 3300005842 | Bacteria | 15847 |
| 181 | Ga0068858_100387156 | 3300005842 | Bacteria | 1342 |
| 182 | Ga0068858_100534859 | 3300005842 | Bacteria | 1134 |
| 183 | Ga0068860_100001230 | 3300005843 | Bacteria | 27942 |
| 184 | Ga0068860_100212273 | 3300005843 | Bacteria | 1878 |
| 185 | Ga0068860_101534762 | 3300005843 | Bacteria | 688 |
| 186 | Ga0068862_100010417 | 3300005844 | Bacteria | 7676 |
| 187 | Ga0068862_100032132 | 3300005844 | Bacteria | 4434 |
| 188 | Ga0068862_100149773 | 3300005844 | Bacteria | 2076 |
| 189 | Ga0068862_100278266 | 3300005844 | Bacteria | 1533 |
| 190 | Ga0068862_100600397 | 3300005844 | Bacteria | 1057 |
| 191 | Ga0081538_10160025 | 3300005981 | Bacteria | 1002 |
| 192 | Ga0081539_10000842 | 3300005985 | Bacteria | 58746 |
| 193 | Ga0075364_10247712 | 3300006051 | Bacteria | 1211 |
| 194 | Ga0075364_10729198 | 3300006051 | Bacteria | 676 |
| 195 | Ga0070715_10081179 | 3300006163 | Bacteria | 1472 |
| 196 | Ga0070715_10439900 | 3300006163 | Bacteria | 734 |
| 197 | Ga0070715_10538208 | 3300006163 | Bacteria | 675 |
| 198 | Ga0070716_100555142 | 3300006173 | Bacteria | 857 |
| 199 | Ga0070716_100894593 | 3300006173 | Bacteria | 695 |
| 200 | Ga0070712_101175719 | 3300006175 | Bacteria | 667 |
| 201 | Ga0075366_10008600 | 3300006195 | Bacteria | 5683 |
| 202 | Ga0097621_100001888 | 3300006237 | Bacteria | 14313 |
| 203 | Ga0097621_100015589 | 3300006237 | Bacteria | 5724 |
| 204 | Ga0097621_100570193 | 3300006237 | Bacteria | 1032 |
| 205 | Ga0068871_100000120 | 3300006358 | Bacteria | 49031 |
| 206 | Ga0068871_100003000 | 3300006358 | Bacteria | 11579 |
| 207 | Ga0075428_100013129 | 3300006844 | Bacteria | 9212 |
| 208 | Ga0075428_100025250 | 3300006844 | Bacteria | 6576 |
| 209 | Ga0075428_100060247 | 3300006844 | Bacteria | 4157 |
| 210 | Ga0075428_100251107 | 3300006844 | Bacteria | 1906 |
| 211 | Ga0075430_100008695 | 3300006846 | Bacteria | 8567 |
| 212 | Ga0075430_100049636 | 3300006846 | Bacteria | 3541 |
| 213 | Ga0075430_100742838 | 3300006846 | Bacteria | 809 |
| 214 | Ga0075431_100013334 | 3300006847 | Bacteria | 8307 |
| 215 | Ga0075431_100146517 | 3300006847 | Bacteria | 2433 |
| 216 | Ga0075431_100351111 | 3300006847 | Bacteria | 1483 |
| 217 | Ga0075431_100700496 | 3300006847 | Bacteria | 990 |
| 218 | Ga0075431_100742305 | 3300006847 | Bacteria | 957 |
| 219 | Ga0075431_100762845 | 3300006847 | Bacteria | 942 |
| 220 | Ga0075431_100832103 | 3300006847 | Bacteria | 895 |
| 221 | Ga0075431_102108306 | 3300006847 | Bacteria | 518 |
| 222 | Ga0075433_10014942 | 3300006852 | Bacteria | 6354 |
| 223 | Ga0075433_10042272 | 3300006852 | Bacteria | 3953 |
| 224 | Ga0075433_10160924 | 3300006852 | Bacteria | 1998 |
| 225 | Ga0075433_10778163 | 3300006852 | Bacteria | 837 |
| 226 | Ga0075433_11223104 | 3300006852 | Bacteria | 652 |
| 227 | Ga0075434_100000073 | 3300006871 | Bacteria | 52987 |
| 228 | Ga0075434_100001176 | 3300006871 | Bacteria | 21677 |
| 229 | Ga0075434_100019885 | 3300006871 | Bacteria | 6503 |
| 230 | Ga0075434_100485931 | 3300006871 | Bacteria | 1256 |
| 231 | Ga0075434_102139299 | 3300006871 | Bacteria | 564 |
| 232 | Ga0075429_100000080 | 3300006880 | Bacteria | 49555 |
| 233 | Ga0075429_100001130 | 3300006880 | Bacteria | 21515 |
| 234 | Ga0075429_100043946 | 3300006880 | Bacteria | 3886 |
| 235 | Ga0075429_100168323 | 3300006880 | Bacteria | 1920 |
| 236 | Ga0075429_100428394 | 3300006880 | Bacteria | 1159 |
| 237 | Ga0075429_100678858 | 3300006880 | Bacteria | 902 |
| 238 | Ga0075429_100737243 | 3300006880 | Bacteria | 863 |
| 239 | Ga0075429_100822042 | 3300006880 | Bacteria | 813 |
| 240 | Ga0075429_101138282 | 3300006880 | Bacteria | 681 |
| 241 | Ga0068865_100001461 | 3300006881 | Bacteria | 13771 |
| 242 | Ga0068865_100029927 | 3300006881 | Bacteria | 3617 |
| 243 | Ga0068865_100811787 | 3300006881 | Bacteria | 808 |
| 244 | Ga0075436_100000205 | 3300006914 | Bacteria | 36621 |
| 245 | Ga0075436_100004890 | 3300006914 | Bacteria | 9208 |
| 246 | Ga0075436_100038706 | 3300006914 | Bacteria | 3291 |
| 247 | Ga0075436_100058404 | 3300006914 | Bacteria | 2664 |
| 248 | Ga0075436_100498424 | 3300006914 | Bacteria | 891 |
| 249 | Ga0075436_100515462 | 3300006914 | Bacteria | 876 |
| 250 | Ga0075436_100558744 | 3300006914 | Bacteria | 841 |
| 251 | Ga0097620_100011861 | 3300006931 | Bacteria | 8754 |
| 252 | Ga0097620_100019288 | 3300006931 | Bacteria | 6852 |
| 253 | Ga0097620_100028423 | 3300006931 | Bacteria | 5605 |
| 254 | Ga0097620_100520376 | 3300006931 | Bacteria | 1285 |
| 255 | Ga0097620_101038090 | 3300006931 | Bacteria | 901 |
| 256 | Ga0097620_101151728 | 3300006931 | Bacteria | 854 |
| 257 | Ga0097620_101809470 | 3300006931 | Bacteria | 674 |
| 258 | Ga0075435_100006291 | 3300007076 | Bacteria | 8385 |
| 259 | Ga0075435_100007630 | 3300007076 | Bacteria | 7725 |
| 260 | Ga0075435_100140284 | 3300007076 | Bacteria | 2027 |
| 261 | Ga0075435_100239981 | 3300007076 | Bacteria | 1541 |
| 262 | Ga0075435_100328058 | 3300007076 | Bacteria | 1310 |
| 263 | Ga0075435_101752918 | 3300007076 | Bacteria | 545 |
| 264 | Ga0099794_10043743 | 3300007265 | Bacteria | 2138 |
| 265 | Ga0099794_10066967 | 3300007265 | Bacteria | 1753 |
| 266 | Ga0099794_10363308 | 3300007265 | Bacteria | 754 |
| 267 | Ga0099794_10438859 | 3300007265 | Bacteria | 684 |
| 268 | Ga0105250_10020860 | 3300009092 | Bacteria | 2645 |
| 269 | Ga0111539_10037024 | 3300009094 | Bacteria | 5895 |
| 270 | Ga0111539_10050653 | 3300009094 | Bacteria | 4947 |
| 271 | Ga0111539_10065584 | 3300009094 | Bacteria | 4289 |
| 272 | Ga0111539_10131269 | 3300009094 | Bacteria | 2933 |
| 273 | Ga0111539_10168418 | 3300009094 | Bacteria | 2560 |
| 274 | Ga0111539_10222278 | 3300009094 | Bacteria | 2199 |
| 275 | Ga0111539_10551503 | 3300009094 | Bacteria | 1342 |
| 276 | Ga0111539_11095879 | 3300009094 | Bacteria | 925 |
| 277 | Ga0111539_11967183 | 3300009094 | Bacteria | 678 |
| 278 | Ga0111539_13145343 | 3300009094 | Bacteria | 532 |
| 279 | Ga0111539_13348128 | 3300009094 | Bacteria | 516 |
| 280 | Ga0105245_10000259 | 3300009098 | Bacteria | 50388 |
| 281 | Ga0105245_11512819 | 3300009098 | Bacteria | 722 |
| 282 | Ga0105245_12959604 | 3300009098 | Bacteria | 526 |
| 283 | Ga0114129_10002101 | 3300009147 | Bacteria | 27413 |
| 284 | Ga0114129_10032898 | 3300009147 | Bacteria | 7327 |
| 285 | Ga0114129_10373021 | 3300009147 | Bacteria | 1885 |
| 286 | Ga0114129_10515058 | 3300009147 | Bacteria | 1560 |
| 287 | Ga0114129_10731066 | 3300009147 | Bacteria | 1269 |
| 288 | Ga0114129_10999632 | 3300009147 | Bacteria | 1053 |
| 289 | Ga0114129_11630562 | 3300009147 | Bacteria | 789 |
| 290 | Ga0105243_10003095 | 3300009148 | Bacteria | 13686 |
| 291 | Ga0105243_10045531 | 3300009148 | Bacteria | 3448 |
| 292 | Ga0105243_12071974 | 3300009148 | Bacteria | 604 |
| 293 | Ga0105243_12402752 | 3300009148 | Bacteria | 565 |
| 294 | Ga0105241_10010209 | 3300009174 | Bacteria | 6897 |
| 295 | Ga0105242_10036544 | 3300009176 | Bacteria | 3941 |
| 296 | Ga0105242_10209160 | 3300009176 | Bacteria | 1737 |
| 297 | Ga0105242_11564528 | 3300009176 | Bacteria | 692 |
| 298 | Ga0105248_10559731 | 3300009177 | Bacteria | 1290 |
| 299 | Ga0105248_10888186 | 3300009177 | Bacteria | 1006 |
| 300 | Ga0105238_12744922 | 3300009551 | Bacteria | 529 |
| 301 | Ga0105249_10001070 | 3300009553 | Bacteria | 24290 |
| 302 | Ga0105249_10377074 | 3300009553 | Bacteria | 1444 |
| 303 | Ga0105249_12816224 | 3300009553 | Bacteria | 558 |
| 304 | Ga0105249_13480936 | 3300009553 | Bacteria | 507 |
| 305 | Ga0105239_11866616 | 3300010375 | Bacteria | 697 |
| 306 | Ga0105246_10835144 | 3300011119 | Bacteria | 820 |
| 307 | Ga0157339_1040404 | 3300012505 | Bacteria | 583 |
| 308 | Ga0157378_10000576 | 3300013297 | Bacteria | 34686 |
| 309 | Ga0157378_11059085 | 3300013297 | Bacteria | 847 |
| 310 | Ga0157378_12059457 | 3300013297 | Bacteria | 621 |
| 311 | Ga0163162_10199606 | 3300013306 | Bacteria | 2129 |
| 312 | Ga0157372_10981400 | 3300013307 | Bacteria | 979 |
| 313 | Ga0157375_10093020 | 3300013308 | Bacteria | 3080 |
| 314 | Ga0157380_10011328 | 3300014326 | Bacteria | 6441 |
| 315 | Ga0157380_10170367 | 3300014326 | Bacteria | 1902 |
| 316 | Ga0157380_10537147 | 3300014326 | Bacteria | 1144 |
| 317 | Ga0157380_12109104 | 3300014326 | Bacteria | 627 |
| 318 | Ga0157377_10426969 | 3300014745 | Bacteria | 909 |
| 319 | Ga0157379_11570464 | 3300014968 | Bacteria | 642 |
| 320 | Ga0157376_10003705 | 3300014969 | Bacteria | 10559 |
| 321 | Ga0157376_10070012 | 3300014969 | Bacteria | 2976 |
| 322 | Ga0207696_1115335 | 3300025711 | Bacteria | 726 |
| 323 | Ga0207653_10053692 | 3300025885 | Bacteria | 1346 |
| 324 | Ga0207653_10072326 | 3300025885 | Bacteria | 1180 |
| 325 | Ga0207692_10571143 | 3300025898 | Bacteria | 724 |
| 326 | Ga0207642_10124344 | 3300025899 | Bacteria | 1336 |
| 327 | Ga0207642_10183429 | 3300025899 | Bacteria | 1142 |
| 328 | Ga0207688_10103278 | 3300025901 | Bacteria | 1648 |
| 329 | Ga0207688_10325951 | 3300025901 | Bacteria | 943 |
| 330 | Ga0207647_10784874 | 3300025904 | Bacteria | 513 |
| 331 | Ga0207685_10032127 | 3300025905 | Bacteria | 1886 |
| 332 | Ga0207699_10823002 | 3300025906 | Bacteria | 683 |
| 333 | Ga0207645_10053737 | 3300025907 | Bacteria | 2574 |
| 334 | Ga0207645_10366205 | 3300025907 | Bacteria | 966 |
| 335 | Ga0207643_10103236 | 3300025908 | Bacteria | 1673 |
| 336 | Ga0207684_10398182 | 3300025910 | Bacteria | 1184 |
| 337 | Ga0207684_10736824 | 3300025910 | Bacteria | 836 |
| 338 | Ga0207684_11521226 | 3300025910 | Bacteria | 544 |
| 339 | Ga0207654_10004685 | 3300025911 | Bacteria | 6919 |
| 340 | Ga0207707_10003333 | 3300025912 | Bacteria | 14259 |
| 341 | Ga0207663_10655419 | 3300025916 | Bacteria | 829 |
| 342 | Ga0207660_10001340 | 3300025917 | Bacteria | 16476 |
| 343 | Ga0207660_10020821 | 3300025917 | Bacteria | 4408 |
| 344 | Ga0207660_10655257 | 3300025917 | Bacteria | 856 |
| 345 | Ga0207662_10000106 | 3300025918 | Bacteria | 40137 |
| 346 | Ga0207662_10064715 | 3300025918 | Bacteria | 2200 |
| 347 | Ga0207662_10070983 | 3300025918 | Bacteria | 2107 |
| 348 | Ga0207662_10274069 | 3300025918 | Bacteria | 1114 |
| 349 | Ga0207652_10007736 | 3300025921 | Bacteria | 8632 |
| 350 | Ga0207652_10030844 | 3300025921 | Bacteria | 4494 |
| 351 | Ga0207646_10406772 | 3300025922 | Bacteria | 1229 |
| 352 | Ga0207646_10427740 | 3300025922 | Bacteria | 1195 |
| 353 | Ga0207681_10006318 | 3300025923 | Bacteria | 7273 |
| 354 | Ga0207681_11729119 | 3300025923 | Bacteria | 522 |
| 355 | Ga0207659_10062589 | 3300025926 | Bacteria | 2686 |
| 356 | Ga0207659_10089394 | 3300025926 | Bacteria | 2297 |
| 357 | Ga0207644_10486154 | 3300025931 | Bacteria | 1017 |
| 358 | Ga0207706_10766185 | 3300025933 | Bacteria | 821 |
| 359 | Ga0207686_10000883 | 3300025934 | Bacteria | 18123 |
| 360 | Ga0207686_10557776 | 3300025934 | Bacteria | 896 |
| 361 | Ga0207709_10003980 | 3300025935 | Bacteria | 8621 |
| 362 | Ga0207709_10007609 | 3300025935 | Bacteria | 6011 |
| 363 | Ga0207670_10067768 | 3300025936 | Bacteria | 2456 |
| 364 | Ga0207670_10418035 | 3300025936 | Bacteria | 1075 |
| 365 | Ga0207670_10752244 | 3300025936 | Bacteria | 809 |
| 366 | Ga0207670_11186945 | 3300025936 | Bacteria | 646 |
| 367 | Ga0207669_10003349 | 3300025937 | Bacteria | 6939 |
| 368 | Ga0207669_10811645 | 3300025937 | Bacteria | 776 |
| 369 | Ga0207704_10000434 | 3300025938 | Bacteria | 18663 |
| 370 | Ga0207704_10007398 | 3300025938 | Bacteria | 5185 |
| 371 | Ga0207704_10180508 | 3300025938 | Bacteria | 1525 |
| 372 | Ga0207665_10327019 | 3300025939 | Bacteria | 1152 |
| 373 | Ga0207665_10880138 | 3300025939 | Bacteria | 710 |
| 374 | Ga0207691_10119742 | 3300025940 | Bacteria | 2334 |
| 375 | Ga0207689_10000376 | 3300025942 | Bacteria | 41990 |
| 376 | Ga0207689_10371845 | 3300025942 | Bacteria | 1189 |
| 377 | Ga0207689_10435302 | 3300025942 | Bacteria | 1095 |
| 378 | Ga0207689_11464904 | 3300025942 | Bacteria | 571 |
| 379 | Ga0207661_10179401 | 3300025944 | Bacteria | 1849 |
| 380 | Ga0207667_10134989 | 3300025949 | Bacteria | 2541 |
| 381 | Ga0207651_11016019 | 3300025960 | Bacteria | 741 |
| 382 | Ga0207651_11102964 | 3300025960 | Bacteria | 711 |
| 383 | Ga0207712_10005157 | 3300025961 | Bacteria | 8264 |
| 384 | Ga0207712_10225900 | 3300025961 | Bacteria | 1500 |
| 385 | Ga0207668_10037290 | 3300025972 | Bacteria | 3252 |
| 386 | Ga0207640_10060273 | 3300025981 | Bacteria | 2507 |
| 387 | Ga0207640_11529530 | 3300025981 | Bacteria | 600 |
| 388 | Ga0207677_10004790 | 3300026023 | Bacteria | 7300 |
| 389 | Ga0207677_10653886 | 3300026023 | Bacteria | 928 |
| 390 | Ga0207703_10001886 | 3300026035 | Bacteria | 18616 |
| 391 | Ga0207703_10031708 | 3300026035 | Bacteria | 4180 |
| 392 | Ga0207703_11784423 | 3300026035 | Bacteria | 591 |
| 393 | Ga0207639_10050531 | 3300026041 | Bacteria | 3158 |
| 394 | Ga0207708_10000239 | 3300026075 | Bacteria | 43452 |
| 395 | Ga0207708_10006009 | 3300026075 | Bacteria | 8996 |
| 396 | Ga0207708_10036334 | 3300026075 | Bacteria | 3750 |
| 397 | Ga0207708_10246018 | 3300026075 | Bacteria | 1440 |
| 398 | Ga0207708_11269594 | 3300026075 | Bacteria | 645 |
| 399 | Ga0207702_10056135 | 3300026078 | Bacteria | 3342 |
| 400 | Ga0207702_10261003 | 3300026078 | Bacteria | 1631 |
| 401 | Ga0207702_10897698 | 3300026078 | Bacteria | 878 |
| 402 | Ga0207641_10042652 | 3300026088 | Bacteria | 3807 |
| 403 | Ga0207641_10474389 | 3300026088 | Bacteria | 1212 |
| 404 | Ga0207648_10000369 | 3300026089 | Bacteria | 49386 |
| 405 | Ga0207648_10002987 | 3300026089 | Bacteria | 17871 |
| 406 | Ga0207648_11293123 | 3300026089 | Bacteria | 685 |
| 407 | Ga0207676_10049205 | 3300026095 | Bacteria | 3277 |
| 408 | Ga0207676_11565246 | 3300026095 | Bacteria | 657 |
| 409 | Ga0207674_10174419 | 3300026116 | Bacteria | 2102 |
| 410 | Ga0207674_10462949 | 3300026116 | Bacteria | 1225 |
| 411 | Ga0207675_100000651 | 3300026118 | Bacteria | 34173 |
| 412 | Ga0207675_100002559 | 3300026118 | Bacteria | 18014 |
| 413 | Ga0207675_100492840 | 3300026118 | Bacteria | 1219 |
| 414 | Ga0207675_100638682 | 3300026118 | Bacteria | 1070 |
| 415 | Ga0207675_100861044 | 3300026118 | Bacteria | 921 |
| 416 | Ga0207675_101248408 | 3300026118 | Bacteria | 763 |
| 417 | Ga0207683_10091937 | 3300026121 | Bacteria | 2703 |
| 418 | Ga0207683_10628706 | 3300026121 | Bacteria | 994 |
| 419 | Ga0207698_10047953 | 3300026142 | Bacteria | 3240 |
| 420 | Ga0209969_1028833 | 3300027360 | Bacteria | 845 |
| 421 | Ga0209967_1005806 | 3300027364 | Bacteria | 1667 |
| 422 | Ga0209967_1006851 | 3300027364 | Bacteria | 1552 |
| 423 | Ga0209967_1007443 | 3300027364 | Bacteria | 1497 |
| 424 | Ga0209981_1009968 | 3300027378 | Bacteria | 1302 |
| 425 | Ga0209981_1037131 | 3300027378 | Bacteria | 723 |
| 426 | Ga0209996_1022515 | 3300027395 | Bacteria | 892 |
| 427 | Ga0209996_1042690 | 3300027395 | Bacteria | 676 |
| 428 | Ga0210000_1005614 | 3300027462 | Bacteria | 1821 |
| 429 | Ga0210000_1009349 | 3300027462 | Bacteria | 1442 |
| 430 | Ga0210000_1016142 | 3300027462 | Bacteria | 1127 |
| 431 | Ga0209995_1010851 | 3300027471 | Bacteria | 1480 |
| 432 | Ga0209995_1012130 | 3300027471 | Bacteria | 1404 |
| 433 | Ga0209968_1007653 | 3300027526 | Bacteria | 1636 |
| 434 | Ga0209999_1004248 | 3300027543 | Bacteria | 2578 |
| 435 | Ga0209999_1031217 | 3300027543 | Bacteria | 989 |
| 436 | Ga0209999_1083453 | 3300027543 | Bacteria | 617 |
| 437 | Ga0209982_1049402 | 3300027552 | Bacteria | 677 |
| 438 | Ga0209970_1041651 | 3300027614 | Bacteria | 818 |
| 439 | Ga0209970_1099545 | 3300027614 | Bacteria | 555 |
| 440 | Ga0209983_1136672 | 3300027665 | Bacteria | 561 |
| 441 | Ga0209983_1161936 | 3300027665 | Bacteria | 513 |
| 442 | Ga0209588_1056698 | 3300027671 | Bacteria | 1266 |
| 443 | Ga0209971_1006528 | 3300027682 | Bacteria | 2759 |
| 444 | Ga0209971_1105422 | 3300027682 | Bacteria | 691 |
| 445 | Ga0209966_1023390 | 3300027695 | Bacteria | 1214 |
| 446 | Ga0209966_1042642 | 3300027695 | Bacteria | 949 |
| 447 | Ga0209974_10011132 | 3300027876 | Bacteria | 3026 |
| 448 | Ga0209974_10138771 | 3300027876 | Bacteria | 871 |
| 449 | Ga0207428_10010784 | 3300027907 | Bacteria | 8147 |
| 450 | Ga0207428_10019374 | 3300027907 | Bacteria | 5803 |
| 451 | Ga0207428_10201221 | 3300027907 | Bacteria | 1498 |
| 452 | Ga0207428_10286072 | 3300027907 | Bacteria | 1223 |
| 453 | Ga0207428_10322863 | 3300027907 | Bacteria | 1140 |
| 454 | Ga0207428_10404566 | 3300027907 | Bacteria | 999 |
| 455 | Ga0268265_10000781 | 3300028380 | Bacteria | 30469 |
| 456 | Ga0268265_10001333 | 3300028380 | Bacteria | 21108 |
| 457 | Ga0268265_10172111 | 3300028380 | Bacteria | 1852 |
| 458 | Ga0268265_10539870 | 3300028380 | Bacteria | 1105 |
| 459 | Ga0268265_11132614 | 3300028380 | Bacteria | 778 |
| 460 | Ga0268265_12016389 | 3300028380 | Bacteria | 584 |
| 461 | Ga0268264_10001450 | 3300028381 | Bacteria | 22200 |
| 462 | Ga0268264_10358617 | 3300028381 | Bacteria | 1390 |
| 463 | Ga0268264_10617457 | 3300028381 | Bacteria | 1070 |
| 464 | Ga0268264_11581433 | 3300028381 | Bacteria | 666 |
| 465 | Ga0307408_100217170 | 3300031548 | Bacteria | 1558 |
| 466 | Ga0307408_100328650 | 3300031548 | Bacteria | 1290 |
| 467 | Ga0307408_100397344 | 3300031548 | Bacteria | 1183 |
| 468 | Ga0307408_100483338 | 3300031548 | Bacteria | 1081 |
| 469 | Ga0307408_100499765 | 3300031548 | Bacteria | 1064 |
| 470 | Ga0307408_100558767 | 3300031548 | Bacteria | 1011 |
| 471 | Ga0307408_100961731 | 3300031548 | Bacteria | 785 |
| 472 | Ga0307405_10266818 | 3300031731 | Bacteria | 1282 |
| 473 | Ga0307405_10471668 | 3300031731 | Bacteria | 1000 |
| 474 | Ga0307410_11276436 | 3300031852 | Bacteria | 642 |
| 475 | Ga0307410_12032337 | 3300031852 | Bacteria | 513 |
| 476 | Ga0307406_10254138 | 3300031901 | Bacteria | 1326 |
| 477 | Ga0307406_10660434 | 3300031901 | Bacteria | 869 |
| 478 | Ga0307407_10210867 | 3300031903 | Bacteria | 1308 |
| 479 | Ga0307412_10408092 | 3300031911 | Bacteria | 1108 |
| 480 | Ga0307412_10843877 | 3300031911 | Bacteria | 799 |
| 481 | Ga0307409_100169468 | 3300031995 | Bacteria | 1920 |
| 482 | Ga0307409_100466699 | 3300031995 | Bacteria | 1222 |
| 483 | Ga0307416_100143175 | 3300032002 | Bacteria | 2177 |
| 484 | Ga0307416_100191358 | 3300032002 | Bacteria | 1930 |
| 485 | Ga0307416_100323996 | 3300032002 | Bacteria | 1545 |
| 486 | Ga0307416_100359490 | 3300032002 | Bacteria | 1477 |
| 487 | Ga0307416_100689954 | 3300032002 | Bacteria | 1109 |
| 488 | Ga0307416_101345812 | 3300032002 | Bacteria | 820 |
| 489 | Ga0307416_102700765 | 3300032002 | Bacteria | 593 |
| 490 | Ga0307411_10022035 | 3300032005 | Bacteria | 3743 |
| 491 | Ga0307411_10151900 | 3300032005 | Bacteria | 1722 |
| 492 | Ga0373930_0160468 | 3300034816 | Bacteria | 568 |
| 493 | Ga0373930_0160800 | 3300034816 | Bacteria | 568 |
| 494 | Ga0373948_0011088 | 3300034817 | Bacteria | 1586 |
| 495 | Ga0373950_0059922 | 3300034818 | Bacteria | 763 |
| 496 | Ga0373958_0024227 | 3300034819 | Bacteria | 1147 |
| 497 | Ga0373958_0100025 | 3300034819 | Bacteria | 679 |
| 498 | Ga0373959_0005843 | 3300034820 | Bacteria | 2027 |
| 499 | Ga0373938_0003713 | 3300034957 | Bacteria | 2516 |
| 500 | Ga0373938_0126471 | 3300034957 | Bacteria | 663 |
| 501 | Ga0373938_0185876 | 3300034957 | Bacteria | 569 |
| 502 | Ga0373926_0000230 | 3300035083 | Bacteria | 13313 |
| 503 | Ga0373928_0022347 | 3300035084 | Bacteria | 1341 |
| 504 | Ga0373929_0032794 | 3300035085 | Bacteria | 1119 |
| 505 | Ga0373934_0251967 | 3300035086 | Bacteria | 730 |
| 506 | Ga0373940_0027896 | 3300035088 | Bacteria | 1487 |
| 507 | Ga0373944_0001903 | 3300035089 | Bacteria | 5278 |
| 508 | Ga0373944_0262287 | 3300035089 | Bacteria | 640 |
| 509 | Ga0373949_0053680 | 3300035090 | Bacteria | 1021 |
| 510 | Ga0373951_0090467 | 3300035091 | Bacteria | 802 |
| 511 | Ga0373952_0069643 | 3300035092 | Bacteria | 877 |
| 512 | Ga0373952_0092566 | 3300035092 | Bacteria | 787 |
| 513 | Ga0373923_0288232 | 3300035111 | Bacteria | 775 |
| 514 | Ga0373932_0005565 | 3300035112 | Bacteria | 2963 |
| 515 | Ga0373932_0265155 | 3300035112 | Bacteria | 631 |
| 516 | Ga0373936_0018435 | 3300035113 | Bacteria | 2696 |
| 517 | Ga0373939_0044852 | 3300035114 | Bacteria | 1347 |
| 518 | Ga0373939_0265225 | 3300035114 | Bacteria | 673 |
| 519 | Ga0373941_0018284 | 3300035115 | Bacteria | 1934 |
| 520 | Ga0373941_0039893 | 3300035115 | Bacteria | 1445 |
| 521 | Ga0373945_0004779 | 3300035116 | Bacteria | 4312 |
| 522 | Ga0373945_0137355 | 3300035116 | Bacteria | 983 |
| 523 | Ga0373945_0521942 | 3300035116 | Bacteria | 531 |
| 524 | Ga0373953_0021780 | 3300035117 | Bacteria | 2409 |
| 525 | Ga0373954_0000087 | 3300035118 | Bacteria | 31710 |
| 526 | Ga0373956_0066543 | 3300035119 | Bacteria | 1639 |
| 527 | Ga0373957_0313502 | 3300035120 | Bacteria | 666 |
| 528 | Ga0373960_0023136 | 3300035121 | Bacteria | 1671 |
| 529 | Ga0373943_0020057 | 3300035170 | Bacteria | 3078 |
| 530 | Ga0373943_0176629 | 3300035170 | Bacteria | 1171 |
| 531 | Ga0373943_0811787 | 3300035170 | Bacteria | 557 |
| 532 | Ga0373946_0005892 | 3300035171 | Bacteria | 4440 |
| 533 | Ga0373955_0090832 | 3300035172 | Bacteria | 1740 |
| 534 | Ga0373955_0899204 | 3300035172 | Bacteria | 545 |
| 535 | Ga0373942_0004862 | 3300035207 | Bacteria | 3116 |
| 536 | Ga0373942_0078048 | 3300035207 | Bacteria | 978 |
| 537 | Ga0373942_0183233 | 3300035207 | Bacteria | 687 |
| 538 | Ga0373961_0008933 | 3300035241 | Bacteria | 2444 |
| 539 | Ga0373961_0134635 | 3300035241 | Bacteria | 830 |
| 540 | Ga0373961_0432326 | 3300035241 | Bacteria | 510 |
| 541 | Ga0373962_0082296 | 3300035242 | Bacteria | 979 |
| 542 | Ga0373962_0124605 | 3300035242 | Bacteria | 825 |
| 543 | Ga0373962_0221692 | 3300035242 | Bacteria | 647 |
| 544 | Ga0373924_0014361 | 3300035410 | Bacteria | 2992 |
| 545 | Ga0373924_0059852 | 3300035410 | Bacteria | 1592 |
| 546 | Ga0373924_0097248 | 3300035410 | Bacteria | 1264 |
| 547 | Ga0373924_0108202 | 3300035410 | Bacteria | 1200 |
| 548 | Ga0373931_0002129 | 3300035691 | Bacteria | 8722 |
| 549 | Ga0373931_0004456 | 3300035691 | Bacteria | 6400 |
| 550 | Ga0373931_0014988 | 3300035691 | Bacteria | 3798 |
| 551 | Ga0373931_0128940 | 3300035691 | Bacteria | 1454 |
| 552 | Ga0373935_0010817 | 3300035692 | Bacteria | 5482 |
| 553 | Ga0373935_0010842 | 3300035692 | Bacteria | 5474 |
| 554 | Ga0373935_0094772 | 3300035692 | Bacteria | 1959 |
| 555 | Ga0373927_0023238 | 3300035695 | Bacteria | 4061 |
| 556 | Ga0373927_0038778 | 3300035695 | Bacteria | 3093 |
| 557 | Ga0373927_0136658 | 3300035695 | Bacteria | 1602 |
| 558 | Ga0373927_0445904 | 3300035695 | Bacteria | 855 |
| 559 | Ga0373933_0003173 | 3300035724 | Bacteria | 9182 |
| 560 | Ga0373933_0027928 | 3300035724 | Bacteria | 3253 |
| 561 | Ga0373947_0036854 | 3300035725 | Bacteria | 2900 |
| 562 | Ga0373947_0046108 | 3300035725 | Bacteria | 2609 |
| 563 | Ga0373937_0000296 | 3300036401 | Bacteria | 47231 |
| 564 | Ga0373937_0018367 | 3300036401 | Bacteria | 6244 |
| 565 | Ga0373937_0115160 | 3300036401 | Bacteria | 2503 |
| 566 | Ga0373937_0226652 | 3300036401 | Bacteria | 1759 |
| 567 | Ga0373937_0340309 | 3300036401 | Bacteria | 1421 |
| 568 | Ga0373937_0570520 | 3300036401 | Bacteria | 1075 |
| 569 | Ga0373937_0856988 | 3300036401 | Bacteria | 857 |
| 570 | Ga0373937_1364362 | 3300036401 | Bacteria | 657 |
| 571 | Ga0373925_0007563 | 3300037068 | Bacteria | 7915 |
| 572 | Ga0373925_0212145 | 3300037068 | Bacteria | 1542 |
| 573 | Ga0439436_0149396 | 3300041404 | Bacteria | 659 |
| 574 | Ga0439439_0021515 | 3300041406 | Bacteria | 1608 |
| 575 | Ga0439453_0033996 | 3300041408 | Bacteria | 977 |
| 576 | Ga0439461_0002899 | 3300041410 | Bacteria | 2780 |
| 577 | Ga0451802_0411675 | 3300041460 | Bacteria | 671 |
| 578 | Ga0451807_0142877 | 3300041486 | Bacteria | 984 |
| 579 | Ga0451807_1785507 | 3300041486 | Bacteria | 512 |
| 580 | Ga0451845_0620846 | 3300041501 | Bacteria | 749 |
| 581 | Ga0439441_000488 | 3300042001 | Bacteria | 4310 |
| 582 | Ga0439441_029634 | 3300042001 | Bacteria | 1054 |
| 583 | Ga0439441_045240 | 3300042001 | Bacteria | 893 |
| 584 | Ga0439441_081579 | 3300042001 | Bacteria | 705 |
| 585 | Ga0439441_147161 | 3300042001 | Bacteria | 553 |
| 586 | Ga0439443_036387 | 3300042003 | Bacteria | 828 |
| 587 | Ga0439451_031250 | 3300042009 | Bacteria | 1070 |
| 588 | Ga0439462_0012540 | 3300042015 | Bacteria | 2166 |
| 589 | Ga0450923_114106 | 3300042125 | Bacteria | 633 |
| 590 | Ga0439446_0004777 | 3300042156 | Bacteria | 3451 |
| 591 | Ga0439446_0111205 | 3300042156 | Bacteria | 874 |
| 592 | Ga0439434_0000076 | 3300042435 | Bacteria | 24744 |
| 593 | Ga0439434_0103290 | 3300042435 | Bacteria | 919 |
| 594 | Ga0439435_0001056 | 3300042436 | Bacteria | 4863 |
| 595 | Ga0439435_0098919 | 3300042436 | Bacteria | 894 |
| 596 | Ga0439444_0021720 | 3300042437 | Bacteria | 1138 |
| 597 | Ga0450893_0058995 | 3300042532 | Bacteria | 730 |
| 598 | Ga0451577_0015044 | 3300042876 | Bacteria | 7198 |
| 599 | Ga0451577_0547198 | 3300042876 | Bacteria | 1051 |
| 600 | Ga0453683_0536007 | 3300044673 | Bacteria | 761 |
| 601 | Ga0466965_0132417 | 3300044683 | Bacteria | 1294 |
| 602 | Ga0451576_0017229 | 3300045051 | Bacteria | 7947 |
| 603 | Ga0451576_0033552 | 3300045051 | Bacteria | 5456 |
| 604 | Ga0451576_0045166 | 3300045051 | Bacteria | 4641 |
| 605 | Ga0451576_0090352 | 3300045051 | Bacteria | 3185 |
| 606 | Ga0451576_0214293 | 3300045051 | Bacteria | 2011 |
| 607 | Ga0451576_0406018 | 3300045051 | Bacteria | 1428 |
| 608 | Ga0451576_1310889 | 3300045051 | Bacteria | 755 |
| 609 | Ga0451576_1717735 | 3300045051 | Bacteria | 650 |
| 610 | Ga0451576_1899017 | 3300045051 | Bacteria | 614 |
| 611 | Ga0451576_2176584 | 3300045051 | Bacteria | 570 |
| 612 | Ga0466958_0467474 | 3300045836 | Bacteria | 817 |
| 613 | Ga0466967_0113879 | 3300045976 | Bacteria | 2489 |
| 614 | Ga0495592_0001592 | 3300046454 | Bacteria | 15869 |
| 615 | Ga0495603_0005705 | 3300046455 | Bacteria | 7441 |
| 616 | Ga0495629_0268868 | 3300046459 | Bacteria | 1171 |
| 617 | Ga0495629_1087947 | 3300046459 | Bacteria | 517 |
| 618 | Ga0495651_0242044 | 3300046462 | Bacteria | 1237 |
| 619 | Ga0495651_0980578 | 3300046462 | Bacteria | 514 |
| 620 | Ga0495653_0047055 | 3300046463 | Bacteria | 3338 |
| 621 | Ga0495653_0292991 | 3300046463 | Bacteria | 1064 |
| 622 | Ga0495653_0303011 | 3300046463 | Bacteria | 1041 |
| 623 | Ga0495582_0034547 | 3300046473 | Bacteria | 2779 |
| 624 | Ga0495582_0088203 | 3300046473 | Bacteria | 1728 |
| 625 | Ga0495639_0005524 | 3300046475 | Bacteria | 5442 |
| 626 | Ga0495639_0422330 | 3300046475 | Bacteria | 675 |
| 627 | Ga0495662_0030769 | 3300046476 | Bacteria | 2591 |
| 628 | Ga0495662_0043033 | 3300046476 | Bacteria | 2180 |
| 629 | Ga0495664_0310021 | 3300046477 | Bacteria | 952 |
| 630 | Ga0495664_0434049 | 3300046477 | Bacteria | 787 |
| 631 | Ga0495608_0007794 | 3300046511 | Bacteria | 7537 |
| 632 | Ga0495608_0099837 | 3300046511 | Bacteria | 1872 |
| 633 | Ga0495618_0140076 | 3300046514 | Bacteria | 1547 |
| 634 | Ga0495628_0003126 | 3300046516 | Bacteria | 14870 |
| 635 | Ga0495628_0252617 | 3300046516 | Bacteria | 1316 |
| 636 | Ga0495630_0073248 | 3300046517 | Bacteria | 2579 |
| 637 | Ga0495630_0526424 | 3300046517 | Bacteria | 906 |
| 638 | Ga0495630_0618846 | 3300046517 | Bacteria | 830 |
| 639 | Ga0495630_0679615 | 3300046517 | Bacteria | 788 |
| 640 | Ga0495666_0013837 | 3300046526 | Bacteria | 4023 |
| 641 | Ga0495666_0025168 | 3300046526 | Bacteria | 2941 |
| 642 | Ga0495652_0257177 | 3300046529 | Bacteria | 1291 |
| 643 | Ga0495652_0440638 | 3300046529 | Bacteria | 914 |
| 644 | Ga0495652_0647059 | 3300046529 | Bacteria | 716 |
| 645 | Ga0495665_0629153 | 3300046531 | Bacteria | 535 |
| 646 | Ga0495640_0009959 | 3300046533 | Bacteria | 7369 |
| 647 | Ga0495640_0065335 | 3300046533 | Bacteria | 2457 |
| 648 | Ga0495586_0016693 | 3300046535 | Bacteria | 3904 |
| 649 | Ga0495586_0055967 | 3300046535 | Bacteria | 2138 |
| 650 | Ga0495587_0109857 | 3300046536 | Bacteria | 1584 |
| 651 | Ga0495587_0118678 | 3300046536 | Bacteria | 1515 |
| 652 | Ga0495587_0451617 | 3300046536 | Bacteria | 712 |
| 653 | Ga0495598_0052961 | 3300046537 | Bacteria | 1228 |
| 654 | Ga0495621_0111561 | 3300046539 | Bacteria | 1049 |
| 655 | Ga0495621_0123251 | 3300046539 | Bacteria | 1003 |
| 656 | Ga0495622_0019198 | 3300046557 | Bacteria | 3183 |
| 657 | Ga0495622_0120892 | 3300046557 | Bacteria | 1196 |
| 658 | Ga0495667_0013563 | 3300046559 | Bacteria | 5513 |
| 659 | Ga0495667_0152297 | 3300046559 | Bacteria | 1489 |
| 660 | Ga0495634_0020851 | 3300046642 | Bacteria | 4642 |
| 661 | Ga0495625_0014493 | 3300046660 | Bacteria | 6286 |
| 662 | Ga0495635_0117809 | 3300046663 | Bacteria | 1812 |
| 663 | Ga0495659_0011438 | 3300046664 | Bacteria | 2858 |
| 664 | Ga0495657_0418123 | 3300046675 | Bacteria | 787 |
| 665 | Ga0495599_0022373 | 3300046678 | Bacteria | 3946 |
| 666 | Ga0495623_0185607 | 3300046679 | Bacteria | 1205 |
| 667 | Ga0495647_0001395 | 3300046681 | Bacteria | 7454 |
| 668 | Ga0495647_0087604 | 3300046681 | Bacteria | 1272 |
| 669 | Ga0495658_0003610 | 3300046683 | Bacteria | 7661 |
| 670 | Ga0495658_0292223 | 3300046683 | Bacteria | 1030 |
| 671 | Ga0495669_0110952 | 3300046684 | Bacteria | 1280 |
| 672 | Ga0495669_0334554 | 3300046684 | Bacteria | 731 |
| 673 | Ga0495613_0047127 | 3300046689 | Bacteria | 3184 |
| 674 | Ga0495624_0065340 | 3300046690 | Bacteria | 2273 |
| 675 | Ga0495624_0497953 | 3300046690 | Bacteria | 729 |
| 676 | Ga0495600_0351907 | 3300046809 | Bacteria | 922 |
| 677 | Ga0495581_0243478 | 3300047315 | Bacteria | 1052 |
| 678 | Ga0495581_0297970 | 3300047315 | Bacteria | 942 |
| 679 | Ga0495581_0835619 | 3300047315 | Bacteria | 527 |
| 680 | Ga0495604_0008726 | 3300047317 | Bacteria | 8014 |
| 681 | Ga0495636_0012828 | 3300047318 | Bacteria | 3320 |
| 682 | Ga0495636_0421976 | 3300047318 | Bacteria | 638 |
| 683 | Ga0495636_0627829 | 3300047318 | Bacteria | 527 |
| 684 | Ga0495674_0532266 | 3300047319 | Bacteria | 937 |
| 685 | Ga0495680_0001252 | 3300047322 | Bacteria | 27832 |
| 686 | Ga0495680_0061033 | 3300047322 | Bacteria | 2902 |
| 687 | Ga0495680_0349761 | 3300047322 | Bacteria | 1029 |
| 688 | Ga0495675_0011335 | 3300047444 | Bacteria | 5596 |
| 689 | Ga0495593_0008922 | 3300047673 | Bacteria | 5819 |
| 690 | Ga0495593_0186440 | 3300047673 | Bacteria | 1044 |
| 691 | Ga0495602_1137740 | 3300048088 | Bacteria | 510 |
| 692 | Ga0495614_0382755 | 3300048089 | Bacteria | 659 |
| 693 | Ga0496106_0159383 | 3300048909 | Bacteria | 1784 |
| 694 | Ga0501291_053309 | 3300049514 | Bacteria | 742 |
| 695 | Ga0501298_040277 | 3300049521 | Bacteria | 946 |
| 696 | Ga0501299_113300 | 3300049522 | Bacteria | 644 |
| 697 | Ga0501303_017067 | 3300049526 | Bacteria | 741 |
| 698 | Ga0501303_047458 | 3300049526 | Bacteria | 555 |
| 699 | Ga0501031_0059330 | 3300049568 | Bacteria | 2493 |
| 700 | Ga0501031_0204174 | 3300049568 | Bacteria | 1289 |
| 701 | Ga0501031_0612243 | 3300049568 | Bacteria | 700 |
| 702 | Ga0501032_0086786 | 3300049569 | Bacteria | 2079 |
| 703 | Ga0501032_0567680 | 3300049569 | Bacteria | 723 |
| 704 | Ga0501033_0011373 | 3300049570 | Bacteria | 6810 |
| 705 | Ga0501033_0264915 | 3300049570 | Bacteria | 1216 |
| 706 | Ga0501036_0001921 | 3300049572 | Bacteria | 16137 |
| 707 | Ga0501036_0085385 | 3300049572 | Bacteria | 2668 |
| 708 | Ga0501036_0391362 | 3300049572 | Bacteria | 1160 |
| 709 | Ga0501036_0547806 | 3300049572 | Bacteria | 961 |
| 710 | Ga0501037_0013201 | 3300049573 | Bacteria | 6089 |
| 711 | Ga0501037_0523020 | 3300049573 | Bacteria | 803 |
| 712 | Ga0501038_0004982 | 3300049574 | Bacteria | 12341 |
| 713 | Ga0501038_0923941 | 3300049574 | Bacteria | 643 |
| 714 | Ga0501039_0000477 | 3300049575 | Bacteria | 28990 |
| 715 | Ga0501039_0024671 | 3300049575 | Bacteria | 4619 |
| 716 | Ga0501039_0027089 | 3300049575 | Bacteria | 4408 |
| 717 | Ga0501039_0033414 | 3300049575 | Bacteria | 3966 |
| 718 | Ga0501040_0000052 | 3300049576 | Bacteria | 54195 |
| 719 | Ga0501040_0005360 | 3300049576 | Bacteria | 8294 |
| 720 | Ga0501040_0113809 | 3300049576 | Bacteria | 1893 |
| 721 | Ga0501040_0205892 | 3300049576 | Bacteria | 1398 |
| 722 | Ga0501041_0000038 | 3300049577 | Bacteria | 44285 |
| 723 | Ga0501041_0015649 | 3300049577 | Bacteria | 4506 |
| 724 | Ga0501041_0015993 | 3300049577 | Bacteria | 4459 |
| 725 | Ga0501041_0240071 | 3300049577 | Bacteria | 1139 |
| 726 | Ga0501041_0430517 | 3300049577 | Bacteria | 837 |
| 727 | Ga0501042_0000048 | 3300049578 | Bacteria | 40877 |
| 728 | Ga0501042_0111133 | 3300049578 | Bacteria | 1973 |
| 729 | Ga0501042_1127447 | 3300049578 | Bacteria | 572 |
| 730 | Ga0501043_0043047 | 3300049579 | Bacteria | 3549 |
| 731 | Ga0501043_0630625 | 3300049579 | Bacteria | 789 |
| 732 | Ga0501046_0000271 | 3300049580 | Bacteria | 52841 |
| 733 | Ga0501046_0012984 | 3300049580 | Bacteria | 7072 |
| 734 | Ga0501046_0131158 | 3300049580 | Bacteria | 1901 |
| 735 | Ga0501046_1092793 | 3300049580 | Bacteria | 551 |
| 736 | Ga0501046_1170956 | 3300049580 | Bacteria | 529 |
| 737 | Ga0501047_0136139 | 3300049581 | Bacteria | 2337 |
| 738 | Ga0501048_0000378 | 3300049582 | Bacteria | 30854 |
| 739 | Ga0501048_0010966 | 3300049582 | Bacteria | 6761 |
| 740 | Ga0501048_0525886 | 3300049582 | Bacteria | 848 |
| 741 | Ga0501048_0536037 | 3300049582 | Bacteria | 840 |
| 742 | Ga0501048_1117835 | 3300049582 | Bacteria | 567 |
| 743 | Ga0501067_0831696 | 3300049583 | Bacteria | 520 |
| 744 | Ga0501068_0014809 | 3300049584 | Bacteria | 4464 |
| 745 | Ga0501068_0086419 | 3300049584 | Bacteria | 1931 |
| 746 | Ga0501069_0123294 | 3300049585 | Bacteria | 1481 |
| 747 | Ga0501069_0541180 | 3300049585 | Bacteria | 696 |
| 748 | Ga0501070_0159893 | 3300049586 | Bacteria | 1857 |
| 749 | Ga0501070_0951507 | 3300049586 | Bacteria | 668 |
| 750 | Ga0501071_0007914 | 3300049587 | Bacteria | 7009 |
| 751 | Ga0501071_0078414 | 3300049587 | Bacteria | 2414 |
| 752 | Ga0501071_0128234 | 3300049587 | Bacteria | 1884 |
| 753 | Ga0501072_0008011 | 3300049588 | Bacteria | 8018 |
| 754 | Ga0501072_0009822 | 3300049588 | Bacteria | 7274 |
| 755 | Ga0501072_0098053 | 3300049588 | Bacteria | 2329 |
| 756 | Ga0501072_0214228 | 3300049588 | Bacteria | 1535 |
| 757 | Ga0501072_0480438 | 3300049588 | Bacteria | 983 |
| 758 | Ga0501072_0488477 | 3300049588 | Bacteria | 974 |
| 759 | Ga0501073_0204289 | 3300049589 | Bacteria | 1366 |
| 760 | Ga0501073_1004475 | 3300049589 | Bacteria | 574 |
| 761 | Ga0501074_0007335 | 3300049590 | Bacteria | 7972 |
| 762 | Ga0501074_0066914 | 3300049590 | Bacteria | 2584 |
| 763 | Ga0501074_0206844 | 3300049590 | Bacteria | 1398 |
| 764 | Ga0501074_0472188 | 3300049590 | Bacteria | 889 |
| 765 | Ga0501074_0636217 | 3300049590 | Bacteria | 754 |
| 766 | Ga0501074_0966257 | 3300049590 | Bacteria | 599 |
| 767 | Ga0501075_0000180 | 3300049591 | Bacteria | 32596 |
| 768 | Ga0501075_0027409 | 3300049591 | Bacteria | 4199 |
| 769 | Ga0501075_0059419 | 3300049591 | Bacteria | 2880 |
| 770 | Ga0501075_0114208 | 3300049591 | Bacteria | 2053 |
| 771 | Ga0501075_0148471 | 3300049591 | Bacteria | 1787 |
| 772 | Ga0501075_0550868 | 3300049591 | Bacteria | 880 |
| 773 | Ga0501076_0000290 | 3300049592 | Bacteria | 31327 |
| 774 | Ga0501076_0000319 | 3300049592 | Bacteria | 29725 |
| 775 | Ga0501076_0103371 | 3300049592 | Bacteria | 2298 |
| 776 | Ga0501076_0195588 | 3300049592 | Bacteria | 1651 |
| 777 | Ga0501076_0698239 | 3300049592 | Bacteria | 838 |
| 778 | Ga0501076_0893114 | 3300049592 | Bacteria | 733 |
| 779 | Ga0501077_0000222 | 3300049593 | Bacteria | 33397 |
| 780 | Ga0501077_0104746 | 3300049593 | Bacteria | 1793 |
| 781 | Ga0501077_0773240 | 3300049593 | Bacteria | 617 |
| 782 | Ga0501217_116597 | 3300049661 | Bacteria | 772 |
| 783 | Ga0501217_194514 | 3300049661 | Bacteria | 629 |
| 784 | Ga0501233_243369 | 3300049668 | Bacteria | 538 |
| 785 | Ga0501225_0046507 | 3300049705 | Bacteria | 1203 |
| 786 | Ga0501225_0274658 | 3300049705 | Bacteria | 562 |
| 787 | Ga0501079_0000061 | 3300049741 | Bacteria | 48925 |
| 788 | Ga0501079_0047873 | 3300049741 | Bacteria | 3299 |
| 789 | Ga0501079_0557856 | 3300049741 | Bacteria | 901 |
| 790 | Ga0501080_0041403 | 3300049742 | Bacteria | 4293 |
| 791 | Ga0501080_0104562 | 3300049742 | Bacteria | 2626 |
| 792 | Ga0501080_0311821 | 3300049742 | Bacteria | 1426 |
| 793 | Ga0501080_0341293 | 3300049742 | Bacteria | 1353 |
| 794 | Ga0501080_1078142 | 3300049742 | Bacteria | 694 |
| 795 | Ga0501081_0000110 | 3300049743 | Bacteria | 34989 |
| 796 | Ga0501081_0005740 | 3300049743 | Bacteria | 8036 |
| 797 | Ga0501081_1178339 | 3300049743 | Bacteria | 580 |
| 798 | Ga0501083_0081556 | 3300049744 | Bacteria | 2144 |
| 799 | Ga0501083_0112833 | 3300049744 | Bacteria | 1786 |
| 800 | Ga0501283_029251 | 3300049779 | Bacteria | 917 |
| 801 | Ga0501035_0021364 | 3300049822 | Bacteria | 5950 |
| 802 | Ga0501035_0802186 | 3300049822 | Bacteria | 752 |
| 803 | Ga0501044_0046768 | 3300049823 | Bacteria | 4479 |
| 804 | Ga0501044_0663837 | 3300049823 | Bacteria | 931 |
| 805 | Ga0501044_1309375 | 3300049823 | Bacteria | 591 |
| 806 | Ga0501045_0000038 | 3300049824 | Bacteria | 55579 |
| 807 | Ga0501045_0169461 | 3300049824 | Bacteria | 1626 |
| 808 | Ga0501045_0251721 | 3300049824 | Bacteria | 1315 |
| 809 | Ga0501212_092899 | 3300049851 | Bacteria | 559 |
| 810 | nmdc:mga0k408_7255_c1 | 3300050493 | Bacteria | 5924 |
| 811 | nmdc:mga05p37_1298538_c1 | 3300050507 | Bacteria | 742 |
| 812 | nmdc:mga05p37_2835_c1 | 3300050507 | Bacteria | 20152 |
| 813 | nmdc:mga05p37_724826_c1 | 3300050507 | Bacteria | 1100 |
| 814 | nmdc:mga05p37_74156_c1 | 3300050507 | Bacteria | 4188 |
| 815 | nmdc:mga05p37_803_c1 | 3300050507 | Bacteria | 35042 |
| 816 | nmdc:mga05p37_869553_c1 | 3300050507 | Bacteria | 976 |
| 817 | nmdc:mga09592_107109_c1 | 3300050508 | Bacteria | 2398 |
| 818 | nmdc:mga09592_15465_c1 | 3300050508 | Bacteria | 6236 |
| 819 | nmdc:mga09592_225263_c1 | 3300050508 | Bacteria | 1625 |
| 820 | nmdc:mga09592_297287_c1 | 3300050508 | Bacteria | 1400 |
| 821 | nmdc:mga09592_44_c1 | 3300050508 | Bacteria | 69981 |
| 822 | nmdc:mga09592_607708_c1 | 3300050508 | Bacteria | 936 |
| 823 | nmdc:mga09592_719365_c1 | 3300050508 | Bacteria | 849 |
| 824 | nmdc:mga0qj67_10164_c1 | 3300050509 | Bacteria | 7025 |
| 825 | nmdc:mga0qj67_131916_c1 | 3300050509 | Bacteria | 2024 |
| 826 | nmdc:mga0qj67_169646_c1 | 3300050509 | Bacteria | 1772 |
| 827 | nmdc:mga0qj67_17987_c1 | 3300050509 | Bacteria | 5382 |
| 828 | nmdc:mga0qj67_33460_c1 | 3300050509 | Bacteria | 4011 |
| 829 | nmdc:mga0qj67_695609_c1 | 3300050509 | Bacteria | 809 |
| 830 | nmdc:mga06r32_144284_c1 | 3300050510 | Bacteria | 2358 |
| 831 | nmdc:mga06r32_1804616_c1 | 3300050510 | Bacteria | 547 |
| 832 | nmdc:mga06r32_200984_c1 | 3300050510 | Bacteria | 1981 |
| 833 | nmdc:mga06r32_213064_c1 | 3300050510 | Bacteria | 1920 |
| 834 | nmdc:mga06r32_344765_c1 | 3300050510 | Bacteria | 1474 |
| 835 | nmdc:mga06r32_41056_c1 | 3300050510 | Bacteria | 4394 |
| 836 | nmdc:mga06r32_811139_c1 | 3300050510 | Bacteria | 896 |
| 837 | nmdc:mga08y16_100735_c1 | 3300050511 | Bacteria | 3008 |
| 838 | nmdc:mga08y16_131646_c1 | 3300050511 | Bacteria | 2601 |
| 839 | nmdc:mga08y16_188039_c1 | 3300050511 | Bacteria | 2143 |
| 840 | nmdc:mga08y16_48362_c1 | 3300050511 | Bacteria | 4452 |
| 841 | nmdc:mga08y16_484157_c1 | 3300050511 | Bacteria | 1259 |
| 842 | nmdc:mga08y16_552806_c1 | 3300050511 | Bacteria | 1165 |
| 843 | nmdc:mga08y16_599224_c1 | 3300050511 | Bacteria | 1111 |
| 844 | nmdc:mga08y16_63695_c1 | 3300050511 | Bacteria | 3851 |
| 845 | nmdc:mga08y16_671179_c1 | 3300050511 | Bacteria | 1039 |
| 846 | nmdc:mga0n895_1797334_c1 | 3300050512 | Bacteria | 574 |
| 847 | nmdc:mga0n895_356505_c1 | 3300050512 | Bacteria | 1481 |
| 848 | nmdc:mga0n895_582_c1 | 3300050512 | Bacteria | 25135 |
| 849 | nmdc:mga0n895_649792_c1 | 3300050512 | Bacteria | 1054 |
| 850 | nmdc:mga0n895_999934_c1 | 3300050512 | Bacteria | 818 |
| 851 | nmdc:mga0rr50_132437_c1 | 3300050513 | Bacteria | 1998 |
| 852 | nmdc:mga0rr50_1494207_c1 | 3300050513 | Bacteria | 571 |
| 853 | nmdc:mga0rr50_19252_c1 | 3300050513 | Bacteria | 4603 |
| 854 | nmdc:mga0rr50_3282_c1 | 3300050513 | Bacteria | 9282 |
| 855 | nmdc:mga0rr50_536725_c1 | 3300050513 | Bacteria | 996 |
| 856 | nmdc:mga0rr50_5530_c2 | 3300050513 | Bacteria | 6785 |
| 857 | nmdc:mga0rr50_573443_c1 | 3300050513 | Bacteria | 961 |
| 858 | nmdc:mga0rr50_695280_c1 | 3300050513 | Bacteria | 868 |
| 859 | nmdc:mga0rr50_825899_c1 | 3300050513 | Bacteria | 791 |
| 860 | nmdc:mga08x19_1243641_c1 | 3300050514 | Bacteria | 528 |
| 861 | nmdc:mga08x19_1858_c1 | 3300050514 | Bacteria | 12938 |
| 862 | nmdc:mga08x19_40646_c1 | 3300050514 | Bacteria | 2960 |
| 863 | nmdc:mga08x19_530202_c1 | 3300050514 | Bacteria | 832 |
| 864 | nmdc:mga08x19_573139_c1 | 3300050514 | Bacteria | 799 |
| 865 | nmdc:mga08x19_74217_c1 | 3300050514 | Bacteria | 2222 |
| 866 | nmdc:mga08x19_91610_c1 | 3300050514 | Bacteria | 2007 |
| 867 | nmdc:mga08x19_98427_c1 | 3300050514 | Bacteria | 1938 |
| 868 | nmdc:mga0a205_1044103_c1 | 3300050515 | Bacteria | 664 |
| 869 | nmdc:mga0a205_1261800_c1 | 3300050515 | Bacteria | 587 |
| 870 | nmdc:mga0a205_1416772_c1 | 3300050515 | Bacteria | 543 |
| 871 | nmdc:mga0a205_18247_c1 | 3300050515 | Bacteria | 6592 |
| 872 | nmdc:mga0a205_252698_c1 | 3300050515 | Bacteria | 1642 |
| 873 | nmdc:mga0a205_34658_c1 | 3300050515 | Bacteria | 4844 |
| 874 | nmdc:mga0a205_357921_c1 | 3300050515 | Bacteria | 1326 |
| 875 | nmdc:mga0a205_740623_c1 | 3300050515 | Bacteria | 832 |
| 876 | Ga0495601_0102515 | 3300053077 | Bacteria | 1849 |
| 877 | Ga0495601_0349746 | 3300053077 | Bacteria | 961 |
| 878 | Ga0495595_0335685 | 3300053084 | Bacteria | 762 |
| 879 | Ga0495619_0621237 | 3300053085 | Bacteria | 738 |
| 880 | Ga0501084_0005924 | 3300054114 | Bacteria | 10067 |
| 881 | Ga0501084_0073589 | 3300054114 | Bacteria | 2861 |
| 882 | Ga0501084_0848067 | 3300054114 | Bacteria | 769 |
| 883 | Ga0501084_0982310 | 3300054114 | Bacteria | 710 |
| 884 | Ga0501084_1073356 | 3300054114 | Bacteria | 676 |
| 885 | Ga0590071_023052 | 3300059421 | Bacteria | 1470 |
| 886 | Ga0590077_063350 | 3300059426 | Bacteria | 840 |
| 887 | Ga0590077_082449 | 3300059426 | Bacteria | 741 |
| 888 | Ga0501082_0000430 | 3300060353 | Bacteria | 37227 |
| 889 | Ga0501082_0014186 | 3300060353 | Bacteria | 6858 |
| 890 | Ga0501082_0665818 | 3300060353 | Bacteria | 911 |
| 891 | Ga0501082_1827029 | 3300060353 | Bacteria | 530 |
| 892 | Ga0530510_0000186 | 3300061734 | Bacteria | 37940 |
| 893 | Ga0530510_0001727 | 3300061734 | Bacteria | 14851 |
| 894 | Ga0530510_0774213 | 3300061734 | Bacteria | 732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10266818 | Ga0307405_102668182 | 101 |
| 2 | 3300046459 | Ga0495629_0268868 | Ga0495629_0268868_103_414 | 103 |
| 3 | 3300046463 | Ga0495653_0303011 | Ga0495653_0303011_102_413 | 103 |
| 4 | 3300046477 | Ga0495664_0434049 | Ga0495664_0434049_195_506 | 103 |
| 5 | 3300046517 | Ga0495630_0526424 | Ga0495630_0526424_88_399 | 103 |
| 6 | 3300046529 | Ga0495652_0647059 | Ga0495652_0647059_40_351 | 103 |
| 7 | 3300046535 | Ga0495586_0016693 | Ga0495586_0016693_2977_3288 | 103 |
| 8 | 3300046536 | Ga0495587_0118678 | Ga0495587_0118678_216_527 | 103 |
| 9 | 3300046557 | Ga0495622_0019198 | Ga0495622_0019198_1734_2045 | 103 |
| 10 | 3300046660 | Ga0495625_0014493 | Ga0495625_0014493_70_381 | 103 |
| 11 | 3300046809 | Ga0495600_0351907 | Ga0495600_0351907_71_382 | 103 |
| 12 | 3300047315 | Ga0495581_0297970 | Ga0495581_0297970_505_816 | 103 |
| 13 | 3300047322 | Ga0495680_0349761 | Ga0495680_0349761_611_922 | 103 |
| 14 | 3300047444 | Ga0495675_0011335 | Ga0495675_0011335_2125_2436 | 103 |
| 15 | 3300047673 | Ga0495593_0008922 | Ga0495593_0008922_796_1107 | 103 |
| 16 | 3300048089 | Ga0495614_0382755 | Ga0495614_0382755_124_435 | 103 |
| 17 | 3300009176 | Ga0105242_11564528 | Ga0105242_115645282 | 105 |
| 18 | 3300049526 | Ga0501303_017067 | Ga0501303_017067_387_704 | 105 |
| 19 | 3300005331 | Ga0070670_100695653 | Ga0070670_1006956532 | 106 |
| 20 | 3300036401 | Ga0373937_0856988 | Ga0373937_0856988_330_677 | 106 |
| 21 | 3300046462 | Ga0495651_0242044 | Ga0495651_0242044_261_608 | 106 |
| 22 | 3300046529 | Ga0495652_0257177 | Ga0495652_0257177_913_1260 | 106 |
| 23 | 3300046536 | Ga0495587_0451617 | Ga0495587_0451617_124_471 | 106 |
| 24 | 3300005343 | Ga0070687_100357092 | Ga0070687_1003570923 | 109 |
| 25 | 3300005364 | Ga0070673_101614351 | Ga0070673_1016143511 | 109 |
| 26 | 3300006852 | Ga0075433_11223104 | Ga0075433_112231042 | 109 |
| 27 | 3300009094 | Ga0111539_10050653 | Ga0111539_100506537 | 109 |
| 28 | 3300025918 | Ga0207662_10274069 | Ga0207662_102740694 | 109 |
| 29 | 3300025960 | Ga0207651_11102964 | Ga0207651_111029642 | 109 |
| 30 | 3300027907 | Ga0207428_10404566 | Ga0207428_104045662 | 109 |
| 31 | 3300049589 | Ga0501073_1004475 | Ga0501073_1004475_98_427 | 109 |
| 32 | 3300049742 | Ga0501080_0104562 | Ga0501080_0104562_502_831 | 109 |
| 33 | 3300050511 | nmdc:mga08y16_671179_c1 | nmdc:mga08y16_671179_c1_490_837 | 109 |
| 34 | 3300050515 | nmdc:mga0a205_1044103_c1 | nmdc:mga0a205_1044103_c1_135_482 | 109 |
| 35 | 3300005293 | Ga0065715_11104991 | Ga0065715_111049911 | 110 |
| 36 | 3300005333 | Ga0070677_10637978 | Ga0070677_106379781 | 110 |
| 37 | 3300042876 | Ga0451577_0547198 | Ga0451577_0547198_689_1021 | 110 |
| 38 | 3300046539 | Ga0495621_0123251 | Ga0495621_0123251_661_993 | 110 |
| 39 | 3300049593 | Ga0501077_0773240 | Ga0501077_0773240_14_352 | 110 |
| 40 | 3300054114 | Ga0501084_0073589 | Ga0501084_0073589_14_352 | 110 |
| 41 | 3300005842 | Ga0068858_100387156 | Ga0068858_1003871563 | 112 |
| 42 | 3300026035 | Ga0207703_11784423 | Ga0207703_117844232 | 112 |
| 43 | 3300035092 | Ga0373952_0092566 | Ga0373952_0092566_149_487 | 112 |
| 44 | 3300049824 | Ga0501045_0251721 | Ga0501045_0251721_318_656 | 112 |
| 45 | 3300006051 | Ga0075364_10247712 | Ga0075364_102477123 | 113 |
| 46 | 3300006195 | Ga0075366_10008600 | Ga0075366_100086006 | 113 |
| 47 | 3300025885 | Ga0207653_10072326 | Ga0207653_100723264 | 113 |
| 48 | 3300050493 | nmdc:mga0k408_7255_c1 | nmdc:mga0k408_7255_c1_4646_4987 | 113 |
| 49 | 3300005295 | Ga0065707_10209799 | Ga0065707_102097992 | 115 |
| 50 | 3300005295 | Ga0065707_10267281 | Ga0065707_102672812 | 115 |
| 51 | 3300005295 | Ga0065707_10279404 | Ga0065707_102794042 | 115 |
| 52 | 3300005295 | Ga0065707_10313736 | Ga0065707_103137362 | 115 |
| 53 | 3300005295 | Ga0065707_10811619 | Ga0065707_108116192 | 115 |
| 54 | 3300005330 | Ga0070690_100346623 | Ga0070690_1003466234 | 115 |
| 55 | 3300005331 | Ga0070670_101242777 | Ga0070670_1012427771 | 115 |
| 56 | 3300005334 | Ga0068869_100776335 | Ga0068869_1007763351 | 115 |
| 57 | 3300005336 | Ga0070680_100057644 | Ga0070680_1000576444 | 115 |
| 58 | 3300005336 | Ga0070680_100144219 | Ga0070680_1001442194 | 115 |
| 59 | 3300005340 | Ga0070689_100222797 | Ga0070689_1002227974 | 115 |
| 60 | 3300005340 | Ga0070689_100345415 | Ga0070689_1003454154 | 115 |
| 61 | 3300005341 | Ga0070691_10226632 | Ga0070691_102266322 | 115 |
| 62 | 3300005341 | Ga0070691_10228333 | Ga0070691_102283332 | 115 |
| 63 | 3300005343 | Ga0070687_100318314 | Ga0070687_1003183142 | 115 |
| 64 | 3300005343 | Ga0070687_100554930 | Ga0070687_1005549302 | 115 |
| 65 | 3300005345 | Ga0070692_10004733 | Ga0070692_100047333 | 115 |
| 66 | 3300005345 | Ga0070692_10472927 | Ga0070692_104729271 | 115 |
| 67 | 3300005345 | Ga0070692_11153104 | Ga0070692_111531041 | 115 |
| 68 | 3300005347 | Ga0070668_100118907 | Ga0070668_1001189073 | 115 |
| 69 | 3300005353 | Ga0070669_100070052 | Ga0070669_1000700522 | 115 |
| 70 | 3300005353 | Ga0070669_100357508 | Ga0070669_1003575082 | 115 |
| 71 | 3300005354 | Ga0070675_100056290 | Ga0070675_1000562904 | 115 |
| 72 | 3300005355 | Ga0070671_101382208 | Ga0070671_1013822082 | 115 |
| 73 | 3300005356 | Ga0070674_100019780 | Ga0070674_1000197802 | 115 |
| 74 | 3300005356 | Ga0070674_100992213 | Ga0070674_1009922132 | 115 |
| 75 | 3300005356 | Ga0070674_101605794 | Ga0070674_1016057941 | 115 |
| 76 | 3300005364 | Ga0070673_101767120 | Ga0070673_1017671202 | 115 |
| 77 | 3300005406 | Ga0070703_10372515 | Ga0070703_103725152 | 115 |
| 78 | 3300005435 | Ga0070714_100185510 | Ga0070714_1001855104 | 115 |
| 79 | 3300005438 | Ga0070701_10020823 | Ga0070701_100208234 | 115 |
| 80 | 3300005440 | Ga0070705_100005488 | Ga0070705_1000054882 | 115 |
| 81 | 3300005440 | Ga0070705_100090996 | Ga0070705_1000909962 | 115 |
| 82 | 3300005440 | Ga0070705_100195727 | Ga0070705_1001957272 | 115 |
| 83 | 3300005440 | Ga0070705_100378924 | Ga0070705_1003789242 | 115 |
| 84 | 3300005440 | Ga0070705_100563316 | Ga0070705_1005633163 | 115 |
| 85 | 3300005440 | Ga0070705_101053381 | Ga0070705_1010533812 | 115 |
| 86 | 3300005441 | Ga0070700_100006936 | Ga0070700_1000069362 | 115 |
| 87 | 3300005441 | Ga0070700_100308089 | Ga0070700_1003080892 | 115 |
| 88 | 3300005441 | Ga0070700_100312331 | Ga0070700_1003123311 | 115 |
| 89 | 3300005441 | Ga0070700_100602125 | Ga0070700_1006021253 | 115 |
| 90 | 3300005441 | Ga0070700_101374856 | Ga0070700_1013748562 | 115 |
| 91 | 3300005441 | Ga0070700_101568565 | Ga0070700_1015685652 | 115 |
| 92 | 3300005444 | Ga0070694_100009317 | Ga0070694_1000093177 | 115 |
| 93 | 3300005444 | Ga0070694_100014517 | Ga0070694_1000145174 | 115 |
| 94 | 3300005444 | Ga0070694_100141175 | Ga0070694_1001411752 | 115 |
| 95 | 3300005444 | Ga0070694_100179831 | Ga0070694_1001798312 | 115 |
| 96 | 3300005444 | Ga0070694_100267604 | Ga0070694_1002676041 | 115 |
| 97 | 3300005444 | Ga0070694_100355163 | Ga0070694_1003551633 | 115 |
| 98 | 3300005444 | Ga0070694_100367647 | Ga0070694_1003676473 | 115 |
| 99 | 3300005444 | Ga0070694_100995358 | Ga0070694_1009953582 | 115 |
| 100 | 3300005445 | Ga0070708_101140782 | Ga0070708_1011407822 | 115 |
| 101 | 3300005445 | Ga0070708_101725016 | Ga0070708_1017250162 | 115 |
| 102 | 3300005456 | Ga0070678_100324300 | Ga0070678_1003243003 | 115 |
| 103 | 3300005458 | Ga0070681_10000198 | Ga0070681_1000019833 | 115 |
| 104 | 3300005459 | Ga0068867_100023523 | Ga0068867_1000235234 | 115 |
| 105 | 3300005459 | Ga0068867_101307236 | Ga0068867_1013072362 | 115 |
| 106 | 3300005466 | Ga0070685_11391110 | Ga0070685_113911102 | 115 |
| 107 | 3300005466 | Ga0070685_11471537 | Ga0070685_114715371 | 115 |
| 108 | 3300005467 | Ga0070706_100167580 | Ga0070706_1001675802 | 115 |
| 109 | 3300005468 | Ga0070707_100571189 | Ga0070707_1005711892 | 115 |
| 110 | 3300005468 | Ga0070707_100984659 | Ga0070707_1009846592 | 115 |
| 111 | 3300005471 | Ga0070698_100054920 | Ga0070698_1000549203 | 115 |
| 112 | 3300005471 | Ga0070698_101668378 | Ga0070698_1016683781 | 115 |
| 113 | 3300005518 | Ga0070699_100095806 | Ga0070699_1000958064 | 115 |
| 114 | 3300005518 | Ga0070699_100258097 | Ga0070699_1002580972 | 115 |
| 115 | 3300005518 | Ga0070699_100512930 | Ga0070699_1005129302 | 115 |
| 116 | 3300005530 | Ga0070679_100687178 | Ga0070679_1006871782 | 115 |
| 117 | 3300005530 | Ga0070679_101310155 | Ga0070679_1013101551 | 115 |
| 118 | 3300005530 | Ga0070679_102013320 | Ga0070679_1020133201 | 115 |
| 119 | 3300005536 | Ga0070697_100002931 | Ga0070697_10000293117 | 115 |
| 120 | 3300005536 | Ga0070697_100095073 | Ga0070697_1000950732 | 115 |
| 121 | 3300005536 | Ga0070697_101135835 | Ga0070697_1011358351 | 115 |
| 122 | 3300005536 | Ga0070697_101993232 | Ga0070697_1019932321 | 115 |
| 123 | 3300005543 | Ga0070672_100467010 | Ga0070672_1004670103 | 115 |
| 124 | 3300005544 | Ga0070686_100028921 | Ga0070686_1000289214 | 115 |
| 125 | 3300005544 | Ga0070686_100244972 | Ga0070686_1002449723 | 115 |
| 126 | 3300005544 | Ga0070686_100572972 | Ga0070686_1005729722 | 115 |
| 127 | 3300005544 | Ga0070686_100721495 | Ga0070686_1007214952 | 115 |
| 128 | 3300005544 | Ga0070686_101073141 | Ga0070686_1010731411 | 115 |
| 129 | 3300005544 | Ga0070686_101615787 | Ga0070686_1016157871 | 115 |
| 130 | 3300005545 | Ga0070695_100003592 | Ga0070695_1000035924 | 115 |
| 131 | 3300005545 | Ga0070695_100029321 | Ga0070695_1000293212 | 115 |
| 132 | 3300005545 | Ga0070695_100260639 | Ga0070695_1002606392 | 115 |
| 133 | 3300005545 | Ga0070695_100651696 | Ga0070695_1006516962 | 115 |
| 134 | 3300005545 | Ga0070695_100856214 | Ga0070695_1008562141 | 115 |
| 135 | 3300005545 | Ga0070695_101518489 | Ga0070695_1015184891 | 115 |
| 136 | 3300005546 | Ga0070696_100067694 | Ga0070696_1000676942 | 115 |
| 137 | 3300005546 | Ga0070696_100259271 | Ga0070696_1002592712 | 115 |
| 138 | 3300005546 | Ga0070696_100395783 | Ga0070696_1003957831 | 115 |
| 139 | 3300005546 | Ga0070696_100408338 | Ga0070696_1004083382 | 115 |
| 140 | 3300005546 | Ga0070696_100579076 | Ga0070696_1005790761 | 115 |
| 141 | 3300005549 | Ga0070704_100046477 | Ga0070704_1000464774 | 115 |
| 142 | 3300005549 | Ga0070704_100060605 | Ga0070704_1000606052 | 115 |
| 143 | 3300005549 | Ga0070704_100100059 | Ga0070704_1001000593 | 115 |
| 144 | 3300005549 | Ga0070704_100110016 | Ga0070704_1001100162 | 115 |
| 145 | 3300005577 | Ga0068857_100535415 | Ga0068857_1005354152 | 115 |
| 146 | 3300005614 | Ga0068856_101171182 | Ga0068856_1011711822 | 115 |
| 147 | 3300005615 | Ga0070702_100230352 | Ga0070702_1002303522 | 115 |
| 148 | 3300005617 | Ga0068859_100019288 | Ga0068859_1000192886 | 115 |
| 149 | 3300005617 | Ga0068859_100028423 | Ga0068859_1000284234 | 115 |
| 150 | 3300005617 | Ga0068859_101038106 | Ga0068859_1010381063 | 115 |
| 151 | 3300005617 | Ga0068859_101151732 | Ga0068859_1011517323 | 115 |
| 152 | 3300005617 | Ga0068859_101809460 | Ga0068859_1018094602 | 115 |
| 153 | 3300005718 | Ga0068866_10452638 | Ga0068866_104526382 | 115 |
| 154 | 3300005719 | Ga0068861_100021205 | Ga0068861_1000212054 | 115 |
| 155 | 3300005719 | Ga0068861_100704402 | Ga0068861_1007044022 | 115 |
| 156 | 3300005719 | Ga0068861_101058305 | Ga0068861_1010583052 | 115 |
| 157 | 3300005840 | Ga0068870_10793039 | Ga0068870_107930391 | 115 |
| 158 | 3300005840 | Ga0068870_11174522 | Ga0068870_111745222 | 115 |
| 159 | 3300005841 | Ga0068863_100759325 | Ga0068863_1007593252 | 115 |
| 160 | 3300005843 | Ga0068860_101534762 | Ga0068860_1015347621 | 115 |
| 161 | 3300005844 | Ga0068862_100032132 | Ga0068862_1000321324 | 115 |
| 162 | 3300005844 | Ga0068862_100149773 | Ga0068862_1001497732 | 115 |
| 163 | 3300005844 | Ga0068862_100278266 | Ga0068862_1002782662 | 115 |
| 164 | 3300005844 | Ga0068862_100600397 | Ga0068862_1006003972 | 115 |
| 165 | 3300005981 | Ga0081538_10160025 | Ga0081538_101600252 | 115 |
| 166 | 3300005985 | Ga0081539_10000842 | Ga0081539_1000084249 | 115 |
| 167 | 3300006051 | Ga0075364_10729198 | Ga0075364_107291982 | 115 |
| 168 | 3300006163 | Ga0070715_10538208 | Ga0070715_105382082 | 115 |
| 169 | 3300006173 | Ga0070716_100894593 | Ga0070716_1008945932 | 115 |
| 170 | 3300006175 | Ga0070712_101175719 | Ga0070712_1011757191 | 115 |
| 171 | 3300006237 | Ga0097621_100570193 | Ga0097621_1005701932 | 115 |
| 172 | 3300006844 | Ga0075428_100060247 | Ga0075428_1000602475 | 115 |
| 173 | 3300006844 | Ga0075428_100251107 | Ga0075428_1002511072 | 115 |
| 174 | 3300006846 | Ga0075430_100049636 | Ga0075430_1000496365 | 115 |
| 175 | 3300006846 | Ga0075430_100742838 | Ga0075430_1007428382 | 115 |
| 176 | 3300006847 | Ga0075431_100013334 | Ga0075431_10001333410 | 115 |
| 177 | 3300006847 | Ga0075431_100146517 | Ga0075431_1001465172 | 115 |
| 178 | 3300006847 | Ga0075431_100351111 | Ga0075431_1003511112 | 115 |
| 179 | 3300006847 | Ga0075431_100700496 | Ga0075431_1007004962 | 115 |
| 180 | 3300006847 | Ga0075431_100832103 | Ga0075431_1008321032 | 115 |
| 181 | 3300006847 | Ga0075431_102108306 | Ga0075431_1021083062 | 115 |
| 182 | 3300006852 | Ga0075433_10042272 | Ga0075433_100422725 | 115 |
| 183 | 3300006871 | Ga0075434_100000073 | Ga0075434_10000007329 | 115 |
| 184 | 3300006871 | Ga0075434_100019885 | Ga0075434_1000198856 | 115 |
| 185 | 3300006871 | Ga0075434_100485931 | Ga0075434_1004859313 | 115 |
| 186 | 3300006871 | Ga0075434_102139299 | Ga0075434_1021392992 | 115 |
| 187 | 3300006880 | Ga0075429_100000080 | Ga0075429_10000008037 | 115 |
| 188 | 3300006880 | Ga0075429_100168323 | Ga0075429_1001683232 | 115 |
| 189 | 3300006880 | Ga0075429_100678858 | Ga0075429_1006788581 | 115 |
| 190 | 3300006880 | Ga0075429_100737243 | Ga0075429_1007372431 | 115 |
| 191 | 3300006880 | Ga0075429_100822042 | Ga0075429_1008220423 | 115 |
| 192 | 3300006880 | Ga0075429_101138282 | Ga0075429_1011382822 | 115 |
| 193 | 3300006881 | Ga0068865_100029927 | Ga0068865_1000299272 | 115 |
| 194 | 3300006881 | Ga0068865_100811787 | Ga0068865_1008117872 | 115 |
| 195 | 3300006914 | Ga0075436_100000205 | Ga0075436_10000020513 | 115 |
| 196 | 3300006914 | Ga0075436_100038706 | Ga0075436_1000387062 | 115 |
| 197 | 3300006914 | Ga0075436_100058404 | Ga0075436_1000584042 | 115 |
| 198 | 3300006914 | Ga0075436_100498424 | Ga0075436_1004984242 | 115 |
| 199 | 3300006914 | Ga0075436_100515462 | Ga0075436_1005154621 | 115 |
| 200 | 3300006914 | Ga0075436_100558744 | Ga0075436_1005587442 | 115 |
| 201 | 3300006931 | Ga0097620_100019288 | Ga0097620_1000192886 | 115 |
| 202 | 3300006931 | Ga0097620_100028423 | Ga0097620_1000284236 | 115 |
| 203 | 3300006931 | Ga0097620_101038090 | Ga0097620_1010380903 | 115 |
| 204 | 3300006931 | Ga0097620_101151728 | Ga0097620_1011517283 | 115 |
| 205 | 3300006931 | Ga0097620_101809470 | Ga0097620_1018094701 | 115 |
| 206 | 3300007076 | Ga0075435_100006291 | Ga0075435_1000062915 | 115 |
| 207 | 3300007076 | Ga0075435_100140284 | Ga0075435_1001402845 | 115 |
| 208 | 3300007076 | Ga0075435_100328058 | Ga0075435_1003280582 | 115 |
| 209 | 3300007076 | Ga0075435_101752918 | Ga0075435_1017529181 | 115 |
| 210 | 3300009094 | Ga0111539_10065584 | Ga0111539_100655846 | 115 |
| 211 | 3300009094 | Ga0111539_10131269 | Ga0111539_101312692 | 115 |
| 212 | 3300009094 | Ga0111539_10168418 | Ga0111539_101684182 | 115 |
| 213 | 3300009094 | Ga0111539_10551503 | Ga0111539_105515032 | 115 |
| 214 | 3300009094 | Ga0111539_11095879 | Ga0111539_110958792 | 115 |
| 215 | 3300009094 | Ga0111539_11967183 | Ga0111539_119671831 | 115 |
| 216 | 3300009094 | Ga0111539_13348128 | Ga0111539_133481282 | 115 |
| 217 | 3300009098 | Ga0105245_12959604 | Ga0105245_129596042 | 115 |
| 218 | 3300009147 | Ga0114129_10032898 | Ga0114129_100328985 | 115 |
| 219 | 3300009147 | Ga0114129_10373021 | Ga0114129_103730212 | 115 |
| 220 | 3300009147 | Ga0114129_10515058 | Ga0114129_105150582 | 115 |
| 221 | 3300009147 | Ga0114129_10999632 | Ga0114129_109996322 | 115 |
| 222 | 3300009147 | Ga0114129_11630562 | Ga0114129_116305622 | 115 |
| 223 | 3300009148 | Ga0105243_10045531 | Ga0105243_100455312 | 115 |
| 224 | 3300009148 | Ga0105243_12071974 | Ga0105243_120719742 | 115 |
| 225 | 3300009148 | Ga0105243_12402752 | Ga0105243_124027521 | 115 |
| 226 | 3300009176 | Ga0105242_10209160 | Ga0105242_102091602 | 115 |
| 227 | 3300009553 | Ga0105249_10377074 | Ga0105249_103770742 | 115 |
| 228 | 3300009553 | Ga0105249_12816224 | Ga0105249_128162241 | 115 |
| 229 | 3300009553 | Ga0105249_13480936 | Ga0105249_134809361 | 115 |
| 230 | 3300013297 | Ga0157378_11059085 | Ga0157378_110590852 | 115 |
| 231 | 3300013297 | Ga0157378_12059457 | Ga0157378_120594572 | 115 |
| 232 | 3300014326 | Ga0157380_10011328 | Ga0157380_100113283 | 115 |
| 233 | 3300014326 | Ga0157380_12109104 | Ga0157380_121091042 | 115 |
| 234 | 3300014745 | Ga0157377_10426969 | Ga0157377_104269692 | 115 |
| 235 | 3300025899 | Ga0207642_10124344 | Ga0207642_101243442 | 115 |
| 236 | 3300025901 | Ga0207688_10325951 | Ga0207688_103259513 | 115 |
| 237 | 3300025907 | Ga0207645_10053737 | Ga0207645_100537373 | 115 |
| 238 | 3300025908 | Ga0207643_10103236 | Ga0207643_101032362 | 115 |
| 239 | 3300025910 | Ga0207684_10398182 | Ga0207684_103981822 | 115 |
| 240 | 3300025910 | Ga0207684_10736824 | Ga0207684_107368242 | 115 |
| 241 | 3300025912 | Ga0207707_10003333 | Ga0207707_1000333314 | 115 |
| 242 | 3300025916 | Ga0207663_10655419 | Ga0207663_106554192 | 115 |
| 243 | 3300025917 | Ga0207660_10020821 | Ga0207660_100208214 | 115 |
| 244 | 3300025917 | Ga0207660_10655257 | Ga0207660_106552572 | 115 |
| 245 | 3300025918 | Ga0207662_10064715 | Ga0207662_100647154 | 115 |
| 246 | 3300025918 | Ga0207662_10070983 | Ga0207662_100709832 | 115 |
| 247 | 3300025921 | Ga0207652_10030844 | Ga0207652_100308442 | 115 |
| 248 | 3300025922 | Ga0207646_10427740 | Ga0207646_104277402 | 115 |
| 249 | 3300025923 | Ga0207681_10006318 | Ga0207681_100063188 | 115 |
| 250 | 3300025923 | Ga0207681_11729119 | Ga0207681_117291192 | 115 |
| 251 | 3300025926 | Ga0207659_10062589 | Ga0207659_100625892 | 115 |
| 252 | 3300025933 | Ga0207706_10766185 | Ga0207706_107661853 | 115 |
| 253 | 3300025934 | Ga0207686_10557776 | Ga0207686_105577762 | 115 |
| 254 | 3300025935 | Ga0207709_10007609 | Ga0207709_100076096 | 115 |
| 255 | 3300025936 | Ga0207670_10418035 | Ga0207670_104180354 | 115 |
| 256 | 3300025936 | Ga0207670_10752244 | Ga0207670_107522442 | 115 |
| 257 | 3300025937 | Ga0207669_10003349 | Ga0207669_100033498 | 115 |
| 258 | 3300025937 | Ga0207669_10811645 | Ga0207669_108116452 | 115 |
| 259 | 3300025938 | Ga0207704_10007398 | Ga0207704_100073985 | 115 |
| 260 | 3300025938 | Ga0207704_10180508 | Ga0207704_101805083 | 115 |
| 261 | 3300025939 | Ga0207665_10327019 | Ga0207665_103270192 | 115 |
| 262 | 3300025939 | Ga0207665_10880138 | Ga0207665_108801382 | 115 |
| 263 | 3300025940 | Ga0207691_10119742 | Ga0207691_101197422 | 115 |
| 264 | 3300025942 | Ga0207689_10371845 | Ga0207689_103718452 | 115 |
| 265 | 3300025942 | Ga0207689_10435302 | Ga0207689_104353023 | 115 |
| 266 | 3300025942 | Ga0207689_11464904 | Ga0207689_114649042 | 115 |
| 267 | 3300025960 | Ga0207651_11016019 | Ga0207651_110160192 | 115 |
| 268 | 3300025961 | Ga0207712_10225900 | Ga0207712_102259003 | 115 |
| 269 | 3300025972 | Ga0207668_10037290 | Ga0207668_100372904 | 115 |
| 270 | 3300026023 | Ga0207677_10653886 | Ga0207677_106538862 | 115 |
| 271 | 3300026075 | Ga0207708_10006009 | Ga0207708_100060098 | 115 |
| 272 | 3300026075 | Ga0207708_10036334 | Ga0207708_100363342 | 115 |
| 273 | 3300026075 | Ga0207708_10246018 | Ga0207708_102460183 | 115 |
| 274 | 3300026075 | Ga0207708_11269594 | Ga0207708_112695942 | 115 |
| 275 | 3300026078 | Ga0207702_10897698 | Ga0207702_108976982 | 115 |
| 276 | 3300026089 | Ga0207648_10002987 | Ga0207648_100029876 | 115 |
| 277 | 3300026089 | Ga0207648_11293123 | Ga0207648_112931231 | 115 |
| 278 | 3300026095 | Ga0207676_11565246 | Ga0207676_115652462 | 115 |
| 279 | 3300026116 | Ga0207674_10174419 | Ga0207674_101744191 | 115 |
| 280 | 3300026116 | Ga0207674_10462949 | Ga0207674_104629493 | 115 |
| 281 | 3300026118 | Ga0207675_100000651 | Ga0207675_1000006517 | 115 |
| 282 | 3300026118 | Ga0207675_100638682 | Ga0207675_1006386822 | 115 |
| 283 | 3300026118 | Ga0207675_100861044 | Ga0207675_1008610443 | 115 |
| 284 | 3300026118 | Ga0207675_101248408 | Ga0207675_1012484082 | 115 |
| 285 | 3300026121 | Ga0207683_10091937 | Ga0207683_100919371 | 115 |
| 286 | 3300027360 | Ga0209969_1028833 | Ga0209969_10288332 | 115 |
| 287 | 3300027364 | Ga0209967_1005806 | Ga0209967_10058063 | 115 |
| 288 | 3300027364 | Ga0209967_1006851 | Ga0209967_10068514 | 115 |
| 289 | 3300027364 | Ga0209967_1007443 | Ga0209967_10074432 | 115 |
| 290 | 3300027378 | Ga0209981_1009968 | Ga0209981_10099682 | 115 |
| 291 | 3300027378 | Ga0209981_1037131 | Ga0209981_10371311 | 115 |
| 292 | 3300027395 | Ga0209996_1022515 | Ga0209996_10225152 | 115 |
| 293 | 3300027395 | Ga0209996_1042690 | Ga0209996_10426901 | 115 |
| 294 | 3300027462 | Ga0210000_1005614 | Ga0210000_10056142 | 115 |
| 295 | 3300027462 | Ga0210000_1009349 | Ga0210000_10093493 | 115 |
| 296 | 3300027462 | Ga0210000_1016142 | Ga0210000_10161423 | 115 |
| 297 | 3300027471 | Ga0209995_1010851 | Ga0209995_10108514 | 115 |
| 298 | 3300027471 | Ga0209995_1012130 | Ga0209995_10121303 | 115 |
| 299 | 3300027526 | Ga0209968_1007653 | Ga0209968_10076533 | 115 |
| 300 | 3300027543 | Ga0209999_1004248 | Ga0209999_10042485 | 115 |
| 301 | 3300027543 | Ga0209999_1031217 | Ga0209999_10312172 | 115 |
| 302 | 3300027543 | Ga0209999_1083453 | Ga0209999_10834532 | 115 |
| 303 | 3300027552 | Ga0209982_1049402 | Ga0209982_10494022 | 115 |
| 304 | 3300027614 | Ga0209970_1041651 | Ga0209970_10416512 | 115 |
| 305 | 3300027614 | Ga0209970_1099545 | Ga0209970_10995452 | 115 |
| 306 | 3300027665 | Ga0209983_1136672 | Ga0209983_11366722 | 115 |
| 307 | 3300027665 | Ga0209983_1161936 | Ga0209983_11619362 | 115 |
| 308 | 3300027682 | Ga0209971_1006528 | Ga0209971_10065282 | 115 |
| 309 | 3300027682 | Ga0209971_1105422 | Ga0209971_11054222 | 115 |
| 310 | 3300027695 | Ga0209966_1023390 | Ga0209966_10233902 | 115 |
| 311 | 3300027695 | Ga0209966_1042642 | Ga0209966_10426422 | 115 |
| 312 | 3300027876 | Ga0209974_10011132 | Ga0209974_100111324 | 115 |
| 313 | 3300027876 | Ga0209974_10138771 | Ga0209974_101387712 | 115 |
| 314 | 3300027907 | Ga0207428_10019374 | Ga0207428_100193745 | 115 |
| 315 | 3300027907 | Ga0207428_10286072 | Ga0207428_102860722 | 115 |
| 316 | 3300027907 | Ga0207428_10322863 | Ga0207428_103228632 | 115 |
| 317 | 3300028380 | Ga0268265_10000781 | Ga0268265_1000078122 | 115 |
| 318 | 3300028380 | Ga0268265_10172111 | Ga0268265_101721112 | 115 |
| 319 | 3300028380 | Ga0268265_10539870 | Ga0268265_105398702 | 115 |
| 320 | 3300028380 | Ga0268265_11132614 | Ga0268265_111326142 | 115 |
| 321 | 3300028380 | Ga0268265_12016389 | Ga0268265_120163891 | 115 |
| 322 | 3300028381 | Ga0268264_10358617 | Ga0268264_103586172 | 115 |
| 323 | 3300031548 | Ga0307408_100217170 | Ga0307408_1002171704 | 115 |
| 324 | 3300031548 | Ga0307408_100328650 | Ga0307408_1003286503 | 115 |
| 325 | 3300031548 | Ga0307408_100397344 | Ga0307408_1003973442 | 115 |
| 326 | 3300031548 | Ga0307408_100483338 | Ga0307408_1004833383 | 115 |
| 327 | 3300031548 | Ga0307408_100499765 | Ga0307408_1004997652 | 115 |
| 328 | 3300031548 | Ga0307408_100558767 | Ga0307408_1005587673 | 115 |
| 329 | 3300031548 | Ga0307408_100961731 | Ga0307408_1009617313 | 115 |
| 330 | 3300031731 | Ga0307405_10471668 | Ga0307405_104716683 | 115 |
| 331 | 3300031852 | Ga0307410_12032337 | Ga0307410_120323371 | 115 |
| 332 | 3300031901 | Ga0307406_10254138 | Ga0307406_102541382 | 115 |
| 333 | 3300031901 | Ga0307406_10660434 | Ga0307406_106604342 | 115 |
| 334 | 3300031903 | Ga0307407_10210867 | Ga0307407_102108672 | 115 |
| 335 | 3300031911 | Ga0307412_10408092 | Ga0307412_104080921 | 115 |
| 336 | 3300031911 | Ga0307412_10843877 | Ga0307412_108438772 | 115 |
| 337 | 3300031995 | Ga0307409_100169468 | Ga0307409_1001694682 | 115 |
| 338 | 3300031995 | Ga0307409_100466699 | Ga0307409_1004666993 | 115 |
| 339 | 3300032002 | Ga0307416_100143175 | Ga0307416_1001431753 | 115 |
| 340 | 3300032002 | Ga0307416_100191358 | Ga0307416_1001913582 | 115 |
| 341 | 3300032002 | Ga0307416_100323996 | Ga0307416_1003239962 | 115 |
| 342 | 3300032002 | Ga0307416_100359490 | Ga0307416_1003594904 | 115 |
| 343 | 3300032002 | Ga0307416_100689954 | Ga0307416_1006899542 | 115 |
| 344 | 3300032002 | Ga0307416_101345812 | Ga0307416_1013458121 | 115 |
| 345 | 3300032005 | Ga0307411_10022035 | Ga0307411_100220353 | 115 |
| 346 | 3300032005 | Ga0307411_10151900 | Ga0307411_101519004 | 115 |
| 347 | 3300034816 | Ga0373930_0160800 | Ga0373930_0160800_93_440 | 115 |
| 348 | 3300034957 | Ga0373938_0126471 | Ga0373938_0126471_140_487 | 115 |
| 349 | 3300035086 | Ga0373934_0251967 | Ga0373934_0251967_78_425 | 115 |
| 350 | 3300035114 | Ga0373939_0044852 | Ga0373939_0044852_97_444 | 115 |
| 351 | 3300035207 | Ga0373942_0183233 | Ga0373942_0183233_68_415 | 115 |
| 352 | 3300035410 | Ga0373924_0108202 | Ga0373924_0108202_77_424 | 115 |
| 353 | 3300035691 | Ga0373931_0128940 | Ga0373931_0128940_796_1143 | 115 |
| 354 | 3300035692 | Ga0373935_0010817 | Ga0373935_0010817_1321_1668 | 115 |
| 355 | 3300035695 | Ga0373927_0038778 | Ga0373927_0038778_818_1165 | 115 |
| 356 | 3300036401 | Ga0373937_0115160 | Ga0373937_0115160_1189_1536 | 115 |
| 357 | 3300036401 | Ga0373937_0226652 | Ga0373937_0226652_1081_1428 | 115 |
| 358 | 3300036401 | Ga0373937_0340309 | Ga0373937_0340309_98_445 | 115 |
| 359 | 3300036401 | Ga0373937_0570520 | Ga0373937_0570520_169_516 | 115 |
| 360 | 3300036401 | Ga0373937_1364362 | Ga0373937_1364362_291_638 | 115 |
| 361 | 3300037068 | Ga0373925_0007563 | Ga0373925_0007563_4572_4919 | 115 |
| 362 | 3300041404 | Ga0439436_0149396 | Ga0439436_0149396_207_554 | 115 |
| 363 | 3300041406 | Ga0439439_0021515 | Ga0439439_0021515_655_1002 | 115 |
| 364 | 3300041408 | Ga0439453_0033996 | Ga0439453_0033996_564_911 | 115 |
| 365 | 3300041410 | Ga0439461_0002899 | Ga0439461_0002899_1713_2060 | 115 |
| 366 | 3300041460 | Ga0451802_0411675 | Ga0451802_0411675_37_384 | 115 |
| 367 | 3300041486 | Ga0451807_0142877 | Ga0451807_0142877_552_899 | 115 |
| 368 | 3300041486 | Ga0451807_1785507 | Ga0451807_1785507_28_375 | 115 |
| 369 | 3300041501 | Ga0451845_0620846 | Ga0451845_0620846_31_378 | 115 |
| 370 | 3300042001 | Ga0439441_000488 | Ga0439441_000488_836_1189 | 115 |
| 371 | 3300042001 | Ga0439441_029634 | Ga0439441_029634_585_932 | 115 |
| 372 | 3300042001 | Ga0439441_045240 | Ga0439441_045240_65_412 | 115 |
| 373 | 3300042001 | Ga0439441_081579 | Ga0439441_081579_170_517 | 115 |
| 374 | 3300042001 | Ga0439441_147161 | Ga0439441_147161_86_436 | 115 |
| 375 | 3300042003 | Ga0439443_036387 | Ga0439443_036387_412_765 | 115 |
| 376 | 3300042009 | Ga0439451_031250 | Ga0439451_031250_224_577 | 115 |
| 377 | 3300042015 | Ga0439462_0012540 | Ga0439462_0012540_97_444 | 115 |
| 378 | 3300042125 | Ga0450923_114106 | Ga0450923_114106_65_412 | 115 |
| 379 | 3300042156 | Ga0439446_0004777 | Ga0439446_0004777_2964_3311 | 115 |
| 380 | 3300042156 | Ga0439446_0111205 | Ga0439446_0111205_44_391 | 115 |
| 381 | 3300042435 | Ga0439434_0000076 | Ga0439434_0000076_3204_3551 | 115 |
| 382 | 3300042435 | Ga0439434_0103290 | Ga0439434_0103290_312_659 | 115 |
| 383 | 3300042436 | Ga0439435_0001056 | Ga0439435_0001056_3108_3455 | 115 |
| 384 | 3300042436 | Ga0439435_0098919 | Ga0439435_0098919_505_858 | 115 |
| 385 | 3300042437 | Ga0439444_0021720 | Ga0439444_0021720_110_457 | 115 |
| 386 | 3300044673 | Ga0453683_0536007 | Ga0453683_0536007_164_511 | 115 |
| 387 | 3300044683 | Ga0466965_0132417 | Ga0466965_0132417_858_1205 | 115 |
| 388 | 3300045051 | Ga0451576_0017229 | Ga0451576_0017229_4737_5084 | 115 |
| 389 | 3300045051 | Ga0451576_0045166 | Ga0451576_0045166_3139_3486 | 115 |
| 390 | 3300045051 | Ga0451576_0214293 | Ga0451576_0214293_1191_1538 | 115 |
| 391 | 3300045051 | Ga0451576_1310889 | Ga0451576_1310889_284_631 | 115 |
| 392 | 3300045051 | Ga0451576_2176584 | Ga0451576_2176584_158_505 | 115 |
| 393 | 3300045836 | Ga0466958_0467474 | Ga0466958_0467474_189_536 | 115 |
| 394 | 3300045976 | Ga0466967_0113879 | Ga0466967_0113879_1045_1392 | 115 |
| 395 | 3300046454 | Ga0495592_0001592 | Ga0495592_0001592_6332_6679 | 115 |
| 396 | 3300046459 | Ga0495629_1087947 | Ga0495629_1087947_55_402 | 115 |
| 397 | 3300046462 | Ga0495651_0980578 | Ga0495651_0980578_155_502 | 115 |
| 398 | 3300046463 | Ga0495653_0047055 | Ga0495653_0047055_1868_2215 | 115 |
| 399 | 3300046473 | Ga0495582_0088203 | Ga0495582_0088203_598_945 | 115 |
| 400 | 3300046475 | Ga0495639_0422330 | Ga0495639_0422330_231_578 | 115 |
| 401 | 3300046476 | Ga0495662_0030769 | Ga0495662_0030769_1236_1583 | 115 |
| 402 | 3300046476 | Ga0495662_0043033 | Ga0495662_0043033_1074_1421 | 115 |
| 403 | 3300046477 | Ga0495664_0310021 | Ga0495664_0310021_554_901 | 115 |
| 404 | 3300046511 | Ga0495608_0007794 | Ga0495608_0007794_3328_3675 | 115 |
| 405 | 3300046514 | Ga0495618_0140076 | Ga0495618_0140076_535_882 | 115 |
| 406 | 3300046516 | Ga0495628_0003126 | Ga0495628_0003126_3066_3413 | 115 |
| 407 | 3300046516 | Ga0495628_0252617 | Ga0495628_0252617_571_918 | 115 |
| 408 | 3300046517 | Ga0495630_0073248 | Ga0495630_0073248_74_421 | 115 |
| 409 | 3300046517 | Ga0495630_0618846 | Ga0495630_0618846_62_409 | 115 |
| 410 | 3300046526 | Ga0495666_0025168 | Ga0495666_0025168_1831_2178 | 115 |
| 411 | 3300046529 | Ga0495652_0440638 | Ga0495652_0440638_114_461 | 115 |
| 412 | 3300046533 | Ga0495640_0009959 | Ga0495640_0009959_3771_4118 | 115 |
| 413 | 3300046533 | Ga0495640_0065335 | Ga0495640_0065335_1722_2069 | 115 |
| 414 | 3300046535 | Ga0495586_0055967 | Ga0495586_0055967_15_362 | 115 |
| 415 | 3300046536 | Ga0495587_0109857 | Ga0495587_0109857_154_501 | 115 |
| 416 | 3300046537 | Ga0495598_0052961 | Ga0495598_0052961_157_504 | 115 |
| 417 | 3300046539 | Ga0495621_0111561 | Ga0495621_0111561_178_525 | 115 |
| 418 | 3300046559 | Ga0495667_0013563 | Ga0495667_0013563_3877_4224 | 115 |
| 419 | 3300046642 | Ga0495634_0020851 | Ga0495634_0020851_2966_3313 | 115 |
| 420 | 3300046663 | Ga0495635_0117809 | Ga0495635_0117809_773_1120 | 115 |
| 421 | 3300046678 | Ga0495599_0022373 | Ga0495599_0022373_2277_2624 | 115 |
| 422 | 3300046681 | Ga0495647_0087604 | Ga0495647_0087604_614_961 | 115 |
| 423 | 3300046683 | Ga0495658_0292223 | Ga0495658_0292223_241_588 | 115 |
| 424 | 3300046684 | Ga0495669_0334554 | Ga0495669_0334554_214_561 | 115 |
| 425 | 3300046689 | Ga0495613_0047127 | Ga0495613_0047127_1879_2226 | 115 |
| 426 | 3300046690 | Ga0495624_0065340 | Ga0495624_0065340_552_899 | 115 |
| 427 | 3300047315 | Ga0495581_0243478 | Ga0495581_0243478_457_804 | 115 |
| 428 | 3300047315 | Ga0495581_0835619 | Ga0495581_0835619_105_452 | 115 |
| 429 | 3300047317 | Ga0495604_0008726 | Ga0495604_0008726_4129_4476 | 115 |
| 430 | 3300047318 | Ga0495636_0012828 | Ga0495636_0012828_395_742 | 115 |
| 431 | 3300047318 | Ga0495636_0421976 | Ga0495636_0421976_226_573 | 115 |
| 432 | 3300047318 | Ga0495636_0627829 | Ga0495636_0627829_136_483 | 115 |
| 433 | 3300047319 | Ga0495674_0532266 | Ga0495674_0532266_428_775 | 115 |
| 434 | 3300047322 | Ga0495680_0001252 | Ga0495680_0001252_11638_11985 | 115 |
| 435 | 3300047673 | Ga0495593_0186440 | Ga0495593_0186440_587_934 | 115 |
| 436 | 3300048088 | Ga0495602_1137740 | Ga0495602_1137740_30_377 | 115 |
| 437 | 3300049514 | Ga0501291_053309 | Ga0501291_053309_219_566 | 115 |
| 438 | 3300049521 | Ga0501298_040277 | Ga0501298_040277_282_629 | 115 |
| 439 | 3300049522 | Ga0501299_113300 | Ga0501299_113300_240_587 | 115 |
| 440 | 3300049526 | Ga0501303_047458 | Ga0501303_047458_72_419 | 115 |
| 441 | 3300049568 | Ga0501031_0059330 | Ga0501031_0059330_732_1079 | 115 |
| 442 | 3300049569 | Ga0501032_0086786 | Ga0501032_0086786_568_915 | 115 |
| 443 | 3300049570 | Ga0501033_0011373 | Ga0501033_0011373_1257_1604 | 115 |
| 444 | 3300049570 | Ga0501033_0264915 | Ga0501033_0264915_11_358 | 115 |
| 445 | 3300049572 | Ga0501036_0001921 | Ga0501036_0001921_10479_10826 | 115 |
| 446 | 3300049572 | Ga0501036_0085385 | Ga0501036_0085385_1855_2208 | 115 |
| 447 | 3300049572 | Ga0501036_0547806 | Ga0501036_0547806_117_464 | 115 |
| 448 | 3300049573 | Ga0501037_0013201 | Ga0501037_0013201_4532_4879 | 115 |
| 449 | 3300049574 | Ga0501038_0004982 | Ga0501038_0004982_4033_4380 | 115 |
| 450 | 3300049574 | Ga0501038_0923941 | Ga0501038_0923941_94_441 | 115 |
| 451 | 3300049575 | Ga0501039_0000477 | Ga0501039_0000477_18893_19240 | 115 |
| 452 | 3300049575 | Ga0501039_0024671 | Ga0501039_0024671_3880_4233 | 115 |
| 453 | 3300049575 | Ga0501039_0027089 | Ga0501039_0027089_522_869 | 115 |
| 454 | 3300049575 | Ga0501039_0033414 | Ga0501039_0033414_1102_1455 | 115 |
| 455 | 3300049576 | Ga0501040_0000052 | Ga0501040_0000052_27039_27386 | 115 |
| 456 | 3300049576 | Ga0501040_0005360 | Ga0501040_0005360_7817_8170 | 115 |
| 457 | 3300049576 | Ga0501040_0113809 | Ga0501040_0113809_336_683 | 115 |
| 458 | 3300049577 | Ga0501041_0000038 | Ga0501041_0000038_27269_27616 | 115 |
| 459 | 3300049577 | Ga0501041_0015649 | Ga0501041_0015649_3656_4003 | 115 |
| 460 | 3300049577 | Ga0501041_0240071 | Ga0501041_0240071_318_671 | 115 |
| 461 | 3300049577 | Ga0501041_0430517 | Ga0501041_0430517_338_685 | 115 |
| 462 | 3300049578 | Ga0501042_0000048 | Ga0501042_0000048_22703_23050 | 115 |
| 463 | 3300049578 | Ga0501042_0111133 | Ga0501042_0111133_532_879 | 115 |
| 464 | 3300049579 | Ga0501043_0043047 | Ga0501043_0043047_1122_1469 | 115 |
| 465 | 3300049579 | Ga0501043_0630625 | Ga0501043_0630625_414_767 | 115 |
| 466 | 3300049580 | Ga0501046_0000271 | Ga0501046_0000271_25629_25976 | 115 |
| 467 | 3300049580 | Ga0501046_0012984 | Ga0501046_0012984_4853_5206 | 115 |
| 468 | 3300049580 | Ga0501046_1170956 | Ga0501046_1170956_23_370 | 115 |
| 469 | 3300049581 | Ga0501047_0136139 | Ga0501047_0136139_799_1146 | 115 |
| 470 | 3300049582 | Ga0501048_0000378 | Ga0501048_0000378_3769_4116 | 115 |
| 471 | 3300049582 | Ga0501048_0010966 | Ga0501048_0010966_2043_2396 | 115 |
| 472 | 3300049582 | Ga0501048_0536037 | Ga0501048_0536037_358_705 | 115 |
| 473 | 3300049583 | Ga0501067_0831696 | Ga0501067_0831696_37_384 | 115 |
| 474 | 3300049584 | Ga0501068_0014809 | Ga0501068_0014809_1123_1470 | 115 |
| 475 | 3300049584 | Ga0501068_0086419 | Ga0501068_0086419_87_440 | 115 |
| 476 | 3300049585 | Ga0501069_0123294 | Ga0501069_0123294_618_965 | 115 |
| 477 | 3300049585 | Ga0501069_0541180 | Ga0501069_0541180_142_489 | 115 |
| 478 | 3300049586 | Ga0501070_0159893 | Ga0501070_0159893_233_580 | 115 |
| 479 | 3300049586 | Ga0501070_0951507 | Ga0501070_0951507_181_528 | 115 |
| 480 | 3300049587 | Ga0501071_0007914 | Ga0501071_0007914_5351_5698 | 115 |
| 481 | 3300049587 | Ga0501071_0128234 | Ga0501071_0128234_596_943 | 115 |
| 482 | 3300049588 | Ga0501072_0008011 | Ga0501072_0008011_3950_4303 | 115 |
| 483 | 3300049588 | Ga0501072_0009822 | Ga0501072_0009822_5743_6090 | 115 |
| 484 | 3300049588 | Ga0501072_0214228 | Ga0501072_0214228_382_729 | 115 |
| 485 | 3300049588 | Ga0501072_0488477 | Ga0501072_0488477_607_954 | 115 |
| 486 | 3300049589 | Ga0501073_0204289 | Ga0501073_0204289_313_666 | 115 |
| 487 | 3300049590 | Ga0501074_0007335 | Ga0501074_0007335_6431_6778 | 115 |
| 488 | 3300049590 | Ga0501074_0066914 | Ga0501074_0066914_59_412 | 115 |
| 489 | 3300049590 | Ga0501074_0472188 | Ga0501074_0472188_165_512 | 115 |
| 490 | 3300049590 | Ga0501074_0636217 | Ga0501074_0636217_119_466 | 115 |
| 491 | 3300049590 | Ga0501074_0966257 | Ga0501074_0966257_63_410 | 115 |
| 492 | 3300049591 | Ga0501075_0000180 | Ga0501075_0000180_5540_5887 | 115 |
| 493 | 3300049591 | Ga0501075_0027409 | Ga0501075_0027409_2158_2511 | 115 |
| 494 | 3300049591 | Ga0501075_0148471 | Ga0501075_0148471_673_1026 | 115 |
| 495 | 3300049591 | Ga0501075_0550868 | Ga0501075_0550868_342_689 | 115 |
| 496 | 3300049592 | Ga0501076_0000290 | Ga0501076_0000290_25832_26185 | 115 |
| 497 | 3300049592 | Ga0501076_0000319 | Ga0501076_0000319_5782_6129 | 115 |
| 498 | 3300049592 | Ga0501076_0195588 | Ga0501076_0195588_65_418 | 115 |
| 499 | 3300049592 | Ga0501076_0698239 | Ga0501076_0698239_470_823 | 115 |
| 500 | 3300049592 | Ga0501076_0893114 | Ga0501076_0893114_206_553 | 115 |
| 501 | 3300049593 | Ga0501077_0000222 | Ga0501077_0000222_14077_14424 | 115 |
| 502 | 3300049593 | Ga0501077_0104746 | Ga0501077_0104746_1347_1694 | 115 |
| 503 | 3300049661 | Ga0501217_116597 | Ga0501217_116597_140_487 | 115 |
| 504 | 3300049661 | Ga0501217_194514 | Ga0501217_194514_171_518 | 115 |
| 505 | 3300049668 | Ga0501233_243369 | Ga0501233_243369_122_469 | 115 |
| 506 | 3300049705 | Ga0501225_0046507 | Ga0501225_0046507_729_1076 | 115 |
| 507 | 3300049705 | Ga0501225_0274658 | Ga0501225_0274658_148_495 | 115 |
| 508 | 3300049741 | Ga0501079_0000061 | Ga0501079_0000061_21937_22284 | 115 |
| 509 | 3300049741 | Ga0501079_0047873 | Ga0501079_0047873_495_848 | 115 |
| 510 | 3300049741 | Ga0501079_0557856 | Ga0501079_0557856_365_718 | 115 |
| 511 | 3300049742 | Ga0501080_0041403 | Ga0501080_0041403_2585_2932 | 115 |
| 512 | 3300049742 | Ga0501080_0311821 | Ga0501080_0311821_238_591 | 115 |
| 513 | 3300049742 | Ga0501080_0341293 | Ga0501080_0341293_259_612 | 115 |
| 514 | 3300049742 | Ga0501080_1078142 | Ga0501080_1078142_25_372 | 115 |
| 515 | 3300049743 | Ga0501081_0000110 | Ga0501081_0000110_27114_27461 | 115 |
| 516 | 3300049743 | Ga0501081_0005740 | Ga0501081_0005740_2820_3173 | 115 |
| 517 | 3300049743 | Ga0501081_1178339 | Ga0501081_1178339_184_531 | 115 |
| 518 | 3300049744 | Ga0501083_0081556 | Ga0501083_0081556_903_1250 | 115 |
| 519 | 3300049744 | Ga0501083_0112833 | Ga0501083_0112833_344_697 | 115 |
| 520 | 3300049779 | Ga0501283_029251 | Ga0501283_029251_72_425 | 115 |
| 521 | 3300049822 | Ga0501035_0021364 | Ga0501035_0021364_3613_3960 | 115 |
| 522 | 3300049823 | Ga0501044_0046768 | Ga0501044_0046768_2866_3213 | 115 |
| 523 | 3300049823 | Ga0501044_0663837 | Ga0501044_0663837_155_508 | 115 |
| 524 | 3300049824 | Ga0501045_0000038 | Ga0501045_0000038_38561_38908 | 115 |
| 525 | 3300049824 | Ga0501045_0169461 | Ga0501045_0169461_206_559 | 115 |
| 526 | 3300049851 | Ga0501212_092899 | Ga0501212_092899_78_425 | 115 |
| 527 | 3300050507 | nmdc:mga05p37_724826_c1 | nmdc:mga05p37_724826_c1_118_465 | 115 |
| 528 | 3300050507 | nmdc:mga05p37_803_c1 | nmdc:mga05p37_803_c1_22583_22933 | 115 |
| 529 | 3300050507 | nmdc:mga05p37_869553_c1 | nmdc:mga05p37_869553_c1_405_752 | 115 |
| 530 | 3300050508 | nmdc:mga09592_107109_c1 | nmdc:mga09592_107109_c1_771_1118 | 115 |
| 531 | 3300050508 | nmdc:mga09592_225263_c1 | nmdc:mga09592_225263_c1_944_1291 | 115 |
| 532 | 3300050508 | nmdc:mga09592_44_c1 | nmdc:mga09592_44_c1_38749_39099 | 115 |
| 533 | 3300050508 | nmdc:mga09592_607708_c1 | nmdc:mga09592_607708_c1_169_516 | 115 |
| 534 | 3300050509 | nmdc:mga0qj67_10164_c1 | nmdc:mga0qj67_10164_c1_2832_3179 | 115 |
| 535 | 3300050509 | nmdc:mga0qj67_131916_c1 | nmdc:mga0qj67_131916_c1_1620_1967 | 115 |
| 536 | 3300050509 | nmdc:mga0qj67_169646_c1 | nmdc:mga0qj67_169646_c1_1101_1448 | 115 |
| 537 | 3300050509 | nmdc:mga0qj67_17987_c1 | nmdc:mga0qj67_17987_c1_3106_3453 | 115 |
| 538 | 3300050509 | nmdc:mga0qj67_695609_c1 | nmdc:mga0qj67_695609_c1_359_706 | 115 |
| 539 | 3300050510 | nmdc:mga06r32_144284_c1 | nmdc:mga06r32_144284_c1_1098_1448 | 115 |
| 540 | 3300050510 | nmdc:mga06r32_1804616_c1 | nmdc:mga06r32_1804616_c1_172_519 | 115 |
| 541 | 3300050510 | nmdc:mga06r32_213064_c1 | nmdc:mga06r32_213064_c1_234_581 | 115 |
| 542 | 3300050510 | nmdc:mga06r32_344765_c1 | nmdc:mga06r32_344765_c1_615_962 | 115 |
| 543 | 3300050510 | nmdc:mga06r32_811139_c1 | nmdc:mga06r32_811139_c1_298_645 | 115 |
| 544 | 3300050511 | nmdc:mga08y16_100735_c1 | nmdc:mga08y16_100735_c1_88_435 | 115 |
| 545 | 3300050511 | nmdc:mga08y16_188039_c1 | nmdc:mga08y16_188039_c1_459_806 | 115 |
| 546 | 3300050511 | nmdc:mga08y16_484157_c1 | nmdc:mga08y16_484157_c1_772_1119 | 115 |
| 547 | 3300050511 | nmdc:mga08y16_552806_c1 | nmdc:mga08y16_552806_c1_578_925 | 115 |
| 548 | 3300050511 | nmdc:mga08y16_599224_c1 | nmdc:mga08y16_599224_c1_554_901 | 115 |
| 549 | 3300050511 | nmdc:mga08y16_63695_c1 | nmdc:mga08y16_63695_c1_2523_2870 | 115 |
| 550 | 3300050512 | nmdc:mga0n895_1797334_c1 | nmdc:mga0n895_1797334_c1_84_431 | 115 |
| 551 | 3300050512 | nmdc:mga0n895_356505_c1 | nmdc:mga0n895_356505_c1_555_902 | 115 |
| 552 | 3300050512 | nmdc:mga0n895_582_c1 | nmdc:mga0n895_582_c1_2701_3048 | 115 |
| 553 | 3300050512 | nmdc:mga0n895_999934_c1 | nmdc:mga0n895_999934_c1_159_506 | 115 |
| 554 | 3300050513 | nmdc:mga0rr50_132437_c1 | nmdc:mga0rr50_132437_c1_1050_1397 | 115 |
| 555 | 3300050513 | nmdc:mga0rr50_1494207_c1 | nmdc:mga0rr50_1494207_c1_186_533 | 115 |
| 556 | 3300050513 | nmdc:mga0rr50_3282_c1 | nmdc:mga0rr50_3282_c1_5106_5453 | 115 |
| 557 | 3300050513 | nmdc:mga0rr50_536725_c1 | nmdc:mga0rr50_536725_c1_505_852 | 115 |
| 558 | 3300050513 | nmdc:mga0rr50_573443_c1 | nmdc:mga0rr50_573443_c1_522_869 | 115 |
| 559 | 3300050513 | nmdc:mga0rr50_695280_c1 | nmdc:mga0rr50_695280_c1_330_677 | 115 |
| 560 | 3300050513 | nmdc:mga0rr50_825899_c1 | nmdc:mga0rr50_825899_c1_313_660 | 115 |
| 561 | 3300050514 | nmdc:mga08x19_1243641_c1 | nmdc:mga08x19_1243641_c1_152_499 | 115 |
| 562 | 3300050514 | nmdc:mga08x19_1858_c1 | nmdc:mga08x19_1858_c1_4028_4375 | 115 |
| 563 | 3300050514 | nmdc:mga08x19_40646_c1 | nmdc:mga08x19_40646_c1_358_705 | 115 |
| 564 | 3300050514 | nmdc:mga08x19_530202_c1 | nmdc:mga08x19_530202_c1_369_716 | 115 |
| 565 | 3300050514 | nmdc:mga08x19_573139_c1 | nmdc:mga08x19_573139_c1_165_512 | 115 |
| 566 | 3300050514 | nmdc:mga08x19_74217_c1 | nmdc:mga08x19_74217_c1_36_383 | 115 |
| 567 | 3300050514 | nmdc:mga08x19_91610_c1 | nmdc:mga08x19_91610_c1_892_1239 | 115 |
| 568 | 3300050515 | nmdc:mga0a205_1261800_c1 | nmdc:mga0a205_1261800_c1_97_444 | 115 |
| 569 | 3300050515 | nmdc:mga0a205_1416772_c1 | nmdc:mga0a205_1416772_c1_128_475 | 115 |
| 570 | 3300050515 | nmdc:mga0a205_18247_c1 | nmdc:mga0a205_18247_c1_6047_6394 | 115 |
| 571 | 3300050515 | nmdc:mga0a205_740623_c1 | nmdc:mga0a205_740623_c1_132_482 | 115 |
| 572 | 3300053077 | Ga0495601_0102515 | Ga0495601_0102515_950_1297 | 115 |
| 573 | 3300053077 | Ga0495601_0349746 | Ga0495601_0349746_181_528 | 115 |
| 574 | 3300053084 | Ga0495595_0335685 | Ga0495595_0335685_39_386 | 115 |
| 575 | 3300053085 | Ga0495619_0621237 | Ga0495619_0621237_267_614 | 115 |
| 576 | 3300054114 | Ga0501084_0005924 | Ga0501084_0005924_5757_6104 | 115 |
| 577 | 3300054114 | Ga0501084_0982310 | Ga0501084_0982310_186_533 | 115 |
| 578 | 3300059426 | Ga0590077_063350 | Ga0590077_063350_175_522 | 115 |
| 579 | 3300059426 | Ga0590077_082449 | Ga0590077_082449_242_589 | 115 |
| 580 | 3300060353 | Ga0501082_0000430 | Ga0501082_0000430_17986_18333 | 115 |
| 581 | 3300060353 | Ga0501082_0014186 | Ga0501082_0014186_5537_5890 | 115 |
| 582 | 3300060353 | Ga0501082_1827029 | Ga0501082_1827029_75_428 | 115 |
| 583 | 3300061734 | Ga0530510_0000186 | Ga0530510_0000186_11863_12210 | 115 |
| 584 | 3300061734 | Ga0530510_0001727 | Ga0530510_0001727_11888_12241 | 115 |
| 585 | 3300061734 | Ga0530510_0774213 | Ga0530510_0774213_278_625 | 115 |
| 586 | 3300005290 | Ga0065712_10489792 | Ga0065712_104897921 | 116 |
| 587 | 3300005295 | Ga0065707_10110299 | Ga0065707_101102992 | 116 |
| 588 | 3300005328 | Ga0070676_10395485 | Ga0070676_103954852 | 116 |
| 589 | 3300005329 | Ga0070683_101289846 | Ga0070683_1012898461 | 116 |
| 590 | 3300005330 | Ga0070690_100000048 | Ga0070690_10000004820 | 116 |
| 591 | 3300005330 | Ga0070690_100855288 | Ga0070690_1008552881 | 116 |
| 592 | 3300005334 | Ga0068869_100003924 | Ga0068869_1000039244 | 116 |
| 593 | 3300005335 | Ga0070666_10070556 | Ga0070666_100705562 | 116 |
| 594 | 3300005336 | Ga0070680_100002906 | Ga0070680_1000029069 | 116 |
| 595 | 3300005337 | Ga0070682_100059435 | Ga0070682_1000594355 | 116 |
| 596 | 3300005338 | Ga0068868_100000169 | Ga0068868_10000016932 | 116 |
| 597 | 3300005340 | Ga0070689_100052142 | Ga0070689_1000521427 | 116 |
| 598 | 3300005340 | Ga0070689_100105537 | Ga0070689_1001055372 | 116 |
| 599 | 3300005341 | Ga0070691_10005631 | Ga0070691_100056316 | 116 |
| 600 | 3300005343 | Ga0070687_100000112 | Ga0070687_1000001127 | 116 |
| 601 | 3300005343 | Ga0070687_100058394 | Ga0070687_1000583942 | 116 |
| 602 | 3300005343 | Ga0070687_100375502 | Ga0070687_1003755023 | 116 |
| 603 | 3300005345 | Ga0070692_10000771 | Ga0070692_1000077117 | 116 |
| 604 | 3300005353 | Ga0070669_100573438 | Ga0070669_1005734382 | 116 |
| 605 | 3300005355 | Ga0070671_100474898 | Ga0070671_1004748982 | 116 |
| 606 | 3300005356 | Ga0070674_100861481 | Ga0070674_1008614812 | 116 |
| 607 | 3300005365 | Ga0070688_100213291 | Ga0070688_1002132911 | 116 |
| 608 | 3300005437 | Ga0070710_10728486 | Ga0070710_107284862 | 116 |
| 609 | 3300005438 | Ga0070701_10001982 | Ga0070701_100019822 | 116 |
| 610 | 3300005439 | Ga0070711_101167953 | Ga0070711_1011679532 | 116 |
| 611 | 3300005440 | Ga0070705_100000275 | Ga0070705_1000002754 | 116 |
| 612 | 3300005441 | Ga0070700_100000718 | Ga0070700_10000071820 | 116 |
| 613 | 3300005441 | Ga0070700_100159819 | Ga0070700_1001598192 | 116 |
| 614 | 3300005444 | Ga0070694_100000608 | Ga0070694_10000060825 | 116 |
| 615 | 3300005444 | Ga0070694_100488581 | Ga0070694_1004885812 | 116 |
| 616 | 3300005456 | Ga0070678_100590668 | Ga0070678_1005906682 | 116 |
| 617 | 3300005459 | Ga0068867_100000568 | Ga0068867_10000056825 | 116 |
| 618 | 3300005518 | Ga0070699_100204649 | Ga0070699_1002046493 | 116 |
| 619 | 3300005530 | Ga0070679_100024440 | Ga0070679_1000244402 | 116 |
| 620 | 3300005535 | Ga0070684_100904293 | Ga0070684_1009042932 | 116 |
| 621 | 3300005539 | Ga0068853_100079777 | Ga0068853_1000797773 | 116 |
| 622 | 3300005544 | Ga0070686_100002218 | Ga0070686_10000221814 | 116 |
| 623 | 3300005544 | Ga0070686_100160293 | Ga0070686_1001602932 | 116 |
| 624 | 3300005544 | Ga0070686_100319207 | Ga0070686_1003192072 | 116 |
| 625 | 3300005544 | Ga0070686_100900045 | Ga0070686_1009000452 | 116 |
| 626 | 3300005545 | Ga0070695_100000176 | Ga0070695_10000017619 | 116 |
| 627 | 3300005545 | Ga0070695_100075647 | Ga0070695_1000756475 | 116 |
| 628 | 3300005545 | Ga0070695_100516992 | Ga0070695_1005169922 | 116 |
| 629 | 3300005546 | Ga0070696_100000137 | Ga0070696_10000013717 | 116 |
| 630 | 3300005546 | Ga0070696_100001735 | Ga0070696_1000017352 | 116 |
| 631 | 3300005546 | Ga0070696_100836439 | Ga0070696_1008364392 | 116 |
| 632 | 3300005546 | Ga0070696_100900886 | Ga0070696_1009008862 | 116 |
| 633 | 3300005547 | Ga0070693_100001113 | Ga0070693_1000011136 | 116 |
| 634 | 3300005547 | Ga0070693_100076425 | Ga0070693_1000764253 | 116 |
| 635 | 3300005549 | Ga0070704_100000057 | Ga0070704_10000005731 | 116 |
| 636 | 3300005563 | Ga0068855_100118320 | Ga0068855_1001183202 | 116 |
| 637 | 3300005578 | Ga0068854_100797180 | Ga0068854_1007971802 | 116 |
| 638 | 3300005614 | Ga0068856_100175279 | Ga0068856_1001752793 | 116 |
| 639 | 3300005614 | Ga0068856_100362114 | Ga0068856_1003621142 | 116 |
| 640 | 3300005615 | Ga0070702_100000016 | Ga0070702_10000001625 | 116 |
| 641 | 3300005615 | Ga0070702_100674737 | Ga0070702_1006747372 | 116 |
| 642 | 3300005616 | Ga0068852_100053098 | Ga0068852_1000530984 | 116 |
| 643 | 3300005617 | Ga0068859_100011860 | Ga0068859_10001186013 | 116 |
| 644 | 3300005617 | Ga0068859_100520407 | Ga0068859_1005204073 | 116 |
| 645 | 3300005618 | Ga0068864_100025516 | Ga0068864_1000255162 | 116 |
| 646 | 3300005718 | Ga0068866_10000914 | Ga0068866_100009144 | 116 |
| 647 | 3300005719 | Ga0068861_100000199 | Ga0068861_10000019926 | 116 |
| 648 | 3300005841 | Ga0068863_100084048 | Ga0068863_1000840486 | 116 |
| 649 | 3300005842 | Ga0068858_100003393 | Ga0068858_1000033936 | 116 |
| 650 | 3300005842 | Ga0068858_100534859 | Ga0068858_1005348593 | 116 |
| 651 | 3300005843 | Ga0068860_100001230 | Ga0068860_10000123027 | 116 |
| 652 | 3300005843 | Ga0068860_100212273 | Ga0068860_1002122732 | 116 |
| 653 | 3300005844 | Ga0068862_100010417 | Ga0068862_1000104176 | 116 |
| 654 | 3300006163 | Ga0070715_10081179 | Ga0070715_100811794 | 116 |
| 655 | 3300006163 | Ga0070715_10439900 | Ga0070715_104399002 | 116 |
| 656 | 3300006173 | Ga0070716_100555142 | Ga0070716_1005551422 | 116 |
| 657 | 3300006237 | Ga0097621_100001888 | Ga0097621_1000018882 | 116 |
| 658 | 3300006237 | Ga0097621_100015589 | Ga0097621_1000155892 | 116 |
| 659 | 3300006358 | Ga0068871_100000120 | Ga0068871_10000012042 | 116 |
| 660 | 3300006358 | Ga0068871_100003000 | Ga0068871_10000300011 | 116 |
| 661 | 3300006844 | Ga0075428_100013129 | Ga0075428_1000131292 | 116 |
| 662 | 3300006844 | Ga0075428_100025250 | Ga0075428_10002525012 | 116 |
| 663 | 3300006846 | Ga0075430_100008695 | Ga0075430_1000086956 | 116 |
| 664 | 3300006847 | Ga0075431_100742305 | Ga0075431_1007423052 | 116 |
| 665 | 3300006847 | Ga0075431_100762845 | Ga0075431_1007628452 | 116 |
| 666 | 3300006852 | Ga0075433_10014942 | Ga0075433_100149428 | 116 |
| 667 | 3300006852 | Ga0075433_10160924 | Ga0075433_101609242 | 116 |
| 668 | 3300006852 | Ga0075433_10778163 | Ga0075433_107781632 | 116 |
| 669 | 3300006871 | Ga0075434_100001176 | Ga0075434_10000117614 | 116 |
| 670 | 3300006880 | Ga0075429_100001130 | Ga0075429_10000113026 | 116 |
| 671 | 3300006880 | Ga0075429_100043946 | Ga0075429_1000439467 | 116 |
| 672 | 3300006880 | Ga0075429_100428394 | Ga0075429_1004283942 | 116 |
| 673 | 3300006881 | Ga0068865_100001461 | Ga0068865_10000146113 | 116 |
| 674 | 3300006914 | Ga0075436_100004890 | Ga0075436_10000489014 | 116 |
| 675 | 3300006931 | Ga0097620_100011861 | Ga0097620_10001186113 | 116 |
| 676 | 3300006931 | Ga0097620_100520376 | Ga0097620_1005203763 | 116 |
| 677 | 3300007076 | Ga0075435_100007630 | Ga0075435_10000763011 | 116 |
| 678 | 3300007076 | Ga0075435_100239981 | Ga0075435_1002399814 | 116 |
| 679 | 3300007265 | Ga0099794_10043743 | Ga0099794_100437433 | 116 |
| 680 | 3300007265 | Ga0099794_10066967 | Ga0099794_100669672 | 116 |
| 681 | 3300007265 | Ga0099794_10363308 | Ga0099794_103633082 | 116 |
| 682 | 3300007265 | Ga0099794_10438859 | Ga0099794_104388592 | 116 |
| 683 | 3300009092 | Ga0105250_10020860 | Ga0105250_100208602 | 116 |
| 684 | 3300009094 | Ga0111539_10037024 | Ga0111539_100370242 | 116 |
| 685 | 3300009094 | Ga0111539_10222278 | Ga0111539_102222782 | 116 |
| 686 | 3300009094 | Ga0111539_13145343 | Ga0111539_131453432 | 116 |
| 687 | 3300009098 | Ga0105245_10000259 | Ga0105245_1000025926 | 116 |
| 688 | 3300009098 | Ga0105245_11512819 | Ga0105245_115128192 | 116 |
| 689 | 3300009147 | Ga0114129_10002101 | Ga0114129_1000210127 | 116 |
| 690 | 3300009147 | Ga0114129_10731066 | Ga0114129_107310662 | 116 |
| 691 | 3300009148 | Ga0105243_10003095 | Ga0105243_100030952 | 116 |
| 692 | 3300009174 | Ga0105241_10010209 | Ga0105241_100102095 | 116 |
| 693 | 3300009176 | Ga0105242_10036544 | Ga0105242_100365443 | 116 |
| 694 | 3300009177 | Ga0105248_10559731 | Ga0105248_105597311 | 116 |
| 695 | 3300009177 | Ga0105248_10888186 | Ga0105248_108881861 | 116 |
| 696 | 3300009551 | Ga0105238_12744922 | Ga0105238_127449222 | 116 |
| 697 | 3300009553 | Ga0105249_10001070 | Ga0105249_1000107024 | 116 |
| 698 | 3300010375 | Ga0105239_11866616 | Ga0105239_118666162 | 116 |
| 699 | 3300011119 | Ga0105246_10835144 | Ga0105246_108351442 | 116 |
| 700 | 3300012505 | Ga0157339_1040404 | Ga0157339_10404042 | 116 |
| 701 | 3300013297 | Ga0157378_10000576 | Ga0157378_1000057624 | 116 |
| 702 | 3300013306 | Ga0163162_10199606 | Ga0163162_101996062 | 116 |
| 703 | 3300013307 | Ga0157372_10981400 | Ga0157372_109814002 | 116 |
| 704 | 3300013308 | Ga0157375_10093020 | Ga0157375_100930202 | 116 |
| 705 | 3300014326 | Ga0157380_10170367 | Ga0157380_101703673 | 116 |
| 706 | 3300014326 | Ga0157380_10537147 | Ga0157380_105371472 | 116 |
| 707 | 3300014968 | Ga0157379_11570464 | Ga0157379_115704641 | 116 |
| 708 | 3300014969 | Ga0157376_10003705 | Ga0157376_1000370516 | 116 |
| 709 | 3300014969 | Ga0157376_10070012 | Ga0157376_100700125 | 116 |
| 710 | 3300025711 | Ga0207696_1115335 | Ga0207696_11153353 | 116 |
| 711 | 3300025885 | Ga0207653_10053692 | Ga0207653_100536922 | 116 |
| 712 | 3300025898 | Ga0207692_10571143 | Ga0207692_105711432 | 116 |
| 713 | 3300025899 | Ga0207642_10183429 | Ga0207642_101834292 | 116 |
| 714 | 3300025901 | Ga0207688_10103278 | Ga0207688_101032782 | 116 |
| 715 | 3300025904 | Ga0207647_10784874 | Ga0207647_107848742 | 116 |
| 716 | 3300025905 | Ga0207685_10032127 | Ga0207685_100321272 | 116 |
| 717 | 3300025906 | Ga0207699_10823002 | Ga0207699_108230022 | 116 |
| 718 | 3300025907 | Ga0207645_10366205 | Ga0207645_103662053 | 116 |
| 719 | 3300025910 | Ga0207684_11521226 | Ga0207684_115212262 | 116 |
| 720 | 3300025911 | Ga0207654_10004685 | Ga0207654_100046859 | 116 |
| 721 | 3300025917 | Ga0207660_10001340 | Ga0207660_1000134022 | 116 |
| 722 | 3300025918 | Ga0207662_10000106 | Ga0207662_1000010646 | 116 |
| 723 | 3300025921 | Ga0207652_10007736 | Ga0207652_100077362 | 116 |
| 724 | 3300025922 | Ga0207646_10406772 | Ga0207646_104067722 | 116 |
| 725 | 3300025926 | Ga0207659_10089394 | Ga0207659_100893942 | 116 |
| 726 | 3300025931 | Ga0207644_10486154 | Ga0207644_104861541 | 116 |
| 727 | 3300025934 | Ga0207686_10000883 | Ga0207686_100008832 | 116 |
| 728 | 3300025935 | Ga0207709_10003980 | Ga0207709_1000398012 | 116 |
| 729 | 3300025936 | Ga0207670_10067768 | Ga0207670_100677685 | 116 |
| 730 | 3300025936 | Ga0207670_11186945 | Ga0207670_111869451 | 116 |
| 731 | 3300025938 | Ga0207704_10000434 | Ga0207704_100004343 | 116 |
| 732 | 3300025942 | Ga0207689_10000376 | Ga0207689_1000037631 | 116 |
| 733 | 3300025944 | Ga0207661_10179401 | Ga0207661_101794012 | 116 |
| 734 | 3300025949 | Ga0207667_10134989 | Ga0207667_101349892 | 116 |
| 735 | 3300025961 | Ga0207712_10005157 | Ga0207712_1000515716 | 116 |
| 736 | 3300025981 | Ga0207640_10060273 | Ga0207640_100602736 | 116 |
| 737 | 3300025981 | Ga0207640_11529530 | Ga0207640_115295302 | 116 |
| 738 | 3300026023 | Ga0207677_10004790 | Ga0207677_100047902 | 116 |
| 739 | 3300026035 | Ga0207703_10001886 | Ga0207703_1000188621 | 116 |
| 740 | 3300026035 | Ga0207703_10031708 | Ga0207703_100317082 | 116 |
| 741 | 3300026041 | Ga0207639_10050531 | Ga0207639_100505313 | 116 |
| 742 | 3300026075 | Ga0207708_10000239 | Ga0207708_1000023941 | 116 |
| 743 | 3300026078 | Ga0207702_10056135 | Ga0207702_100561353 | 116 |
| 744 | 3300026078 | Ga0207702_10261003 | Ga0207702_102610033 | 116 |
| 745 | 3300026088 | Ga0207641_10042652 | Ga0207641_100426528 | 116 |
| 746 | 3300026088 | Ga0207641_10474389 | Ga0207641_104743894 | 116 |
| 747 | 3300026089 | Ga0207648_10000369 | Ga0207648_1000036926 | 116 |
| 748 | 3300026095 | Ga0207676_10049205 | Ga0207676_100492055 | 116 |
| 749 | 3300026118 | Ga0207675_100002559 | Ga0207675_10000255924 | 116 |
| 750 | 3300026118 | Ga0207675_100492840 | Ga0207675_1004928401 | 116 |
| 751 | 3300026121 | Ga0207683_10628706 | Ga0207683_106287062 | 116 |
| 752 | 3300026142 | Ga0207698_10047953 | Ga0207698_100479531 | 116 |
| 753 | 3300027671 | Ga0209588_1056698 | Ga0209588_10566982 | 116 |
| 754 | 3300027907 | Ga0207428_10010784 | Ga0207428_1001078411 | 116 |
| 755 | 3300027907 | Ga0207428_10201221 | Ga0207428_102012213 | 116 |
| 756 | 3300028380 | Ga0268265_10001333 | Ga0268265_100013335 | 116 |
| 757 | 3300028381 | Ga0268264_10001450 | Ga0268264_100014506 | 116 |
| 758 | 3300028381 | Ga0268264_10617457 | Ga0268264_106174573 | 116 |
| 759 | 3300028381 | Ga0268264_11581433 | Ga0268264_115814332 | 116 |
| 760 | 3300031852 | Ga0307410_11276436 | Ga0307410_112764362 | 116 |
| 761 | 3300032002 | Ga0307416_102700765 | Ga0307416_1027007652 | 116 |
| 762 | 3300034816 | Ga0373930_0160468 | Ga0373930_0160468_170_520 | 116 |
| 763 | 3300034817 | Ga0373948_0011088 | Ga0373948_0011088_395_745 | 116 |
| 764 | 3300034818 | Ga0373950_0059922 | Ga0373950_0059922_355_705 | 116 |
| 765 | 3300034819 | Ga0373958_0024227 | Ga0373958_0024227_45_395 | 116 |
| 766 | 3300034819 | Ga0373958_0100025 | Ga0373958_0100025_104_454 | 116 |
| 767 | 3300034820 | Ga0373959_0005843 | Ga0373959_0005843_657_1007 | 116 |
| 768 | 3300034957 | Ga0373938_0003713 | Ga0373938_0003713_940_1290 | 116 |
| 769 | 3300034957 | Ga0373938_0185876 | Ga0373938_0185876_116_466 | 116 |
| 770 | 3300035083 | Ga0373926_0000230 | Ga0373926_0000230_6587_6937 | 116 |
| 771 | 3300035084 | Ga0373928_0022347 | Ga0373928_0022347_114_464 | 116 |
| 772 | 3300035085 | Ga0373929_0032794 | Ga0373929_0032794_183_533 | 116 |
| 773 | 3300035088 | Ga0373940_0027896 | Ga0373940_0027896_284_634 | 116 |
| 774 | 3300035089 | Ga0373944_0001903 | Ga0373944_0001903_3975_4325 | 116 |
| 775 | 3300035089 | Ga0373944_0262287 | Ga0373944_0262287_104_454 | 116 |
| 776 | 3300035090 | Ga0373949_0053680 | Ga0373949_0053680_585_935 | 116 |
| 777 | 3300035091 | Ga0373951_0090467 | Ga0373951_0090467_399_749 | 116 |
| 778 | 3300035092 | Ga0373952_0069643 | Ga0373952_0069643_273_623 | 116 |
| 779 | 3300035111 | Ga0373923_0288232 | Ga0373923_0288232_20_370 | 116 |
| 780 | 3300035112 | Ga0373932_0005565 | Ga0373932_0005565_1192_1542 | 116 |
| 781 | 3300035112 | Ga0373932_0265155 | Ga0373932_0265155_160_510 | 116 |
| 782 | 3300035113 | Ga0373936_0018435 | Ga0373936_0018435_1019_1369 | 116 |
| 783 | 3300035114 | Ga0373939_0265225 | Ga0373939_0265225_258_608 | 116 |
| 784 | 3300035115 | Ga0373941_0018284 | Ga0373941_0018284_186_536 | 116 |
| 785 | 3300035115 | Ga0373941_0039893 | Ga0373941_0039893_238_588 | 116 |
| 786 | 3300035116 | Ga0373945_0004779 | Ga0373945_0004779_1498_1848 | 116 |
| 787 | 3300035116 | Ga0373945_0137355 | Ga0373945_0137355_379_729 | 116 |
| 788 | 3300035116 | Ga0373945_0521942 | Ga0373945_0521942_100_450 | 116 |
| 789 | 3300035117 | Ga0373953_0021780 | Ga0373953_0021780_431_790 | 116 |
| 790 | 3300035118 | Ga0373954_0000087 | Ga0373954_0000087_22471_22830 | 116 |
| 791 | 3300035119 | Ga0373956_0066543 | Ga0373956_0066543_158_508 | 116 |
| 792 | 3300035120 | Ga0373957_0313502 | Ga0373957_0313502_133_483 | 116 |
| 793 | 3300035121 | Ga0373960_0023136 | Ga0373960_0023136_827_1177 | 116 |
| 794 | 3300035170 | Ga0373943_0020057 | Ga0373943_0020057_2359_2709 | 116 |
| 795 | 3300035170 | Ga0373943_0176629 | Ga0373943_0176629_402_752 | 116 |
| 796 | 3300035170 | Ga0373943_0811787 | Ga0373943_0811787_173_523 | 116 |
| 797 | 3300035171 | Ga0373946_0005892 | Ga0373946_0005892_2117_2467 | 116 |
| 798 | 3300035172 | Ga0373955_0090832 | Ga0373955_0090832_662_1021 | 116 |
| 799 | 3300035172 | Ga0373955_0899204 | Ga0373955_0899204_67_417 | 116 |
| 800 | 3300035207 | Ga0373942_0004862 | Ga0373942_0004862_2302_2652 | 116 |
| 801 | 3300035207 | Ga0373942_0078048 | Ga0373942_0078048_199_549 | 116 |
| 802 | 3300035241 | Ga0373961_0008933 | Ga0373961_0008933_204_554 | 116 |
| 803 | 3300035241 | Ga0373961_0134635 | Ga0373961_0134635_36_386 | 116 |
| 804 | 3300035241 | Ga0373961_0432326 | Ga0373961_0432326_100_450 | 116 |
| 805 | 3300035242 | Ga0373962_0082296 | Ga0373962_0082296_27_377 | 116 |
| 806 | 3300035242 | Ga0373962_0124605 | Ga0373962_0124605_433_783 | 116 |
| 807 | 3300035242 | Ga0373962_0221692 | Ga0373962_0221692_75_425 | 116 |
| 808 | 3300035410 | Ga0373924_0014361 | Ga0373924_0014361_839_1189 | 116 |
| 809 | 3300035410 | Ga0373924_0059852 | Ga0373924_0059852_512_862 | 116 |
| 810 | 3300035410 | Ga0373924_0097248 | Ga0373924_0097248_102_461 | 116 |
| 811 | 3300035691 | Ga0373931_0002129 | Ga0373931_0002129_7108_7458 | 116 |
| 812 | 3300035691 | Ga0373931_0004456 | Ga0373931_0004456_5751_6101 | 116 |
| 813 | 3300035691 | Ga0373931_0014988 | Ga0373931_0014988_2993_3343 | 116 |
| 814 | 3300035692 | Ga0373935_0010842 | Ga0373935_0010842_3797_4147 | 116 |
| 815 | 3300035692 | Ga0373935_0094772 | Ga0373935_0094772_1328_1678 | 116 |
| 816 | 3300035695 | Ga0373927_0023238 | Ga0373927_0023238_391_741 | 116 |
| 817 | 3300035695 | Ga0373927_0136658 | Ga0373927_0136658_662_1012 | 116 |
| 818 | 3300035695 | Ga0373927_0445904 | Ga0373927_0445904_267_620 | 116 |
| 819 | 3300035724 | Ga0373933_0003173 | Ga0373933_0003173_2833_3192 | 116 |
| 820 | 3300035724 | Ga0373933_0027928 | Ga0373933_0027928_977_1327 | 116 |
| 821 | 3300035725 | Ga0373947_0036854 | Ga0373947_0036854_1174_1524 | 116 |
| 822 | 3300035725 | Ga0373947_0046108 | Ga0373947_0046108_954_1304 | 116 |
| 823 | 3300036401 | Ga0373937_0000296 | Ga0373937_0000296_21911_22270 | 116 |
| 824 | 3300036401 | Ga0373937_0018367 | Ga0373937_0018367_2159_2509 | 116 |
| 825 | 3300037068 | Ga0373925_0212145 | Ga0373925_0212145_392_742 | 116 |
| 826 | 3300042532 | Ga0450893_0058995 | Ga0450893_0058995_197_547 | 116 |
| 827 | 3300042876 | Ga0451577_0015044 | Ga0451577_0015044_4867_5217 | 116 |
| 828 | 3300045051 | Ga0451576_0033552 | Ga0451576_0033552_211_561 | 116 |
| 829 | 3300045051 | Ga0451576_0090352 | Ga0451576_0090352_695_1045 | 116 |
| 830 | 3300045051 | Ga0451576_0406018 | Ga0451576_0406018_937_1287 | 116 |
| 831 | 3300045051 | Ga0451576_1717735 | Ga0451576_1717735_245_595 | 116 |
| 832 | 3300045051 | Ga0451576_1899017 | Ga0451576_1899017_148_498 | 116 |
| 833 | 3300046455 | Ga0495603_0005705 | Ga0495603_0005705_316_666 | 116 |
| 834 | 3300046463 | Ga0495653_0292991 | Ga0495653_0292991_220_570 | 116 |
| 835 | 3300046473 | Ga0495582_0034547 | Ga0495582_0034547_1448_1798 | 116 |
| 836 | 3300046475 | Ga0495639_0005524 | Ga0495639_0005524_426_776 | 116 |
| 837 | 3300046511 | Ga0495608_0099837 | Ga0495608_0099837_1310_1669 | 116 |
| 838 | 3300046517 | Ga0495630_0679615 | Ga0495630_0679615_10_360 | 116 |
| 839 | 3300046526 | Ga0495666_0013837 | Ga0495666_0013837_697_1047 | 116 |
| 840 | 3300046531 | Ga0495665_0629153 | Ga0495665_0629153_61_411 | 116 |
| 841 | 3300046557 | Ga0495622_0120892 | Ga0495622_0120892_629_979 | 116 |
| 842 | 3300046559 | Ga0495667_0152297 | Ga0495667_0152297_856_1206 | 116 |
| 843 | 3300046664 | Ga0495659_0011438 | Ga0495659_0011438_1498_1848 | 116 |
| 844 | 3300046675 | Ga0495657_0418123 | Ga0495657_0418123_375_734 | 116 |
| 845 | 3300046679 | Ga0495623_0185607 | Ga0495623_0185607_694_1053 | 116 |
| 846 | 3300046681 | Ga0495647_0001395 | Ga0495647_0001395_5818_6168 | 116 |
| 847 | 3300046683 | Ga0495658_0003610 | Ga0495658_0003610_4389_4739 | 116 |
| 848 | 3300046684 | Ga0495669_0110952 | Ga0495669_0110952_721_1071 | 116 |
| 849 | 3300046690 | Ga0495624_0497953 | Ga0495624_0497953_337_687 | 116 |
| 850 | 3300047322 | Ga0495680_0061033 | Ga0495680_0061033_399_749 | 116 |
| 851 | 3300048909 | Ga0496106_0159383 | Ga0496106_0159383_497_847 | 116 |
| 852 | 3300049568 | Ga0501031_0204174 | Ga0501031_0204174_11_361 | 116 |
| 853 | 3300049568 | Ga0501031_0612243 | Ga0501031_0612243_73_423 | 116 |
| 854 | 3300049569 | Ga0501032_0567680 | Ga0501032_0567680_268_621 | 116 |
| 855 | 3300049572 | Ga0501036_0391362 | Ga0501036_0391362_131_484 | 116 |
| 856 | 3300049573 | Ga0501037_0523020 | Ga0501037_0523020_20_370 | 116 |
| 857 | 3300049576 | Ga0501040_0205892 | Ga0501040_0205892_161_511 | 116 |
| 858 | 3300049577 | Ga0501041_0015993 | Ga0501041_0015993_3531_3884 | 116 |
| 859 | 3300049578 | Ga0501042_1127447 | Ga0501042_1127447_121_471 | 116 |
| 860 | 3300049580 | Ga0501046_0131158 | Ga0501046_0131158_104_457 | 116 |
| 861 | 3300049580 | Ga0501046_1092793 | Ga0501046_1092793_60_410 | 116 |
| 862 | 3300049582 | Ga0501048_0525886 | Ga0501048_0525886_194_547 | 116 |
| 863 | 3300049582 | Ga0501048_1117835 | Ga0501048_1117835_25_375 | 116 |
| 864 | 3300049587 | Ga0501071_0078414 | Ga0501071_0078414_146_499 | 116 |
| 865 | 3300049588 | Ga0501072_0098053 | Ga0501072_0098053_1578_1931 | 116 |
| 866 | 3300049588 | Ga0501072_0480438 | Ga0501072_0480438_39_389 | 116 |
| 867 | 3300049590 | Ga0501074_0206844 | Ga0501074_0206844_725_1075 | 116 |
| 868 | 3300049591 | Ga0501075_0059419 | Ga0501075_0059419_1197_1547 | 116 |
| 869 | 3300049591 | Ga0501075_0114208 | Ga0501075_0114208_1657_2010 | 116 |
| 870 | 3300049592 | Ga0501076_0103371 | Ga0501076_0103371_214_564 | 116 |
| 871 | 3300049822 | Ga0501035_0802186 | Ga0501035_0802186_91_444 | 116 |
| 872 | 3300049823 | Ga0501044_1309375 | Ga0501044_1309375_119_469 | 116 |
| 873 | 3300050507 | nmdc:mga05p37_1298538_c1 | nmdc:mga05p37_1298538_c1_219_569 | 116 |
| 874 | 3300050507 | nmdc:mga05p37_2835_c1 | nmdc:mga05p37_2835_c1_13877_14227 | 116 |
| 875 | 3300050507 | nmdc:mga05p37_74156_c1 | nmdc:mga05p37_74156_c1_3221_3571 | 116 |
| 876 | 3300050508 | nmdc:mga09592_15465_c1 | nmdc:mga09592_15465_c1_2899_3249 | 116 |
| 877 | 3300050508 | nmdc:mga09592_297287_c1 | nmdc:mga09592_297287_c1_510_860 | 116 |
| 878 | 3300050508 | nmdc:mga09592_719365_c1 | nmdc:mga09592_719365_c1_36_386 | 116 |
| 879 | 3300050509 | nmdc:mga0qj67_33460_c1 | nmdc:mga0qj67_33460_c1_654_1004 | 116 |
| 880 | 3300050510 | nmdc:mga06r32_200984_c1 | nmdc:mga06r32_200984_c1_544_894 | 116 |
| 881 | 3300050510 | nmdc:mga06r32_41056_c1 | nmdc:mga06r32_41056_c1_3400_3750 | 116 |
| 882 | 3300050511 | nmdc:mga08y16_131646_c1 | nmdc:mga08y16_131646_c1_1042_1392 | 116 |
| 883 | 3300050511 | nmdc:mga08y16_48362_c1 | nmdc:mga08y16_48362_c1_1493_1843 | 116 |
| 884 | 3300050512 | nmdc:mga0n895_649792_c1 | nmdc:mga0n895_649792_c1_600_950 | 116 |
| 885 | 3300050513 | nmdc:mga0rr50_19252_c1 | nmdc:mga0rr50_19252_c1_794_1144 | 116 |
| 886 | 3300050513 | nmdc:mga0rr50_5530_c2 | nmdc:mga0rr50_5530_c2_1399_1749 | 116 |
| 887 | 3300050514 | nmdc:mga08x19_98427_c1 | nmdc:mga08x19_98427_c1_988_1338 | 116 |
| 888 | 3300050515 | nmdc:mga0a205_252698_c1 | nmdc:mga0a205_252698_c1_642_992 | 116 |
| 889 | 3300050515 | nmdc:mga0a205_34658_c1 | nmdc:mga0a205_34658_c1_3132_3482 | 116 |
| 890 | 3300050515 | nmdc:mga0a205_357921_c1 | nmdc:mga0a205_357921_c1_231_581 | 116 |
| 891 | 3300054114 | Ga0501084_0848067 | Ga0501084_0848067_239_589 | 116 |
| 892 | 3300054114 | Ga0501084_1073356 | Ga0501084_1073356_312_665 | 116 |
| 893 | 3300059421 | Ga0590071_023052 | Ga0590071_023052_57_407 | 116 |
| 894 | 3300060353 | Ga0501082_0665818 | Ga0501082_0665818_181_534 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.8867 | 2 | 109 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.883 | 1 | 106 |
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.879 | 2 | 109 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.8531 | 1 | 106 |
| 2y5c-assembly2.cif.gz_B | structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster | 0.8267 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9 | 2 | 107 | 3.10.20.30 |
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8688 | 2 | 107 | 3.10.20.30 |
| af_A4I756_34_144_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7968 | 2 | 104 | 3.10.20.30 |
| af_A4I234_54_172_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.793 | 2 | 106 | 3.10.20.30 |
| 1krhB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.7918 | 2 | 100 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A7BVS5-F1-model_v4 | 2Fe-2S ferredoxin | 0.9045 | 1 | 106 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A2D8WQG4-F1-model_v4 | 2Fe-2S ferredoxin | 0.9033 | 2 | 106 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A1Z9HTG0-F1-model_v4 | 2Fe-2S ferredoxin | 0.9029 | 1 | 105 |
GO:0005829
GO:0009055 GO:0016226 GO:0051537 GO:0140647 |
| AF-A0A455TAU1-F1-model_v4 | 2Fe-2S ferredoxin | 0.9026 | 1 | 107 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A2X1SLU2-F1-model_v4 | 2Fe-2S ferredoxin | 0.902 | 1 | 101 |
GO:0005829
GO:0008198 GO:0009055 GO:0016226 GO:0051537 GO:0140647 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar