F484938
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 894 | 401 | 1788 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10134797|Ga0157378_101347971 |
| Length | 271 |
| Sequence | MVLDAVGNPQTILLLGGTSEIGLAICERYLRNASARIVLTALPDDPLRDNAVAQMKAAGAKSVEVIDFDAVDTESHPKVIDAAFKDGVGGPRDVDVAIVAFGLLGNAEELWQNQRKAVQIAEINYTAAISVGVLLGEKMRAQGFGQIIAMSSAAGERVRRSNFVYGSTKAGLDGFYLGLGEALREFGVRVLVIRPGQVRTTTTVEHWKATGTKEAPFTVDKEYVAELAVTASAKGKELVWAPGAFRYVMMVLRHIPRPIFRKLPIGCAALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 186 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 200 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 207 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 208 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 285 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 286 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 337 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 343 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 344 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 345 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 346 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 347 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 348 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 349 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 350 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 351 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 352 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 353 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 354 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 355 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 356 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 357 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 358 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 359 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 360 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 361 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 362 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 363 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 364 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 365 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 366 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 367 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 368 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 369 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 370 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 371 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 372 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 373 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 374 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 375 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 376 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 377 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 378 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 379 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 380 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 381 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 382 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 383 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 384 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 385 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 386 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 387 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 388 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 389 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 390 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 391 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 392 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 393 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 394 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 395 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 396 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 397 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 398 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 399 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 400 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 401 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.4 |
| Metatranscriptomes | 0 |
| Isolates | 6.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 8.39 |
| Nodule | 0.11 |
| Rhizoplane | 9.62 |
| Rhizosphere | 71.48 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10134797 | 3300013297 | Bacteria | 2289 |
| 2 | JGI24737J22298_10008519 | 3300001990 | Bacteria | 3428 |
| 3 | JGI24750J21931_1002359 | 3300002070 | Bacteria | 2279 |
| 4 | JGI24748J21848_1002939 | 3300002074 | Bacteria | 1941 |
| 5 | JGI24749J21850_1015492 | 3300002076 | Bacteria | 1069 |
| 6 | JGI24744J21845_10003469 | 3300002077 | Bacteria | 3242 |
| 7 | JGI24034J26672_10003741 | 3300002239 | Bacteria | 2129 |
| 8 | JGI24742J22300_10000256 | 3300002244 | Bacteria | 7906 |
| 9 | JGI24751J29686_10007130 | 3300002459 | Bacteria | 2286 |
| 10 | JGI25406J46586_10000561 | 3300003203 | Bacteria | 17546 |
| 11 | JGI25406J46586_10009101 | 3300003203 | Bacteria | 4458 |
| 12 | rootH2_10029196 | 3300003320 | Bacteria | 4774 |
| 13 | JGI25407J50210_10001654 | 3300003373 | Bacteria | 5099 |
| 14 | Ga0055540_1000224 | 3300003792 | Bacteria | 53433 |
| 15 | Ga0055540_1000638 | 3300003792 | Bacteria | 24867 |
| 16 | Ga0055540_1002195 | 3300003792 | Bacteria | 10612 |
| 17 | Ga0055540_1003480 | 3300003792 | Bacteria | 7595 |
| 18 | Ga0055540_1009335 | 3300003792 | Bacteria | 3401 |
| 19 | JGI25405J52794_10015821 | 3300003911 | Bacteria | 1485 |
| 20 | Ga0070676_10006401 | 3300005328 | Bacteria | 6291 |
| 21 | Ga0070676_10076885 | 3300005328 | Bacteria | 2016 |
| 22 | Ga0070683_100188763 | 3300005329 | Bacteria | 1957 |
| 23 | Ga0070666_10064939 | 3300005335 | Bacteria | 2476 |
| 24 | Ga0070666_10169424 | 3300005335 | Bacteria | 1529 |
| 25 | Ga0070682_100002498 | 3300005337 | Bacteria | 10156 |
| 26 | Ga0070682_100015971 | 3300005337 | Bacteria | 4360 |
| 27 | Ga0070682_100061262 | 3300005337 | Bacteria | 2381 |
| 28 | Ga0068868_100002197 | 3300005338 | Bacteria | 13465 |
| 29 | Ga0068868_100225302 | 3300005338 | Bacteria | 1571 |
| 30 | Ga0070660_100272893 | 3300005339 | Bacteria | 1383 |
| 31 | Ga0070689_100018845 | 3300005340 | Bacteria | 5094 |
| 32 | Ga0070689_100248362 | 3300005340 | Bacteria | 1467 |
| 33 | Ga0070691_10006195 | 3300005341 | Bacteria | 5459 |
| 34 | Ga0070692_10035217 | 3300005345 | Bacteria | 2533 |
| 35 | Ga0070668_100002008 | 3300005347 | Bacteria | 14877 |
| 36 | Ga0070668_100005862 | 3300005347 | Bacteria | 9109 |
| 37 | Ga0070668_100057308 | 3300005347 | Bacteria | 3010 |
| 38 | Ga0070668_100086399 | 3300005347 | Bacteria | 2466 |
| 39 | Ga0070669_100003185 | 3300005353 | Bacteria | 11798 |
| 40 | Ga0070669_100003801 | 3300005353 | Bacteria | 10908 |
| 41 | Ga0070674_100001890 | 3300005356 | Bacteria | 11371 |
| 42 | Ga0070674_100637400 | 3300005356 | Bacteria | 904 |
| 43 | Ga0070673_100276308 | 3300005364 | Bacteria | 1472 |
| 44 | Ga0070688_100006685 | 3300005365 | Bacteria | 6181 |
| 45 | Ga0070688_100107590 | 3300005365 | Bacteria | 1849 |
| 46 | Ga0070688_100356216 | 3300005365 | Bacteria | 1072 |
| 47 | Ga0070659_100006606 | 3300005366 | Bacteria | 8378 |
| 48 | Ga0070659_100491900 | 3300005366 | Bacteria | 1045 |
| 49 | Ga0070667_100000099 | 3300005367 | Bacteria | 108662 |
| 50 | Ga0070667_100001927 | 3300005367 | Bacteria | 18405 |
| 51 | Ga0070667_100003067 | 3300005367 | Bacteria | 14370 |
| 52 | Ga0070667_100186354 | 3300005367 | Bacteria | 1837 |
| 53 | Ga0070667_100438081 | 3300005367 | Bacteria | 1193 |
| 54 | Ga0070709_10006137 | 3300005434 | Bacteria | 6538 |
| 55 | Ga0070709_10045358 | 3300005434 | Bacteria | 2727 |
| 56 | Ga0070714_100005131 | 3300005435 | Bacteria | 9965 |
| 57 | Ga0070714_100024876 | 3300005435 | Bacteria | 4936 |
| 58 | Ga0070714_100069932 | 3300005435 | Bacteria | 3033 |
| 59 | Ga0070714_100186647 | 3300005435 | Bacteria | 1889 |
| 60 | Ga0070713_100050798 | 3300005436 | Bacteria | 3427 |
| 61 | Ga0070713_100104658 | 3300005436 | Bacteria | 2457 |
| 62 | Ga0070710_10002517 | 3300005437 | Bacteria | 8694 |
| 63 | Ga0070710_10046689 | 3300005437 | Bacteria | 2413 |
| 64 | Ga0070710_10060752 | 3300005437 | Bacteria | 2150 |
| 65 | Ga0070701_10002780 | 3300005438 | Bacteria | 6798 |
| 66 | Ga0070711_100002334 | 3300005439 | Bacteria | 10781 |
| 67 | Ga0070705_100031235 | 3300005440 | Bacteria | 2948 |
| 68 | Ga0070705_100249754 | 3300005440 | Bacteria | 1244 |
| 69 | Ga0070700_100006443 | 3300005441 | Bacteria | 6280 |
| 70 | Ga0070700_100170492 | 3300005441 | Bacteria | 1507 |
| 71 | Ga0070694_100032483 | 3300005444 | Bacteria | 3428 |
| 72 | Ga0070663_100003168 | 3300005455 | Bacteria | 9441 |
| 73 | Ga0070663_100003811 | 3300005455 | Bacteria | 8775 |
| 74 | Ga0070663_100045175 | 3300005455 | Bacteria | 3110 |
| 75 | Ga0070663_100249745 | 3300005455 | Bacteria | 1404 |
| 76 | Ga0070678_100000756 | 3300005456 | Bacteria | 16206 |
| 77 | Ga0070678_100134739 | 3300005456 | Bacteria | 1968 |
| 78 | Ga0070678_100246191 | 3300005456 | Bacteria | 1497 |
| 79 | Ga0070662_100006460 | 3300005457 | Bacteria | 7558 |
| 80 | Ga0070662_100023089 | 3300005457 | Bacteria | 4269 |
| 81 | Ga0070662_100024036 | 3300005457 | Bacteria | 4193 |
| 82 | Ga0070662_100074274 | 3300005457 | Bacteria | 2514 |
| 83 | Ga0068867_100003459 | 3300005459 | Bacteria | 11107 |
| 84 | Ga0068867_100176268 | 3300005459 | Bacteria | 1697 |
| 85 | Ga0070684_100820585 | 3300005535 | Bacteria | 870 |
| 86 | Ga0068853_100003045 | 3300005539 | Bacteria | 12804 |
| 87 | Ga0068853_100139121 | 3300005539 | Bacteria | 2179 |
| 88 | Ga0070695_100087204 | 3300005545 | Bacteria | 2076 |
| 89 | Ga0070696_100002281 | 3300005546 | Bacteria | 12645 |
| 90 | Ga0070693_100008418 | 3300005547 | Bacteria | 5085 |
| 91 | Ga0070693_100166396 | 3300005547 | Bacteria | 1409 |
| 92 | Ga0070665_100010952 | 3300005548 | Bacteria | 9171 |
| 93 | Ga0070665_100012066 | 3300005548 | Bacteria | 8716 |
| 94 | Ga0070665_100179534 | 3300005548 | Bacteria | 2118 |
| 95 | Ga0070665_100339486 | 3300005548 | Bacteria | 1507 |
| 96 | Ga0070704_100001654 | 3300005549 | Bacteria | 12080 |
| 97 | Ga0068854_100002834 | 3300005578 | Bacteria | 10772 |
| 98 | Ga0068854_100053305 | 3300005578 | Bacteria | 2904 |
| 99 | Ga0068854_100083310 | 3300005578 | Bacteria | 2365 |
| 100 | Ga0068854_100161019 | 3300005578 | Bacteria | 1738 |
| 101 | Ga0068854_100362087 | 3300005578 | Bacteria | 1190 |
| 102 | Ga0068856_100039659 | 3300005614 | Bacteria | 4624 |
| 103 | Ga0070702_100000598 | 3300005615 | Bacteria | 13237 |
| 104 | Ga0070702_100055618 | 3300005615 | Bacteria | 2282 |
| 105 | Ga0070702_100279135 | 3300005615 | Bacteria | 1146 |
| 106 | Ga0070702_100464409 | 3300005615 | Bacteria | 921 |
| 107 | Ga0068852_100321797 | 3300005616 | Bacteria | 1502 |
| 108 | Ga0068852_100549849 | 3300005616 | Bacteria | 1155 |
| 109 | Ga0068852_100853838 | 3300005616 | Bacteria | 926 |
| 110 | Ga0068859_100159534 | 3300005617 | Bacteria | 2334 |
| 111 | Ga0068864_100374755 | 3300005618 | Bacteria | 1347 |
| 112 | Ga0068864_100746491 | 3300005618 | Bacteria | 959 |
| 113 | Ga0068861_100002278 | 3300005719 | Bacteria | 12452 |
| 114 | Ga0068861_100117472 | 3300005719 | Bacteria | 2140 |
| 115 | Ga0068861_100227457 | 3300005719 | Bacteria | 1580 |
| 116 | Ga0068861_100256686 | 3300005719 | Bacteria | 1494 |
| 117 | Ga0068861_100446717 | 3300005719 | Bacteria | 1158 |
| 118 | Ga0068863_100001544 | 3300005841 | Bacteria | 22729 |
| 119 | Ga0068863_100255560 | 3300005841 | Bacteria | 1693 |
| 120 | Ga0068858_100006943 | 3300005842 | Bacteria | 11004 |
| 121 | Ga0068858_100079396 | 3300005842 | Bacteria | 3049 |
| 122 | Ga0068858_100430484 | 3300005842 | Bacteria | 1270 |
| 123 | Ga0068860_100000163 | 3300005843 | Bacteria | 108836 |
| 124 | Ga0068860_100005668 | 3300005843 | Bacteria | 12610 |
| 125 | Ga0068862_100000089 | 3300005844 | Bacteria | 109047 |
| 126 | Ga0081455_10000960 | 3300005937 | Bacteria | 36843 |
| 127 | Ga0081455_10001006 | 3300005937 | Bacteria | 35740 |
| 128 | Ga0081455_10015441 | 3300005937 | Bacteria | 7420 |
| 129 | Ga0081455_10023737 | 3300005937 | Bacteria | 5699 |
| 130 | Ga0081455_10037388 | 3300005937 | Bacteria | 4313 |
| 131 | Ga0081455_10039180 | 3300005937 | Bacteria | 4191 |
| 132 | Ga0081455_10088813 | 3300005937 | Bacteria | 2510 |
| 133 | Ga0081455_10297549 | 3300005937 | Bacteria | 1159 |
| 134 | Ga0081538_10000350 | 3300005981 | Bacteria | 52656 |
| 135 | Ga0081538_10037698 | 3300005981 | Bacteria | 3130 |
| 136 | Ga0081539_10000177 | 3300005985 | Bacteria | 149939 |
| 137 | Ga0081539_10000208 | 3300005985 | Bacteria | 136941 |
| 138 | Ga0075365_10004072 | 3300006038 | Bacteria | 7674 |
| 139 | Ga0075365_10018618 | 3300006038 | Bacteria | 4273 |
| 140 | Ga0075365_10036173 | 3300006038 | Bacteria | 3199 |
| 141 | Ga0075365_10255222 | 3300006038 | Bacteria | 1232 |
| 142 | Ga0075363_100002325 | 3300006048 | Bacteria | 7724 |
| 143 | Ga0075363_100004070 | 3300006048 | Bacteria | 6332 |
| 144 | Ga0075363_100007457 | 3300006048 | Bacteria | 5031 |
| 145 | Ga0075363_100010027 | 3300006048 | Bacteria | 4477 |
| 146 | Ga0075363_100029559 | 3300006048 | Bacteria | 2830 |
| 147 | Ga0075363_100033350 | 3300006048 | Bacteria | 2680 |
| 148 | Ga0075363_100215888 | 3300006048 | Bacteria | 1099 |
| 149 | Ga0075364_10004891 | 3300006051 | Bacteria | 7764 |
| 150 | Ga0075364_10005390 | 3300006051 | Bacteria | 7427 |
| 151 | Ga0075364_10010736 | 3300006051 | Bacteria | 5541 |
| 152 | Ga0075364_10253633 | 3300006051 | Bacteria | 1196 |
| 153 | Ga0075364_10283997 | 3300006051 | Bacteria | 1126 |
| 154 | Ga0075432_10000656 | 3300006058 | Bacteria | 10582 |
| 155 | Ga0075432_10002493 | 3300006058 | Bacteria | 6118 |
| 156 | Ga0070715_10077959 | 3300006163 | Bacteria | 1497 |
| 157 | Ga0070716_100026600 | 3300006173 | Bacteria | 3099 |
| 158 | Ga0070712_100002169 | 3300006175 | Bacteria | 12073 |
| 159 | Ga0075362_10074410 | 3300006177 | Bacteria | 1556 |
| 160 | Ga0075362_10093730 | 3300006177 | Bacteria | 1397 |
| 161 | Ga0075367_10019928 | 3300006178 | Bacteria | 3727 |
| 162 | Ga0075367_10027141 | 3300006178 | Bacteria | 3254 |
| 163 | Ga0075367_10046966 | 3300006178 | Bacteria | 2538 |
| 164 | Ga0075369_10010520 | 3300006186 | Bacteria | 3619 |
| 165 | Ga0075369_10024117 | 3300006186 | Bacteria | 2519 |
| 166 | Ga0075369_10039578 | 3300006186 | Bacteria | 2013 |
| 167 | Ga0097621_100065638 | 3300006237 | Bacteria | 2988 |
| 168 | Ga0097621_100148069 | 3300006237 | Bacteria | 2012 |
| 169 | Ga0075370_10176872 | 3300006353 | Bacteria | 1255 |
| 170 | Ga0075370_10208702 | 3300006353 | Bacteria | 1153 |
| 171 | Ga0068871_100386129 | 3300006358 | Bacteria | 1245 |
| 172 | Ga0075428_100003868 | 3300006844 | Bacteria | 16449 |
| 173 | Ga0075428_100005349 | 3300006844 | Bacteria | 14275 |
| 174 | Ga0075428_100098420 | 3300006844 | Bacteria | 3189 |
| 175 | Ga0075430_100206146 | 3300006846 | Bacteria | 1632 |
| 176 | Ga0075430_100365266 | 3300006846 | Bacteria | 1192 |
| 177 | Ga0075431_100005313 | 3300006847 | Bacteria | 12699 |
| 178 | Ga0075431_100098407 | 3300006847 | Bacteria | 3020 |
| 179 | Ga0075433_10012690 | 3300006852 | Bacteria | 6818 |
| 180 | Ga0075433_10031857 | 3300006852 | Bacteria | 4511 |
| 181 | Ga0075434_100002464 | 3300006871 | Bacteria | 16286 |
| 182 | Ga0075434_100009840 | 3300006871 | Bacteria | 8940 |
| 183 | Ga0075429_100226184 | 3300006880 | Bacteria | 1639 |
| 184 | Ga0068865_100005190 | 3300006881 | Bacteria | 7876 |
| 185 | Ga0068865_100025998 | 3300006881 | Bacteria | 3855 |
| 186 | Ga0068865_100082211 | 3300006881 | Bacteria | 2315 |
| 187 | Ga0068865_100157136 | 3300006881 | Bacteria | 1731 |
| 188 | Ga0075436_100010325 | 3300006914 | Bacteria | 6397 |
| 189 | Ga0075436_100107687 | 3300006914 | Bacteria | 1944 |
| 190 | Ga0097620_100159520 | 3300006931 | Bacteria | 2334 |
| 191 | Ga0075435_100037694 | 3300007076 | Bacteria | 3851 |
| 192 | Ga0075435_100280488 | 3300007076 | Bacteria | 1422 |
| 193 | Ga0105250_10024692 | 3300009092 | Bacteria | 2421 |
| 194 | Ga0105240_10660461 | 3300009093 | Bacteria | 1145 |
| 195 | Ga0111539_10001067 | 3300009094 | Bacteria | 36168 |
| 196 | Ga0111539_10002580 | 3300009094 | Bacteria | 23985 |
| 197 | Ga0111539_10065758 | 3300009094 | Bacteria | 4283 |
| 198 | Ga0105245_10003222 | 3300009098 | Bacteria | 14618 |
| 199 | Ga0105245_10153586 | 3300009098 | Bacteria | 2179 |
| 200 | Ga0105245_10154976 | 3300009098 | Bacteria | 2169 |
| 201 | Ga0105245_10413592 | 3300009098 | Bacteria | 1350 |
| 202 | Ga0105245_10670808 | 3300009098 | Bacteria | 1068 |
| 203 | Ga0105245_11145297 | 3300009098 | Bacteria | 825 |
| 204 | Ga0105247_10000089 | 3300009101 | Bacteria | 98925 |
| 205 | Ga0105247_10000789 | 3300009101 | Bacteria | 24300 |
| 206 | Ga0105247_10367976 | 3300009101 | Bacteria | 1016 |
| 207 | Ga0114129_10004878 | 3300009147 | Bacteria | 18928 |
| 208 | Ga0114129_10022481 | 3300009147 | Bacteria | 8950 |
| 209 | Ga0105243_10000750 | 3300009148 | Bacteria | 31118 |
| 210 | Ga0105243_10001257 | 3300009148 | Bacteria | 22766 |
| 211 | Ga0105243_10011698 | 3300009148 | Bacteria | 6638 |
| 212 | Ga0105243_10078344 | 3300009148 | Bacteria | 2690 |
| 213 | Ga0105243_10198101 | 3300009148 | Bacteria | 1759 |
| 214 | Ga0105243_10228889 | 3300009148 | Bacteria | 1648 |
| 215 | Ga0105241_10190536 | 3300009174 | Bacteria | 1707 |
| 216 | Ga0105242_10000963 | 3300009176 | Bacteria | 22475 |
| 217 | Ga0105242_10041923 | 3300009176 | Bacteria | 3694 |
| 218 | Ga0105248_10000759 | 3300009177 | Bacteria | 36159 |
| 219 | Ga0105248_10005751 | 3300009177 | Bacteria | 13624 |
| 220 | Ga0105248_10019990 | 3300009177 | Bacteria | 7414 |
| 221 | Ga0105237_10005264 | 3300009545 | Bacteria | 14636 |
| 222 | Ga0105237_10051567 | 3300009545 | Bacteria | 4132 |
| 223 | Ga0105237_10074798 | 3300009545 | Bacteria | 3379 |
| 224 | Ga0105237_10424447 | 3300009545 | Bacteria | 1335 |
| 225 | Ga0105237_10932101 | 3300009545 | Bacteria | 875 |
| 226 | Ga0105238_10352577 | 3300009551 | Bacteria | 1460 |
| 227 | Ga0105249_10000117 | 3300009553 | Bacteria | 108322 |
| 228 | Ga0105249_10001051 | 3300009553 | Bacteria | 24454 |
| 229 | Ga0105249_10013331 | 3300009553 | Bacteria | 7258 |
| 230 | Ga0105249_10020582 | 3300009553 | Bacteria | 5899 |
| 231 | Ga0105249_10169468 | 3300009553 | Bacteria | 2116 |
| 232 | Ga0105239_10085231 | 3300010375 | Bacteria | 3481 |
| 233 | Ga0105239_10141564 | 3300010375 | Bacteria | 2680 |
| 234 | Ga0105239_10272391 | 3300010375 | Bacteria | 1904 |
| 235 | Ga0105239_11241536 | 3300010375 | Bacteria | 859 |
| 236 | Ga0157371_10135563 | 3300013102 | Bacteria | 1753 |
| 237 | Ga0157371_10401226 | 3300013102 | Unclassified | 1003 |
| 238 | Ga0157374_10033602 | 3300013296 | Bacteria | 4681 |
| 239 | Ga0157378_10002445 | 3300013297 | Bacteria | 16526 |
| 240 | Ga0157378_10675430 | 3300013297 | Bacteria | 1050 |
| 241 | Ga0163162_10013672 | 3300013306 | Bacteria | 7931 |
| 242 | Ga0163162_10044867 | 3300013306 | Bacteria | 4428 |
| 243 | Ga0163162_10082635 | 3300013306 | Bacteria | 3284 |
| 244 | Ga0163162_10157074 | 3300013306 | Bacteria | 2395 |
| 245 | Ga0163162_10613772 | 3300013306 | Bacteria | 1213 |
| 246 | Ga0157372_10016723 | 3300013307 | Bacteria | 7874 |
| 247 | Ga0157375_10011656 | 3300013308 | Bacteria | 7767 |
| 248 | Ga0157375_10069720 | 3300013308 | Bacteria | 3523 |
| 249 | Ga0157375_10196913 | 3300013308 | Bacteria | 2170 |
| 250 | Ga0157375_10608751 | 3300013308 | Bacteria | 1251 |
| 251 | Ga0157375_10793531 | 3300013308 | Bacteria | 1096 |
| 252 | Ga0163163_10113908 | 3300014325 | Bacteria | 2735 |
| 253 | Ga0163163_10633755 | 3300014325 | Bacteria | 1132 |
| 254 | Ga0157380_10003822 | 3300014326 | Bacteria | 10370 |
| 255 | Ga0157380_10249288 | 3300014326 | Bacteria | 1606 |
| 256 | Ga0157380_10421896 | 3300014326 | Bacteria | 1273 |
| 257 | Ga0157380_10962613 | 3300014326 | Bacteria | 884 |
| 258 | Ga0157377_10008125 | 3300014745 | Bacteria | 5102 |
| 259 | Ga0157379_10015349 | 3300014968 | Bacteria | 6720 |
| 260 | Ga0157379_10610045 | 3300014968 | Bacteria | 1019 |
| 261 | Ga0163161_10050877 | 3300017792 | Bacteria | 2999 |
| 262 | Ga0163161_10101657 | 3300017792 | Bacteria | 2140 |
| 263 | Ga0163161_10538727 | 3300017792 | Bacteria | 955 |
| 264 | Ga0213876_10007573 | 3300021384 | Bacteria | 5896 |
| 265 | Ga0213876_10057069 | 3300021384 | Bacteria | 2061 |
| 266 | Ga0209025_1071975 | 3300025294 | Bacteria | 1221 |
| 267 | Ga0209051_1000014 | 3300025303 | Bacteria | 552732 |
| 268 | Ga0209051_1000649 | 3300025303 | Bacteria | 39520 |
| 269 | Ga0209051_1017134 | 3300025303 | Bacteria | 3248 |
| 270 | Ga0207682_10079290 | 3300025893 | Bacteria | 1404 |
| 271 | Ga0207692_10070073 | 3300025898 | Bacteria | 1844 |
| 272 | Ga0207642_10001963 | 3300025899 | Bacteria | 6348 |
| 273 | Ga0207710_10000117 | 3300025900 | Bacteria | 98934 |
| 274 | Ga0207710_10002764 | 3300025900 | Bacteria | 8027 |
| 275 | Ga0207688_10004112 | 3300025901 | Bacteria | 7931 |
| 276 | Ga0207688_10025078 | 3300025901 | Bacteria | 3272 |
| 277 | Ga0207688_10041216 | 3300025901 | Bacteria | 2568 |
| 278 | Ga0207688_10098058 | 3300025901 | Bacteria | 1689 |
| 279 | Ga0207688_10148614 | 3300025901 | Bacteria | 1383 |
| 280 | Ga0207680_10025388 | 3300025903 | Bacteria | 3268 |
| 281 | Ga0207680_10175026 | 3300025903 | Bacteria | 1448 |
| 282 | Ga0207647_10062110 | 3300025904 | Bacteria | 2277 |
| 283 | Ga0207685_10058280 | 3300025905 | Bacteria | 1519 |
| 284 | Ga0207699_10063575 | 3300025906 | Bacteria | 2230 |
| 285 | Ga0207699_10107364 | 3300025906 | Bacteria | 1783 |
| 286 | Ga0207645_10004678 | 3300025907 | Bacteria | 10074 |
| 287 | Ga0207645_10017935 | 3300025907 | Bacteria | 4667 |
| 288 | Ga0207705_10211588 | 3300025909 | Bacteria | 1471 |
| 289 | Ga0207654_10059311 | 3300025911 | Bacteria | 2231 |
| 290 | Ga0207671_10029890 | 3300025914 | Bacteria | 4066 |
| 291 | Ga0207671_10305666 | 3300025914 | Bacteria | 1257 |
| 292 | Ga0207693_10003426 | 3300025915 | Bacteria | 13530 |
| 293 | Ga0207693_10003579 | 3300025915 | Bacteria | 13280 |
| 294 | Ga0207693_10362631 | 3300025915 | Bacteria | 1134 |
| 295 | Ga0207663_10000867 | 3300025916 | Bacteria | 13745 |
| 296 | Ga0207663_10050520 | 3300025916 | Bacteria | 2584 |
| 297 | Ga0207657_10348721 | 3300025919 | Bacteria | 1168 |
| 298 | Ga0207681_10000981 | 3300025923 | Bacteria | 18645 |
| 299 | Ga0207681_10003890 | 3300025923 | Bacteria | 9273 |
| 300 | Ga0207681_10448070 | 3300025923 | Bacteria | 1050 |
| 301 | Ga0207694_10201362 | 3300025924 | Bacteria | 1620 |
| 302 | Ga0207687_10001539 | 3300025927 | Bacteria | 15831 |
| 303 | Ga0207687_10064402 | 3300025927 | Bacteria | 2599 |
| 304 | Ga0207687_10104853 | 3300025927 | Bacteria | 2088 |
| 305 | Ga0207700_10039701 | 3300025928 | Bacteria | 3429 |
| 306 | Ga0207700_10130438 | 3300025928 | Bacteria | 2051 |
| 307 | Ga0207664_10055373 | 3300025929 | Bacteria | 3147 |
| 308 | Ga0207664_10135649 | 3300025929 | Bacteria | 2077 |
| 309 | Ga0207664_10139816 | 3300025929 | Bacteria | 2047 |
| 310 | Ga0207664_10476243 | 3300025929 | Bacteria | 1116 |
| 311 | Ga0207664_10542340 | 3300025929 | Bacteria | 1043 |
| 312 | Ga0207644_10022462 | 3300025931 | Bacteria | 4310 |
| 313 | Ga0207644_10179092 | 3300025931 | Bacteria | 1660 |
| 314 | Ga0207690_10089896 | 3300025932 | Bacteria | 2166 |
| 315 | Ga0207706_10003642 | 3300025933 | Bacteria | 14716 |
| 316 | Ga0207706_10013964 | 3300025933 | Bacteria | 7282 |
| 317 | Ga0207706_10089652 | 3300025933 | Bacteria | 2704 |
| 318 | Ga0207686_10036566 | 3300025934 | Bacteria | 2957 |
| 319 | Ga0207686_10090564 | 3300025934 | Bacteria | 2018 |
| 320 | Ga0207709_10001151 | 3300025935 | Bacteria | 19257 |
| 321 | Ga0207709_10001566 | 3300025935 | Bacteria | 15676 |
| 322 | Ga0207709_10044571 | 3300025935 | Bacteria | 2681 |
| 323 | Ga0207709_10195296 | 3300025935 | Bacteria | 1441 |
| 324 | Ga0207709_10223529 | 3300025935 | Bacteria | 1359 |
| 325 | Ga0207670_10110788 | 3300025936 | Bacteria | 1978 |
| 326 | Ga0207669_10000548 | 3300025937 | Bacteria | 16351 |
| 327 | Ga0207669_10241713 | 3300025937 | Bacteria | 1339 |
| 328 | Ga0207704_10002430 | 3300025938 | Bacteria | 8379 |
| 329 | Ga0207704_10044280 | 3300025938 | Bacteria | 2636 |
| 330 | Ga0207704_10072209 | 3300025938 | Bacteria | 2193 |
| 331 | Ga0207704_10125956 | 3300025938 | Bacteria | 1764 |
| 332 | Ga0207704_10340214 | 3300025938 | Unclassified | 1164 |
| 333 | Ga0207665_10007609 | 3300025939 | Bacteria | 7154 |
| 334 | Ga0207665_10010595 | 3300025939 | Bacteria | 6056 |
| 335 | Ga0207711_10002505 | 3300025941 | Bacteria | 16371 |
| 336 | Ga0207711_10006754 | 3300025941 | Bacteria | 9646 |
| 337 | Ga0207711_10119077 | 3300025941 | Bacteria | 2356 |
| 338 | Ga0207689_10020743 | 3300025942 | Bacteria | 5526 |
| 339 | Ga0207689_10170004 | 3300025942 | Bacteria | 1796 |
| 340 | Ga0207679_10825414 | 3300025945 | Bacteria | 846 |
| 341 | Ga0207667_10116751 | 3300025949 | Bacteria | 2750 |
| 342 | Ga0207712_10000083 | 3300025961 | Bacteria | 108319 |
| 343 | Ga0207712_10008133 | 3300025961 | Bacteria | 6635 |
| 344 | Ga0207712_10448487 | 3300025961 | Bacteria | 1094 |
| 345 | Ga0207668_10011317 | 3300025972 | Bacteria | 5415 |
| 346 | Ga0207668_10024543 | 3300025972 | Bacteria | 3893 |
| 347 | Ga0207668_10351183 | 3300025972 | Bacteria | 1233 |
| 348 | Ga0207668_10647212 | 3300025972 | Bacteria | 925 |
| 349 | Ga0207640_10022189 | 3300025981 | Bacteria | 3795 |
| 350 | Ga0207640_10076831 | 3300025981 | Bacteria | 2268 |
| 351 | Ga0207640_10124896 | 3300025981 | Bacteria | 1851 |
| 352 | Ga0207640_10172078 | 3300025981 | Bacteria | 1615 |
| 353 | Ga0207640_10283957 | 3300025981 | Bacteria | 1302 |
| 354 | Ga0207658_10014847 | 3300025986 | Bacteria | 5337 |
| 355 | Ga0207658_10155624 | 3300025986 | Bacteria | 1867 |
| 356 | Ga0207677_10001615 | 3300026023 | Bacteria | 11954 |
| 357 | Ga0207703_10011161 | 3300026035 | Bacteria | 6991 |
| 358 | Ga0207703_10060130 | 3300026035 | Bacteria | 3106 |
| 359 | Ga0207703_10155123 | 3300026035 | Bacteria | 2000 |
| 360 | Ga0207703_10213120 | 3300026035 | Bacteria | 1723 |
| 361 | Ga0207639_10002209 | 3300026041 | Bacteria | 13112 |
| 362 | Ga0207639_10025226 | 3300026041 | Bacteria | 4310 |
| 363 | Ga0207678_10000033 | 3300026067 | Bacteria | 105464 |
| 364 | Ga0207678_10044189 | 3300026067 | Bacteria | 3854 |
| 365 | Ga0207678_10286429 | 3300026067 | Bacteria | 1415 |
| 366 | Ga0207678_10475365 | 3300026067 | Bacteria | 1088 |
| 367 | Ga0207708_10005099 | 3300026075 | Bacteria | 9691 |
| 368 | Ga0207708_10020907 | 3300026075 | Bacteria | 4938 |
| 369 | Ga0207708_10035565 | 3300026075 | Bacteria | 3790 |
| 370 | Ga0207702_10027519 | 3300026078 | Bacteria | 4722 |
| 371 | Ga0207702_10462864 | 3300026078 | Bacteria | 1232 |
| 372 | Ga0207641_10001265 | 3300026088 | Bacteria | 25170 |
| 373 | Ga0207641_10005115 | 3300026088 | Bacteria | 11233 |
| 374 | Ga0207641_10250521 | 3300026088 | Bacteria | 1654 |
| 375 | Ga0207648_10001134 | 3300026089 | Bacteria | 29924 |
| 376 | Ga0207648_10193084 | 3300026089 | Bacteria | 1805 |
| 377 | Ga0207676_10247514 | 3300026095 | Bacteria | 1603 |
| 378 | Ga0207676_10697129 | 3300026095 | Bacteria | 983 |
| 379 | Ga0207675_100003626 | 3300026118 | Bacteria | 15059 |
| 380 | Ga0207675_100012534 | 3300026118 | Bacteria | 7919 |
| 381 | Ga0207675_100084687 | 3300026118 | Bacteria | 2975 |
| 382 | Ga0207675_100143011 | 3300026118 | Bacteria | 2273 |
| 383 | Ga0207675_100268882 | 3300026118 | Bacteria | 1654 |
| 384 | Ga0207675_100382278 | 3300026118 | Bacteria | 1385 |
| 385 | Ga0207683_10001167 | 3300026121 | Bacteria | 23768 |
| 386 | Ga0207683_10022192 | 3300026121 | Bacteria | 5448 |
| 387 | Ga0207683_10086046 | 3300026121 | Bacteria | 2795 |
| 388 | Ga0207683_10260258 | 3300026121 | Bacteria | 1584 |
| 389 | Ga0207698_10525432 | 3300026142 | Bacteria | 1156 |
| 390 | Ga0207428_10002324 | 3300027907 | Bacteria | 19038 |
| 391 | Ga0207428_10005586 | 3300027907 | Bacteria | 11694 |
| 392 | Ga0207428_10222363 | 3300027907 | Bacteria | 1415 |
| 393 | Ga0268266_10017220 | 3300028379 | Bacteria | 6171 |
| 394 | Ga0268266_10048488 | 3300028379 | Bacteria | 3641 |
| 395 | Ga0268266_10099338 | 3300028379 | Bacteria | 2562 |
| 396 | Ga0268266_10128750 | 3300028379 | Bacteria | 2262 |
| 397 | Ga0268266_10181683 | 3300028379 | Bacteria | 1916 |
| 398 | Ga0268265_10000099 | 3300028380 | Bacteria | 109591 |
| 399 | Ga0268265_10170717 | 3300028380 | Bacteria | 1858 |
| 400 | Ga0268264_10000225 | 3300028381 | Bacteria | 109852 |
| 401 | Ga0268264_10003305 | 3300028381 | Bacteria | 13927 |
| 402 | Ga0268264_10549046 | 3300028381 | Bacteria | 1133 |
| 403 | Ga0268264_10576725 | 3300028381 | Bacteria | 1106 |
| 404 | Ga0307515_10056052 | 3300028794 | Bacteria | 5739 |
| 405 | Ga0307515_10170871 | 3300028794 | Bacteria | 2167 |
| 406 | Ga0307512_10004437 | 3300030522 | Bacteria | 15365 |
| 407 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 408 | Ga0265327_10000113 | 3300031251 | Bacteria | 175267 |
| 409 | Ga0265327_10001712 | 3300031251 | Bacteria | 26120 |
| 410 | Ga0265327_10012873 | 3300031251 | Bacteria | 5603 |
| 411 | Ga0307408_100021224 | 3300031548 | Bacteria | 4393 |
| 412 | Ga0307408_100021790 | 3300031548 | Bacteria | 4342 |
| 413 | Ga0307408_100080051 | 3300031548 | Bacteria | 2439 |
| 414 | Ga0307405_10011820 | 3300031731 | Bacteria | 4595 |
| 415 | Ga0307405_10120053 | 3300031731 | Bacteria | 1797 |
| 416 | Ga0307405_10171850 | 3300031731 | Unclassified | 1547 |
| 417 | Ga0307405_10457330 | 3300031731 | Unclassified | 1013 |
| 418 | Ga0307413_10005578 | 3300031824 | Bacteria | 5637 |
| 419 | Ga0307413_10006466 | 3300031824 | Bacteria | 5356 |
| 420 | Ga0307413_10014889 | 3300031824 | Bacteria | 3968 |
| 421 | Ga0307413_10182836 | 3300031824 | Bacteria | 1497 |
| 422 | Ga0307518_10000474 | 3300031838 | Bacteria | 30579 |
| 423 | Ga0307518_10008681 | 3300031838 | Bacteria | 7259 |
| 424 | Ga0307410_10000323 | 3300031852 | Bacteria | 18618 |
| 425 | Ga0307410_10007648 | 3300031852 | Bacteria | 5928 |
| 426 | Ga0307410_10078510 | 3300031852 | Bacteria | 2311 |
| 427 | Ga0307410_10090479 | 3300031852 | Bacteria | 2170 |
| 428 | Ga0307406_10001419 | 3300031901 | Bacteria | 13274 |
| 429 | Ga0307406_10008727 | 3300031901 | Bacteria | 5664 |
| 430 | Ga0307406_10237404 | 3300031901 | Bacteria | 1365 |
| 431 | Ga0307407_10004733 | 3300031903 | Bacteria | 5819 |
| 432 | Ga0307407_10039837 | 3300031903 | Bacteria | 2615 |
| 433 | Ga0307407_10114423 | 3300031903 | Bacteria | 1699 |
| 434 | Ga0307412_10007342 | 3300031911 | Bacteria | 6249 |
| 435 | Ga0307412_10023055 | 3300031911 | Bacteria | 3826 |
| 436 | Ga0307409_100002136 | 3300031995 | Bacteria | 10185 |
| 437 | Ga0307409_100028131 | 3300031995 | Bacteria | 3998 |
| 438 | Ga0307409_100034938 | 3300031995 | Bacteria | 3678 |
| 439 | Ga0307409_100085664 | 3300031995 | Bacteria | 2562 |
| 440 | Ga0307409_100216541 | 3300031995 | Bacteria | 1725 |
| 441 | Ga0307409_100332781 | 3300031995 | Bacteria | 1426 |
| 442 | Ga0307416_100000046 | 3300032002 | Bacteria | 120916 |
| 443 | Ga0307416_100011055 | 3300032002 | Bacteria | 5998 |
| 444 | Ga0307416_100392199 | 3300032002 | Bacteria | 1423 |
| 445 | Ga0307414_10004676 | 3300032004 | Bacteria | 7462 |
| 446 | Ga0307414_10090784 | 3300032004 | Bacteria | 2268 |
| 447 | Ga0307414_10274876 | 3300032004 | Bacteria | 1413 |
| 448 | Ga0307411_10000436 | 3300032005 | Bacteria | 14249 |
| 449 | Ga0307411_10038704 | 3300032005 | Bacteria | 3010 |
| 450 | Ga0307415_100000401 | 3300032126 | Bacteria | 18454 |
| 451 | Ga0307415_100071255 | 3300032126 | Bacteria | 2443 |
| 452 | Ga0307415_100080416 | 3300032126 | Bacteria | 2325 |
| 453 | Ga0307415_100250182 | 3300032126 | Bacteria | 1439 |
| 454 | Ga0316583_10023557 | 3300032133 | Bacteria | 2199 |
| 455 | Ga0307507_10030415 | 3300033179 | Bacteria | 5696 |
| 456 | Ga0307507_10254176 | 3300033179 | Bacteria | 1131 |
| 457 | Ga0373949_0026112 | 3300035090 | Bacteria | 1367 |
| 458 | Ga0373962_0041304 | 3300035242 | Bacteria | 1300 |
| 459 | Ga0373931_0012026 | 3300035691 | Bacteria | 4189 |
| 460 | Ga0373931_0067399 | 3300035691 | Bacteria | 1945 |
| 461 | Ga0373947_0084518 | 3300035725 | Bacteria | 1970 |
| 462 | Ga0316584_0061259 | 3300036712 | Bacteria | 2818 |
| 463 | Ga0436364_0197209 | 3300037853 | Bacteria | 9790 |
| 464 | Ga0436365_0175886 | 3300039437 | Bacteria | 3447 |
| 465 | Ga0436365_0204440 | 3300039437 | Bacteria | 69949 |
| 466 | Ga0436365_0584104 | 3300039437 | Bacteria | 949 |
| 467 | Ga0436363_1366560 | 3300039450 | Bacteria | 2386 |
| 468 | Ga0439461_0003303 | 3300041410 | Bacteria | 2648 |
| 469 | Ga0439461_0028679 | 3300041410 | Bacteria | 1148 |
| 470 | Ga0439466_0001673 | 3300041411 | Bacteria | 8658 |
| 471 | Ga0439466_0015252 | 3300041411 | Bacteria | 2792 |
| 472 | Ga0439465_0003497 | 3300041413 | Bacteria | 5120 |
| 473 | Ga0439465_0009288 | 3300041413 | Bacteria | 3097 |
| 474 | Ga0451791_0138042 | 3300041451 | Bacteria | 812 |
| 475 | Ga0451833_1190084 | 3300041491 | Bacteria | 2640 |
| 476 | Ga0451837_0583427 | 3300041494 | Bacteria | 1708 |
| 477 | Ga0451853_1890043 | 3300041512 | Bacteria | 2867 |
| 478 | Ga0451853_3823848 | 3300041512 | Bacteria | 7397 |
| 479 | Ga0439431_0015082 | 3300041997 | Bacteria | 1796 |
| 480 | Ga0439431_0019303 | 3300041997 | Bacteria | 1620 |
| 481 | Ga0439442_009060 | 3300042002 | Bacteria | 2012 |
| 482 | Ga0439442_025376 | 3300042002 | Bacteria | 1233 |
| 483 | Ga0439445_0012234 | 3300042004 | Bacteria | 2059 |
| 484 | Ga0439445_0045596 | 3300042004 | Bacteria | 1173 |
| 485 | Ga0439448_0019001 | 3300042005 | Bacteria | 2112 |
| 486 | Ga0439450_005997 | 3300042008 | Bacteria | 2167 |
| 487 | Ga0439463_000935 | 3300042016 | Bacteria | 8012 |
| 488 | Ga0439463_035877 | 3300042016 | Bacteria | 1256 |
| 489 | Ga0450900_021040 | 3300042136 | Bacteria | 909 |
| 490 | Ga0439440_0002422 | 3300042993 | Bacteria | 3529 |
| 491 | Ga0466969_0028410 | 3300044656 | Bacteria | 2859 |
| 492 | Ga0466972_0001388 | 3300044658 | Bacteria | 11749 |
| 493 | Ga0466972_0003436 | 3300044658 | Bacteria | 7854 |
| 494 | Ga0466972_0038369 | 3300044658 | Bacteria | 2340 |
| 495 | Ga0466972_0052629 | 3300044658 | Bacteria | 1961 |
| 496 | Ga0466972_0092234 | 3300044658 | Bacteria | 1436 |
| 497 | Ga0466965_0000276 | 3300044683 | Bacteria | 16929 |
| 498 | Ga0466965_0000672 | 3300044683 | Bacteria | 12575 |
| 499 | Ga0466965_0020433 | 3300044683 | Bacteria | 3183 |
| 500 | Ga0466965_0033639 | 3300044683 | Bacteria | 2506 |
| 501 | Ga0466965_0152438 | 3300044683 | Bacteria | 1208 |
| 502 | Ga0466965_0217495 | 3300044683 | Bacteria | 1018 |
| 503 | Ga0466966_0007657 | 3300044684 | Bacteria | 7158 |
| 504 | Ga0466966_0046479 | 3300044684 | Bacteria | 2771 |
| 505 | Ga0466961_0008084 | 3300044693 | Bacteria | 6704 |
| 506 | Ga0466961_0048460 | 3300044693 | Bacteria | 2715 |
| 507 | Ga0466963_0016619 | 3300044694 | Bacteria | 4578 |
| 508 | Ga0466963_0177531 | 3300044694 | Bacteria | 1486 |
| 509 | Ga0466963_0242473 | 3300044694 | Bacteria | 1264 |
| 510 | Ga0466964_0079923 | 3300044706 | Bacteria | 1401 |
| 511 | Ga0466971_0004305 | 3300044719 | Bacteria | 6137 |
| 512 | Ga0466971_0029624 | 3300044719 | Bacteria | 2448 |
| 513 | Ga0466971_0042574 | 3300044719 | Bacteria | 2041 |
| 514 | Ga0466968_0000522 | 3300044735 | Bacteria | 13039 |
| 515 | Ga0466968_0003228 | 3300044735 | Bacteria | 6011 |
| 516 | Ga0466968_0017269 | 3300044735 | Bacteria | 2883 |
| 517 | Ga0466968_0070613 | 3300044735 | Bacteria | 1520 |
| 518 | Ga0466970_0013085 | 3300044765 | Bacteria | 4252 |
| 519 | Ga0466970_0013332 | 3300044765 | Bacteria | 4214 |
| 520 | Ga0466970_0026952 | 3300044765 | Bacteria | 3013 |
| 521 | Ga0466957_0006946 | 3300044842 | Bacteria | 6401 |
| 522 | Ga0466957_0010454 | 3300044842 | Bacteria | 5330 |
| 523 | Ga0466957_0040976 | 3300044842 | Bacteria | 2800 |
| 524 | Ga0466957_0090237 | 3300044842 | Bacteria | 1919 |
| 525 | Ga0466957_0358888 | 3300044842 | Bacteria | 990 |
| 526 | Ga0466960_0000899 | 3300044901 | Bacteria | 10526 |
| 527 | Ga0466960_0001321 | 3300044901 | Bacteria | 8987 |
| 528 | Ga0466960_0002938 | 3300044901 | Bacteria | 6495 |
| 529 | Ga0466960_0106127 | 3300044901 | Bacteria | 1453 |
| 530 | Ga0466960_0174384 | 3300044901 | Bacteria | 1162 |
| 531 | Ga0466960_0243746 | 3300044901 | Bacteria | 996 |
| 532 | Ga0466959_0003838 | 3300045049 | Bacteria | 9966 |
| 533 | Ga0466959_0006678 | 3300045049 | Bacteria | 8020 |
| 534 | Ga0466959_0098621 | 3300045049 | Bacteria | 2093 |
| 535 | Ga0466959_0160913 | 3300045049 | Bacteria | 1578 |
| 536 | Ga0466958_0007296 | 3300045836 | Bacteria | 6070 |
| 537 | Ga0466958_0015430 | 3300045836 | Bacteria | 4377 |
| 538 | Ga0466958_0061296 | 3300045836 | Bacteria | 2291 |
| 539 | Ga0466958_0102603 | 3300045836 | Bacteria | 1780 |
| 540 | Ga0466958_0115373 | 3300045836 | Bacteria | 1678 |
| 541 | Ga0466958_0136365 | 3300045836 | Bacteria | 1543 |
| 542 | Ga0466967_0009905 | 3300045976 | Bacteria | 7111 |
| 543 | Ga0466967_0075943 | 3300045976 | Bacteria | 3021 |
| 544 | Ga0466967_0125798 | 3300045976 | Bacteria | 2374 |
| 545 | Ga0466967_0127636 | 3300045976 | Bacteria | 2357 |
| 546 | Ga0466967_0139907 | 3300045976 | Bacteria | 2254 |
| 547 | Ga0466967_0161325 | 3300045976 | Bacteria | 2104 |
| 548 | Ga0495603_0081610 | 3300046455 | Bacteria | 1894 |
| 549 | Ga0495590_0044339 | 3300046457 | Bacteria | 1551 |
| 550 | Ga0495629_0033004 | 3300046459 | Bacteria | 3663 |
| 551 | Ga0495638_0001822 | 3300046460 | Bacteria | 18494 |
| 552 | Ga0495641_0012381 | 3300046461 | Bacteria | 4777 |
| 553 | Ga0495653_0018710 | 3300046463 | Bacteria | 5624 |
| 554 | Ga0495580_0451287 | 3300046472 | Bacteria | 863 |
| 555 | Ga0495582_0011213 | 3300046473 | Bacteria | 4937 |
| 556 | Ga0495662_0037068 | 3300046476 | Bacteria | 2355 |
| 557 | Ga0495585_0250570 | 3300046492 | Bacteria | 884 |
| 558 | Ga0495596_0195568 | 3300046500 | Bacteria | 786 |
| 559 | Ga0495616_0157300 | 3300046513 | Bacteria | 1024 |
| 560 | Ga0495620_0149111 | 3300046515 | Bacteria | 912 |
| 561 | Ga0495648_0001604 | 3300046524 | Bacteria | 22021 |
| 562 | Ga0495654_0015682 | 3300046530 | Bacteria | 4022 |
| 563 | Ga0495640_0024292 | 3300046533 | Bacteria | 4411 |
| 564 | Ga0495640_0150739 | 3300046533 | Bacteria | 1494 |
| 565 | Ga0495656_0249120 | 3300046615 | Bacteria | 897 |
| 566 | Ga0495668_0000819 | 3300046616 | Bacteria | 35709 |
| 567 | Ga0495668_0034299 | 3300046616 | Bacteria | 2848 |
| 568 | Ga0495611_0043291 | 3300046648 | Bacteria | 2013 |
| 569 | Ga0495625_0119732 | 3300046660 | Bacteria | 1793 |
| 570 | Ga0495635_0256284 | 3300046663 | Bacteria | 1179 |
| 571 | Ga0495658_0029681 | 3300046683 | Bacteria | 2963 |
| 572 | Ga0495624_0113850 | 3300046690 | Bacteria | 1663 |
| 573 | Ga0495670_0154290 | 3300046691 | Bacteria | 1205 |
| 574 | Ga0495670_0438462 | 3300046691 | Bacteria | 707 |
| 575 | Ga0495671_0020560 | 3300046692 | Bacteria | 3477 |
| 576 | Ga0495671_0026087 | 3300046692 | Bacteria | 3032 |
| 577 | Ga0495649_0027000 | 3300046694 | Bacteria | 3188 |
| 578 | Ga0495589_0143621 | 3300046794 | Bacteria | 1142 |
| 579 | Ga0495581_0024484 | 3300047315 | Bacteria | 3498 |
| 580 | Ga0495581_0032555 | 3300047315 | Bacteria | 3019 |
| 581 | Ga0495581_0082060 | 3300047315 | Bacteria | 1867 |
| 582 | Ga0495674_0037616 | 3300047319 | Bacteria | 4349 |
| 583 | Ga0495672_0001082 | 3300047320 | Bacteria | 27689 |
| 584 | Ga0495672_0007166 | 3300047320 | Bacteria | 8435 |
| 585 | Ga0495676_0072018 | 3300047321 | Bacteria | 2655 |
| 586 | Ga0495676_0326047 | 3300047321 | Bacteria | 1031 |
| 587 | Ga0495683_0000230 | 3300047323 | Bacteria | 51313 |
| 588 | Ga0495673_0001630 | 3300047469 | Bacteria | 17372 |
| 589 | Ga0495686_0247924 | 3300047472 | Bacteria | 1002 |
| 590 | Ga0495593_0001301 | 3300047673 | Bacteria | 14647 |
| 591 | Ga0495614_0168148 | 3300048089 | Bacteria | 983 |
| 592 | Ga0496100_0000043 | 3300048903 | Bacteria | 89692 |
| 593 | Ga0496100_0000351 | 3300048903 | Bacteria | 22387 |
| 594 | Ga0496100_0003387 | 3300048903 | Bacteria | 8305 |
| 595 | Ga0496100_0014275 | 3300048903 | Bacteria | 4609 |
| 596 | Ga0496100_0030245 | 3300048903 | Bacteria | 3358 |
| 597 | Ga0496100_0098032 | 3300048903 | Bacteria | 2014 |
| 598 | Ga0496100_0099704 | 3300048903 | Bacteria | 1999 |
| 599 | Ga0496100_0371160 | 3300048903 | Bacteria | 1085 |
| 600 | Ga0496101_0000050 | 3300048904 | Bacteria | 144545 |
| 601 | Ga0496101_0000149 | 3300048904 | Bacteria | 60550 |
| 602 | Ga0496101_0000573 | 3300048904 | Bacteria | 22521 |
| 603 | Ga0496101_0001052 | 3300048904 | Bacteria | 16316 |
| 604 | Ga0496101_0010564 | 3300048904 | Bacteria | 6098 |
| 605 | Ga0496101_0019709 | 3300048904 | Bacteria | 4610 |
| 606 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 607 | Ga0496102_0007074 | 3300048905 | Bacteria | 9577 |
| 608 | Ga0496102_0014671 | 3300048905 | Bacteria | 6811 |
| 609 | Ga0496102_0018624 | 3300048905 | Bacteria | 6106 |
| 610 | Ga0496102_0053844 | 3300048905 | Bacteria | 3667 |
| 611 | Ga0496102_0111513 | 3300048905 | Bacteria | 2550 |
| 612 | Ga0496102_0133506 | 3300048905 | Bacteria | 2325 |
| 613 | Ga0496102_0146679 | 3300048905 | Bacteria | 2215 |
| 614 | Ga0496102_0190103 | 3300048905 | Bacteria | 1934 |
| 615 | Ga0496102_0232976 | 3300048905 | Bacteria | 1736 |
| 616 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 617 | Ga0496103_0000152 | 3300048906 | Bacteria | 72428 |
| 618 | Ga0496103_0000887 | 3300048906 | Bacteria | 21625 |
| 619 | Ga0496103_0001401 | 3300048906 | Bacteria | 16211 |
| 620 | Ga0496103_0255223 | 3300048906 | Bacteria | 1128 |
| 621 | Ga0496104_0065243 | 3300048907 | Bacteria | 3455 |
| 622 | Ga0496104_0079818 | 3300048907 | Bacteria | 3119 |
| 623 | Ga0496104_0165188 | 3300048907 | Bacteria | 2123 |
| 624 | Ga0496104_0262599 | 3300048907 | Bacteria | 1639 |
| 625 | Ga0496104_0307843 | 3300048907 | Bacteria | 1497 |
| 626 | Ga0496104_0368755 | 3300048907 | Bacteria | 1348 |
| 627 | Ga0496104_0777568 | 3300048907 | Bacteria | 864 |
| 628 | Ga0496105_0019458 | 3300048908 | Bacteria | 5476 |
| 629 | Ga0496106_0000382 | 3300048909 | Bacteria | 31520 |
| 630 | Ga0496106_0002028 | 3300048909 | Bacteria | 15229 |
| 631 | Ga0496106_0007154 | 3300048909 | Bacteria | 8241 |
| 632 | Ga0496106_0019795 | 3300048909 | Bacteria | 4991 |
| 633 | Ga0496106_0057299 | 3300048909 | Bacteria | 2946 |
| 634 | Ga0496106_0114900 | 3300048909 | Bacteria | 2099 |
| 635 | Ga0496106_0183566 | 3300048909 | Bacteria | 1661 |
| 636 | Ga0496107_0000154 | 3300048910 | Bacteria | 34838 |
| 637 | Ga0496107_0000170 | 3300048910 | Bacteria | 33766 |
| 638 | Ga0496107_0005819 | 3300048910 | Bacteria | 8441 |
| 639 | Ga0496107_0018315 | 3300048910 | Bacteria | 4931 |
| 640 | Ga0496107_0465399 | 3300048910 | Bacteria | 939 |
| 641 | Ga0496108_0002389 | 3300048911 | Bacteria | 15021 |
| 642 | Ga0496108_0009156 | 3300048911 | Bacteria | 8014 |
| 643 | Ga0496108_0120385 | 3300048911 | Bacteria | 2251 |
| 644 | Ga0496108_0344031 | 3300048911 | Bacteria | 1301 |
| 645 | Ga0496109_0000194 | 3300048912 | Bacteria | 60448 |
| 646 | Ga0496109_0012206 | 3300048912 | Bacteria | 7412 |
| 647 | Ga0496109_0014026 | 3300048912 | Bacteria | 6966 |
| 648 | Ga0496109_0019135 | 3300048912 | Bacteria | 6032 |
| 649 | Ga0496109_0044911 | 3300048912 | Bacteria | 4009 |
| 650 | Ga0496110_0001051 | 3300048913 | Bacteria | 19501 |
| 651 | Ga0496110_0036207 | 3300048913 | Bacteria | 4285 |
| 652 | Ga0496110_0047047 | 3300048913 | Bacteria | 3776 |
| 653 | Ga0496111_0017962 | 3300048914 | Bacteria | 4892 |
| 654 | Ga0496111_0153284 | 3300048914 | Bacteria | 1710 |
| 655 | Ga0496111_0418389 | 3300048914 | Bacteria | 990 |
| 656 | Ga0496111_0455107 | 3300048914 | Bacteria | 944 |
| 657 | Ga0496112_0014362 | 3300048915 | Bacteria | 7341 |
| 658 | Ga0496112_0020568 | 3300048915 | Bacteria | 6257 |
| 659 | Ga0496112_0037501 | 3300048915 | Bacteria | 4730 |
| 660 | Ga0496112_0102127 | 3300048915 | Bacteria | 2837 |
| 661 | Ga0496112_0127243 | 3300048915 | Bacteria | 2518 |
| 662 | Ga0496113_0047645 | 3300048916 | Bacteria | 3185 |
| 663 | Ga0496113_0096601 | 3300048916 | Bacteria | 2285 |
| 664 | Ga0496113_0159394 | 3300048916 | Bacteria | 1783 |
| 665 | Ga0496113_0246821 | 3300048916 | Bacteria | 1425 |
| 666 | Ga0496114_0000565 | 3300048917 | Bacteria | 27454 |
| 667 | Ga0496114_0001578 | 3300048917 | Bacteria | 17308 |
| 668 | Ga0496114_0002406 | 3300048917 | Bacteria | 14266 |
| 669 | Ga0496114_0015932 | 3300048917 | Bacteria | 6049 |
| 670 | Ga0496114_0042881 | 3300048917 | Bacteria | 3751 |
| 671 | Ga0496114_0128610 | 3300048917 | Bacteria | 2185 |
| 672 | Ga0496114_0187776 | 3300048917 | Bacteria | 1807 |
| 673 | Ga0496115_0002015 | 3300048918 | Bacteria | 14515 |
| 674 | Ga0496115_0003619 | 3300048918 | Bacteria | 11116 |
| 675 | Ga0496115_0005175 | 3300048918 | Bacteria | 9484 |
| 676 | Ga0496115_0215114 | 3300048918 | Bacteria | 1587 |
| 677 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 678 | Ga0496116_0004103 | 3300048919 | Bacteria | 14061 |
| 679 | Ga0496116_0011312 | 3300048919 | Bacteria | 7403 |
| 680 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 681 | Ga0496117_0011705 | 3300048920 | Bacteria | 7825 |
| 682 | Ga0496117_0013169 | 3300048920 | Bacteria | 7234 |
| 683 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 684 | Ga0496118_0001009 | 3300048921 | Bacteria | 43809 |
| 685 | Ga0496118_0008813 | 3300048921 | Bacteria | 10337 |
| 686 | Ga0496118_0015304 | 3300048921 | Bacteria | 7111 |
| 687 | Ga0496119_0000172 | 3300048922 | Bacteria | 91464 |
| 688 | Ga0496119_0001151 | 3300048922 | Bacteria | 33191 |
| 689 | Ga0496119_0003415 | 3300048922 | Bacteria | 16502 |
| 690 | Ga0496120_0000155 | 3300048923 | Bacteria | 114046 |
| 691 | Ga0496120_0047135 | 3300048923 | Bacteria | 2486 |
| 692 | Ga0496120_0059207 | 3300048923 | Bacteria | 2147 |
| 693 | Ga0496121_0000048 | 3300048924 | Bacteria | 330242 |
| 694 | Ga0496121_0001740 | 3300048924 | Bacteria | 35570 |
| 695 | Ga0496121_0008039 | 3300048924 | Bacteria | 12574 |
| 696 | Ga0496121_0145222 | 3300048924 | Bacteria | 1754 |
| 697 | Ga0496121_0285497 | 3300048924 | Bacteria | 1127 |
| 698 | Ga0496122_0000301 | 3300048925 | Bacteria | 109636 |
| 699 | Ga0496122_0026612 | 3300048925 | Bacteria | 4978 |
| 700 | Ga0496123_0005215 | 3300048926 | Bacteria | 13201 |
| 701 | Ga0496124_0000044 | 3300048927 | Bacteria | 289064 |
| 702 | Ga0496125_0000037 | 3300048928 | Bacteria | 330242 |
| 703 | Ga0496125_0050109 | 3300048928 | Bacteria | 3461 |
| 704 | Ga0496125_0082381 | 3300048928 | Bacteria | 2452 |
| 705 | Ga0496126_0000046 | 3300048929 | Bacteria | 330242 |
| 706 | Ga0496126_0001956 | 3300048929 | Bacteria | 29218 |
| 707 | Ga0496126_0002081 | 3300048929 | Bacteria | 28036 |
| 708 | Ga0496126_0002916 | 3300048929 | Bacteria | 22240 |
| 709 | Ga0496126_0058084 | 3300048929 | Bacteria | 3488 |
| 710 | Ga0496126_0549661 | 3300048929 | Bacteria | 916 |
| 711 | Ga0501031_0001304 | 3300049568 | Bacteria | 15291 |
| 712 | Ga0501031_0154326 | 3300049568 | Bacteria | 1501 |
| 713 | Ga0501032_0002887 | 3300049569 | Bacteria | 13361 |
| 714 | Ga0501032_0004269 | 3300049569 | Bacteria | 10792 |
| 715 | Ga0501032_0018962 | 3300049569 | Bacteria | 4813 |
| 716 | Ga0501032_0068983 | 3300049569 | Bacteria | 2359 |
| 717 | Ga0501033_0007728 | 3300049570 | Bacteria | 8339 |
| 718 | Ga0501033_0008359 | 3300049570 | Bacteria | 8015 |
| 719 | Ga0501034_0004872 | 3300049571 | Bacteria | 14809 |
| 720 | Ga0501034_0008695 | 3300049571 | Bacteria | 10694 |
| 721 | Ga0501034_0030032 | 3300049571 | Bacteria | 5525 |
| 722 | Ga0501034_0041969 | 3300049571 | Bacteria | 4630 |
| 723 | Ga0501034_0223518 | 3300049571 | Bacteria | 1835 |
| 724 | Ga0501034_0554987 | 3300049571 | Bacteria | 1058 |
| 725 | Ga0501036_0003021 | 3300049572 | Bacteria | 13394 |
| 726 | Ga0501036_0063603 | 3300049572 | Bacteria | 3124 |
| 727 | Ga0501037_0000709 | 3300049573 | Bacteria | 25325 |
| 728 | Ga0501037_0000782 | 3300049573 | Bacteria | 23992 |
| 729 | Ga0501037_0017891 | 3300049573 | Bacteria | 5217 |
| 730 | Ga0501037_0117570 | 3300049573 | Bacteria | 1913 |
| 731 | Ga0501038_0003575 | 3300049574 | Bacteria | 14462 |
| 732 | Ga0501039_0001120 | 3300049575 | Bacteria | 19696 |
| 733 | Ga0501039_0001546 | 3300049575 | Bacteria | 16916 |
| 734 | Ga0501042_0136574 | 3300049578 | Bacteria | 1768 |
| 735 | Ga0501043_0001589 | 3300049579 | Bacteria | 19750 |
| 736 | Ga0501043_0004131 | 3300049579 | Bacteria | 11860 |
| 737 | Ga0501043_0116065 | 3300049579 | Bacteria | 2101 |
| 738 | Ga0501043_0307131 | 3300049579 | Bacteria | 1211 |
| 739 | Ga0501046_0000628 | 3300049580 | Bacteria | 34641 |
| 740 | Ga0501046_0001159 | 3300049580 | Bacteria | 25641 |
| 741 | Ga0501047_0005042 | 3300049581 | Bacteria | 12392 |
| 742 | Ga0501047_0007282 | 3300049581 | Bacteria | 10401 |
| 743 | Ga0501047_0127448 | 3300049581 | Bacteria | 2426 |
| 744 | Ga0501047_0131948 | 3300049581 | Bacteria | 2378 |
| 745 | Ga0501048_0002485 | 3300049582 | Bacteria | 14081 |
| 746 | Ga0501048_0004665 | 3300049582 | Bacteria | 10430 |
| 747 | Ga0501067_0006536 | 3300049583 | Bacteria | 6463 |
| 748 | Ga0501068_0020388 | 3300049584 | Bacteria | 3861 |
| 749 | Ga0501069_0006510 | 3300049585 | Bacteria | 6107 |
| 750 | Ga0501069_0029463 | 3300049585 | Bacteria | 3012 |
| 751 | Ga0501070_0001113 | 3300049586 | Bacteria | 24139 |
| 752 | Ga0501070_0001530 | 3300049586 | Bacteria | 20572 |
| 753 | Ga0501070_0008364 | 3300049586 | Bacteria | 8743 |
| 754 | Ga0501070_0102791 | 3300049586 | Bacteria | 2363 |
| 755 | Ga0501070_0180606 | 3300049586 | Bacteria | 1737 |
| 756 | Ga0501071_0212238 | 3300049587 | Bacteria | 1456 |
| 757 | Ga0501072_0089346 | 3300049588 | Bacteria | 2445 |
| 758 | Ga0501072_0512128 | 3300049588 | Bacteria | 949 |
| 759 | Ga0501073_0002300 | 3300049589 | Bacteria | 14295 |
| 760 | Ga0501073_0228294 | 3300049589 | Bacteria | 1286 |
| 761 | Ga0501073_0340960 | 3300049589 | Bacteria | 1034 |
| 762 | Ga0501074_0001996 | 3300049590 | Bacteria | 14048 |
| 763 | Ga0501080_0007010 | 3300049742 | Bacteria | 10176 |
| 764 | Ga0501080_0548622 | 3300049742 | Bacteria | 1030 |
| 765 | Ga0501083_0055356 | 3300049744 | Bacteria | 2660 |
| 766 | Ga0501035_0000229 | 3300049822 | Bacteria | 66514 |
| 767 | Ga0501035_0001480 | 3300049822 | Bacteria | 24041 |
| 768 | Ga0501035_0004339 | 3300049822 | Bacteria | 13458 |
| 769 | Ga0501044_0000880 | 3300049823 | Bacteria | 36201 |
| 770 | Ga0501044_0003297 | 3300049823 | Bacteria | 18183 |
| 771 | Ga0501044_0004798 | 3300049823 | Bacteria | 15118 |
| 772 | Ga0501044_0006629 | 3300049823 | Bacteria | 12768 |
| 773 | Ga0501044_0029695 | 3300049823 | Bacteria | 5764 |
| 774 | Ga0501044_0328210 | 3300049823 | Bacteria | 1453 |
| 775 | Ga0501044_0355447 | 3300049823 | Bacteria | 1384 |
| 776 | nmdc:mga03683_129562_c1 | 3300050489 | Bacteria | 1127 |
| 777 | nmdc:mga03683_51133_c1 | 3300050489 | Bacteria | 1724 |
| 778 | nmdc:mga03n38_45315_c1 | 3300050490 | Bacteria | 1936 |
| 779 | nmdc:mga03n38_56426_c1 | 3300050490 | Bacteria | 1772 |
| 780 | nmdc:mga03n38_5804_c1 | 3300050490 | Bacteria | 4239 |
| 781 | nmdc:mga03n38_67015_c1 | 3300050490 | Bacteria | 1651 |
| 782 | nmdc:mga03n38_9753_c1 | 3300050490 | Bacteria | 3504 |
| 783 | nmdc:mga00v17_115761_c1 | 3300050491 | Bacteria | 1704 |
| 784 | nmdc:mga00v17_2162_c1 | 3300050491 | Bacteria | 10101 |
| 785 | nmdc:mga00v17_23825_c1 | 3300050491 | Bacteria | 3544 |
| 786 | nmdc:mga00v17_3910_c1 | 3300050491 | Bacteria | 7684 |
| 787 | nmdc:mga00v17_44428_c1 | 3300050491 | Bacteria | 2679 |
| 788 | nmdc:mga00v17_86327_c1 | 3300050491 | Bacteria | 1966 |
| 789 | nmdc:mga0yw44_111002_c1 | 3300050492 | Bacteria | 1757 |
| 790 | nmdc:mga0yw44_52884_c1 | 3300050492 | Bacteria | 2464 |
| 791 | nmdc:mga0yw44_88939_c1 | 3300050492 | Bacteria | 1948 |
| 792 | nmdc:mga06z11_211952_c1 | 3300050494 | Bacteria | 1129 |
| 793 | nmdc:mga07m45_101026_c1 | 3300050496 | Bacteria | 1656 |
| 794 | nmdc:mga07m45_288120_c1 | 3300050496 | Bacteria | 955 |
| 795 | nmdc:mga07m45_4443_c1 | 3300050496 | Bacteria | 6864 |
| 796 | nmdc:mga05p37_13488_c1 | 3300050507 | Bacteria | 9793 |
| 797 | nmdc:mga05p37_42989_c1 | 3300050507 | Bacteria | 5555 |
| 798 | nmdc:mga09592_95605_c1 | 3300050508 | Bacteria | 2541 |
| 799 | nmdc:mga06r32_1478_c1 | 3300050510 | Bacteria | 3020 |
| 800 | nmdc:mga08y16_126057_c1 | 3300050511 | Bacteria | 2664 |
| 801 | nmdc:mga08y16_1361118_c1 | 3300050511 | Bacteria | 674 |
| 802 | nmdc:mga08y16_228716_c1 | 3300050511 | Bacteria | 1924 |
| 803 | nmdc:mga08y16_35007_c1 | 3300050511 | Bacteria | 5276 |
| 804 | nmdc:mga0n895_2309_c1 | 3300050512 | Bacteria | 14839 |
| 805 | nmdc:mga0rr50_103117_c1 | 3300050513 | Bacteria | 2245 |
| 806 | nmdc:mga0rr50_571000_c1 | 3300050513 | Bacteria | 963 |
| 807 | nmdc:mga0rr50_82254_c1 | 3300050513 | Bacteria | 2487 |
| 808 | nmdc:mga08x19_93863_c1 | 3300050514 | Bacteria | 1983 |
| 809 | nmdc:mga0a205_253272_c1 | 3300050515 | Bacteria | 1640 |
| 810 | nmdc:mga0a205_39886_c1 | 3300050515 | Bacteria | 4520 |
| 811 | nmdc:mga0sz30_2519_c1 | 3300050516 | Bacteria | 6529 |
| 812 | nmdc:mga0sz30_28623_c2 | 3300050516 | Bacteria | 1910 |
| 813 | nmdc:mga0sz30_2940_c1 | 3300050516 | Bacteria | 6104 |
| 814 | nmdc:mga0sz30_30044_c1 | 3300050516 | Bacteria | 2243 |
| 815 | nmdc:mga0sz30_74407_c1 | 3300050516 | Bacteria | 1465 |
| 816 | Ga0495601_0220837 | 3300053077 | Bacteria | 1238 |
| 817 | Ga0500635_0000868 | 3300053080 | Bacteria | 7378 |
| 818 | Ga0495595_0081764 | 3300053084 | Bacteria | 1540 |
| 819 | Ga0500643_007147 | 3300053087 | Bacteria | 4565 |
| 820 | Ga0500643_007375 | 3300053087 | Bacteria | 4445 |
| 821 | Ga0500644_0097777 | 3300053088 | Bacteria | 1110 |
| 822 | Ga0500562_008683 | 3300053108 | Bacteria | 2567 |
| 823 | Ga0500562_017976 | 3300053108 | Bacteria | 1825 |
| 824 | Ga0500593_010816 | 3300053117 | Bacteria | 3838 |
| 825 | Ga0500642_0046509 | 3300053130 | Bacteria | 1898 |
| 826 | Ga0500652_001228 | 3300053131 | Bacteria | 8146 |
| 827 | Ga0500559_0029303 | 3300053136 | Bacteria | 2356 |
| 828 | Ga0500616_0029440 | 3300053153 | Bacteria | 3020 |
| 829 | Ga0500616_0060050 | 3300053153 | Bacteria | 1972 |
| 830 | Ga0500627_0001651 | 3300053158 | Bacteria | 6311 |
| 831 | Ga0500645_000004 | 3300053730 | Bacteria | 305014 |
| 832 | Ga0500645_025183 | 3300053730 | Bacteria | 1816 |
| 833 | Ga0501084_0005190 | 3300054114 | Bacteria | 10656 |
| 834 | Ga0466962_0008263 | 3300061719 | Bacteria | 4988 |
| 835 | Ga0466962_0155051 | 3300061719 | Bacteria | 1112 |
| 836 | 2523384195 | 2523231044 | Bacteria | 6434991 |
| 837 | 2548692421 | 2547132424 | Bacteria | 8348532 |
| 838 | 2552104961 | 2551306166 | Bacteria | 9731570 |
| 839 | 2566994634 | 2565956761 | Bacteria | 6601618 |
| 840 | 2583148717 | 2582580736 | Bacteria | 5325865 |
| 841 | 2586057600 | 2585427649 | Bacteria | 9053857 |
| 842 | 2644089528 | 2643221615 | Bacteria | 5487866 |
| 843 | 2644319373 | 2643221657 | Bacteria | 5490246 |
| 844 | 2644488351 | 2643221687 | Bacteria | 6500351 |
| 845 | 2644517336 | 2643221692 | Bacteria | 7282860 |
| 846 | 2644639965 | 2643221715 | Bacteria | 6671032 |
| 847 | 2738663862 | 2738541264 | Bacteria | 5935393 |
| 848 | 2738703209 | 2738541274 | Bacteria | 6909446 |
| 849 | 2738891138 | 2738541308 | Bacteria | 7020677 |
| 850 | 2739142997 | 2738541356 | Bacteria | 5935017 |
| 851 | 2739207215 | 2738543005 | Bacteria | 5278128 |
| 852 | 2739236335 | 2738543011 | Bacteria | 5731169 |
| 853 | 2739329327 | 2738543028 | Bacteria | 6917070 |
| 854 | 2739366019 | 2738543034 | Bacteria | 6084756 |
| 855 | 2744955115 | 2744054611 | Bacteria | 5611514 |
| 856 | 2753036791 | 2751185725 | Bacteria | 5740550 |
| 857 | 2753324662 | 2751185792 | Bacteria | 5739090 |
| 858 | 2791912534 | 2791354901 | Bacteria | 8322202 |
| 859 | 2795780673 | 2795385470 | Bacteria | 8317180 |
| 860 | 2809585771 | 2808606522 | Bacteria | 9488490 |
| 861 | 2816506447 | 2816332139 | Bacteria | 9138787 |
| 862 | 2842136181 | 2842134933 | Bacteria | 5847019 |
| 863 | 2842892229 | 2842888712 | Bacteria | 4279094 |
| 864 | 2866553417 | 2866552031 | Bacteria | 5824618 |
| 865 | 2866612275 | 2866612099 | Bacteria | 7543886 |
| 866 | 2883823317 | 2883821847 | Bacteria | 5121194 |
| 867 | 2889304199 | 2889300758 | Bacteria | 5690814 |
| 868 | 2891332093 | 2891326441 | Bacteria | 6439512 |
| 869 | 2899363700 | 2899359706 | Bacteria | 10940472 |
| 870 | 2899376270 | 2899370129 | Bacteria | 6781179 |
| 871 | 2902795269 | 2902792274 | Bacteria | 7270173 |
| 872 | 2902800390 | 2902799365 | Bacteria | 5419524 |
| 873 | 2902811827 | 2902810491 | Bacteria | 6794147 |
| 874 | 2902842904 | 2902837492 | Bacteria | 6697721 |
| 875 | 2904536162 | 2904535858 | Bacteria | 6308016 |
| 876 | 2904768372 | 2904765812 | Bacteria | 5369154 |
| 877 | 2904775761 | 2904770941 | Bacteria | 5580202 |
| 878 | 2908816030 | 2908811453 | Bacteria | 5478616 |
| 879 | 2915771085 | 2915768154 | Bacteria | 8424322 |
| 880 | 2917745082 | 2917736166 | Bacteria | 9690793 |
| 881 | 2919421743 | 2919420072 | Bacteria | 5390363 |
| 882 | 2919434699 | 2919432681 | Bacteria | 5390474 |
| 883 | 2919714788 | 2919713450 | Bacteria | 7431245 |
| 884 | 2922558087 | 2922554459 | Bacteria | 6683962 |
| 885 | 2928147463 | 2928142448 | Bacteria | 5288925 |
| 886 | 2929218418 | 2929212328 | Bacteria | 7708288 |
| 887 | 2932400044 | 2932398195 | Bacteria | 3847976 |
| 888 | 2939583625 | 2939582691 | Bacteria | 7088898 |
| 889 | 2939745407 | 2939743619 | Bacteria | 5762299 |
| 890 | 2956940702 | 2956939328 | Bacteria | 3474458 |
| 891 | 2974319686 | 2974315732 | Bacteria | 4602776 |
| 892 | 2984523554 | 2984523437 | Bacteria | 4508481 |
| 893 | 3001120382 | 3001119090 | Bacteria | 3449530 |
| 894 | 8003314481 | 8003314358 | Bacteria | 10575343 |
| 895 | Ga0157378_10134797 | |||
| 896 | JGI24737J22298_10008519 | |||
| 897 | JGI24750J21931_1002359 | |||
| 898 | JGI24748J21848_1002939 | |||
| 899 | JGI24749J21850_1015492 | |||
| 900 | JGI24744J21845_10003469 | |||
| 901 | JGI24034J26672_10003741 | |||
| 902 | JGI24742J22300_10000256 | |||
| 903 | JGI24751J29686_10007130 | |||
| 904 | JGI25406J46586_10000561 | |||
| 905 | JGI25406J46586_10009101 | |||
| 906 | rootH2_10029196 | |||
| 907 | JGI25407J50210_10001654 | |||
| 908 | Ga0055540_1000224 | |||
| 909 | Ga0055540_1000638 | |||
| 910 | Ga0055540_1002195 | |||
| 911 | Ga0055540_1003480 | |||
| 912 | Ga0055540_1009335 | |||
| 913 | JGI25405J52794_10015821 | |||
| 914 | Ga0070676_10006401 | |||
| 915 | Ga0070676_10076885 | |||
| 916 | Ga0070683_100188763 | |||
| 917 | Ga0070666_10064939 | |||
| 918 | Ga0070666_10169424 | |||
| 919 | Ga0070682_100002498 | |||
| 920 | Ga0070682_100015971 | |||
| 921 | Ga0070682_100061262 | |||
| 922 | Ga0068868_100002197 | |||
| 923 | Ga0068868_100225302 | |||
| 924 | Ga0070660_100272893 | |||
| 925 | Ga0070689_100018845 | |||
| 926 | Ga0070689_100248362 | |||
| 927 | Ga0070691_10006195 | |||
| 928 | Ga0070692_10035217 | |||
| 929 | Ga0070668_100002008 | |||
| 930 | Ga0070668_100005862 | |||
| 931 | Ga0070668_100057308 | |||
| 932 | Ga0070668_100086399 | |||
| 933 | Ga0070669_100003185 | |||
| 934 | Ga0070669_100003801 | |||
| 935 | Ga0070674_100001890 | |||
| 936 | Ga0070674_100637400 | |||
| 937 | Ga0070673_100276308 | |||
| 938 | Ga0070688_100006685 | |||
| 939 | Ga0070688_100107590 | |||
| 940 | Ga0070688_100356216 | |||
| 941 | Ga0070659_100006606 | |||
| 942 | Ga0070659_100491900 | |||
| 943 | Ga0070667_100000099 | |||
| 944 | Ga0070667_100001927 | |||
| 945 | Ga0070667_100003067 | |||
| 946 | Ga0070667_100186354 | |||
| 947 | Ga0070667_100438081 | |||
| 948 | Ga0070709_10006137 | |||
| 949 | Ga0070709_10045358 | |||
| 950 | Ga0070714_100005131 | |||
| 951 | Ga0070714_100024876 | |||
| 952 | Ga0070714_100069932 | |||
| 953 | Ga0070714_100186647 | |||
| 954 | Ga0070713_100050798 | |||
| 955 | Ga0070713_100104658 | |||
| 956 | Ga0070710_10002517 | |||
| 957 | Ga0070710_10046689 | |||
| 958 | Ga0070710_10060752 | |||
| 959 | Ga0070701_10002780 | |||
| 960 | Ga0070711_100002334 | |||
| 961 | Ga0070705_100031235 | |||
| 962 | Ga0070705_100249754 | |||
| 963 | Ga0070700_100006443 | |||
| 964 | Ga0070700_100170492 | |||
| 965 | Ga0070694_100032483 | |||
| 966 | Ga0070663_100003168 | |||
| 967 | Ga0070663_100003811 | |||
| 968 | Ga0070663_100045175 | |||
| 969 | Ga0070663_100249745 | |||
| 970 | Ga0070678_100000756 | |||
| 971 | Ga0070678_100134739 | |||
| 972 | Ga0070678_100246191 | |||
| 973 | Ga0070662_100006460 | |||
| 974 | Ga0070662_100023089 | |||
| 975 | Ga0070662_100024036 | |||
| 976 | Ga0070662_100074274 | |||
| 977 | Ga0068867_100003459 | |||
| 978 | Ga0068867_100176268 | |||
| 979 | Ga0070684_100820585 | |||
| 980 | Ga0068853_100003045 | |||
| 981 | Ga0068853_100139121 | |||
| 982 | Ga0070695_100087204 | |||
| 983 | Ga0070696_100002281 | |||
| 984 | Ga0070693_100008418 | |||
| 985 | Ga0070693_100166396 | |||
| 986 | Ga0070665_100010952 | |||
| 987 | Ga0070665_100012066 | |||
| 988 | Ga0070665_100179534 | |||
| 989 | Ga0070665_100339486 | |||
| 990 | Ga0070704_100001654 | |||
| 991 | Ga0068854_100002834 | |||
| 992 | Ga0068854_100053305 | |||
| 993 | Ga0068854_100083310 | |||
| 994 | Ga0068854_100161019 | |||
| 995 | Ga0068854_100362087 | |||
| 996 | Ga0068856_100039659 | |||
| 997 | Ga0070702_100000598 | |||
| 998 | Ga0070702_100055618 | |||
| 999 | Ga0070702_100279135 | |||
| 1000 | Ga0070702_100464409 | |||
| 1001 | Ga0068852_100321797 | |||
| 1002 | Ga0068852_100549849 | |||
| 1003 | Ga0068852_100853838 | |||
| 1004 | Ga0068859_100159534 | |||
| 1005 | Ga0068864_100374755 | |||
| 1006 | Ga0068864_100746491 | |||
| 1007 | Ga0068861_100002278 | |||
| 1008 | Ga0068861_100117472 | |||
| 1009 | Ga0068861_100227457 | |||
| 1010 | Ga0068861_100256686 | |||
| 1011 | Ga0068861_100446717 | |||
| 1012 | Ga0068863_100001544 | |||
| 1013 | Ga0068863_100255560 | |||
| 1014 | Ga0068858_100006943 | |||
| 1015 | Ga0068858_100079396 | |||
| 1016 | Ga0068858_100430484 | |||
| 1017 | Ga0068860_100000163 | |||
| 1018 | Ga0068860_100005668 | |||
| 1019 | Ga0068862_100000089 | |||
| 1020 | Ga0081455_10000960 | |||
| 1021 | Ga0081455_10001006 | |||
| 1022 | Ga0081455_10015441 | |||
| 1023 | Ga0081455_10023737 | |||
| 1024 | Ga0081455_10037388 | |||
| 1025 | Ga0081455_10039180 | |||
| 1026 | Ga0081455_10088813 | |||
| 1027 | Ga0081455_10297549 | |||
| 1028 | Ga0081538_10000350 | |||
| 1029 | Ga0081538_10037698 | |||
| 1030 | Ga0081539_10000177 | |||
| 1031 | Ga0081539_10000208 | |||
| 1032 | Ga0075365_10004072 | |||
| 1033 | Ga0075365_10018618 | |||
| 1034 | Ga0075365_10036173 | |||
| 1035 | Ga0075365_10255222 | |||
| 1036 | Ga0075363_100002325 | |||
| 1037 | Ga0075363_100004070 | |||
| 1038 | Ga0075363_100007457 | |||
| 1039 | Ga0075363_100010027 | |||
| 1040 | Ga0075363_100029559 | |||
| 1041 | Ga0075363_100033350 | |||
| 1042 | Ga0075363_100215888 | |||
| 1043 | Ga0075364_10004891 | |||
| 1044 | Ga0075364_10005390 | |||
| 1045 | Ga0075364_10010736 | |||
| 1046 | Ga0075364_10253633 | |||
| 1047 | Ga0075364_10283997 | |||
| 1048 | Ga0075432_10000656 | |||
| 1049 | Ga0075432_10002493 | |||
| 1050 | Ga0070715_10077959 | |||
| 1051 | Ga0070716_100026600 | |||
| 1052 | Ga0070712_100002169 | |||
| 1053 | Ga0075362_10074410 | |||
| 1054 | Ga0075362_10093730 | |||
| 1055 | Ga0075367_10019928 | |||
| 1056 | Ga0075367_10027141 | |||
| 1057 | Ga0075367_10046966 | |||
| 1058 | Ga0075369_10010520 | |||
| 1059 | Ga0075369_10024117 | |||
| 1060 | Ga0075369_10039578 | |||
| 1061 | Ga0097621_100065638 | |||
| 1062 | Ga0097621_100148069 | |||
| 1063 | Ga0075370_10176872 | |||
| 1064 | Ga0075370_10208702 | |||
| 1065 | Ga0068871_100386129 | |||
| 1066 | Ga0075428_100003868 | |||
| 1067 | Ga0075428_100005349 | |||
| 1068 | Ga0075428_100098420 | |||
| 1069 | Ga0075430_100206146 | |||
| 1070 | Ga0075430_100365266 | |||
| 1071 | Ga0075431_100005313 | |||
| 1072 | Ga0075431_100098407 | |||
| 1073 | Ga0075433_10012690 | |||
| 1074 | Ga0075433_10031857 | |||
| 1075 | Ga0075434_100002464 | |||
| 1076 | Ga0075434_100009840 | |||
| 1077 | Ga0075429_100226184 | |||
| 1078 | Ga0068865_100005190 | |||
| 1079 | Ga0068865_100025998 | |||
| 1080 | Ga0068865_100082211 | |||
| 1081 | Ga0068865_100157136 | |||
| 1082 | Ga0075436_100010325 | |||
| 1083 | Ga0075436_100107687 | |||
| 1084 | Ga0097620_100159520 | |||
| 1085 | Ga0075435_100037694 | |||
| 1086 | Ga0075435_100280488 | |||
| 1087 | Ga0105250_10024692 | |||
| 1088 | Ga0105240_10660461 | |||
| 1089 | Ga0111539_10001067 | |||
| 1090 | Ga0111539_10002580 | |||
| 1091 | Ga0111539_10065758 | |||
| 1092 | Ga0105245_10003222 | |||
| 1093 | Ga0105245_10153586 | |||
| 1094 | Ga0105245_10154976 | |||
| 1095 | Ga0105245_10413592 | |||
| 1096 | Ga0105245_10670808 | |||
| 1097 | Ga0105245_11145297 | |||
| 1098 | Ga0105247_10000089 | |||
| 1099 | Ga0105247_10000789 | |||
| 1100 | Ga0105247_10367976 | |||
| 1101 | Ga0114129_10004878 | |||
| 1102 | Ga0114129_10022481 | |||
| 1103 | Ga0105243_10000750 | |||
| 1104 | Ga0105243_10001257 | |||
| 1105 | Ga0105243_10011698 | |||
| 1106 | Ga0105243_10078344 | |||
| 1107 | Ga0105243_10198101 | |||
| 1108 | Ga0105243_10228889 | |||
| 1109 | Ga0105241_10190536 | |||
| 1110 | Ga0105242_10000963 | |||
| 1111 | Ga0105242_10041923 | |||
| 1112 | Ga0105248_10000759 | |||
| 1113 | Ga0105248_10005751 | |||
| 1114 | Ga0105248_10019990 | |||
| 1115 | Ga0105237_10005264 | |||
| 1116 | Ga0105237_10051567 | |||
| 1117 | Ga0105237_10074798 | |||
| 1118 | Ga0105237_10424447 | |||
| 1119 | Ga0105237_10932101 | |||
| 1120 | Ga0105238_10352577 | |||
| 1121 | Ga0105249_10000117 | |||
| 1122 | Ga0105249_10001051 | |||
| 1123 | Ga0105249_10013331 | |||
| 1124 | Ga0105249_10020582 | |||
| 1125 | Ga0105249_10169468 | |||
| 1126 | Ga0105239_10085231 | |||
| 1127 | Ga0105239_10141564 | |||
| 1128 | Ga0105239_10272391 | |||
| 1129 | Ga0105239_11241536 | |||
| 1130 | Ga0157371_10135563 | |||
| 1131 | Ga0157371_10401226 | |||
| 1132 | Ga0157374_10033602 | |||
| 1133 | Ga0157378_10002445 | |||
| 1134 | Ga0157378_10675430 | |||
| 1135 | Ga0163162_10013672 | |||
| 1136 | Ga0163162_10044867 | |||
| 1137 | Ga0163162_10082635 | |||
| 1138 | Ga0163162_10157074 | |||
| 1139 | Ga0163162_10613772 | |||
| 1140 | Ga0157372_10016723 | |||
| 1141 | Ga0157375_10011656 | |||
| 1142 | Ga0157375_10069720 | |||
| 1143 | Ga0157375_10196913 | |||
| 1144 | Ga0157375_10608751 | |||
| 1145 | Ga0157375_10793531 | |||
| 1146 | Ga0163163_10113908 | |||
| 1147 | Ga0163163_10633755 | |||
| 1148 | Ga0157380_10003822 | |||
| 1149 | Ga0157380_10249288 | |||
| 1150 | Ga0157380_10421896 | |||
| 1151 | Ga0157380_10962613 | |||
| 1152 | Ga0157377_10008125 | |||
| 1153 | Ga0157379_10015349 | |||
| 1154 | Ga0157379_10610045 | |||
| 1155 | Ga0163161_10050877 | |||
| 1156 | Ga0163161_10101657 | |||
| 1157 | Ga0163161_10538727 | |||
| 1158 | Ga0213876_10007573 | |||
| 1159 | Ga0213876_10057069 | |||
| 1160 | Ga0209025_1071975 | |||
| 1161 | Ga0209051_1000014 | |||
| 1162 | Ga0209051_1000649 | |||
| 1163 | Ga0209051_1017134 | |||
| 1164 | Ga0207682_10079290 | |||
| 1165 | Ga0207692_10070073 | |||
| 1166 | Ga0207642_10001963 | |||
| 1167 | Ga0207710_10000117 | |||
| 1168 | Ga0207710_10002764 | |||
| 1169 | Ga0207688_10004112 | |||
| 1170 | Ga0207688_10025078 | |||
| 1171 | Ga0207688_10041216 | |||
| 1172 | Ga0207688_10098058 | |||
| 1173 | Ga0207688_10148614 | |||
| 1174 | Ga0207680_10025388 | |||
| 1175 | Ga0207680_10175026 | |||
| 1176 | Ga0207647_10062110 | |||
| 1177 | Ga0207685_10058280 | |||
| 1178 | Ga0207699_10063575 | |||
| 1179 | Ga0207699_10107364 | |||
| 1180 | Ga0207645_10004678 | |||
| 1181 | Ga0207645_10017935 | |||
| 1182 | Ga0207705_10211588 | |||
| 1183 | Ga0207654_10059311 | |||
| 1184 | Ga0207671_10029890 | |||
| 1185 | Ga0207671_10305666 | |||
| 1186 | Ga0207693_10003426 | |||
| 1187 | Ga0207693_10003579 | |||
| 1188 | Ga0207693_10362631 | |||
| 1189 | Ga0207663_10000867 | |||
| 1190 | Ga0207663_10050520 | |||
| 1191 | Ga0207657_10348721 | |||
| 1192 | Ga0207681_10000981 | |||
| 1193 | Ga0207681_10003890 | |||
| 1194 | Ga0207681_10448070 | |||
| 1195 | Ga0207694_10201362 | |||
| 1196 | Ga0207687_10001539 | |||
| 1197 | Ga0207687_10064402 | |||
| 1198 | Ga0207687_10104853 | |||
| 1199 | Ga0207700_10039701 | |||
| 1200 | Ga0207700_10130438 | |||
| 1201 | Ga0207664_10055373 | |||
| 1202 | Ga0207664_10135649 | |||
| 1203 | Ga0207664_10139816 | |||
| 1204 | Ga0207664_10476243 | |||
| 1205 | Ga0207664_10542340 | |||
| 1206 | Ga0207644_10022462 | |||
| 1207 | Ga0207644_10179092 | |||
| 1208 | Ga0207690_10089896 | |||
| 1209 | Ga0207706_10003642 | |||
| 1210 | Ga0207706_10013964 | |||
| 1211 | Ga0207706_10089652 | |||
| 1212 | Ga0207686_10036566 | |||
| 1213 | Ga0207686_10090564 | |||
| 1214 | Ga0207709_10001151 | |||
| 1215 | Ga0207709_10001566 | |||
| 1216 | Ga0207709_10044571 | |||
| 1217 | Ga0207709_10195296 | |||
| 1218 | Ga0207709_10223529 | |||
| 1219 | Ga0207670_10110788 | |||
| 1220 | Ga0207669_10000548 | |||
| 1221 | Ga0207669_10241713 | |||
| 1222 | Ga0207704_10002430 | |||
| 1223 | Ga0207704_10044280 | |||
| 1224 | Ga0207704_10072209 | |||
| 1225 | Ga0207704_10125956 | |||
| 1226 | Ga0207704_10340214 | |||
| 1227 | Ga0207665_10007609 | |||
| 1228 | Ga0207665_10010595 | |||
| 1229 | Ga0207711_10002505 | |||
| 1230 | Ga0207711_10006754 | |||
| 1231 | Ga0207711_10119077 | |||
| 1232 | Ga0207689_10020743 | |||
| 1233 | Ga0207689_10170004 | |||
| 1234 | Ga0207679_10825414 | |||
| 1235 | Ga0207667_10116751 | |||
| 1236 | Ga0207712_10000083 | |||
| 1237 | Ga0207712_10008133 | |||
| 1238 | Ga0207712_10448487 | |||
| 1239 | Ga0207668_10011317 | |||
| 1240 | Ga0207668_10024543 | |||
| 1241 | Ga0207668_10351183 | |||
| 1242 | Ga0207668_10647212 | |||
| 1243 | Ga0207640_10022189 | |||
| 1244 | Ga0207640_10076831 | |||
| 1245 | Ga0207640_10124896 | |||
| 1246 | Ga0207640_10172078 | |||
| 1247 | Ga0207640_10283957 | |||
| 1248 | Ga0207658_10014847 | |||
| 1249 | Ga0207658_10155624 | |||
| 1250 | Ga0207677_10001615 | |||
| 1251 | Ga0207703_10011161 | |||
| 1252 | Ga0207703_10060130 | |||
| 1253 | Ga0207703_10155123 | |||
| 1254 | Ga0207703_10213120 | |||
| 1255 | Ga0207639_10002209 | |||
| 1256 | Ga0207639_10025226 | |||
| 1257 | Ga0207678_10000033 | |||
| 1258 | Ga0207678_10044189 | |||
| 1259 | Ga0207678_10286429 | |||
| 1260 | Ga0207678_10475365 | |||
| 1261 | Ga0207708_10005099 | |||
| 1262 | Ga0207708_10020907 | |||
| 1263 | Ga0207708_10035565 | |||
| 1264 | Ga0207702_10027519 | |||
| 1265 | Ga0207702_10462864 | |||
| 1266 | Ga0207641_10001265 | |||
| 1267 | Ga0207641_10005115 | |||
| 1268 | Ga0207641_10250521 | |||
| 1269 | Ga0207648_10001134 | |||
| 1270 | Ga0207648_10193084 | |||
| 1271 | Ga0207676_10247514 | |||
| 1272 | Ga0207676_10697129 | |||
| 1273 | Ga0207675_100003626 | |||
| 1274 | Ga0207675_100012534 | |||
| 1275 | Ga0207675_100084687 | |||
| 1276 | Ga0207675_100143011 | |||
| 1277 | Ga0207675_100268882 | |||
| 1278 | Ga0207675_100382278 | |||
| 1279 | Ga0207683_10001167 | |||
| 1280 | Ga0207683_10022192 | |||
| 1281 | Ga0207683_10086046 | |||
| 1282 | Ga0207683_10260258 | |||
| 1283 | Ga0207698_10525432 | |||
| 1284 | Ga0207428_10002324 | |||
| 1285 | Ga0207428_10005586 | |||
| 1286 | Ga0207428_10222363 | |||
| 1287 | Ga0268266_10017220 | |||
| 1288 | Ga0268266_10048488 | |||
| 1289 | Ga0268266_10099338 | |||
| 1290 | Ga0268266_10128750 | |||
| 1291 | Ga0268266_10181683 | |||
| 1292 | Ga0268265_10000099 | |||
| 1293 | Ga0268265_10170717 | |||
| 1294 | Ga0268264_10000225 | |||
| 1295 | Ga0268264_10003305 | |||
| 1296 | Ga0268264_10549046 | |||
| 1297 | Ga0268264_10576725 | |||
| 1298 | Ga0307515_10056052 | |||
| 1299 | Ga0307515_10170871 | |||
| 1300 | Ga0307512_10004437 | |||
| 1301 | Ga0265327_10000001 | |||
| 1302 | Ga0265327_10000113 | |||
| 1303 | Ga0265327_10001712 | |||
| 1304 | Ga0265327_10012873 | |||
| 1305 | Ga0307408_100021224 | |||
| 1306 | Ga0307408_100021790 | |||
| 1307 | Ga0307408_100080051 | |||
| 1308 | Ga0307405_10011820 | |||
| 1309 | Ga0307405_10120053 | |||
| 1310 | Ga0307405_10171850 | |||
| 1311 | Ga0307405_10457330 | |||
| 1312 | Ga0307413_10005578 | |||
| 1313 | Ga0307413_10006466 | |||
| 1314 | Ga0307413_10014889 | |||
| 1315 | Ga0307413_10182836 | |||
| 1316 | Ga0307518_10000474 | |||
| 1317 | Ga0307518_10008681 | |||
| 1318 | Ga0307410_10000323 | |||
| 1319 | Ga0307410_10007648 | |||
| 1320 | Ga0307410_10078510 | |||
| 1321 | Ga0307410_10090479 | |||
| 1322 | Ga0307406_10001419 | |||
| 1323 | Ga0307406_10008727 | |||
| 1324 | Ga0307406_10237404 | |||
| 1325 | Ga0307407_10004733 | |||
| 1326 | Ga0307407_10039837 | |||
| 1327 | Ga0307407_10114423 | |||
| 1328 | Ga0307412_10007342 | |||
| 1329 | Ga0307412_10023055 | |||
| 1330 | Ga0307409_100002136 | |||
| 1331 | Ga0307409_100028131 | |||
| 1332 | Ga0307409_100034938 | |||
| 1333 | Ga0307409_100085664 | |||
| 1334 | Ga0307409_100216541 | |||
| 1335 | Ga0307409_100332781 | |||
| 1336 | Ga0307416_100000046 | |||
| 1337 | Ga0307416_100011055 | |||
| 1338 | Ga0307416_100392199 | |||
| 1339 | Ga0307414_10004676 | |||
| 1340 | Ga0307414_10090784 | |||
| 1341 | Ga0307414_10274876 | |||
| 1342 | Ga0307411_10000436 | |||
| 1343 | Ga0307411_10038704 | |||
| 1344 | Ga0307415_100000401 | |||
| 1345 | Ga0307415_100071255 | |||
| 1346 | Ga0307415_100080416 | |||
| 1347 | Ga0307415_100250182 | |||
| 1348 | Ga0316583_10023557 | |||
| 1349 | Ga0307507_10030415 | |||
| 1350 | Ga0307507_10254176 | |||
| 1351 | Ga0373949_0026112 | |||
| 1352 | Ga0373962_0041304 | |||
| 1353 | Ga0373931_0012026 | |||
| 1354 | Ga0373931_0067399 | |||
| 1355 | Ga0373947_0084518 | |||
| 1356 | Ga0316584_0061259 | |||
| 1357 | Ga0436364_0197209 | |||
| 1358 | Ga0436365_0175886 | |||
| 1359 | Ga0436365_0204440 | |||
| 1360 | Ga0436365_0584104 | |||
| 1361 | Ga0436363_1366560 | |||
| 1362 | Ga0439461_0003303 | |||
| 1363 | Ga0439461_0028679 | |||
| 1364 | Ga0439466_0001673 | |||
| 1365 | Ga0439466_0015252 | |||
| 1366 | Ga0439465_0003497 | |||
| 1367 | Ga0439465_0009288 | |||
| 1368 | Ga0451791_0138042 | |||
| 1369 | Ga0451833_1190084 | |||
| 1370 | Ga0451837_0583427 | |||
| 1371 | Ga0451853_1890043 | |||
| 1372 | Ga0451853_3823848 | |||
| 1373 | Ga0439431_0015082 | |||
| 1374 | Ga0439431_0019303 | |||
| 1375 | Ga0439442_009060 | |||
| 1376 | Ga0439442_025376 | |||
| 1377 | Ga0439445_0012234 | |||
| 1378 | Ga0439445_0045596 | |||
| 1379 | Ga0439448_0019001 | |||
| 1380 | Ga0439450_005997 | |||
| 1381 | Ga0439463_000935 | |||
| 1382 | Ga0439463_035877 | |||
| 1383 | Ga0450900_021040 | |||
| 1384 | Ga0439440_0002422 | |||
| 1385 | Ga0466969_0028410 | |||
| 1386 | Ga0466972_0001388 | |||
| 1387 | Ga0466972_0003436 | |||
| 1388 | Ga0466972_0038369 | |||
| 1389 | Ga0466972_0052629 | |||
| 1390 | Ga0466972_0092234 | |||
| 1391 | Ga0466965_0000276 | |||
| 1392 | Ga0466965_0000672 | |||
| 1393 | Ga0466965_0020433 | |||
| 1394 | Ga0466965_0033639 | |||
| 1395 | Ga0466965_0152438 | |||
| 1396 | Ga0466965_0217495 | |||
| 1397 | Ga0466966_0007657 | |||
| 1398 | Ga0466966_0046479 | |||
| 1399 | Ga0466961_0008084 | |||
| 1400 | Ga0466961_0048460 | |||
| 1401 | Ga0466963_0016619 | |||
| 1402 | Ga0466963_0177531 | |||
| 1403 | Ga0466963_0242473 | |||
| 1404 | Ga0466964_0079923 | |||
| 1405 | Ga0466971_0004305 | |||
| 1406 | Ga0466971_0029624 | |||
| 1407 | Ga0466971_0042574 | |||
| 1408 | Ga0466968_0000522 | |||
| 1409 | Ga0466968_0003228 | |||
| 1410 | Ga0466968_0017269 | |||
| 1411 | Ga0466968_0070613 | |||
| 1412 | Ga0466970_0013085 | |||
| 1413 | Ga0466970_0013332 | |||
| 1414 | Ga0466970_0026952 | |||
| 1415 | Ga0466957_0006946 | |||
| 1416 | Ga0466957_0010454 | |||
| 1417 | Ga0466957_0040976 | |||
| 1418 | Ga0466957_0090237 | |||
| 1419 | Ga0466957_0358888 | |||
| 1420 | Ga0466960_0000899 | |||
| 1421 | Ga0466960_0001321 | |||
| 1422 | Ga0466960_0002938 | |||
| 1423 | Ga0466960_0106127 | |||
| 1424 | Ga0466960_0174384 | |||
| 1425 | Ga0466960_0243746 | |||
| 1426 | Ga0466959_0003838 | |||
| 1427 | Ga0466959_0006678 | |||
| 1428 | Ga0466959_0098621 | |||
| 1429 | Ga0466959_0160913 | |||
| 1430 | Ga0466958_0007296 | |||
| 1431 | Ga0466958_0015430 | |||
| 1432 | Ga0466958_0061296 | |||
| 1433 | Ga0466958_0102603 | |||
| 1434 | Ga0466958_0115373 | |||
| 1435 | Ga0466958_0136365 | |||
| 1436 | Ga0466967_0009905 | |||
| 1437 | Ga0466967_0075943 | |||
| 1438 | Ga0466967_0125798 | |||
| 1439 | Ga0466967_0127636 | |||
| 1440 | Ga0466967_0139907 | |||
| 1441 | Ga0466967_0161325 | |||
| 1442 | Ga0495603_0081610 | |||
| 1443 | Ga0495590_0044339 | |||
| 1444 | Ga0495629_0033004 | |||
| 1445 | Ga0495638_0001822 | |||
| 1446 | Ga0495641_0012381 | |||
| 1447 | Ga0495653_0018710 | |||
| 1448 | Ga0495580_0451287 | |||
| 1449 | Ga0495582_0011213 | |||
| 1450 | Ga0495662_0037068 | |||
| 1451 | Ga0495585_0250570 | |||
| 1452 | Ga0495596_0195568 | |||
| 1453 | Ga0495616_0157300 | |||
| 1454 | Ga0495620_0149111 | |||
| 1455 | Ga0495648_0001604 | |||
| 1456 | Ga0495654_0015682 | |||
| 1457 | Ga0495640_0024292 | |||
| 1458 | Ga0495640_0150739 | |||
| 1459 | Ga0495656_0249120 | |||
| 1460 | Ga0495668_0000819 | |||
| 1461 | Ga0495668_0034299 | |||
| 1462 | Ga0495611_0043291 | |||
| 1463 | Ga0495625_0119732 | |||
| 1464 | Ga0495635_0256284 | |||
| 1465 | Ga0495658_0029681 | |||
| 1466 | Ga0495624_0113850 | |||
| 1467 | Ga0495670_0154290 | |||
| 1468 | Ga0495670_0438462 | |||
| 1469 | Ga0495671_0020560 | |||
| 1470 | Ga0495671_0026087 | |||
| 1471 | Ga0495649_0027000 | |||
| 1472 | Ga0495589_0143621 | |||
| 1473 | Ga0495581_0024484 | |||
| 1474 | Ga0495581_0032555 | |||
| 1475 | Ga0495581_0082060 | |||
| 1476 | Ga0495674_0037616 | |||
| 1477 | Ga0495672_0001082 | |||
| 1478 | Ga0495672_0007166 | |||
| 1479 | Ga0495676_0072018 | |||
| 1480 | Ga0495676_0326047 | |||
| 1481 | Ga0495683_0000230 | |||
| 1482 | Ga0495673_0001630 | |||
| 1483 | Ga0495686_0247924 | |||
| 1484 | Ga0495593_0001301 | |||
| 1485 | Ga0495614_0168148 | |||
| 1486 | Ga0496100_0000043 | |||
| 1487 | Ga0496100_0000351 | |||
| 1488 | Ga0496100_0003387 | |||
| 1489 | Ga0496100_0014275 | |||
| 1490 | Ga0496100_0030245 | |||
| 1491 | Ga0496100_0098032 | |||
| 1492 | Ga0496100_0099704 | |||
| 1493 | Ga0496100_0371160 | |||
| 1494 | Ga0496101_0000050 | |||
| 1495 | Ga0496101_0000149 | |||
| 1496 | Ga0496101_0000573 | |||
| 1497 | Ga0496101_0001052 | |||
| 1498 | Ga0496101_0010564 | |||
| 1499 | Ga0496101_0019709 | |||
| 1500 | Ga0496102_0000001 | |||
| 1501 | Ga0496102_0007074 | |||
| 1502 | Ga0496102_0014671 | |||
| 1503 | Ga0496102_0018624 | |||
| 1504 | Ga0496102_0053844 | |||
| 1505 | Ga0496102_0111513 | |||
| 1506 | Ga0496102_0133506 | |||
| 1507 | Ga0496102_0146679 | |||
| 1508 | Ga0496102_0190103 | |||
| 1509 | Ga0496102_0232976 | |||
| 1510 | Ga0496103_0000007 | |||
| 1511 | Ga0496103_0000152 | |||
| 1512 | Ga0496103_0000887 | |||
| 1513 | Ga0496103_0001401 | |||
| 1514 | Ga0496103_0255223 | |||
| 1515 | Ga0496104_0065243 | |||
| 1516 | Ga0496104_0079818 | |||
| 1517 | Ga0496104_0165188 | |||
| 1518 | Ga0496104_0262599 | |||
| 1519 | Ga0496104_0307843 | |||
| 1520 | Ga0496104_0368755 | |||
| 1521 | Ga0496104_0777568 | |||
| 1522 | Ga0496105_0019458 | |||
| 1523 | Ga0496106_0000382 | |||
| 1524 | Ga0496106_0002028 | |||
| 1525 | Ga0496106_0007154 | |||
| 1526 | Ga0496106_0019795 | |||
| 1527 | Ga0496106_0057299 | |||
| 1528 | Ga0496106_0114900 | |||
| 1529 | Ga0496106_0183566 | |||
| 1530 | Ga0496107_0000154 | |||
| 1531 | Ga0496107_0000170 | |||
| 1532 | Ga0496107_0005819 | |||
| 1533 | Ga0496107_0018315 | |||
| 1534 | Ga0496107_0465399 | |||
| 1535 | Ga0496108_0002389 | |||
| 1536 | Ga0496108_0009156 | |||
| 1537 | Ga0496108_0120385 | |||
| 1538 | Ga0496108_0344031 | |||
| 1539 | Ga0496109_0000194 | |||
| 1540 | Ga0496109_0012206 | |||
| 1541 | Ga0496109_0014026 | |||
| 1542 | Ga0496109_0019135 | |||
| 1543 | Ga0496109_0044911 | |||
| 1544 | Ga0496110_0001051 | |||
| 1545 | Ga0496110_0036207 | |||
| 1546 | Ga0496110_0047047 | |||
| 1547 | Ga0496111_0017962 | |||
| 1548 | Ga0496111_0153284 | |||
| 1549 | Ga0496111_0418389 | |||
| 1550 | Ga0496111_0455107 | |||
| 1551 | Ga0496112_0014362 | |||
| 1552 | Ga0496112_0020568 | |||
| 1553 | Ga0496112_0037501 | |||
| 1554 | Ga0496112_0102127 | |||
| 1555 | Ga0496112_0127243 | |||
| 1556 | Ga0496113_0047645 | |||
| 1557 | Ga0496113_0096601 | |||
| 1558 | Ga0496113_0159394 | |||
| 1559 | Ga0496113_0246821 | |||
| 1560 | Ga0496114_0000565 | |||
| 1561 | Ga0496114_0001578 | |||
| 1562 | Ga0496114_0002406 | |||
| 1563 | Ga0496114_0015932 | |||
| 1564 | Ga0496114_0042881 | |||
| 1565 | Ga0496114_0128610 | |||
| 1566 | Ga0496114_0187776 | |||
| 1567 | Ga0496115_0002015 | |||
| 1568 | Ga0496115_0003619 | |||
| 1569 | Ga0496115_0005175 | |||
| 1570 | Ga0496115_0215114 | |||
| 1571 | Ga0496116_0000018 | |||
| 1572 | Ga0496116_0004103 | |||
| 1573 | Ga0496116_0011312 | |||
| 1574 | Ga0496117_0000015 | |||
| 1575 | Ga0496117_0011705 | |||
| 1576 | Ga0496117_0013169 | |||
| 1577 | Ga0496118_0000012 | |||
| 1578 | Ga0496118_0001009 | |||
| 1579 | Ga0496118_0008813 | |||
| 1580 | Ga0496118_0015304 | |||
| 1581 | Ga0496119_0000172 | |||
| 1582 | Ga0496119_0001151 | |||
| 1583 | Ga0496119_0003415 | |||
| 1584 | Ga0496120_0000155 | |||
| 1585 | Ga0496120_0047135 | |||
| 1586 | Ga0496120_0059207 | |||
| 1587 | Ga0496121_0000048 | |||
| 1588 | Ga0496121_0001740 | |||
| 1589 | Ga0496121_0008039 | |||
| 1590 | Ga0496121_0145222 | |||
| 1591 | Ga0496121_0285497 | |||
| 1592 | Ga0496122_0000301 | |||
| 1593 | Ga0496122_0026612 | |||
| 1594 | Ga0496123_0005215 | |||
| 1595 | Ga0496124_0000044 | |||
| 1596 | Ga0496125_0000037 | |||
| 1597 | Ga0496125_0050109 | |||
| 1598 | Ga0496125_0082381 | |||
| 1599 | Ga0496126_0000046 | |||
| 1600 | Ga0496126_0001956 | |||
| 1601 | Ga0496126_0002081 | |||
| 1602 | Ga0496126_0002916 | |||
| 1603 | Ga0496126_0058084 | |||
| 1604 | Ga0496126_0549661 | |||
| 1605 | Ga0501031_0001304 | |||
| 1606 | Ga0501031_0154326 | |||
| 1607 | Ga0501032_0002887 | |||
| 1608 | Ga0501032_0004269 | |||
| 1609 | Ga0501032_0018962 | |||
| 1610 | Ga0501032_0068983 | |||
| 1611 | Ga0501033_0007728 | |||
| 1612 | Ga0501033_0008359 | |||
| 1613 | Ga0501034_0004872 | |||
| 1614 | Ga0501034_0008695 | |||
| 1615 | Ga0501034_0030032 | |||
| 1616 | Ga0501034_0041969 | |||
| 1617 | Ga0501034_0223518 | |||
| 1618 | Ga0501034_0554987 | |||
| 1619 | Ga0501036_0003021 | |||
| 1620 | Ga0501036_0063603 | |||
| 1621 | Ga0501037_0000709 | |||
| 1622 | Ga0501037_0000782 | |||
| 1623 | Ga0501037_0017891 | |||
| 1624 | Ga0501037_0117570 | |||
| 1625 | Ga0501038_0003575 | |||
| 1626 | Ga0501039_0001120 | |||
| 1627 | Ga0501039_0001546 | |||
| 1628 | Ga0501042_0136574 | |||
| 1629 | Ga0501043_0001589 | |||
| 1630 | Ga0501043_0004131 | |||
| 1631 | Ga0501043_0116065 | |||
| 1632 | Ga0501043_0307131 | |||
| 1633 | Ga0501046_0000628 | |||
| 1634 | Ga0501046_0001159 | |||
| 1635 | Ga0501047_0005042 | |||
| 1636 | Ga0501047_0007282 | |||
| 1637 | Ga0501047_0127448 | |||
| 1638 | Ga0501047_0131948 | |||
| 1639 | Ga0501048_0002485 | |||
| 1640 | Ga0501048_0004665 | |||
| 1641 | Ga0501067_0006536 | |||
| 1642 | Ga0501068_0020388 | |||
| 1643 | Ga0501069_0006510 | |||
| 1644 | Ga0501069_0029463 | |||
| 1645 | Ga0501070_0001113 | |||
| 1646 | Ga0501070_0001530 | |||
| 1647 | Ga0501070_0008364 | |||
| 1648 | Ga0501070_0102791 | |||
| 1649 | Ga0501070_0180606 | |||
| 1650 | Ga0501071_0212238 | |||
| 1651 | Ga0501072_0089346 | |||
| 1652 | Ga0501072_0512128 | |||
| 1653 | Ga0501073_0002300 | |||
| 1654 | Ga0501073_0228294 | |||
| 1655 | Ga0501073_0340960 | |||
| 1656 | Ga0501074_0001996 | |||
| 1657 | Ga0501080_0007010 | |||
| 1658 | Ga0501080_0548622 | |||
| 1659 | Ga0501083_0055356 | |||
| 1660 | Ga0501035_0000229 | |||
| 1661 | Ga0501035_0001480 | |||
| 1662 | Ga0501035_0004339 | |||
| 1663 | Ga0501044_0000880 | |||
| 1664 | Ga0501044_0003297 | |||
| 1665 | Ga0501044_0004798 | |||
| 1666 | Ga0501044_0006629 | |||
| 1667 | Ga0501044_0029695 | |||
| 1668 | Ga0501044_0328210 | |||
| 1669 | Ga0501044_0355447 | |||
| 1670 | nmdc:mga03683_129562_c1 | |||
| 1671 | nmdc:mga03683_51133_c1 | |||
| 1672 | nmdc:mga03n38_45315_c1 | |||
| 1673 | nmdc:mga03n38_56426_c1 | |||
| 1674 | nmdc:mga03n38_5804_c1 | |||
| 1675 | nmdc:mga03n38_67015_c1 | |||
| 1676 | nmdc:mga03n38_9753_c1 | |||
| 1677 | nmdc:mga00v17_115761_c1 | |||
| 1678 | nmdc:mga00v17_2162_c1 | |||
| 1679 | nmdc:mga00v17_23825_c1 | |||
| 1680 | nmdc:mga00v17_3910_c1 | |||
| 1681 | nmdc:mga00v17_44428_c1 | |||
| 1682 | nmdc:mga00v17_86327_c1 | |||
| 1683 | nmdc:mga0yw44_111002_c1 | |||
| 1684 | nmdc:mga0yw44_52884_c1 | |||
| 1685 | nmdc:mga0yw44_88939_c1 | |||
| 1686 | nmdc:mga06z11_211952_c1 | |||
| 1687 | nmdc:mga07m45_101026_c1 | |||
| 1688 | nmdc:mga07m45_288120_c1 | |||
| 1689 | nmdc:mga07m45_4443_c1 | |||
| 1690 | nmdc:mga05p37_13488_c1 | |||
| 1691 | nmdc:mga05p37_42989_c1 | |||
| 1692 | nmdc:mga09592_95605_c1 | |||
| 1693 | nmdc:mga06r32_1478_c1 | |||
| 1694 | nmdc:mga08y16_126057_c1 | |||
| 1695 | nmdc:mga08y16_1361118_c1 | |||
| 1696 | nmdc:mga08y16_228716_c1 | |||
| 1697 | nmdc:mga08y16_35007_c1 | |||
| 1698 | nmdc:mga0n895_2309_c1 | |||
| 1699 | nmdc:mga0rr50_103117_c1 | |||
| 1700 | nmdc:mga0rr50_571000_c1 | |||
| 1701 | nmdc:mga0rr50_82254_c1 | |||
| 1702 | nmdc:mga08x19_93863_c1 | |||
| 1703 | nmdc:mga0a205_253272_c1 | |||
| 1704 | nmdc:mga0a205_39886_c1 | |||
| 1705 | nmdc:mga0sz30_2519_c1 | |||
| 1706 | nmdc:mga0sz30_28623_c2 | |||
| 1707 | nmdc:mga0sz30_2940_c1 | |||
| 1708 | nmdc:mga0sz30_30044_c1 | |||
| 1709 | nmdc:mga0sz30_74407_c1 | |||
| 1710 | Ga0495601_0220837 | |||
| 1711 | Ga0500635_0000868 | |||
| 1712 | Ga0495595_0081764 | |||
| 1713 | Ga0500643_007147 | |||
| 1714 | Ga0500643_007375 | |||
| 1715 | Ga0500644_0097777 | |||
| 1716 | Ga0500562_008683 | |||
| 1717 | Ga0500562_017976 | |||
| 1718 | Ga0500593_010816 | |||
| 1719 | Ga0500642_0046509 | |||
| 1720 | Ga0500652_001228 | |||
| 1721 | Ga0500559_0029303 | |||
| 1722 | Ga0500616_0029440 | |||
| 1723 | Ga0500616_0060050 | |||
| 1724 | Ga0500627_0001651 | |||
| 1725 | Ga0500645_000004 | |||
| 1726 | Ga0500645_025183 | |||
| 1727 | Ga0501084_0005190 | |||
| 1728 | Ga0466962_0008263 | |||
| 1729 | Ga0466962_0155051 | |||
| 1730 | 2523384195 | |||
| 1731 | 2548692421 | |||
| 1732 | 2552104961 | |||
| 1733 | 2566994634 | |||
| 1734 | 2583148717 | |||
| 1735 | 2586057600 | |||
| 1736 | 2644089528 | |||
| 1737 | 2644319373 | |||
| 1738 | 2644488351 | |||
| 1739 | 2644517336 | |||
| 1740 | 2644639965 | |||
| 1741 | 2738663862 | |||
| 1742 | 2738703209 | |||
| 1743 | 2738891138 | |||
| 1744 | 2739142997 | |||
| 1745 | 2739207215 | |||
| 1746 | 2739236335 | |||
| 1747 | 2739329327 | |||
| 1748 | 2739366019 | |||
| 1749 | 2744955115 | |||
| 1750 | 2753036791 | |||
| 1751 | 2753324662 | |||
| 1752 | 2791912534 | |||
| 1753 | 2795780673 | |||
| 1754 | 2809585771 | |||
| 1755 | 2816506447 | |||
| 1756 | 2842136181 | |||
| 1757 | 2842892229 | |||
| 1758 | 2866553417 | |||
| 1759 | 2866612275 | |||
| 1760 | 2883823317 | |||
| 1761 | 2889304199 | |||
| 1762 | 2891332093 | |||
| 1763 | 2899363700 | |||
| 1764 | 2899376270 | |||
| 1765 | 2902795269 | |||
| 1766 | 2902800390 | |||
| 1767 | 2902811827 | |||
| 1768 | 2902842904 | |||
| 1769 | 2904536162 | |||
| 1770 | 2904768372 | |||
| 1771 | 2904775761 | |||
| 1772 | 2908816030 | |||
| 1773 | 2915771085 | |||
| 1774 | 2917745082 | |||
| 1775 | 2919421743 | |||
| 1776 | 2919434699 | |||
| 1777 | 2919714788 | |||
| 1778 | 2922558087 | |||
| 1779 | 2928147463 | |||
| 1780 | 2929218418 | |||
| 1781 | 2932400044 | |||
| 1782 | 2939583625 | |||
| 1783 | 2939745407 | |||
| 1784 | 2956940702 | |||
| 1785 | 2974319686 | |||
| 1786 | 2984523554 | |||
| 1787 | 3001120382 | |||
| 1788 | 8003314481 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g93-assembly1.cif.gz_B | crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 | 0.8571 | 10 | 251 |
| 4jro-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.8474 | 10 | 238 |
| 1gz6-assembly1.cif.gz_B | (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 | 0.8474 | 10 | 224 |
| 3d5q-assembly3.cif.gz_C | crystal structure of 11b-hsd1 in complex with triazole inhibitor | 0.8465 | 10 | 235 |
| 2bel-assembly1.cif.gz_A | structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone | 0.8461 | 10 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGS9_8_252_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9656 | 8 | 258 | 3.40.50.720 |
| af_P9WGS9_8_252_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9617 | 8 | 258 | 3.40.50.720 |
| af_P9WGR3_8_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9144 | 12 | 258 | 3.40.50.720 |
| af_P9WGR3_8_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9071 | 12 | 258 | 3.40.50.720 |
| af_Q6PUF3_19_286_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8601 | 10 | 257 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8EZP4-F1-model_v4 | deleted | 0.9636 | 13 | 260 |
|
| AF-A0A259YPS8-F1-model_v4 | Decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase | 0.9622 | 1 | 260 |
GO:0016491
|
| AF-A0A4U0PY96-F1-model_v4 | deleted | 0.9601 | 2 | 260 |
|
| AF-A0A259YPS8-F1-model_v4 | Decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase | 0.9585 | 1 | 260 |
GO:0016491
|
| AF-A0A4U0PY96-F1-model_v4 | deleted | 0.9564 | 2 | 260 |
|