F484938

General Info

Members Datasets Scaffolds Average Seq Length
894 401 1788 256

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10134797|Ga0157378_101347971
Length 271
Sequence MVLDAVGNPQTILLLGGTSEIGLAICERYLRNASARIVLTALPDDPLRDNAVAQMKAAGAKSVEVIDFDAVDTESHPKVIDAAFKDGVGGPRDVDVAIVAFGLLGNAEELWQNQRKAVQIAEINYTAAISVGVLLGEKMRAQGFGQIIAMSSAAGERVRRSNFVYGSTKAGLDGFYLGLGEALREFGVRVLVIRPGQVRTTTTVEHWKATGTKEAPFTVDKEYVAELAVTASAKGKELVWAPGAFRYVMMVLRHIPRPIFRKLPIGCAALR

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
208 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
344 2547132424 Nocardia nova SH22a Isolate Unclassified
345 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
346 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
347 2582580736 Prauserella sp. Am3 Isolate Unclassified
348 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
349 2643221615 Nocardioides sp. Root224 Isolate Unclassified
350 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
351 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
352 2643221692 Nocardia sp. Root136 Isolate Unclassified
353 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
354 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
355 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
356 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
357 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
358 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
359 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
360 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
361 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
362 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
363 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
364 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
365 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
366 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
367 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
368 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
369 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
370 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
371 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
372 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
373 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
374 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
375 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
376 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
377 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
378 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
379 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
380 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
381 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
382 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
383 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
384 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
385 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
386 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
387 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
388 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
389 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
390 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
391 2922554459 Rhodococcus sp. 66b Isolate Unclassified
392 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
393 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
394 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
395 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
396 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
397 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
398 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
399 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
400 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
401 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 8.39
Nodule 0.11
Rhizoplane 9.62
Rhizosphere 71.48
Stem 0
Stem Tuber 0.11
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10134797 3300013297 Bacteria 2289
2 JGI24737J22298_10008519 3300001990 Bacteria 3428
3 JGI24750J21931_1002359 3300002070 Bacteria 2279
4 JGI24748J21848_1002939 3300002074 Bacteria 1941
5 JGI24749J21850_1015492 3300002076 Bacteria 1069
6 JGI24744J21845_10003469 3300002077 Bacteria 3242
7 JGI24034J26672_10003741 3300002239 Bacteria 2129
8 JGI24742J22300_10000256 3300002244 Bacteria 7906
9 JGI24751J29686_10007130 3300002459 Bacteria 2286
10 JGI25406J46586_10000561 3300003203 Bacteria 17546
11 JGI25406J46586_10009101 3300003203 Bacteria 4458
12 rootH2_10029196 3300003320 Bacteria 4774
13 JGI25407J50210_10001654 3300003373 Bacteria 5099
14 Ga0055540_1000224 3300003792 Bacteria 53433
15 Ga0055540_1000638 3300003792 Bacteria 24867
16 Ga0055540_1002195 3300003792 Bacteria 10612
17 Ga0055540_1003480 3300003792 Bacteria 7595
18 Ga0055540_1009335 3300003792 Bacteria 3401
19 JGI25405J52794_10015821 3300003911 Bacteria 1485
20 Ga0070676_10006401 3300005328 Bacteria 6291
21 Ga0070676_10076885 3300005328 Bacteria 2016
22 Ga0070683_100188763 3300005329 Bacteria 1957
23 Ga0070666_10064939 3300005335 Bacteria 2476
24 Ga0070666_10169424 3300005335 Bacteria 1529
25 Ga0070682_100002498 3300005337 Bacteria 10156
26 Ga0070682_100015971 3300005337 Bacteria 4360
27 Ga0070682_100061262 3300005337 Bacteria 2381
28 Ga0068868_100002197 3300005338 Bacteria 13465
29 Ga0068868_100225302 3300005338 Bacteria 1571
30 Ga0070660_100272893 3300005339 Bacteria 1383
31 Ga0070689_100018845 3300005340 Bacteria 5094
32 Ga0070689_100248362 3300005340 Bacteria 1467
33 Ga0070691_10006195 3300005341 Bacteria 5459
34 Ga0070692_10035217 3300005345 Bacteria 2533
35 Ga0070668_100002008 3300005347 Bacteria 14877
36 Ga0070668_100005862 3300005347 Bacteria 9109
37 Ga0070668_100057308 3300005347 Bacteria 3010
38 Ga0070668_100086399 3300005347 Bacteria 2466
39 Ga0070669_100003185 3300005353 Bacteria 11798
40 Ga0070669_100003801 3300005353 Bacteria 10908
41 Ga0070674_100001890 3300005356 Bacteria 11371
42 Ga0070674_100637400 3300005356 Bacteria 904
43 Ga0070673_100276308 3300005364 Bacteria 1472
44 Ga0070688_100006685 3300005365 Bacteria 6181
45 Ga0070688_100107590 3300005365 Bacteria 1849
46 Ga0070688_100356216 3300005365 Bacteria 1072
47 Ga0070659_100006606 3300005366 Bacteria 8378
48 Ga0070659_100491900 3300005366 Bacteria 1045
49 Ga0070667_100000099 3300005367 Bacteria 108662
50 Ga0070667_100001927 3300005367 Bacteria 18405
51 Ga0070667_100003067 3300005367 Bacteria 14370
52 Ga0070667_100186354 3300005367 Bacteria 1837
53 Ga0070667_100438081 3300005367 Bacteria 1193
54 Ga0070709_10006137 3300005434 Bacteria 6538
55 Ga0070709_10045358 3300005434 Bacteria 2727
56 Ga0070714_100005131 3300005435 Bacteria 9965
57 Ga0070714_100024876 3300005435 Bacteria 4936
58 Ga0070714_100069932 3300005435 Bacteria 3033
59 Ga0070714_100186647 3300005435 Bacteria 1889
60 Ga0070713_100050798 3300005436 Bacteria 3427
61 Ga0070713_100104658 3300005436 Bacteria 2457
62 Ga0070710_10002517 3300005437 Bacteria 8694
63 Ga0070710_10046689 3300005437 Bacteria 2413
64 Ga0070710_10060752 3300005437 Bacteria 2150
65 Ga0070701_10002780 3300005438 Bacteria 6798
66 Ga0070711_100002334 3300005439 Bacteria 10781
67 Ga0070705_100031235 3300005440 Bacteria 2948
68 Ga0070705_100249754 3300005440 Bacteria 1244
69 Ga0070700_100006443 3300005441 Bacteria 6280
70 Ga0070700_100170492 3300005441 Bacteria 1507
71 Ga0070694_100032483 3300005444 Bacteria 3428
72 Ga0070663_100003168 3300005455 Bacteria 9441
73 Ga0070663_100003811 3300005455 Bacteria 8775
74 Ga0070663_100045175 3300005455 Bacteria 3110
75 Ga0070663_100249745 3300005455 Bacteria 1404
76 Ga0070678_100000756 3300005456 Bacteria 16206
77 Ga0070678_100134739 3300005456 Bacteria 1968
78 Ga0070678_100246191 3300005456 Bacteria 1497
79 Ga0070662_100006460 3300005457 Bacteria 7558
80 Ga0070662_100023089 3300005457 Bacteria 4269
81 Ga0070662_100024036 3300005457 Bacteria 4193
82 Ga0070662_100074274 3300005457 Bacteria 2514
83 Ga0068867_100003459 3300005459 Bacteria 11107
84 Ga0068867_100176268 3300005459 Bacteria 1697
85 Ga0070684_100820585 3300005535 Bacteria 870
86 Ga0068853_100003045 3300005539 Bacteria 12804
87 Ga0068853_100139121 3300005539 Bacteria 2179
88 Ga0070695_100087204 3300005545 Bacteria 2076
89 Ga0070696_100002281 3300005546 Bacteria 12645
90 Ga0070693_100008418 3300005547 Bacteria 5085
91 Ga0070693_100166396 3300005547 Bacteria 1409
92 Ga0070665_100010952 3300005548 Bacteria 9171
93 Ga0070665_100012066 3300005548 Bacteria 8716
94 Ga0070665_100179534 3300005548 Bacteria 2118
95 Ga0070665_100339486 3300005548 Bacteria 1507
96 Ga0070704_100001654 3300005549 Bacteria 12080
97 Ga0068854_100002834 3300005578 Bacteria 10772
98 Ga0068854_100053305 3300005578 Bacteria 2904
99 Ga0068854_100083310 3300005578 Bacteria 2365
100 Ga0068854_100161019 3300005578 Bacteria 1738
101 Ga0068854_100362087 3300005578 Bacteria 1190
102 Ga0068856_100039659 3300005614 Bacteria 4624
103 Ga0070702_100000598 3300005615 Bacteria 13237
104 Ga0070702_100055618 3300005615 Bacteria 2282
105 Ga0070702_100279135 3300005615 Bacteria 1146
106 Ga0070702_100464409 3300005615 Bacteria 921
107 Ga0068852_100321797 3300005616 Bacteria 1502
108 Ga0068852_100549849 3300005616 Bacteria 1155
109 Ga0068852_100853838 3300005616 Bacteria 926
110 Ga0068859_100159534 3300005617 Bacteria 2334
111 Ga0068864_100374755 3300005618 Bacteria 1347
112 Ga0068864_100746491 3300005618 Bacteria 959
113 Ga0068861_100002278 3300005719 Bacteria 12452
114 Ga0068861_100117472 3300005719 Bacteria 2140
115 Ga0068861_100227457 3300005719 Bacteria 1580
116 Ga0068861_100256686 3300005719 Bacteria 1494
117 Ga0068861_100446717 3300005719 Bacteria 1158
118 Ga0068863_100001544 3300005841 Bacteria 22729
119 Ga0068863_100255560 3300005841 Bacteria 1693
120 Ga0068858_100006943 3300005842 Bacteria 11004
121 Ga0068858_100079396 3300005842 Bacteria 3049
122 Ga0068858_100430484 3300005842 Bacteria 1270
123 Ga0068860_100000163 3300005843 Bacteria 108836
124 Ga0068860_100005668 3300005843 Bacteria 12610
125 Ga0068862_100000089 3300005844 Bacteria 109047
126 Ga0081455_10000960 3300005937 Bacteria 36843
127 Ga0081455_10001006 3300005937 Bacteria 35740
128 Ga0081455_10015441 3300005937 Bacteria 7420
129 Ga0081455_10023737 3300005937 Bacteria 5699
130 Ga0081455_10037388 3300005937 Bacteria 4313
131 Ga0081455_10039180 3300005937 Bacteria 4191
132 Ga0081455_10088813 3300005937 Bacteria 2510
133 Ga0081455_10297549 3300005937 Bacteria 1159
134 Ga0081538_10000350 3300005981 Bacteria 52656
135 Ga0081538_10037698 3300005981 Bacteria 3130
136 Ga0081539_10000177 3300005985 Bacteria 149939
137 Ga0081539_10000208 3300005985 Bacteria 136941
138 Ga0075365_10004072 3300006038 Bacteria 7674
139 Ga0075365_10018618 3300006038 Bacteria 4273
140 Ga0075365_10036173 3300006038 Bacteria 3199
141 Ga0075365_10255222 3300006038 Bacteria 1232
142 Ga0075363_100002325 3300006048 Bacteria 7724
143 Ga0075363_100004070 3300006048 Bacteria 6332
144 Ga0075363_100007457 3300006048 Bacteria 5031
145 Ga0075363_100010027 3300006048 Bacteria 4477
146 Ga0075363_100029559 3300006048 Bacteria 2830
147 Ga0075363_100033350 3300006048 Bacteria 2680
148 Ga0075363_100215888 3300006048 Bacteria 1099
149 Ga0075364_10004891 3300006051 Bacteria 7764
150 Ga0075364_10005390 3300006051 Bacteria 7427
151 Ga0075364_10010736 3300006051 Bacteria 5541
152 Ga0075364_10253633 3300006051 Bacteria 1196
153 Ga0075364_10283997 3300006051 Bacteria 1126
154 Ga0075432_10000656 3300006058 Bacteria 10582
155 Ga0075432_10002493 3300006058 Bacteria 6118
156 Ga0070715_10077959 3300006163 Bacteria 1497
157 Ga0070716_100026600 3300006173 Bacteria 3099
158 Ga0070712_100002169 3300006175 Bacteria 12073
159 Ga0075362_10074410 3300006177 Bacteria 1556
160 Ga0075362_10093730 3300006177 Bacteria 1397
161 Ga0075367_10019928 3300006178 Bacteria 3727
162 Ga0075367_10027141 3300006178 Bacteria 3254
163 Ga0075367_10046966 3300006178 Bacteria 2538
164 Ga0075369_10010520 3300006186 Bacteria 3619
165 Ga0075369_10024117 3300006186 Bacteria 2519
166 Ga0075369_10039578 3300006186 Bacteria 2013
167 Ga0097621_100065638 3300006237 Bacteria 2988
168 Ga0097621_100148069 3300006237 Bacteria 2012
169 Ga0075370_10176872 3300006353 Bacteria 1255
170 Ga0075370_10208702 3300006353 Bacteria 1153
171 Ga0068871_100386129 3300006358 Bacteria 1245
172 Ga0075428_100003868 3300006844 Bacteria 16449
173 Ga0075428_100005349 3300006844 Bacteria 14275
174 Ga0075428_100098420 3300006844 Bacteria 3189
175 Ga0075430_100206146 3300006846 Bacteria 1632
176 Ga0075430_100365266 3300006846 Bacteria 1192
177 Ga0075431_100005313 3300006847 Bacteria 12699
178 Ga0075431_100098407 3300006847 Bacteria 3020
179 Ga0075433_10012690 3300006852 Bacteria 6818
180 Ga0075433_10031857 3300006852 Bacteria 4511
181 Ga0075434_100002464 3300006871 Bacteria 16286
182 Ga0075434_100009840 3300006871 Bacteria 8940
183 Ga0075429_100226184 3300006880 Bacteria 1639
184 Ga0068865_100005190 3300006881 Bacteria 7876
185 Ga0068865_100025998 3300006881 Bacteria 3855
186 Ga0068865_100082211 3300006881 Bacteria 2315
187 Ga0068865_100157136 3300006881 Bacteria 1731
188 Ga0075436_100010325 3300006914 Bacteria 6397
189 Ga0075436_100107687 3300006914 Bacteria 1944
190 Ga0097620_100159520 3300006931 Bacteria 2334
191 Ga0075435_100037694 3300007076 Bacteria 3851
192 Ga0075435_100280488 3300007076 Bacteria 1422
193 Ga0105250_10024692 3300009092 Bacteria 2421
194 Ga0105240_10660461 3300009093 Bacteria 1145
195 Ga0111539_10001067 3300009094 Bacteria 36168
196 Ga0111539_10002580 3300009094 Bacteria 23985
197 Ga0111539_10065758 3300009094 Bacteria 4283
198 Ga0105245_10003222 3300009098 Bacteria 14618
199 Ga0105245_10153586 3300009098 Bacteria 2179
200 Ga0105245_10154976 3300009098 Bacteria 2169
201 Ga0105245_10413592 3300009098 Bacteria 1350
202 Ga0105245_10670808 3300009098 Bacteria 1068
203 Ga0105245_11145297 3300009098 Bacteria 825
204 Ga0105247_10000089 3300009101 Bacteria 98925
205 Ga0105247_10000789 3300009101 Bacteria 24300
206 Ga0105247_10367976 3300009101 Bacteria 1016
207 Ga0114129_10004878 3300009147 Bacteria 18928
208 Ga0114129_10022481 3300009147 Bacteria 8950
209 Ga0105243_10000750 3300009148 Bacteria 31118
210 Ga0105243_10001257 3300009148 Bacteria 22766
211 Ga0105243_10011698 3300009148 Bacteria 6638
212 Ga0105243_10078344 3300009148 Bacteria 2690
213 Ga0105243_10198101 3300009148 Bacteria 1759
214 Ga0105243_10228889 3300009148 Bacteria 1648
215 Ga0105241_10190536 3300009174 Bacteria 1707
216 Ga0105242_10000963 3300009176 Bacteria 22475
217 Ga0105242_10041923 3300009176 Bacteria 3694
218 Ga0105248_10000759 3300009177 Bacteria 36159
219 Ga0105248_10005751 3300009177 Bacteria 13624
220 Ga0105248_10019990 3300009177 Bacteria 7414
221 Ga0105237_10005264 3300009545 Bacteria 14636
222 Ga0105237_10051567 3300009545 Bacteria 4132
223 Ga0105237_10074798 3300009545 Bacteria 3379
224 Ga0105237_10424447 3300009545 Bacteria 1335
225 Ga0105237_10932101 3300009545 Bacteria 875
226 Ga0105238_10352577 3300009551 Bacteria 1460
227 Ga0105249_10000117 3300009553 Bacteria 108322
228 Ga0105249_10001051 3300009553 Bacteria 24454
229 Ga0105249_10013331 3300009553 Bacteria 7258
230 Ga0105249_10020582 3300009553 Bacteria 5899
231 Ga0105249_10169468 3300009553 Bacteria 2116
232 Ga0105239_10085231 3300010375 Bacteria 3481
233 Ga0105239_10141564 3300010375 Bacteria 2680
234 Ga0105239_10272391 3300010375 Bacteria 1904
235 Ga0105239_11241536 3300010375 Bacteria 859
236 Ga0157371_10135563 3300013102 Bacteria 1753
237 Ga0157371_10401226 3300013102 Unclassified 1003
238 Ga0157374_10033602 3300013296 Bacteria 4681
239 Ga0157378_10002445 3300013297 Bacteria 16526
240 Ga0157378_10675430 3300013297 Bacteria 1050
241 Ga0163162_10013672 3300013306 Bacteria 7931
242 Ga0163162_10044867 3300013306 Bacteria 4428
243 Ga0163162_10082635 3300013306 Bacteria 3284
244 Ga0163162_10157074 3300013306 Bacteria 2395
245 Ga0163162_10613772 3300013306 Bacteria 1213
246 Ga0157372_10016723 3300013307 Bacteria 7874
247 Ga0157375_10011656 3300013308 Bacteria 7767
248 Ga0157375_10069720 3300013308 Bacteria 3523
249 Ga0157375_10196913 3300013308 Bacteria 2170
250 Ga0157375_10608751 3300013308 Bacteria 1251
251 Ga0157375_10793531 3300013308 Bacteria 1096
252 Ga0163163_10113908 3300014325 Bacteria 2735
253 Ga0163163_10633755 3300014325 Bacteria 1132
254 Ga0157380_10003822 3300014326 Bacteria 10370
255 Ga0157380_10249288 3300014326 Bacteria 1606
256 Ga0157380_10421896 3300014326 Bacteria 1273
257 Ga0157380_10962613 3300014326 Bacteria 884
258 Ga0157377_10008125 3300014745 Bacteria 5102
259 Ga0157379_10015349 3300014968 Bacteria 6720
260 Ga0157379_10610045 3300014968 Bacteria 1019
261 Ga0163161_10050877 3300017792 Bacteria 2999
262 Ga0163161_10101657 3300017792 Bacteria 2140
263 Ga0163161_10538727 3300017792 Bacteria 955
264 Ga0213876_10007573 3300021384 Bacteria 5896
265 Ga0213876_10057069 3300021384 Bacteria 2061
266 Ga0209025_1071975 3300025294 Bacteria 1221
267 Ga0209051_1000014 3300025303 Bacteria 552732
268 Ga0209051_1000649 3300025303 Bacteria 39520
269 Ga0209051_1017134 3300025303 Bacteria 3248
270 Ga0207682_10079290 3300025893 Bacteria 1404
271 Ga0207692_10070073 3300025898 Bacteria 1844
272 Ga0207642_10001963 3300025899 Bacteria 6348
273 Ga0207710_10000117 3300025900 Bacteria 98934
274 Ga0207710_10002764 3300025900 Bacteria 8027
275 Ga0207688_10004112 3300025901 Bacteria 7931
276 Ga0207688_10025078 3300025901 Bacteria 3272
277 Ga0207688_10041216 3300025901 Bacteria 2568
278 Ga0207688_10098058 3300025901 Bacteria 1689
279 Ga0207688_10148614 3300025901 Bacteria 1383
280 Ga0207680_10025388 3300025903 Bacteria 3268
281 Ga0207680_10175026 3300025903 Bacteria 1448
282 Ga0207647_10062110 3300025904 Bacteria 2277
283 Ga0207685_10058280 3300025905 Bacteria 1519
284 Ga0207699_10063575 3300025906 Bacteria 2230
285 Ga0207699_10107364 3300025906 Bacteria 1783
286 Ga0207645_10004678 3300025907 Bacteria 10074
287 Ga0207645_10017935 3300025907 Bacteria 4667
288 Ga0207705_10211588 3300025909 Bacteria 1471
289 Ga0207654_10059311 3300025911 Bacteria 2231
290 Ga0207671_10029890 3300025914 Bacteria 4066
291 Ga0207671_10305666 3300025914 Bacteria 1257
292 Ga0207693_10003426 3300025915 Bacteria 13530
293 Ga0207693_10003579 3300025915 Bacteria 13280
294 Ga0207693_10362631 3300025915 Bacteria 1134
295 Ga0207663_10000867 3300025916 Bacteria 13745
296 Ga0207663_10050520 3300025916 Bacteria 2584
297 Ga0207657_10348721 3300025919 Bacteria 1168
298 Ga0207681_10000981 3300025923 Bacteria 18645
299 Ga0207681_10003890 3300025923 Bacteria 9273
300 Ga0207681_10448070 3300025923 Bacteria 1050
301 Ga0207694_10201362 3300025924 Bacteria 1620
302 Ga0207687_10001539 3300025927 Bacteria 15831
303 Ga0207687_10064402 3300025927 Bacteria 2599
304 Ga0207687_10104853 3300025927 Bacteria 2088
305 Ga0207700_10039701 3300025928 Bacteria 3429
306 Ga0207700_10130438 3300025928 Bacteria 2051
307 Ga0207664_10055373 3300025929 Bacteria 3147
308 Ga0207664_10135649 3300025929 Bacteria 2077
309 Ga0207664_10139816 3300025929 Bacteria 2047
310 Ga0207664_10476243 3300025929 Bacteria 1116
311 Ga0207664_10542340 3300025929 Bacteria 1043
312 Ga0207644_10022462 3300025931 Bacteria 4310
313 Ga0207644_10179092 3300025931 Bacteria 1660
314 Ga0207690_10089896 3300025932 Bacteria 2166
315 Ga0207706_10003642 3300025933 Bacteria 14716
316 Ga0207706_10013964 3300025933 Bacteria 7282
317 Ga0207706_10089652 3300025933 Bacteria 2704
318 Ga0207686_10036566 3300025934 Bacteria 2957
319 Ga0207686_10090564 3300025934 Bacteria 2018
320 Ga0207709_10001151 3300025935 Bacteria 19257
321 Ga0207709_10001566 3300025935 Bacteria 15676
322 Ga0207709_10044571 3300025935 Bacteria 2681
323 Ga0207709_10195296 3300025935 Bacteria 1441
324 Ga0207709_10223529 3300025935 Bacteria 1359
325 Ga0207670_10110788 3300025936 Bacteria 1978
326 Ga0207669_10000548 3300025937 Bacteria 16351
327 Ga0207669_10241713 3300025937 Bacteria 1339
328 Ga0207704_10002430 3300025938 Bacteria 8379
329 Ga0207704_10044280 3300025938 Bacteria 2636
330 Ga0207704_10072209 3300025938 Bacteria 2193
331 Ga0207704_10125956 3300025938 Bacteria 1764
332 Ga0207704_10340214 3300025938 Unclassified 1164
333 Ga0207665_10007609 3300025939 Bacteria 7154
334 Ga0207665_10010595 3300025939 Bacteria 6056
335 Ga0207711_10002505 3300025941 Bacteria 16371
336 Ga0207711_10006754 3300025941 Bacteria 9646
337 Ga0207711_10119077 3300025941 Bacteria 2356
338 Ga0207689_10020743 3300025942 Bacteria 5526
339 Ga0207689_10170004 3300025942 Bacteria 1796
340 Ga0207679_10825414 3300025945 Bacteria 846
341 Ga0207667_10116751 3300025949 Bacteria 2750
342 Ga0207712_10000083 3300025961 Bacteria 108319
343 Ga0207712_10008133 3300025961 Bacteria 6635
344 Ga0207712_10448487 3300025961 Bacteria 1094
345 Ga0207668_10011317 3300025972 Bacteria 5415
346 Ga0207668_10024543 3300025972 Bacteria 3893
347 Ga0207668_10351183 3300025972 Bacteria 1233
348 Ga0207668_10647212 3300025972 Bacteria 925
349 Ga0207640_10022189 3300025981 Bacteria 3795
350 Ga0207640_10076831 3300025981 Bacteria 2268
351 Ga0207640_10124896 3300025981 Bacteria 1851
352 Ga0207640_10172078 3300025981 Bacteria 1615
353 Ga0207640_10283957 3300025981 Bacteria 1302
354 Ga0207658_10014847 3300025986 Bacteria 5337
355 Ga0207658_10155624 3300025986 Bacteria 1867
356 Ga0207677_10001615 3300026023 Bacteria 11954
357 Ga0207703_10011161 3300026035 Bacteria 6991
358 Ga0207703_10060130 3300026035 Bacteria 3106
359 Ga0207703_10155123 3300026035 Bacteria 2000
360 Ga0207703_10213120 3300026035 Bacteria 1723
361 Ga0207639_10002209 3300026041 Bacteria 13112
362 Ga0207639_10025226 3300026041 Bacteria 4310
363 Ga0207678_10000033 3300026067 Bacteria 105464
364 Ga0207678_10044189 3300026067 Bacteria 3854
365 Ga0207678_10286429 3300026067 Bacteria 1415
366 Ga0207678_10475365 3300026067 Bacteria 1088
367 Ga0207708_10005099 3300026075 Bacteria 9691
368 Ga0207708_10020907 3300026075 Bacteria 4938
369 Ga0207708_10035565 3300026075 Bacteria 3790
370 Ga0207702_10027519 3300026078 Bacteria 4722
371 Ga0207702_10462864 3300026078 Bacteria 1232
372 Ga0207641_10001265 3300026088 Bacteria 25170
373 Ga0207641_10005115 3300026088 Bacteria 11233
374 Ga0207641_10250521 3300026088 Bacteria 1654
375 Ga0207648_10001134 3300026089 Bacteria 29924
376 Ga0207648_10193084 3300026089 Bacteria 1805
377 Ga0207676_10247514 3300026095 Bacteria 1603
378 Ga0207676_10697129 3300026095 Bacteria 983
379 Ga0207675_100003626 3300026118 Bacteria 15059
380 Ga0207675_100012534 3300026118 Bacteria 7919
381 Ga0207675_100084687 3300026118 Bacteria 2975
382 Ga0207675_100143011 3300026118 Bacteria 2273
383 Ga0207675_100268882 3300026118 Bacteria 1654
384 Ga0207675_100382278 3300026118 Bacteria 1385
385 Ga0207683_10001167 3300026121 Bacteria 23768
386 Ga0207683_10022192 3300026121 Bacteria 5448
387 Ga0207683_10086046 3300026121 Bacteria 2795
388 Ga0207683_10260258 3300026121 Bacteria 1584
389 Ga0207698_10525432 3300026142 Bacteria 1156
390 Ga0207428_10002324 3300027907 Bacteria 19038
391 Ga0207428_10005586 3300027907 Bacteria 11694
392 Ga0207428_10222363 3300027907 Bacteria 1415
393 Ga0268266_10017220 3300028379 Bacteria 6171
394 Ga0268266_10048488 3300028379 Bacteria 3641
395 Ga0268266_10099338 3300028379 Bacteria 2562
396 Ga0268266_10128750 3300028379 Bacteria 2262
397 Ga0268266_10181683 3300028379 Bacteria 1916
398 Ga0268265_10000099 3300028380 Bacteria 109591
399 Ga0268265_10170717 3300028380 Bacteria 1858
400 Ga0268264_10000225 3300028381 Bacteria 109852
401 Ga0268264_10003305 3300028381 Bacteria 13927
402 Ga0268264_10549046 3300028381 Bacteria 1133
403 Ga0268264_10576725 3300028381 Bacteria 1106
404 Ga0307515_10056052 3300028794 Bacteria 5739
405 Ga0307515_10170871 3300028794 Bacteria 2167
406 Ga0307512_10004437 3300030522 Bacteria 15365
407 Ga0265327_10000001 3300031251 Bacteria 894475
408 Ga0265327_10000113 3300031251 Bacteria 175267
409 Ga0265327_10001712 3300031251 Bacteria 26120
410 Ga0265327_10012873 3300031251 Bacteria 5603
411 Ga0307408_100021224 3300031548 Bacteria 4393
412 Ga0307408_100021790 3300031548 Bacteria 4342
413 Ga0307408_100080051 3300031548 Bacteria 2439
414 Ga0307405_10011820 3300031731 Bacteria 4595
415 Ga0307405_10120053 3300031731 Bacteria 1797
416 Ga0307405_10171850 3300031731 Unclassified 1547
417 Ga0307405_10457330 3300031731 Unclassified 1013
418 Ga0307413_10005578 3300031824 Bacteria 5637
419 Ga0307413_10006466 3300031824 Bacteria 5356
420 Ga0307413_10014889 3300031824 Bacteria 3968
421 Ga0307413_10182836 3300031824 Bacteria 1497
422 Ga0307518_10000474 3300031838 Bacteria 30579
423 Ga0307518_10008681 3300031838 Bacteria 7259
424 Ga0307410_10000323 3300031852 Bacteria 18618
425 Ga0307410_10007648 3300031852 Bacteria 5928
426 Ga0307410_10078510 3300031852 Bacteria 2311
427 Ga0307410_10090479 3300031852 Bacteria 2170
428 Ga0307406_10001419 3300031901 Bacteria 13274
429 Ga0307406_10008727 3300031901 Bacteria 5664
430 Ga0307406_10237404 3300031901 Bacteria 1365
431 Ga0307407_10004733 3300031903 Bacteria 5819
432 Ga0307407_10039837 3300031903 Bacteria 2615
433 Ga0307407_10114423 3300031903 Bacteria 1699
434 Ga0307412_10007342 3300031911 Bacteria 6249
435 Ga0307412_10023055 3300031911 Bacteria 3826
436 Ga0307409_100002136 3300031995 Bacteria 10185
437 Ga0307409_100028131 3300031995 Bacteria 3998
438 Ga0307409_100034938 3300031995 Bacteria 3678
439 Ga0307409_100085664 3300031995 Bacteria 2562
440 Ga0307409_100216541 3300031995 Bacteria 1725
441 Ga0307409_100332781 3300031995 Bacteria 1426
442 Ga0307416_100000046 3300032002 Bacteria 120916
443 Ga0307416_100011055 3300032002 Bacteria 5998
444 Ga0307416_100392199 3300032002 Bacteria 1423
445 Ga0307414_10004676 3300032004 Bacteria 7462
446 Ga0307414_10090784 3300032004 Bacteria 2268
447 Ga0307414_10274876 3300032004 Bacteria 1413
448 Ga0307411_10000436 3300032005 Bacteria 14249
449 Ga0307411_10038704 3300032005 Bacteria 3010
450 Ga0307415_100000401 3300032126 Bacteria 18454
451 Ga0307415_100071255 3300032126 Bacteria 2443
452 Ga0307415_100080416 3300032126 Bacteria 2325
453 Ga0307415_100250182 3300032126 Bacteria 1439
454 Ga0316583_10023557 3300032133 Bacteria 2199
455 Ga0307507_10030415 3300033179 Bacteria 5696
456 Ga0307507_10254176 3300033179 Bacteria 1131
457 Ga0373949_0026112 3300035090 Bacteria 1367
458 Ga0373962_0041304 3300035242 Bacteria 1300
459 Ga0373931_0012026 3300035691 Bacteria 4189
460 Ga0373931_0067399 3300035691 Bacteria 1945
461 Ga0373947_0084518 3300035725 Bacteria 1970
462 Ga0316584_0061259 3300036712 Bacteria 2818
463 Ga0436364_0197209 3300037853 Bacteria 9790
464 Ga0436365_0175886 3300039437 Bacteria 3447
465 Ga0436365_0204440 3300039437 Bacteria 69949
466 Ga0436365_0584104 3300039437 Bacteria 949
467 Ga0436363_1366560 3300039450 Bacteria 2386
468 Ga0439461_0003303 3300041410 Bacteria 2648
469 Ga0439461_0028679 3300041410 Bacteria 1148
470 Ga0439466_0001673 3300041411 Bacteria 8658
471 Ga0439466_0015252 3300041411 Bacteria 2792
472 Ga0439465_0003497 3300041413 Bacteria 5120
473 Ga0439465_0009288 3300041413 Bacteria 3097
474 Ga0451791_0138042 3300041451 Bacteria 812
475 Ga0451833_1190084 3300041491 Bacteria 2640
476 Ga0451837_0583427 3300041494 Bacteria 1708
477 Ga0451853_1890043 3300041512 Bacteria 2867
478 Ga0451853_3823848 3300041512 Bacteria 7397
479 Ga0439431_0015082 3300041997 Bacteria 1796
480 Ga0439431_0019303 3300041997 Bacteria 1620
481 Ga0439442_009060 3300042002 Bacteria 2012
482 Ga0439442_025376 3300042002 Bacteria 1233
483 Ga0439445_0012234 3300042004 Bacteria 2059
484 Ga0439445_0045596 3300042004 Bacteria 1173
485 Ga0439448_0019001 3300042005 Bacteria 2112
486 Ga0439450_005997 3300042008 Bacteria 2167
487 Ga0439463_000935 3300042016 Bacteria 8012
488 Ga0439463_035877 3300042016 Bacteria 1256
489 Ga0450900_021040 3300042136 Bacteria 909
490 Ga0439440_0002422 3300042993 Bacteria 3529
491 Ga0466969_0028410 3300044656 Bacteria 2859
492 Ga0466972_0001388 3300044658 Bacteria 11749
493 Ga0466972_0003436 3300044658 Bacteria 7854
494 Ga0466972_0038369 3300044658 Bacteria 2340
495 Ga0466972_0052629 3300044658 Bacteria 1961
496 Ga0466972_0092234 3300044658 Bacteria 1436
497 Ga0466965_0000276 3300044683 Bacteria 16929
498 Ga0466965_0000672 3300044683 Bacteria 12575
499 Ga0466965_0020433 3300044683 Bacteria 3183
500 Ga0466965_0033639 3300044683 Bacteria 2506
501 Ga0466965_0152438 3300044683 Bacteria 1208
502 Ga0466965_0217495 3300044683 Bacteria 1018
503 Ga0466966_0007657 3300044684 Bacteria 7158
504 Ga0466966_0046479 3300044684 Bacteria 2771
505 Ga0466961_0008084 3300044693 Bacteria 6704
506 Ga0466961_0048460 3300044693 Bacteria 2715
507 Ga0466963_0016619 3300044694 Bacteria 4578
508 Ga0466963_0177531 3300044694 Bacteria 1486
509 Ga0466963_0242473 3300044694 Bacteria 1264
510 Ga0466964_0079923 3300044706 Bacteria 1401
511 Ga0466971_0004305 3300044719 Bacteria 6137
512 Ga0466971_0029624 3300044719 Bacteria 2448
513 Ga0466971_0042574 3300044719 Bacteria 2041
514 Ga0466968_0000522 3300044735 Bacteria 13039
515 Ga0466968_0003228 3300044735 Bacteria 6011
516 Ga0466968_0017269 3300044735 Bacteria 2883
517 Ga0466968_0070613 3300044735 Bacteria 1520
518 Ga0466970_0013085 3300044765 Bacteria 4252
519 Ga0466970_0013332 3300044765 Bacteria 4214
520 Ga0466970_0026952 3300044765 Bacteria 3013
521 Ga0466957_0006946 3300044842 Bacteria 6401
522 Ga0466957_0010454 3300044842 Bacteria 5330
523 Ga0466957_0040976 3300044842 Bacteria 2800
524 Ga0466957_0090237 3300044842 Bacteria 1919
525 Ga0466957_0358888 3300044842 Bacteria 990
526 Ga0466960_0000899 3300044901 Bacteria 10526
527 Ga0466960_0001321 3300044901 Bacteria 8987
528 Ga0466960_0002938 3300044901 Bacteria 6495
529 Ga0466960_0106127 3300044901 Bacteria 1453
530 Ga0466960_0174384 3300044901 Bacteria 1162
531 Ga0466960_0243746 3300044901 Bacteria 996
532 Ga0466959_0003838 3300045049 Bacteria 9966
533 Ga0466959_0006678 3300045049 Bacteria 8020
534 Ga0466959_0098621 3300045049 Bacteria 2093
535 Ga0466959_0160913 3300045049 Bacteria 1578
536 Ga0466958_0007296 3300045836 Bacteria 6070
537 Ga0466958_0015430 3300045836 Bacteria 4377
538 Ga0466958_0061296 3300045836 Bacteria 2291
539 Ga0466958_0102603 3300045836 Bacteria 1780
540 Ga0466958_0115373 3300045836 Bacteria 1678
541 Ga0466958_0136365 3300045836 Bacteria 1543
542 Ga0466967_0009905 3300045976 Bacteria 7111
543 Ga0466967_0075943 3300045976 Bacteria 3021
544 Ga0466967_0125798 3300045976 Bacteria 2374
545 Ga0466967_0127636 3300045976 Bacteria 2357
546 Ga0466967_0139907 3300045976 Bacteria 2254
547 Ga0466967_0161325 3300045976 Bacteria 2104
548 Ga0495603_0081610 3300046455 Bacteria 1894
549 Ga0495590_0044339 3300046457 Bacteria 1551
550 Ga0495629_0033004 3300046459 Bacteria 3663
551 Ga0495638_0001822 3300046460 Bacteria 18494
552 Ga0495641_0012381 3300046461 Bacteria 4777
553 Ga0495653_0018710 3300046463 Bacteria 5624
554 Ga0495580_0451287 3300046472 Bacteria 863
555 Ga0495582_0011213 3300046473 Bacteria 4937
556 Ga0495662_0037068 3300046476 Bacteria 2355
557 Ga0495585_0250570 3300046492 Bacteria 884
558 Ga0495596_0195568 3300046500 Bacteria 786
559 Ga0495616_0157300 3300046513 Bacteria 1024
560 Ga0495620_0149111 3300046515 Bacteria 912
561 Ga0495648_0001604 3300046524 Bacteria 22021
562 Ga0495654_0015682 3300046530 Bacteria 4022
563 Ga0495640_0024292 3300046533 Bacteria 4411
564 Ga0495640_0150739 3300046533 Bacteria 1494
565 Ga0495656_0249120 3300046615 Bacteria 897
566 Ga0495668_0000819 3300046616 Bacteria 35709
567 Ga0495668_0034299 3300046616 Bacteria 2848
568 Ga0495611_0043291 3300046648 Bacteria 2013
569 Ga0495625_0119732 3300046660 Bacteria 1793
570 Ga0495635_0256284 3300046663 Bacteria 1179
571 Ga0495658_0029681 3300046683 Bacteria 2963
572 Ga0495624_0113850 3300046690 Bacteria 1663
573 Ga0495670_0154290 3300046691 Bacteria 1205
574 Ga0495670_0438462 3300046691 Bacteria 707
575 Ga0495671_0020560 3300046692 Bacteria 3477
576 Ga0495671_0026087 3300046692 Bacteria 3032
577 Ga0495649_0027000 3300046694 Bacteria 3188
578 Ga0495589_0143621 3300046794 Bacteria 1142
579 Ga0495581_0024484 3300047315 Bacteria 3498
580 Ga0495581_0032555 3300047315 Bacteria 3019
581 Ga0495581_0082060 3300047315 Bacteria 1867
582 Ga0495674_0037616 3300047319 Bacteria 4349
583 Ga0495672_0001082 3300047320 Bacteria 27689
584 Ga0495672_0007166 3300047320 Bacteria 8435
585 Ga0495676_0072018 3300047321 Bacteria 2655
586 Ga0495676_0326047 3300047321 Bacteria 1031
587 Ga0495683_0000230 3300047323 Bacteria 51313
588 Ga0495673_0001630 3300047469 Bacteria 17372
589 Ga0495686_0247924 3300047472 Bacteria 1002
590 Ga0495593_0001301 3300047673 Bacteria 14647
591 Ga0495614_0168148 3300048089 Bacteria 983
592 Ga0496100_0000043 3300048903 Bacteria 89692
593 Ga0496100_0000351 3300048903 Bacteria 22387
594 Ga0496100_0003387 3300048903 Bacteria 8305
595 Ga0496100_0014275 3300048903 Bacteria 4609
596 Ga0496100_0030245 3300048903 Bacteria 3358
597 Ga0496100_0098032 3300048903 Bacteria 2014
598 Ga0496100_0099704 3300048903 Bacteria 1999
599 Ga0496100_0371160 3300048903 Bacteria 1085
600 Ga0496101_0000050 3300048904 Bacteria 144545
601 Ga0496101_0000149 3300048904 Bacteria 60550
602 Ga0496101_0000573 3300048904 Bacteria 22521
603 Ga0496101_0001052 3300048904 Bacteria 16316
604 Ga0496101_0010564 3300048904 Bacteria 6098
605 Ga0496101_0019709 3300048904 Bacteria 4610
606 Ga0496102_0000001 3300048905 Bacteria 873433
607 Ga0496102_0007074 3300048905 Bacteria 9577
608 Ga0496102_0014671 3300048905 Bacteria 6811
609 Ga0496102_0018624 3300048905 Bacteria 6106
610 Ga0496102_0053844 3300048905 Bacteria 3667
611 Ga0496102_0111513 3300048905 Bacteria 2550
612 Ga0496102_0133506 3300048905 Bacteria 2325
613 Ga0496102_0146679 3300048905 Bacteria 2215
614 Ga0496102_0190103 3300048905 Bacteria 1934
615 Ga0496102_0232976 3300048905 Bacteria 1736
616 Ga0496103_0000007 3300048906 Bacteria 354915
617 Ga0496103_0000152 3300048906 Bacteria 72428
618 Ga0496103_0000887 3300048906 Bacteria 21625
619 Ga0496103_0001401 3300048906 Bacteria 16211
620 Ga0496103_0255223 3300048906 Bacteria 1128
621 Ga0496104_0065243 3300048907 Bacteria 3455
622 Ga0496104_0079818 3300048907 Bacteria 3119
623 Ga0496104_0165188 3300048907 Bacteria 2123
624 Ga0496104_0262599 3300048907 Bacteria 1639
625 Ga0496104_0307843 3300048907 Bacteria 1497
626 Ga0496104_0368755 3300048907 Bacteria 1348
627 Ga0496104_0777568 3300048907 Bacteria 864
628 Ga0496105_0019458 3300048908 Bacteria 5476
629 Ga0496106_0000382 3300048909 Bacteria 31520
630 Ga0496106_0002028 3300048909 Bacteria 15229
631 Ga0496106_0007154 3300048909 Bacteria 8241
632 Ga0496106_0019795 3300048909 Bacteria 4991
633 Ga0496106_0057299 3300048909 Bacteria 2946
634 Ga0496106_0114900 3300048909 Bacteria 2099
635 Ga0496106_0183566 3300048909 Bacteria 1661
636 Ga0496107_0000154 3300048910 Bacteria 34838
637 Ga0496107_0000170 3300048910 Bacteria 33766
638 Ga0496107_0005819 3300048910 Bacteria 8441
639 Ga0496107_0018315 3300048910 Bacteria 4931
640 Ga0496107_0465399 3300048910 Bacteria 939
641 Ga0496108_0002389 3300048911 Bacteria 15021
642 Ga0496108_0009156 3300048911 Bacteria 8014
643 Ga0496108_0120385 3300048911 Bacteria 2251
644 Ga0496108_0344031 3300048911 Bacteria 1301
645 Ga0496109_0000194 3300048912 Bacteria 60448
646 Ga0496109_0012206 3300048912 Bacteria 7412
647 Ga0496109_0014026 3300048912 Bacteria 6966
648 Ga0496109_0019135 3300048912 Bacteria 6032
649 Ga0496109_0044911 3300048912 Bacteria 4009
650 Ga0496110_0001051 3300048913 Bacteria 19501
651 Ga0496110_0036207 3300048913 Bacteria 4285
652 Ga0496110_0047047 3300048913 Bacteria 3776
653 Ga0496111_0017962 3300048914 Bacteria 4892
654 Ga0496111_0153284 3300048914 Bacteria 1710
655 Ga0496111_0418389 3300048914 Bacteria 990
656 Ga0496111_0455107 3300048914 Bacteria 944
657 Ga0496112_0014362 3300048915 Bacteria 7341
658 Ga0496112_0020568 3300048915 Bacteria 6257
659 Ga0496112_0037501 3300048915 Bacteria 4730
660 Ga0496112_0102127 3300048915 Bacteria 2837
661 Ga0496112_0127243 3300048915 Bacteria 2518
662 Ga0496113_0047645 3300048916 Bacteria 3185
663 Ga0496113_0096601 3300048916 Bacteria 2285
664 Ga0496113_0159394 3300048916 Bacteria 1783
665 Ga0496113_0246821 3300048916 Bacteria 1425
666 Ga0496114_0000565 3300048917 Bacteria 27454
667 Ga0496114_0001578 3300048917 Bacteria 17308
668 Ga0496114_0002406 3300048917 Bacteria 14266
669 Ga0496114_0015932 3300048917 Bacteria 6049
670 Ga0496114_0042881 3300048917 Bacteria 3751
671 Ga0496114_0128610 3300048917 Bacteria 2185
672 Ga0496114_0187776 3300048917 Bacteria 1807
673 Ga0496115_0002015 3300048918 Bacteria 14515
674 Ga0496115_0003619 3300048918 Bacteria 11116
675 Ga0496115_0005175 3300048918 Bacteria 9484
676 Ga0496115_0215114 3300048918 Bacteria 1587
677 Ga0496116_0000018 3300048919 Bacteria 545877
678 Ga0496116_0004103 3300048919 Bacteria 14061
679 Ga0496116_0011312 3300048919 Bacteria 7403
680 Ga0496117_0000015 3300048920 Bacteria 583316
681 Ga0496117_0011705 3300048920 Bacteria 7825
682 Ga0496117_0013169 3300048920 Bacteria 7234
683 Ga0496118_0000012 3300048921 Bacteria 583316
684 Ga0496118_0001009 3300048921 Bacteria 43809
685 Ga0496118_0008813 3300048921 Bacteria 10337
686 Ga0496118_0015304 3300048921 Bacteria 7111
687 Ga0496119_0000172 3300048922 Bacteria 91464
688 Ga0496119_0001151 3300048922 Bacteria 33191
689 Ga0496119_0003415 3300048922 Bacteria 16502
690 Ga0496120_0000155 3300048923 Bacteria 114046
691 Ga0496120_0047135 3300048923 Bacteria 2486
692 Ga0496120_0059207 3300048923 Bacteria 2147
693 Ga0496121_0000048 3300048924 Bacteria 330242
694 Ga0496121_0001740 3300048924 Bacteria 35570
695 Ga0496121_0008039 3300048924 Bacteria 12574
696 Ga0496121_0145222 3300048924 Bacteria 1754
697 Ga0496121_0285497 3300048924 Bacteria 1127
698 Ga0496122_0000301 3300048925 Bacteria 109636
699 Ga0496122_0026612 3300048925 Bacteria 4978
700 Ga0496123_0005215 3300048926 Bacteria 13201
701 Ga0496124_0000044 3300048927 Bacteria 289064
702 Ga0496125_0000037 3300048928 Bacteria 330242
703 Ga0496125_0050109 3300048928 Bacteria 3461
704 Ga0496125_0082381 3300048928 Bacteria 2452
705 Ga0496126_0000046 3300048929 Bacteria 330242
706 Ga0496126_0001956 3300048929 Bacteria 29218
707 Ga0496126_0002081 3300048929 Bacteria 28036
708 Ga0496126_0002916 3300048929 Bacteria 22240
709 Ga0496126_0058084 3300048929 Bacteria 3488
710 Ga0496126_0549661 3300048929 Bacteria 916
711 Ga0501031_0001304 3300049568 Bacteria 15291
712 Ga0501031_0154326 3300049568 Bacteria 1501
713 Ga0501032_0002887 3300049569 Bacteria 13361
714 Ga0501032_0004269 3300049569 Bacteria 10792
715 Ga0501032_0018962 3300049569 Bacteria 4813
716 Ga0501032_0068983 3300049569 Bacteria 2359
717 Ga0501033_0007728 3300049570 Bacteria 8339
718 Ga0501033_0008359 3300049570 Bacteria 8015
719 Ga0501034_0004872 3300049571 Bacteria 14809
720 Ga0501034_0008695 3300049571 Bacteria 10694
721 Ga0501034_0030032 3300049571 Bacteria 5525
722 Ga0501034_0041969 3300049571 Bacteria 4630
723 Ga0501034_0223518 3300049571 Bacteria 1835
724 Ga0501034_0554987 3300049571 Bacteria 1058
725 Ga0501036_0003021 3300049572 Bacteria 13394
726 Ga0501036_0063603 3300049572 Bacteria 3124
727 Ga0501037_0000709 3300049573 Bacteria 25325
728 Ga0501037_0000782 3300049573 Bacteria 23992
729 Ga0501037_0017891 3300049573 Bacteria 5217
730 Ga0501037_0117570 3300049573 Bacteria 1913
731 Ga0501038_0003575 3300049574 Bacteria 14462
732 Ga0501039_0001120 3300049575 Bacteria 19696
733 Ga0501039_0001546 3300049575 Bacteria 16916
734 Ga0501042_0136574 3300049578 Bacteria 1768
735 Ga0501043_0001589 3300049579 Bacteria 19750
736 Ga0501043_0004131 3300049579 Bacteria 11860
737 Ga0501043_0116065 3300049579 Bacteria 2101
738 Ga0501043_0307131 3300049579 Bacteria 1211
739 Ga0501046_0000628 3300049580 Bacteria 34641
740 Ga0501046_0001159 3300049580 Bacteria 25641
741 Ga0501047_0005042 3300049581 Bacteria 12392
742 Ga0501047_0007282 3300049581 Bacteria 10401
743 Ga0501047_0127448 3300049581 Bacteria 2426
744 Ga0501047_0131948 3300049581 Bacteria 2378
745 Ga0501048_0002485 3300049582 Bacteria 14081
746 Ga0501048_0004665 3300049582 Bacteria 10430
747 Ga0501067_0006536 3300049583 Bacteria 6463
748 Ga0501068_0020388 3300049584 Bacteria 3861
749 Ga0501069_0006510 3300049585 Bacteria 6107
750 Ga0501069_0029463 3300049585 Bacteria 3012
751 Ga0501070_0001113 3300049586 Bacteria 24139
752 Ga0501070_0001530 3300049586 Bacteria 20572
753 Ga0501070_0008364 3300049586 Bacteria 8743
754 Ga0501070_0102791 3300049586 Bacteria 2363
755 Ga0501070_0180606 3300049586 Bacteria 1737
756 Ga0501071_0212238 3300049587 Bacteria 1456
757 Ga0501072_0089346 3300049588 Bacteria 2445
758 Ga0501072_0512128 3300049588 Bacteria 949
759 Ga0501073_0002300 3300049589 Bacteria 14295
760 Ga0501073_0228294 3300049589 Bacteria 1286
761 Ga0501073_0340960 3300049589 Bacteria 1034
762 Ga0501074_0001996 3300049590 Bacteria 14048
763 Ga0501080_0007010 3300049742 Bacteria 10176
764 Ga0501080_0548622 3300049742 Bacteria 1030
765 Ga0501083_0055356 3300049744 Bacteria 2660
766 Ga0501035_0000229 3300049822 Bacteria 66514
767 Ga0501035_0001480 3300049822 Bacteria 24041
768 Ga0501035_0004339 3300049822 Bacteria 13458
769 Ga0501044_0000880 3300049823 Bacteria 36201
770 Ga0501044_0003297 3300049823 Bacteria 18183
771 Ga0501044_0004798 3300049823 Bacteria 15118
772 Ga0501044_0006629 3300049823 Bacteria 12768
773 Ga0501044_0029695 3300049823 Bacteria 5764
774 Ga0501044_0328210 3300049823 Bacteria 1453
775 Ga0501044_0355447 3300049823 Bacteria 1384
776 nmdc:mga03683_129562_c1 3300050489 Bacteria 1127
777 nmdc:mga03683_51133_c1 3300050489 Bacteria 1724
778 nmdc:mga03n38_45315_c1 3300050490 Bacteria 1936
779 nmdc:mga03n38_56426_c1 3300050490 Bacteria 1772
780 nmdc:mga03n38_5804_c1 3300050490 Bacteria 4239
781 nmdc:mga03n38_67015_c1 3300050490 Bacteria 1651
782 nmdc:mga03n38_9753_c1 3300050490 Bacteria 3504
783 nmdc:mga00v17_115761_c1 3300050491 Bacteria 1704
784 nmdc:mga00v17_2162_c1 3300050491 Bacteria 10101
785 nmdc:mga00v17_23825_c1 3300050491 Bacteria 3544
786 nmdc:mga00v17_3910_c1 3300050491 Bacteria 7684
787 nmdc:mga00v17_44428_c1 3300050491 Bacteria 2679
788 nmdc:mga00v17_86327_c1 3300050491 Bacteria 1966
789 nmdc:mga0yw44_111002_c1 3300050492 Bacteria 1757
790 nmdc:mga0yw44_52884_c1 3300050492 Bacteria 2464
791 nmdc:mga0yw44_88939_c1 3300050492 Bacteria 1948
792 nmdc:mga06z11_211952_c1 3300050494 Bacteria 1129
793 nmdc:mga07m45_101026_c1 3300050496 Bacteria 1656
794 nmdc:mga07m45_288120_c1 3300050496 Bacteria 955
795 nmdc:mga07m45_4443_c1 3300050496 Bacteria 6864
796 nmdc:mga05p37_13488_c1 3300050507 Bacteria 9793
797 nmdc:mga05p37_42989_c1 3300050507 Bacteria 5555
798 nmdc:mga09592_95605_c1 3300050508 Bacteria 2541
799 nmdc:mga06r32_1478_c1 3300050510 Bacteria 3020
800 nmdc:mga08y16_126057_c1 3300050511 Bacteria 2664
801 nmdc:mga08y16_1361118_c1 3300050511 Bacteria 674
802 nmdc:mga08y16_228716_c1 3300050511 Bacteria 1924
803 nmdc:mga08y16_35007_c1 3300050511 Bacteria 5276
804 nmdc:mga0n895_2309_c1 3300050512 Bacteria 14839
805 nmdc:mga0rr50_103117_c1 3300050513 Bacteria 2245
806 nmdc:mga0rr50_571000_c1 3300050513 Bacteria 963
807 nmdc:mga0rr50_82254_c1 3300050513 Bacteria 2487
808 nmdc:mga08x19_93863_c1 3300050514 Bacteria 1983
809 nmdc:mga0a205_253272_c1 3300050515 Bacteria 1640
810 nmdc:mga0a205_39886_c1 3300050515 Bacteria 4520
811 nmdc:mga0sz30_2519_c1 3300050516 Bacteria 6529
812 nmdc:mga0sz30_28623_c2 3300050516 Bacteria 1910
813 nmdc:mga0sz30_2940_c1 3300050516 Bacteria 6104
814 nmdc:mga0sz30_30044_c1 3300050516 Bacteria 2243
815 nmdc:mga0sz30_74407_c1 3300050516 Bacteria 1465
816 Ga0495601_0220837 3300053077 Bacteria 1238
817 Ga0500635_0000868 3300053080 Bacteria 7378
818 Ga0495595_0081764 3300053084 Bacteria 1540
819 Ga0500643_007147 3300053087 Bacteria 4565
820 Ga0500643_007375 3300053087 Bacteria 4445
821 Ga0500644_0097777 3300053088 Bacteria 1110
822 Ga0500562_008683 3300053108 Bacteria 2567
823 Ga0500562_017976 3300053108 Bacteria 1825
824 Ga0500593_010816 3300053117 Bacteria 3838
825 Ga0500642_0046509 3300053130 Bacteria 1898
826 Ga0500652_001228 3300053131 Bacteria 8146
827 Ga0500559_0029303 3300053136 Bacteria 2356
828 Ga0500616_0029440 3300053153 Bacteria 3020
829 Ga0500616_0060050 3300053153 Bacteria 1972
830 Ga0500627_0001651 3300053158 Bacteria 6311
831 Ga0500645_000004 3300053730 Bacteria 305014
832 Ga0500645_025183 3300053730 Bacteria 1816
833 Ga0501084_0005190 3300054114 Bacteria 10656
834 Ga0466962_0008263 3300061719 Bacteria 4988
835 Ga0466962_0155051 3300061719 Bacteria 1112
836 2523384195 2523231044 Bacteria 6434991
837 2548692421 2547132424 Bacteria 8348532
838 2552104961 2551306166 Bacteria 9731570
839 2566994634 2565956761 Bacteria 6601618
840 2583148717 2582580736 Bacteria 5325865
841 2586057600 2585427649 Bacteria 9053857
842 2644089528 2643221615 Bacteria 5487866
843 2644319373 2643221657 Bacteria 5490246
844 2644488351 2643221687 Bacteria 6500351
845 2644517336 2643221692 Bacteria 7282860
846 2644639965 2643221715 Bacteria 6671032
847 2738663862 2738541264 Bacteria 5935393
848 2738703209 2738541274 Bacteria 6909446
849 2738891138 2738541308 Bacteria 7020677
850 2739142997 2738541356 Bacteria 5935017
851 2739207215 2738543005 Bacteria 5278128
852 2739236335 2738543011 Bacteria 5731169
853 2739329327 2738543028 Bacteria 6917070
854 2739366019 2738543034 Bacteria 6084756
855 2744955115 2744054611 Bacteria 5611514
856 2753036791 2751185725 Bacteria 5740550
857 2753324662 2751185792 Bacteria 5739090
858 2791912534 2791354901 Bacteria 8322202
859 2795780673 2795385470 Bacteria 8317180
860 2809585771 2808606522 Bacteria 9488490
861 2816506447 2816332139 Bacteria 9138787
862 2842136181 2842134933 Bacteria 5847019
863 2842892229 2842888712 Bacteria 4279094
864 2866553417 2866552031 Bacteria 5824618
865 2866612275 2866612099 Bacteria 7543886
866 2883823317 2883821847 Bacteria 5121194
867 2889304199 2889300758 Bacteria 5690814
868 2891332093 2891326441 Bacteria 6439512
869 2899363700 2899359706 Bacteria 10940472
870 2899376270 2899370129 Bacteria 6781179
871 2902795269 2902792274 Bacteria 7270173
872 2902800390 2902799365 Bacteria 5419524
873 2902811827 2902810491 Bacteria 6794147
874 2902842904 2902837492 Bacteria 6697721
875 2904536162 2904535858 Bacteria 6308016
876 2904768372 2904765812 Bacteria 5369154
877 2904775761 2904770941 Bacteria 5580202
878 2908816030 2908811453 Bacteria 5478616
879 2915771085 2915768154 Bacteria 8424322
880 2917745082 2917736166 Bacteria 9690793
881 2919421743 2919420072 Bacteria 5390363
882 2919434699 2919432681 Bacteria 5390474
883 2919714788 2919713450 Bacteria 7431245
884 2922558087 2922554459 Bacteria 6683962
885 2928147463 2928142448 Bacteria 5288925
886 2929218418 2929212328 Bacteria 7708288
887 2932400044 2932398195 Bacteria 3847976
888 2939583625 2939582691 Bacteria 7088898
889 2939745407 2939743619 Bacteria 5762299
890 2956940702 2956939328 Bacteria 3474458
891 2974319686 2974315732 Bacteria 4602776
892 2984523554 2984523437 Bacteria 4508481
893 3001120382 3001119090 Bacteria 3449530
894 8003314481 8003314358 Bacteria 10575343
895 Ga0157378_10134797
896 JGI24737J22298_10008519
897 JGI24750J21931_1002359
898 JGI24748J21848_1002939
899 JGI24749J21850_1015492
900 JGI24744J21845_10003469
901 JGI24034J26672_10003741
902 JGI24742J22300_10000256
903 JGI24751J29686_10007130
904 JGI25406J46586_10000561
905 JGI25406J46586_10009101
906 rootH2_10029196
907 JGI25407J50210_10001654
908 Ga0055540_1000224
909 Ga0055540_1000638
910 Ga0055540_1002195
911 Ga0055540_1003480
912 Ga0055540_1009335
913 JGI25405J52794_10015821
914 Ga0070676_10006401
915 Ga0070676_10076885
916 Ga0070683_100188763
917 Ga0070666_10064939
918 Ga0070666_10169424
919 Ga0070682_100002498
920 Ga0070682_100015971
921 Ga0070682_100061262
922 Ga0068868_100002197
923 Ga0068868_100225302
924 Ga0070660_100272893
925 Ga0070689_100018845
926 Ga0070689_100248362
927 Ga0070691_10006195
928 Ga0070692_10035217
929 Ga0070668_100002008
930 Ga0070668_100005862
931 Ga0070668_100057308
932 Ga0070668_100086399
933 Ga0070669_100003185
934 Ga0070669_100003801
935 Ga0070674_100001890
936 Ga0070674_100637400
937 Ga0070673_100276308
938 Ga0070688_100006685
939 Ga0070688_100107590
940 Ga0070688_100356216
941 Ga0070659_100006606
942 Ga0070659_100491900
943 Ga0070667_100000099
944 Ga0070667_100001927
945 Ga0070667_100003067
946 Ga0070667_100186354
947 Ga0070667_100438081
948 Ga0070709_10006137
949 Ga0070709_10045358
950 Ga0070714_100005131
951 Ga0070714_100024876
952 Ga0070714_100069932
953 Ga0070714_100186647
954 Ga0070713_100050798
955 Ga0070713_100104658
956 Ga0070710_10002517
957 Ga0070710_10046689
958 Ga0070710_10060752
959 Ga0070701_10002780
960 Ga0070711_100002334
961 Ga0070705_100031235
962 Ga0070705_100249754
963 Ga0070700_100006443
964 Ga0070700_100170492
965 Ga0070694_100032483
966 Ga0070663_100003168
967 Ga0070663_100003811
968 Ga0070663_100045175
969 Ga0070663_100249745
970 Ga0070678_100000756
971 Ga0070678_100134739
972 Ga0070678_100246191
973 Ga0070662_100006460
974 Ga0070662_100023089
975 Ga0070662_100024036
976 Ga0070662_100074274
977 Ga0068867_100003459
978 Ga0068867_100176268
979 Ga0070684_100820585
980 Ga0068853_100003045
981 Ga0068853_100139121
982 Ga0070695_100087204
983 Ga0070696_100002281
984 Ga0070693_100008418
985 Ga0070693_100166396
986 Ga0070665_100010952
987 Ga0070665_100012066
988 Ga0070665_100179534
989 Ga0070665_100339486
990 Ga0070704_100001654
991 Ga0068854_100002834
992 Ga0068854_100053305
993 Ga0068854_100083310
994 Ga0068854_100161019
995 Ga0068854_100362087
996 Ga0068856_100039659
997 Ga0070702_100000598
998 Ga0070702_100055618
999 Ga0070702_100279135
1000 Ga0070702_100464409
1001 Ga0068852_100321797
1002 Ga0068852_100549849
1003 Ga0068852_100853838
1004 Ga0068859_100159534
1005 Ga0068864_100374755
1006 Ga0068864_100746491
1007 Ga0068861_100002278
1008 Ga0068861_100117472
1009 Ga0068861_100227457
1010 Ga0068861_100256686
1011 Ga0068861_100446717
1012 Ga0068863_100001544
1013 Ga0068863_100255560
1014 Ga0068858_100006943
1015 Ga0068858_100079396
1016 Ga0068858_100430484
1017 Ga0068860_100000163
1018 Ga0068860_100005668
1019 Ga0068862_100000089
1020 Ga0081455_10000960
1021 Ga0081455_10001006
1022 Ga0081455_10015441
1023 Ga0081455_10023737
1024 Ga0081455_10037388
1025 Ga0081455_10039180
1026 Ga0081455_10088813
1027 Ga0081455_10297549
1028 Ga0081538_10000350
1029 Ga0081538_10037698
1030 Ga0081539_10000177
1031 Ga0081539_10000208
1032 Ga0075365_10004072
1033 Ga0075365_10018618
1034 Ga0075365_10036173
1035 Ga0075365_10255222
1036 Ga0075363_100002325
1037 Ga0075363_100004070
1038 Ga0075363_100007457
1039 Ga0075363_100010027
1040 Ga0075363_100029559
1041 Ga0075363_100033350
1042 Ga0075363_100215888
1043 Ga0075364_10004891
1044 Ga0075364_10005390
1045 Ga0075364_10010736
1046 Ga0075364_10253633
1047 Ga0075364_10283997
1048 Ga0075432_10000656
1049 Ga0075432_10002493
1050 Ga0070715_10077959
1051 Ga0070716_100026600
1052 Ga0070712_100002169
1053 Ga0075362_10074410
1054 Ga0075362_10093730
1055 Ga0075367_10019928
1056 Ga0075367_10027141
1057 Ga0075367_10046966
1058 Ga0075369_10010520
1059 Ga0075369_10024117
1060 Ga0075369_10039578
1061 Ga0097621_100065638
1062 Ga0097621_100148069
1063 Ga0075370_10176872
1064 Ga0075370_10208702
1065 Ga0068871_100386129
1066 Ga0075428_100003868
1067 Ga0075428_100005349
1068 Ga0075428_100098420
1069 Ga0075430_100206146
1070 Ga0075430_100365266
1071 Ga0075431_100005313
1072 Ga0075431_100098407
1073 Ga0075433_10012690
1074 Ga0075433_10031857
1075 Ga0075434_100002464
1076 Ga0075434_100009840
1077 Ga0075429_100226184
1078 Ga0068865_100005190
1079 Ga0068865_100025998
1080 Ga0068865_100082211
1081 Ga0068865_100157136
1082 Ga0075436_100010325
1083 Ga0075436_100107687
1084 Ga0097620_100159520
1085 Ga0075435_100037694
1086 Ga0075435_100280488
1087 Ga0105250_10024692
1088 Ga0105240_10660461
1089 Ga0111539_10001067
1090 Ga0111539_10002580
1091 Ga0111539_10065758
1092 Ga0105245_10003222
1093 Ga0105245_10153586
1094 Ga0105245_10154976
1095 Ga0105245_10413592
1096 Ga0105245_10670808
1097 Ga0105245_11145297
1098 Ga0105247_10000089
1099 Ga0105247_10000789
1100 Ga0105247_10367976
1101 Ga0114129_10004878
1102 Ga0114129_10022481
1103 Ga0105243_10000750
1104 Ga0105243_10001257
1105 Ga0105243_10011698
1106 Ga0105243_10078344
1107 Ga0105243_10198101
1108 Ga0105243_10228889
1109 Ga0105241_10190536
1110 Ga0105242_10000963
1111 Ga0105242_10041923
1112 Ga0105248_10000759
1113 Ga0105248_10005751
1114 Ga0105248_10019990
1115 Ga0105237_10005264
1116 Ga0105237_10051567
1117 Ga0105237_10074798
1118 Ga0105237_10424447
1119 Ga0105237_10932101
1120 Ga0105238_10352577
1121 Ga0105249_10000117
1122 Ga0105249_10001051
1123 Ga0105249_10013331
1124 Ga0105249_10020582
1125 Ga0105249_10169468
1126 Ga0105239_10085231
1127 Ga0105239_10141564
1128 Ga0105239_10272391
1129 Ga0105239_11241536
1130 Ga0157371_10135563
1131 Ga0157371_10401226
1132 Ga0157374_10033602
1133 Ga0157378_10002445
1134 Ga0157378_10675430
1135 Ga0163162_10013672
1136 Ga0163162_10044867
1137 Ga0163162_10082635
1138 Ga0163162_10157074
1139 Ga0163162_10613772
1140 Ga0157372_10016723
1141 Ga0157375_10011656
1142 Ga0157375_10069720
1143 Ga0157375_10196913
1144 Ga0157375_10608751
1145 Ga0157375_10793531
1146 Ga0163163_10113908
1147 Ga0163163_10633755
1148 Ga0157380_10003822
1149 Ga0157380_10249288
1150 Ga0157380_10421896
1151 Ga0157380_10962613
1152 Ga0157377_10008125
1153 Ga0157379_10015349
1154 Ga0157379_10610045
1155 Ga0163161_10050877
1156 Ga0163161_10101657
1157 Ga0163161_10538727
1158 Ga0213876_10007573
1159 Ga0213876_10057069
1160 Ga0209025_1071975
1161 Ga0209051_1000014
1162 Ga0209051_1000649
1163 Ga0209051_1017134
1164 Ga0207682_10079290
1165 Ga0207692_10070073
1166 Ga0207642_10001963
1167 Ga0207710_10000117
1168 Ga0207710_10002764
1169 Ga0207688_10004112
1170 Ga0207688_10025078
1171 Ga0207688_10041216
1172 Ga0207688_10098058
1173 Ga0207688_10148614
1174 Ga0207680_10025388
1175 Ga0207680_10175026
1176 Ga0207647_10062110
1177 Ga0207685_10058280
1178 Ga0207699_10063575
1179 Ga0207699_10107364
1180 Ga0207645_10004678
1181 Ga0207645_10017935
1182 Ga0207705_10211588
1183 Ga0207654_10059311
1184 Ga0207671_10029890
1185 Ga0207671_10305666
1186 Ga0207693_10003426
1187 Ga0207693_10003579
1188 Ga0207693_10362631
1189 Ga0207663_10000867
1190 Ga0207663_10050520
1191 Ga0207657_10348721
1192 Ga0207681_10000981
1193 Ga0207681_10003890
1194 Ga0207681_10448070
1195 Ga0207694_10201362
1196 Ga0207687_10001539
1197 Ga0207687_10064402
1198 Ga0207687_10104853
1199 Ga0207700_10039701
1200 Ga0207700_10130438
1201 Ga0207664_10055373
1202 Ga0207664_10135649
1203 Ga0207664_10139816
1204 Ga0207664_10476243
1205 Ga0207664_10542340
1206 Ga0207644_10022462
1207 Ga0207644_10179092
1208 Ga0207690_10089896
1209 Ga0207706_10003642
1210 Ga0207706_10013964
1211 Ga0207706_10089652
1212 Ga0207686_10036566
1213 Ga0207686_10090564
1214 Ga0207709_10001151
1215 Ga0207709_10001566
1216 Ga0207709_10044571
1217 Ga0207709_10195296
1218 Ga0207709_10223529
1219 Ga0207670_10110788
1220 Ga0207669_10000548
1221 Ga0207669_10241713
1222 Ga0207704_10002430
1223 Ga0207704_10044280
1224 Ga0207704_10072209
1225 Ga0207704_10125956
1226 Ga0207704_10340214
1227 Ga0207665_10007609
1228 Ga0207665_10010595
1229 Ga0207711_10002505
1230 Ga0207711_10006754
1231 Ga0207711_10119077
1232 Ga0207689_10020743
1233 Ga0207689_10170004
1234 Ga0207679_10825414
1235 Ga0207667_10116751
1236 Ga0207712_10000083
1237 Ga0207712_10008133
1238 Ga0207712_10448487
1239 Ga0207668_10011317
1240 Ga0207668_10024543
1241 Ga0207668_10351183
1242 Ga0207668_10647212
1243 Ga0207640_10022189
1244 Ga0207640_10076831
1245 Ga0207640_10124896
1246 Ga0207640_10172078
1247 Ga0207640_10283957
1248 Ga0207658_10014847
1249 Ga0207658_10155624
1250 Ga0207677_10001615
1251 Ga0207703_10011161
1252 Ga0207703_10060130
1253 Ga0207703_10155123
1254 Ga0207703_10213120
1255 Ga0207639_10002209
1256 Ga0207639_10025226
1257 Ga0207678_10000033
1258 Ga0207678_10044189
1259 Ga0207678_10286429
1260 Ga0207678_10475365
1261 Ga0207708_10005099
1262 Ga0207708_10020907
1263 Ga0207708_10035565
1264 Ga0207702_10027519
1265 Ga0207702_10462864
1266 Ga0207641_10001265
1267 Ga0207641_10005115
1268 Ga0207641_10250521
1269 Ga0207648_10001134
1270 Ga0207648_10193084
1271 Ga0207676_10247514
1272 Ga0207676_10697129
1273 Ga0207675_100003626
1274 Ga0207675_100012534
1275 Ga0207675_100084687
1276 Ga0207675_100143011
1277 Ga0207675_100268882
1278 Ga0207675_100382278
1279 Ga0207683_10001167
1280 Ga0207683_10022192
1281 Ga0207683_10086046
1282 Ga0207683_10260258
1283 Ga0207698_10525432
1284 Ga0207428_10002324
1285 Ga0207428_10005586
1286 Ga0207428_10222363
1287 Ga0268266_10017220
1288 Ga0268266_10048488
1289 Ga0268266_10099338
1290 Ga0268266_10128750
1291 Ga0268266_10181683
1292 Ga0268265_10000099
1293 Ga0268265_10170717
1294 Ga0268264_10000225
1295 Ga0268264_10003305
1296 Ga0268264_10549046
1297 Ga0268264_10576725
1298 Ga0307515_10056052
1299 Ga0307515_10170871
1300 Ga0307512_10004437
1301 Ga0265327_10000001
1302 Ga0265327_10000113
1303 Ga0265327_10001712
1304 Ga0265327_10012873
1305 Ga0307408_100021224
1306 Ga0307408_100021790
1307 Ga0307408_100080051
1308 Ga0307405_10011820
1309 Ga0307405_10120053
1310 Ga0307405_10171850
1311 Ga0307405_10457330
1312 Ga0307413_10005578
1313 Ga0307413_10006466
1314 Ga0307413_10014889
1315 Ga0307413_10182836
1316 Ga0307518_10000474
1317 Ga0307518_10008681
1318 Ga0307410_10000323
1319 Ga0307410_10007648
1320 Ga0307410_10078510
1321 Ga0307410_10090479
1322 Ga0307406_10001419
1323 Ga0307406_10008727
1324 Ga0307406_10237404
1325 Ga0307407_10004733
1326 Ga0307407_10039837
1327 Ga0307407_10114423
1328 Ga0307412_10007342
1329 Ga0307412_10023055
1330 Ga0307409_100002136
1331 Ga0307409_100028131
1332 Ga0307409_100034938
1333 Ga0307409_100085664
1334 Ga0307409_100216541
1335 Ga0307409_100332781
1336 Ga0307416_100000046
1337 Ga0307416_100011055
1338 Ga0307416_100392199
1339 Ga0307414_10004676
1340 Ga0307414_10090784
1341 Ga0307414_10274876
1342 Ga0307411_10000436
1343 Ga0307411_10038704
1344 Ga0307415_100000401
1345 Ga0307415_100071255
1346 Ga0307415_100080416
1347 Ga0307415_100250182
1348 Ga0316583_10023557
1349 Ga0307507_10030415
1350 Ga0307507_10254176
1351 Ga0373949_0026112
1352 Ga0373962_0041304
1353 Ga0373931_0012026
1354 Ga0373931_0067399
1355 Ga0373947_0084518
1356 Ga0316584_0061259
1357 Ga0436364_0197209
1358 Ga0436365_0175886
1359 Ga0436365_0204440
1360 Ga0436365_0584104
1361 Ga0436363_1366560
1362 Ga0439461_0003303
1363 Ga0439461_0028679
1364 Ga0439466_0001673
1365 Ga0439466_0015252
1366 Ga0439465_0003497
1367 Ga0439465_0009288
1368 Ga0451791_0138042
1369 Ga0451833_1190084
1370 Ga0451837_0583427
1371 Ga0451853_1890043
1372 Ga0451853_3823848
1373 Ga0439431_0015082
1374 Ga0439431_0019303
1375 Ga0439442_009060
1376 Ga0439442_025376
1377 Ga0439445_0012234
1378 Ga0439445_0045596
1379 Ga0439448_0019001
1380 Ga0439450_005997
1381 Ga0439463_000935
1382 Ga0439463_035877
1383 Ga0450900_021040
1384 Ga0439440_0002422
1385 Ga0466969_0028410
1386 Ga0466972_0001388
1387 Ga0466972_0003436
1388 Ga0466972_0038369
1389 Ga0466972_0052629
1390 Ga0466972_0092234
1391 Ga0466965_0000276
1392 Ga0466965_0000672
1393 Ga0466965_0020433
1394 Ga0466965_0033639
1395 Ga0466965_0152438
1396 Ga0466965_0217495
1397 Ga0466966_0007657
1398 Ga0466966_0046479
1399 Ga0466961_0008084
1400 Ga0466961_0048460
1401 Ga0466963_0016619
1402 Ga0466963_0177531
1403 Ga0466963_0242473
1404 Ga0466964_0079923
1405 Ga0466971_0004305
1406 Ga0466971_0029624
1407 Ga0466971_0042574
1408 Ga0466968_0000522
1409 Ga0466968_0003228
1410 Ga0466968_0017269
1411 Ga0466968_0070613
1412 Ga0466970_0013085
1413 Ga0466970_0013332
1414 Ga0466970_0026952
1415 Ga0466957_0006946
1416 Ga0466957_0010454
1417 Ga0466957_0040976
1418 Ga0466957_0090237
1419 Ga0466957_0358888
1420 Ga0466960_0000899
1421 Ga0466960_0001321
1422 Ga0466960_0002938
1423 Ga0466960_0106127
1424 Ga0466960_0174384
1425 Ga0466960_0243746
1426 Ga0466959_0003838
1427 Ga0466959_0006678
1428 Ga0466959_0098621
1429 Ga0466959_0160913
1430 Ga0466958_0007296
1431 Ga0466958_0015430
1432 Ga0466958_0061296
1433 Ga0466958_0102603
1434 Ga0466958_0115373
1435 Ga0466958_0136365
1436 Ga0466967_0009905
1437 Ga0466967_0075943
1438 Ga0466967_0125798
1439 Ga0466967_0127636
1440 Ga0466967_0139907
1441 Ga0466967_0161325
1442 Ga0495603_0081610
1443 Ga0495590_0044339
1444 Ga0495629_0033004
1445 Ga0495638_0001822
1446 Ga0495641_0012381
1447 Ga0495653_0018710
1448 Ga0495580_0451287
1449 Ga0495582_0011213
1450 Ga0495662_0037068
1451 Ga0495585_0250570
1452 Ga0495596_0195568
1453 Ga0495616_0157300
1454 Ga0495620_0149111
1455 Ga0495648_0001604
1456 Ga0495654_0015682
1457 Ga0495640_0024292
1458 Ga0495640_0150739
1459 Ga0495656_0249120
1460 Ga0495668_0000819
1461 Ga0495668_0034299
1462 Ga0495611_0043291
1463 Ga0495625_0119732
1464 Ga0495635_0256284
1465 Ga0495658_0029681
1466 Ga0495624_0113850
1467 Ga0495670_0154290
1468 Ga0495670_0438462
1469 Ga0495671_0020560
1470 Ga0495671_0026087
1471 Ga0495649_0027000
1472 Ga0495589_0143621
1473 Ga0495581_0024484
1474 Ga0495581_0032555
1475 Ga0495581_0082060
1476 Ga0495674_0037616
1477 Ga0495672_0001082
1478 Ga0495672_0007166
1479 Ga0495676_0072018
1480 Ga0495676_0326047
1481 Ga0495683_0000230
1482 Ga0495673_0001630
1483 Ga0495686_0247924
1484 Ga0495593_0001301
1485 Ga0495614_0168148
1486 Ga0496100_0000043
1487 Ga0496100_0000351
1488 Ga0496100_0003387
1489 Ga0496100_0014275
1490 Ga0496100_0030245
1491 Ga0496100_0098032
1492 Ga0496100_0099704
1493 Ga0496100_0371160
1494 Ga0496101_0000050
1495 Ga0496101_0000149
1496 Ga0496101_0000573
1497 Ga0496101_0001052
1498 Ga0496101_0010564
1499 Ga0496101_0019709
1500 Ga0496102_0000001
1501 Ga0496102_0007074
1502 Ga0496102_0014671
1503 Ga0496102_0018624
1504 Ga0496102_0053844
1505 Ga0496102_0111513
1506 Ga0496102_0133506
1507 Ga0496102_0146679
1508 Ga0496102_0190103
1509 Ga0496102_0232976
1510 Ga0496103_0000007
1511 Ga0496103_0000152
1512 Ga0496103_0000887
1513 Ga0496103_0001401
1514 Ga0496103_0255223
1515 Ga0496104_0065243
1516 Ga0496104_0079818
1517 Ga0496104_0165188
1518 Ga0496104_0262599
1519 Ga0496104_0307843
1520 Ga0496104_0368755
1521 Ga0496104_0777568
1522 Ga0496105_0019458
1523 Ga0496106_0000382
1524 Ga0496106_0002028
1525 Ga0496106_0007154
1526 Ga0496106_0019795
1527 Ga0496106_0057299
1528 Ga0496106_0114900
1529 Ga0496106_0183566
1530 Ga0496107_0000154
1531 Ga0496107_0000170
1532 Ga0496107_0005819
1533 Ga0496107_0018315
1534 Ga0496107_0465399
1535 Ga0496108_0002389
1536 Ga0496108_0009156
1537 Ga0496108_0120385
1538 Ga0496108_0344031
1539 Ga0496109_0000194
1540 Ga0496109_0012206
1541 Ga0496109_0014026
1542 Ga0496109_0019135
1543 Ga0496109_0044911
1544 Ga0496110_0001051
1545 Ga0496110_0036207
1546 Ga0496110_0047047
1547 Ga0496111_0017962
1548 Ga0496111_0153284
1549 Ga0496111_0418389
1550 Ga0496111_0455107
1551 Ga0496112_0014362
1552 Ga0496112_0020568
1553 Ga0496112_0037501
1554 Ga0496112_0102127
1555 Ga0496112_0127243
1556 Ga0496113_0047645
1557 Ga0496113_0096601
1558 Ga0496113_0159394
1559 Ga0496113_0246821
1560 Ga0496114_0000565
1561 Ga0496114_0001578
1562 Ga0496114_0002406
1563 Ga0496114_0015932
1564 Ga0496114_0042881
1565 Ga0496114_0128610
1566 Ga0496114_0187776
1567 Ga0496115_0002015
1568 Ga0496115_0003619
1569 Ga0496115_0005175
1570 Ga0496115_0215114
1571 Ga0496116_0000018
1572 Ga0496116_0004103
1573 Ga0496116_0011312
1574 Ga0496117_0000015
1575 Ga0496117_0011705
1576 Ga0496117_0013169
1577 Ga0496118_0000012
1578 Ga0496118_0001009
1579 Ga0496118_0008813
1580 Ga0496118_0015304
1581 Ga0496119_0000172
1582 Ga0496119_0001151
1583 Ga0496119_0003415
1584 Ga0496120_0000155
1585 Ga0496120_0047135
1586 Ga0496120_0059207
1587 Ga0496121_0000048
1588 Ga0496121_0001740
1589 Ga0496121_0008039
1590 Ga0496121_0145222
1591 Ga0496121_0285497
1592 Ga0496122_0000301
1593 Ga0496122_0026612
1594 Ga0496123_0005215
1595 Ga0496124_0000044
1596 Ga0496125_0000037
1597 Ga0496125_0050109
1598 Ga0496125_0082381
1599 Ga0496126_0000046
1600 Ga0496126_0001956
1601 Ga0496126_0002081
1602 Ga0496126_0002916
1603 Ga0496126_0058084
1604 Ga0496126_0549661
1605 Ga0501031_0001304
1606 Ga0501031_0154326
1607 Ga0501032_0002887
1608 Ga0501032_0004269
1609 Ga0501032_0018962
1610 Ga0501032_0068983
1611 Ga0501033_0007728
1612 Ga0501033_0008359
1613 Ga0501034_0004872
1614 Ga0501034_0008695
1615 Ga0501034_0030032
1616 Ga0501034_0041969
1617 Ga0501034_0223518
1618 Ga0501034_0554987
1619 Ga0501036_0003021
1620 Ga0501036_0063603
1621 Ga0501037_0000709
1622 Ga0501037_0000782
1623 Ga0501037_0017891
1624 Ga0501037_0117570
1625 Ga0501038_0003575
1626 Ga0501039_0001120
1627 Ga0501039_0001546
1628 Ga0501042_0136574
1629 Ga0501043_0001589
1630 Ga0501043_0004131
1631 Ga0501043_0116065
1632 Ga0501043_0307131
1633 Ga0501046_0000628
1634 Ga0501046_0001159
1635 Ga0501047_0005042
1636 Ga0501047_0007282
1637 Ga0501047_0127448
1638 Ga0501047_0131948
1639 Ga0501048_0002485
1640 Ga0501048_0004665
1641 Ga0501067_0006536
1642 Ga0501068_0020388
1643 Ga0501069_0006510
1644 Ga0501069_0029463
1645 Ga0501070_0001113
1646 Ga0501070_0001530
1647 Ga0501070_0008364
1648 Ga0501070_0102791
1649 Ga0501070_0180606
1650 Ga0501071_0212238
1651 Ga0501072_0089346
1652 Ga0501072_0512128
1653 Ga0501073_0002300
1654 Ga0501073_0228294
1655 Ga0501073_0340960
1656 Ga0501074_0001996
1657 Ga0501080_0007010
1658 Ga0501080_0548622
1659 Ga0501083_0055356
1660 Ga0501035_0000229
1661 Ga0501035_0001480
1662 Ga0501035_0004339
1663 Ga0501044_0000880
1664 Ga0501044_0003297
1665 Ga0501044_0004798
1666 Ga0501044_0006629
1667 Ga0501044_0029695
1668 Ga0501044_0328210
1669 Ga0501044_0355447
1670 nmdc:mga03683_129562_c1
1671 nmdc:mga03683_51133_c1
1672 nmdc:mga03n38_45315_c1
1673 nmdc:mga03n38_56426_c1
1674 nmdc:mga03n38_5804_c1
1675 nmdc:mga03n38_67015_c1
1676 nmdc:mga03n38_9753_c1
1677 nmdc:mga00v17_115761_c1
1678 nmdc:mga00v17_2162_c1
1679 nmdc:mga00v17_23825_c1
1680 nmdc:mga00v17_3910_c1
1681 nmdc:mga00v17_44428_c1
1682 nmdc:mga00v17_86327_c1
1683 nmdc:mga0yw44_111002_c1
1684 nmdc:mga0yw44_52884_c1
1685 nmdc:mga0yw44_88939_c1
1686 nmdc:mga06z11_211952_c1
1687 nmdc:mga07m45_101026_c1
1688 nmdc:mga07m45_288120_c1
1689 nmdc:mga07m45_4443_c1
1690 nmdc:mga05p37_13488_c1
1691 nmdc:mga05p37_42989_c1
1692 nmdc:mga09592_95605_c1
1693 nmdc:mga06r32_1478_c1
1694 nmdc:mga08y16_126057_c1
1695 nmdc:mga08y16_1361118_c1
1696 nmdc:mga08y16_228716_c1
1697 nmdc:mga08y16_35007_c1
1698 nmdc:mga0n895_2309_c1
1699 nmdc:mga0rr50_103117_c1
1700 nmdc:mga0rr50_571000_c1
1701 nmdc:mga0rr50_82254_c1
1702 nmdc:mga08x19_93863_c1
1703 nmdc:mga0a205_253272_c1
1704 nmdc:mga0a205_39886_c1
1705 nmdc:mga0sz30_2519_c1
1706 nmdc:mga0sz30_28623_c2
1707 nmdc:mga0sz30_2940_c1
1708 nmdc:mga0sz30_30044_c1
1709 nmdc:mga0sz30_74407_c1
1710 Ga0495601_0220837
1711 Ga0500635_0000868
1712 Ga0495595_0081764
1713 Ga0500643_007147
1714 Ga0500643_007375
1715 Ga0500644_0097777
1716 Ga0500562_008683
1717 Ga0500562_017976
1718 Ga0500593_010816
1719 Ga0500642_0046509
1720 Ga0500652_001228
1721 Ga0500559_0029303
1722 Ga0500616_0029440
1723 Ga0500616_0060050
1724 Ga0500627_0001651
1725 Ga0500645_000004
1726 Ga0500645_025183
1727 Ga0501084_0005190
1728 Ga0466962_0008263
1729 Ga0466962_0155051
1730 2523384195
1731 2548692421
1732 2552104961
1733 2566994634
1734 2583148717
1735 2586057600
1736 2644089528
1737 2644319373
1738 2644488351
1739 2644517336
1740 2644639965
1741 2738663862
1742 2738703209
1743 2738891138
1744 2739142997
1745 2739207215
1746 2739236335
1747 2739329327
1748 2739366019
1749 2744955115
1750 2753036791
1751 2753324662
1752 2791912534
1753 2795780673
1754 2809585771
1755 2816506447
1756 2842136181
1757 2842892229
1758 2866553417
1759 2866612275
1760 2883823317
1761 2889304199
1762 2891332093
1763 2899363700
1764 2899376270
1765 2902795269
1766 2902800390
1767 2902811827
1768 2902842904
1769 2904536162
1770 2904768372
1771 2904775761
1772 2908816030
1773 2915771085
1774 2917745082
1775 2919421743
1776 2919434699
1777 2919714788
1778 2922558087
1779 2928147463
1780 2929218418
1781 2932400044
1782 2939583625
1783 2939745407
1784 2956940702
1785 2974319686
1786 2984523554
1787 3001120382
1788 8003314481

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

10

211

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

231

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.8571 10 251
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.8474 10 238
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.8474 10 224
3d5q-assembly3.cif.gz_C crystal structure of 11b-hsd1 in complex with triazole inhibitor 0.8465 10 235
2bel-assembly1.cif.gz_A structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone 0.8461 10 245
ID Description Score Start End Superfamily
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 8 258 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 8 258 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9144 12 258 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9071 12 258 3.40.50.720
af_Q6PUF3_19_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8601 10 257 3.40.50.720
ID Description Score Start End GO Terms
AF-X8EZP4-F1-model_v4 deleted 0.9636 13 260
AF-A0A259YPS8-F1-model_v4 Decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase 0.9622 1 260 GO:0016491
AF-A0A4U0PY96-F1-model_v4 deleted 0.9601 2 260
AF-A0A259YPS8-F1-model_v4 Decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase 0.9585 1 260 GO:0016491
AF-A0A4U0PY96-F1-model_v4 deleted 0.9564 2 260

Map