F484834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 890 | 378 | 1780 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0356750|Ga0501039_0356750_200_772 |
| Length | 190 |
| Sequence | VSDWGFGGRAESRAHAIILSAATGWAELKMPSFDIVSKTDLAEVDNALANMSREMSQRYDFKNSQSRIERNGAEITINADDELKLRQMHELLQGHLARRKIDVGVIDYKPLEKAAGQAVRQKALIRQGIDRDVAKRLVKEVKEGKFKVQISVQGDELRVSGKKRDDLQAVIQHLKALNIELPLQYVNFRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 253 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 374 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 375 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 376 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 377 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 378 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0.56 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.25 |
| Nodule | 0.11 |
| Rhizoplane | 9.1 |
| Rhizosphere | 86.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501039_0356750 | 3300049575 | Bacteria | 1149 |
| 2 | ARSoilOldRDRAFT_c015108 | 3300000044 | Unclassified | 660 |
| 3 | LJQas_1006945 | 3300000549 | Bacteria | 1398 |
| 4 | LJQas_1025160 | 3300000549 | Bacteria | 693 |
| 5 | JGI24737J22298_10108869 | 3300001990 | Bacteria | 820 |
| 6 | JGI24737J22298_10114969 | 3300001990 | Bacteria | 795 |
| 7 | JGI24735J21928_10174210 | 3300002067 | Bacteria | 622 |
| 8 | JGI24750J21931_1041447 | 3300002070 | Bacteria | 700 |
| 9 | JGI24738J21930_10058078 | 3300002075 | Bacteria | 793 |
| 10 | JGI24744J21845_10036654 | 3300002077 | Bacteria | 926 |
| 11 | JGI24035J26624_1002156 | 3300002126 | Bacteria | 1832 |
| 12 | JGI25406J46586_10000706 | 3300003203 | Bacteria | 15595 |
| 13 | JGI25406J46586_10042144 | 3300003203 | Bacteria | 1600 |
| 14 | rootL2_10009494 | 3300003322 | Bacteria | 19196 |
| 15 | Ga0058860_10009735 | 3300004801 | Bacteria | 1235 |
| 16 | Ga0058862_10041721 | 3300004803 | Bacteria | 706 |
| 17 | Ga0065704_10315842 | 3300005289 | Bacteria | 861 |
| 18 | Ga0070658_10376947 | 3300005327 | Bacteria | 1217 |
| 19 | Ga0070676_10001066 | 3300005328 | Bacteria | 13672 |
| 20 | Ga0070676_10483617 | 3300005328 | Bacteria | 876 |
| 21 | Ga0070683_100007756 | 3300005329 | Bacteria | 9088 |
| 22 | Ga0070683_101059987 | 3300005329 | Unclassified | 778 |
| 23 | Ga0070690_100000777 | 3300005330 | Bacteria | 16231 |
| 24 | Ga0070690_100459722 | 3300005330 | Bacteria | 945 |
| 25 | Ga0070670_100077709 | 3300005331 | Bacteria | 2852 |
| 26 | Ga0068869_100428078 | 3300005334 | Bacteria | 1093 |
| 27 | Ga0068869_100620665 | 3300005334 | Bacteria | 915 |
| 28 | Ga0068869_100980973 | 3300005334 | Unclassified | 735 |
| 29 | Ga0070666_10002088 | 3300005335 | Bacteria | 12142 |
| 30 | Ga0070666_10013029 | 3300005335 | Bacteria | 5265 |
| 31 | Ga0070666_10466538 | 3300005335 | Bacteria | 913 |
| 32 | Ga0070680_100053579 | 3300005336 | Bacteria | 3293 |
| 33 | Ga0070682_100008021 | 3300005337 | Bacteria | 5946 |
| 34 | Ga0070682_100191862 | 3300005337 | Bacteria | 1435 |
| 35 | Ga0068868_100079392 | 3300005338 | Bacteria | 2628 |
| 36 | Ga0068868_100205570 | 3300005338 | Bacteria | 1643 |
| 37 | Ga0070660_100057712 | 3300005339 | Bacteria | 3008 |
| 38 | Ga0070689_100014211 | 3300005340 | Bacteria | 5778 |
| 39 | Ga0070689_100109361 | 3300005340 | Bacteria | 2197 |
| 40 | Ga0070689_100293363 | 3300005340 | Bacteria | 1352 |
| 41 | Ga0070691_10000723 | 3300005341 | Bacteria | 12910 |
| 42 | Ga0070691_10102472 | 3300005341 | Bacteria | 1423 |
| 43 | Ga0070691_10132552 | 3300005341 | Bacteria | 1264 |
| 44 | Ga0070687_100029762 | 3300005343 | Bacteria | 2662 |
| 45 | Ga0070661_100002521 | 3300005344 | Bacteria | 12539 |
| 46 | Ga0070661_100159674 | 3300005344 | Bacteria | 1707 |
| 47 | Ga0070692_10054384 | 3300005345 | Bacteria | 2090 |
| 48 | Ga0070692_10232889 | 3300005345 | Bacteria | 1094 |
| 49 | Ga0070668_100033029 | 3300005347 | Bacteria | 3939 |
| 50 | Ga0070668_100091550 | 3300005347 | Bacteria | 2398 |
| 51 | Ga0070668_100101902 | 3300005347 | Bacteria | 2276 |
| 52 | Ga0070668_100557337 | 3300005347 | Bacteria | 998 |
| 53 | Ga0070669_100002002 | 3300005353 | Bacteria | 14747 |
| 54 | Ga0070669_100247657 | 3300005353 | Bacteria | 1418 |
| 55 | Ga0070669_101698926 | 3300005353 | Bacteria | 550 |
| 56 | Ga0070675_100013413 | 3300005354 | Bacteria | 6440 |
| 57 | Ga0070671_100002241 | 3300005355 | Bacteria | 14921 |
| 58 | Ga0070671_100029097 | 3300005355 | Bacteria | 4555 |
| 59 | Ga0070671_100172935 | 3300005355 | Bacteria | 1827 |
| 60 | Ga0070674_100027890 | 3300005356 | Bacteria | 3704 |
| 61 | Ga0070674_101833843 | 3300005356 | Bacteria | 550 |
| 62 | Ga0070673_100004960 | 3300005364 | Bacteria | 8482 |
| 63 | Ga0070688_100004185 | 3300005365 | Bacteria | 7493 |
| 64 | Ga0070688_100263940 | 3300005365 | Bacteria | 1231 |
| 65 | Ga0070688_100534947 | 3300005365 | Unclassified | 889 |
| 66 | Ga0070659_100002341 | 3300005366 | Bacteria | 13474 |
| 67 | Ga0070659_100612419 | 3300005366 | Unclassified | 937 |
| 68 | Ga0070659_100655041 | 3300005366 | Bacteria | 906 |
| 69 | Ga0070667_100004484 | 3300005367 | Bacteria | 11777 |
| 70 | Ga0070667_100145144 | 3300005367 | Bacteria | 2081 |
| 71 | Ga0070667_100326095 | 3300005367 | Bacteria | 1386 |
| 72 | Ga0070709_10017137 | 3300005434 | Bacteria | 4148 |
| 73 | Ga0070709_10018674 | 3300005434 | Bacteria | 3999 |
| 74 | Ga0070709_10120610 | 3300005434 | Bacteria | 1777 |
| 75 | Ga0070709_10821481 | 3300005434 | Bacteria | 731 |
| 76 | Ga0070714_100211493 | 3300005435 | Unclassified | 1778 |
| 77 | Ga0070713_100063258 | 3300005436 | Bacteria | 3102 |
| 78 | Ga0070713_100186498 | 3300005436 | Unclassified | 1867 |
| 79 | Ga0070713_101434501 | 3300005436 | Bacteria | 670 |
| 80 | Ga0070710_10207777 | 3300005437 | Bacteria | 1239 |
| 81 | Ga0070710_10435113 | 3300005437 | Bacteria | 886 |
| 82 | Ga0070701_10002468 | 3300005438 | Bacteria | 7137 |
| 83 | Ga0070701_10209269 | 3300005438 | Bacteria | 1157 |
| 84 | Ga0070701_10224882 | 3300005438 | Bacteria | 1121 |
| 85 | Ga0070701_10701998 | 3300005438 | Unclassified | 681 |
| 86 | Ga0070711_100005851 | 3300005439 | Bacteria | 7381 |
| 87 | Ga0070711_100345540 | 3300005439 | Bacteria | 1195 |
| 88 | Ga0070711_100971566 | 3300005439 | Bacteria | 728 |
| 89 | Ga0070705_100000953 | 3300005440 | Bacteria | 16200 |
| 90 | Ga0070705_100034712 | 3300005440 | Bacteria | 2821 |
| 91 | Ga0070700_100003255 | 3300005441 | Bacteria | 8360 |
| 92 | Ga0070700_100721045 | 3300005441 | Bacteria | 795 |
| 93 | Ga0070694_100081419 | 3300005444 | Bacteria | 2252 |
| 94 | Ga0070694_100531951 | 3300005444 | Bacteria | 939 |
| 95 | Ga0070708_101017802 | 3300005445 | Bacteria | 777 |
| 96 | Ga0070663_100002175 | 3300005455 | Bacteria | 10964 |
| 97 | Ga0070663_100130725 | 3300005455 | Bacteria | 1906 |
| 98 | Ga0070663_100861796 | 3300005455 | Unclassified | 780 |
| 99 | Ga0070678_100001476 | 3300005456 | Bacteria | 12539 |
| 100 | Ga0070678_100182608 | 3300005456 | Bacteria | 1719 |
| 101 | Ga0070678_100940511 | 3300005456 | Bacteria | 792 |
| 102 | Ga0070662_100002241 | 3300005457 | Bacteria | 11866 |
| 103 | Ga0070681_10074252 | 3300005458 | Bacteria | 3362 |
| 104 | Ga0070681_10292624 | 3300005458 | Bacteria | 1538 |
| 105 | Ga0068867_100025080 | 3300005459 | Bacteria | 4277 |
| 106 | Ga0068867_100679641 | 3300005459 | Bacteria | 906 |
| 107 | Ga0068867_100925005 | 3300005459 | Bacteria | 786 |
| 108 | Ga0070685_10095172 | 3300005466 | Bacteria | 1810 |
| 109 | Ga0070685_11056448 | 3300005466 | Bacteria | 612 |
| 110 | Ga0070707_100046218 | 3300005468 | Bacteria | 4167 |
| 111 | Ga0070707_100117663 | 3300005468 | Bacteria | 2579 |
| 112 | Ga0070707_100118028 | 3300005468 | Bacteria | 2575 |
| 113 | Ga0070698_100041373 | 3300005471 | Bacteria | 4730 |
| 114 | Ga0070698_100672394 | 3300005471 | Bacteria | 977 |
| 115 | Ga0070699_100037382 | 3300005518 | Bacteria | 4201 |
| 116 | Ga0070699_100210228 | 3300005518 | Bacteria | 1732 |
| 117 | Ga0070699_100526345 | 3300005518 | Bacteria | 1075 |
| 118 | Ga0070684_100004076 | 3300005535 | Bacteria | 11059 |
| 119 | Ga0070697_100005667 | 3300005536 | Bacteria | 9618 |
| 120 | Ga0070697_100011810 | 3300005536 | Bacteria | 6835 |
| 121 | Ga0070697_100058318 | 3300005536 | Bacteria | 3142 |
| 122 | Ga0070697_100118918 | 3300005536 | Unclassified | 2208 |
| 123 | Ga0070697_100208842 | 3300005536 | Bacteria | 1662 |
| 124 | Ga0070697_100991578 | 3300005536 | Unclassified | 747 |
| 125 | Ga0068853_100015634 | 3300005539 | Bacteria | 6234 |
| 126 | Ga0070672_100001482 | 3300005543 | Bacteria | 14565 |
| 127 | Ga0070686_100037021 | 3300005544 | Bacteria | 3024 |
| 128 | Ga0070686_100119898 | 3300005544 | Bacteria | 1805 |
| 129 | Ga0070695_100081342 | 3300005545 | Bacteria | 2143 |
| 130 | Ga0070695_100374998 | 3300005545 | Bacteria | 1072 |
| 131 | Ga0070696_100016390 | 3300005546 | Bacteria | 4989 |
| 132 | Ga0070696_100058130 | 3300005546 | Bacteria | 2700 |
| 133 | Ga0070696_100309548 | 3300005546 | Unclassified | 1212 |
| 134 | Ga0070693_100000537 | 3300005547 | Bacteria | 17007 |
| 135 | Ga0070693_100155288 | 3300005547 | Bacteria | 1453 |
| 136 | Ga0070665_100008176 | 3300005548 | Bacteria | 10593 |
| 137 | Ga0070665_100140343 | 3300005548 | Bacteria | 2420 |
| 138 | Ga0070665_100446474 | 3300005548 | Bacteria | 1303 |
| 139 | Ga0070665_101644757 | 3300005548 | Bacteria | 650 |
| 140 | Ga0070704_100031051 | 3300005549 | Bacteria | 3588 |
| 141 | Ga0070704_100050389 | 3300005549 | Bacteria | 2926 |
| 142 | Ga0070704_100187376 | 3300005549 | Bacteria | 1660 |
| 143 | Ga0070704_100515601 | 3300005549 | Bacteria | 1040 |
| 144 | Ga0070704_100759549 | 3300005549 | Bacteria | 864 |
| 145 | Ga0068855_100029568 | 3300005563 | Bacteria | 6549 |
| 146 | Ga0068855_100549720 | 3300005563 | Bacteria | 1250 |
| 147 | Ga0070664_100004165 | 3300005564 | Bacteria | 11618 |
| 148 | Ga0068857_100024971 | 3300005577 | Bacteria | 5264 |
| 149 | Ga0068854_100000726 | 3300005578 | Bacteria | 19524 |
| 150 | Ga0068854_100387045 | 3300005578 | Bacteria | 1154 |
| 151 | Ga0068856_100030395 | 3300005614 | Bacteria | 5280 |
| 152 | Ga0068856_100219268 | 3300005614 | Bacteria | 1918 |
| 153 | Ga0070702_100000778 | 3300005615 | Bacteria | 12097 |
| 154 | Ga0070702_100087126 | 3300005615 | Bacteria | 1885 |
| 155 | Ga0068852_100005119 | 3300005616 | Bacteria | 9342 |
| 156 | Ga0068852_100283518 | 3300005616 | Bacteria | 1598 |
| 157 | Ga0068859_100003323 | 3300005617 | Bacteria | 16346 |
| 158 | Ga0068859_100081132 | 3300005617 | Bacteria | 3286 |
| 159 | Ga0068859_100978400 | 3300005617 | Unclassified | 929 |
| 160 | Ga0068864_100008263 | 3300005618 | Bacteria | 8585 |
| 161 | Ga0068864_100914735 | 3300005618 | Bacteria | 867 |
| 162 | Ga0068866_10014394 | 3300005718 | Bacteria | 3493 |
| 163 | Ga0068866_10584265 | 3300005718 | Unclassified | 752 |
| 164 | Ga0068861_100055834 | 3300005719 | Bacteria | 3013 |
| 165 | Ga0068861_100107599 | 3300005719 | Bacteria | 2229 |
| 166 | Ga0068861_100281767 | 3300005719 | Bacteria | 1432 |
| 167 | Ga0068861_100888082 | 3300005719 | Bacteria | 843 |
| 168 | Ga0068851_10368695 | 3300005834 | Bacteria | 839 |
| 169 | Ga0068870_10022113 | 3300005840 | Bacteria | 3121 |
| 170 | Ga0068870_10110574 | 3300005840 | Bacteria | 1568 |
| 171 | Ga0068863_100154312 | 3300005841 | Bacteria | 2198 |
| 172 | Ga0068863_100606972 | 3300005841 | Bacteria | 1083 |
| 173 | Ga0068858_100005508 | 3300005842 | Bacteria | 12397 |
| 174 | Ga0068858_100026659 | 3300005842 | Bacteria | 5368 |
| 175 | Ga0068858_100041820 | 3300005842 | Bacteria | 4248 |
| 176 | Ga0068858_100084744 | 3300005842 | Bacteria | 2948 |
| 177 | Ga0068858_101437190 | 3300005842 | Bacteria | 680 |
| 178 | Ga0068860_100024050 | 3300005843 | Bacteria | 5889 |
| 179 | Ga0068860_100052733 | 3300005843 | Bacteria | 3868 |
| 180 | Ga0068860_100199588 | 3300005843 | Bacteria | 1938 |
| 181 | Ga0068860_100340906 | 3300005843 | Bacteria | 1474 |
| 182 | Ga0068860_102217292 | 3300005843 | Bacteria | 570 |
| 183 | Ga0068862_100063678 | 3300005844 | Bacteria | 3173 |
| 184 | Ga0068862_100087457 | 3300005844 | Bacteria | 2711 |
| 185 | Ga0068862_100200293 | 3300005844 | Bacteria | 1800 |
| 186 | Ga0081455_10068043 | 3300005937 | Bacteria | 2966 |
| 187 | Ga0081455_10805742 | 3300005937 | Bacteria | 589 |
| 188 | Ga0081540_1137050 | 3300005983 | Bacteria | 989 |
| 189 | Ga0081539_10001105 | 3300005985 | Bacteria | 48997 |
| 190 | Ga0081539_10016410 | 3300005985 | Bacteria | 5291 |
| 191 | Ga0081539_10030693 | 3300005985 | Bacteria | 3330 |
| 192 | Ga0081539_10172782 | 3300005985 | Bacteria | 1020 |
| 193 | Ga0070717_10010249 | 3300006028 | Bacteria | 7062 |
| 194 | Ga0070717_10252915 | 3300006028 | Bacteria | 1557 |
| 195 | Ga0075363_100071779 | 3300006048 | Bacteria | 1882 |
| 196 | Ga0075364_10084886 | 3300006051 | Bacteria | 2096 |
| 197 | Ga0075364_10096349 | 3300006051 | Unclassified | 1967 |
| 198 | Ga0075364_10183980 | 3300006051 | Bacteria | 1414 |
| 199 | Ga0070715_10001621 | 3300006163 | Bacteria | 6647 |
| 200 | Ga0070715_10091691 | 3300006163 | Bacteria | 1400 |
| 201 | Ga0070715_10147947 | 3300006163 | Bacteria | 1148 |
| 202 | Ga0070716_100017459 | 3300006173 | Bacteria | 3721 |
| 203 | Ga0070716_100034194 | 3300006173 | Bacteria | 2785 |
| 204 | Ga0070716_100039670 | 3300006173 | Bacteria | 2615 |
| 205 | Ga0070716_100882243 | 3300006173 | Bacteria | 699 |
| 206 | Ga0070712_100001629 | 3300006175 | Bacteria | 13744 |
| 207 | Ga0070712_100050086 | 3300006175 | Bacteria | 2904 |
| 208 | Ga0070712_100728590 | 3300006175 | Unclassified | 847 |
| 209 | Ga0070712_100791773 | 3300006175 | Bacteria | 813 |
| 210 | Ga0070712_100804222 | 3300006175 | Unclassified | 807 |
| 211 | Ga0070712_101040904 | 3300006175 | Bacteria | 709 |
| 212 | Ga0075367_10208597 | 3300006178 | Bacteria | 1221 |
| 213 | Ga0075367_10278731 | 3300006178 | Bacteria | 1051 |
| 214 | Ga0075367_10466930 | 3300006178 | Bacteria | 800 |
| 215 | Ga0097621_100267647 | 3300006237 | Bacteria | 1501 |
| 216 | Ga0097621_100881104 | 3300006237 | Bacteria | 833 |
| 217 | Ga0075370_10117162 | 3300006353 | Bacteria | 1549 |
| 218 | Ga0075370_10421557 | 3300006353 | Bacteria | 802 |
| 219 | Ga0068871_100045272 | 3300006358 | Bacteria | 3541 |
| 220 | Ga0068871_100106281 | 3300006358 | Bacteria | 2356 |
| 221 | Ga0068871_100612252 | 3300006358 | Bacteria | 991 |
| 222 | Ga0068871_100988743 | 3300006358 | Unclassified | 783 |
| 223 | Ga0075428_100266022 | 3300006844 | Bacteria | 1846 |
| 224 | Ga0075428_100318125 | 3300006844 | Bacteria | 1672 |
| 225 | Ga0075428_100451700 | 3300006844 | Bacteria | 1377 |
| 226 | Ga0075428_101854167 | 3300006844 | Bacteria | 627 |
| 227 | Ga0075430_100003402 | 3300006846 | Bacteria | 13294 |
| 228 | Ga0075431_100020686 | 3300006847 | Bacteria | 6724 |
| 229 | Ga0075433_10211783 | 3300006852 | Unclassified | 1722 |
| 230 | Ga0075433_10564702 | 3300006852 | Bacteria | 1000 |
| 231 | Ga0075434_100203910 | 3300006871 | Unclassified | 1998 |
| 232 | Ga0075434_101438472 | 3300006871 | Bacteria | 699 |
| 233 | Ga0075434_101771112 | 3300006871 | Bacteria | 625 |
| 234 | Ga0075429_100111367 | 3300006880 | Bacteria | 2392 |
| 235 | Ga0068865_100002602 | 3300006881 | Bacteria | 10721 |
| 236 | Ga0068865_100065904 | 3300006881 | Bacteria | 2554 |
| 237 | Ga0068865_100927027 | 3300006881 | Bacteria | 759 |
| 238 | Ga0075436_100034677 | 3300006914 | Bacteria | 3480 |
| 239 | Ga0097620_100003323 | 3300006931 | Bacteria | 16346 |
| 240 | Ga0097620_100081132 | 3300006931 | Bacteria | 3286 |
| 241 | Ga0097620_100978561 | 3300006931 | Unclassified | 929 |
| 242 | Ga0075435_100240239 | 3300007076 | Bacteria | 1540 |
| 243 | Ga0105250_10016328 | 3300009092 | Bacteria | 3027 |
| 244 | Ga0105240_10052290 | 3300009093 | Bacteria | 5136 |
| 245 | Ga0111539_10328068 | 3300009094 | Bacteria | 1781 |
| 246 | Ga0111539_10627301 | 3300009094 | Unclassified | 1252 |
| 247 | Ga0111539_10823756 | 3300009094 | Bacteria | 1080 |
| 248 | Ga0105245_10002949 | 3300009098 | Bacteria | 15269 |
| 249 | Ga0105245_10012595 | 3300009098 | Bacteria | 7362 |
| 250 | Ga0105245_10367057 | 3300009098 | Unclassified | 1430 |
| 251 | Ga0105245_10872240 | 3300009098 | Bacteria | 941 |
| 252 | Ga0105245_11316582 | 3300009098 | Bacteria | 772 |
| 253 | Ga0105247_10006205 | 3300009101 | Bacteria | 7413 |
| 254 | Ga0105247_10011889 | 3300009101 | Bacteria | 5233 |
| 255 | Ga0105247_10146652 | 3300009101 | Bacteria | 1551 |
| 256 | Ga0105247_10235540 | 3300009101 | Bacteria | 1245 |
| 257 | Ga0105247_10955780 | 3300009101 | Bacteria | 666 |
| 258 | Ga0114129_10669990 | 3300009147 | Bacteria | 1337 |
| 259 | Ga0114129_11321763 | 3300009147 | Bacteria | 893 |
| 260 | Ga0114129_11391393 | 3300009147 | Bacteria | 866 |
| 261 | Ga0105243_10001793 | 3300009148 | Bacteria | 18439 |
| 262 | Ga0105243_10139409 | 3300009148 | Bacteria | 2067 |
| 263 | Ga0105243_10168054 | 3300009148 | Bacteria | 1897 |
| 264 | Ga0105243_11490012 | 3300009148 | Unclassified | 700 |
| 265 | Ga0105243_11574912 | 3300009148 | Bacteria | 683 |
| 266 | Ga0105243_11774947 | 3300009148 | Bacteria | 647 |
| 267 | Ga0105241_10025245 | 3300009174 | Bacteria | 4415 |
| 268 | Ga0105241_10469059 | 3300009174 | Bacteria | 1117 |
| 269 | Ga0105241_11525019 | 3300009174 | Unclassified | 644 |
| 270 | Ga0105242_10010633 | 3300009176 | Bacteria | 7065 |
| 271 | Ga0105242_10014227 | 3300009176 | Bacteria | 6161 |
| 272 | Ga0105242_10850121 | 3300009176 | Bacteria | 908 |
| 273 | Ga0105248_10089951 | 3300009177 | Bacteria | 3456 |
| 274 | Ga0105248_10118190 | 3300009177 | Bacteria | 2990 |
| 275 | Ga0105248_10645382 | 3300009177 | Bacteria | 1194 |
| 276 | Ga0105248_11849909 | 3300009177 | Unclassified | 685 |
| 277 | Ga0105237_10008490 | 3300009545 | Bacteria | 11117 |
| 278 | Ga0105237_11268936 | 3300009545 | Bacteria | 743 |
| 279 | Ga0105238_10368676 | 3300009551 | Bacteria | 1426 |
| 280 | Ga0105238_10738217 | 3300009551 | Bacteria | 998 |
| 281 | Ga0105238_11334603 | 3300009551 | Bacteria | 744 |
| 282 | Ga0105238_11660148 | 3300009551 | Bacteria | 670 |
| 283 | Ga0105249_10002808 | 3300009553 | Bacteria | 15035 |
| 284 | Ga0105249_10021712 | 3300009553 | Bacteria | 5747 |
| 285 | Ga0105249_10214482 | 3300009553 | Bacteria | 1891 |
| 286 | Ga0105249_10335721 | 3300009553 | Unclassified | 1527 |
| 287 | Ga0105249_10740563 | 3300009553 | Bacteria | 1045 |
| 288 | Ga0105249_12562011 | 3300009553 | Bacteria | 582 |
| 289 | Ga0105239_10075472 | 3300010375 | Bacteria | 3707 |
| 290 | Ga0105239_10275933 | 3300010375 | Bacteria | 1891 |
| 291 | Ga0105246_10006704 | 3300011119 | Bacteria | 7039 |
| 292 | Ga0105246_10120725 | 3300011119 | Bacteria | 1942 |
| 293 | Ga0105246_10211919 | 3300011119 | Bacteria | 1513 |
| 294 | Ga0105246_11958924 | 3300011119 | Bacteria | 564 |
| 295 | Ga0157373_10017570 | 3300013100 | Bacteria | 5210 |
| 296 | Ga0157371_10003182 | 3300013102 | Bacteria | 15073 |
| 297 | Ga0157370_10014817 | 3300013104 | Bacteria | 7957 |
| 298 | Ga0157369_10012918 | 3300013105 | Bacteria | 9463 |
| 299 | Ga0157374_10000023 | 3300013296 | Bacteria | 265247 |
| 300 | Ga0157374_10024865 | 3300013296 | Bacteria | 5372 |
| 301 | Ga0157374_10302203 | 3300013296 | Bacteria | 1583 |
| 302 | Ga0157378_10012911 | 3300013297 | Bacteria | 7312 |
| 303 | Ga0157378_10025102 | 3300013297 | Bacteria | 5251 |
| 304 | Ga0157378_10073867 | 3300013297 | Bacteria | 3067 |
| 305 | Ga0157378_10343225 | 3300013297 | Bacteria | 1457 |
| 306 | Ga0157378_10464193 | 3300013297 | Bacteria | 1259 |
| 307 | Ga0157378_10598529 | 3300013297 | Bacteria | 1113 |
| 308 | Ga0157378_11036120 | 3300013297 | Bacteria | 856 |
| 309 | Ga0163162_10070193 | 3300013306 | Bacteria | 3554 |
| 310 | Ga0163162_10292876 | 3300013306 | Bacteria | 1759 |
| 311 | Ga0163162_10986037 | 3300013306 | Unclassified | 952 |
| 312 | Ga0163162_11278391 | 3300013306 | Bacteria | 833 |
| 313 | Ga0157372_10014732 | 3300013307 | Bacteria | 8368 |
| 314 | Ga0157372_10742299 | 3300013307 | Unclassified | 1142 |
| 315 | Ga0157375_10003246 | 3300013308 | Bacteria | 14111 |
| 316 | Ga0157375_10013731 | 3300013308 | Bacteria | 7219 |
| 317 | Ga0157375_10027983 | 3300013308 | Bacteria | 5276 |
| 318 | Ga0157375_10595996 | 3300013308 | Bacteria | 1264 |
| 319 | Ga0157375_10692509 | 3300013308 | Bacteria | 1173 |
| 320 | Ga0157375_11695706 | 3300013308 | Bacteria | 748 |
| 321 | Ga0157375_11871509 | 3300013308 | Bacteria | 712 |
| 322 | Ga0163163_10167506 | 3300014325 | Bacteria | 2243 |
| 323 | Ga0163163_10320951 | 3300014325 | Bacteria | 1602 |
| 324 | Ga0163163_10325482 | 3300014325 | Bacteria | 1591 |
| 325 | Ga0163163_10328159 | 3300014325 | Bacteria | 1584 |
| 326 | Ga0157380_10001996 | 3300014326 | Bacteria | 13589 |
| 327 | Ga0157380_10024730 | 3300014326 | Bacteria | 4549 |
| 328 | Ga0157380_10368874 | 3300014326 | Bacteria | 1350 |
| 329 | Ga0157380_10888541 | 3300014326 | Bacteria | 916 |
| 330 | Ga0157380_12375439 | 3300014326 | Bacteria | 595 |
| 331 | Ga0182008_10017704 | 3300014497 | Bacteria | 3693 |
| 332 | Ga0157377_10003789 | 3300014745 | Bacteria | 6866 |
| 333 | Ga0157377_10572144 | 3300014745 | Bacteria | 801 |
| 334 | Ga0157379_10014653 | 3300014968 | Bacteria | 6876 |
| 335 | Ga0157379_10034184 | 3300014968 | Bacteria | 4531 |
| 336 | Ga0157379_10058706 | 3300014968 | Bacteria | 3441 |
| 337 | Ga0157376_10010944 | 3300014969 | Bacteria | 6665 |
| 338 | Ga0157376_10037343 | 3300014969 | Bacteria | 3942 |
| 339 | Ga0157376_10374486 | 3300014969 | Bacteria | 1370 |
| 340 | Ga0157376_11080734 | 3300014969 | Bacteria | 827 |
| 341 | Ga0163161_10003417 | 3300017792 | Bacteria | 11139 |
| 342 | Ga0163161_10028783 | 3300017792 | Bacteria | 3947 |
| 343 | Ga0163161_10564947 | 3300017792 | Bacteria | 934 |
| 344 | Ga0163161_10636765 | 3300017792 | Bacteria | 882 |
| 345 | Ga0163161_10806718 | 3300017792 | Unclassified | 789 |
| 346 | Ga0206356_11601678 | 3300020070 | Bacteria | 1232 |
| 347 | Ga0206354_10326588 | 3300020081 | Bacteria | 4193 |
| 348 | Ga0206353_11478257 | 3300020082 | Bacteria | 1042 |
| 349 | Ga0213876_10005718 | 3300021384 | Bacteria | 6818 |
| 350 | Ga0213876_10459708 | 3300021384 | Bacteria | 677 |
| 351 | Ga0207697_10342099 | 3300025315 | Bacteria | 664 |
| 352 | Ga0207656_10237813 | 3300025321 | Bacteria | 889 |
| 353 | Ga0207692_10002916 | 3300025898 | Bacteria | 6618 |
| 354 | Ga0207642_10050465 | 3300025899 | Bacteria | 1877 |
| 355 | Ga0207642_10059024 | 3300025899 | Bacteria | 1772 |
| 356 | Ga0207710_10004861 | 3300025900 | Bacteria | 5825 |
| 357 | Ga0207710_10006413 | 3300025900 | Bacteria | 5024 |
| 358 | Ga0207710_10168278 | 3300025900 | Bacteria | 1071 |
| 359 | Ga0207688_10012337 | 3300025901 | Bacteria | 4650 |
| 360 | Ga0207688_10476638 | 3300025901 | Unclassified | 780 |
| 361 | Ga0207680_10193984 | 3300025903 | Bacteria | 1380 |
| 362 | Ga0207680_10550905 | 3300025903 | Bacteria | 823 |
| 363 | Ga0207647_10042219 | 3300025904 | Bacteria | 2862 |
| 364 | Ga0207647_10482866 | 3300025904 | Bacteria | 692 |
| 365 | Ga0207647_10507206 | 3300025904 | Unclassified | 672 |
| 366 | Ga0207685_10010359 | 3300025905 | Bacteria | 2750 |
| 367 | Ga0207685_10183590 | 3300025905 | Bacteria | 971 |
| 368 | Ga0207699_10024036 | 3300025906 | Bacteria | 3326 |
| 369 | Ga0207645_10011279 | 3300025907 | Bacteria | 6108 |
| 370 | Ga0207643_10286231 | 3300025908 | Bacteria | 1023 |
| 371 | Ga0207705_10253353 | 3300025909 | Bacteria | 1343 |
| 372 | Ga0207654_10044226 | 3300025911 | Bacteria | 2528 |
| 373 | Ga0207654_10104401 | 3300025911 | Bacteria | 1752 |
| 374 | Ga0207654_10683589 | 3300025911 | Unclassified | 736 |
| 375 | Ga0207707_10141953 | 3300025912 | Bacteria | 2100 |
| 376 | Ga0207707_10373058 | 3300025912 | Bacteria | 1227 |
| 377 | Ga0207695_10099556 | 3300025913 | Bacteria | 2904 |
| 378 | Ga0207671_10078480 | 3300025914 | Bacteria | 2473 |
| 379 | Ga0207693_10002134 | 3300025915 | Bacteria | 17233 |
| 380 | Ga0207693_10028377 | 3300025915 | Bacteria | 4422 |
| 381 | Ga0207693_10304651 | 3300025915 | Bacteria | 1248 |
| 382 | Ga0207693_10596580 | 3300025915 | Bacteria | 860 |
| 383 | Ga0207693_10762160 | 3300025915 | Bacteria | 747 |
| 384 | Ga0207663_10010044 | 3300025916 | Bacteria | 5018 |
| 385 | Ga0207663_10041733 | 3300025916 | Bacteria | 2798 |
| 386 | Ga0207660_10016953 | 3300025917 | Bacteria | 4833 |
| 387 | Ga0207662_10002384 | 3300025918 | Bacteria | 9418 |
| 388 | Ga0207662_10574292 | 3300025918 | Bacteria | 783 |
| 389 | Ga0207657_10003901 | 3300025919 | Bacteria | 15822 |
| 390 | Ga0207657_10336508 | 3300025919 | Bacteria | 1192 |
| 391 | Ga0207649_10135154 | 3300025920 | Bacteria | 1680 |
| 392 | Ga0207649_10185837 | 3300025920 | Bacteria | 1458 |
| 393 | Ga0207646_10008729 | 3300025922 | Bacteria | 10113 |
| 394 | Ga0207681_10081385 | 3300025923 | Bacteria | 2286 |
| 395 | Ga0207681_11429106 | 3300025923 | Bacteria | 580 |
| 396 | Ga0207650_10082584 | 3300025925 | Bacteria | 2439 |
| 397 | Ga0207687_10011259 | 3300025927 | Bacteria | 5844 |
| 398 | Ga0207687_10201856 | 3300025927 | Bacteria | 1555 |
| 399 | Ga0207700_10030016 | 3300025928 | Bacteria | 3844 |
| 400 | Ga0207664_10945661 | 3300025929 | Bacteria | 773 |
| 401 | Ga0207644_10013578 | 3300025931 | Bacteria | 5433 |
| 402 | Ga0207644_10150127 | 3300025931 | Bacteria | 1802 |
| 403 | Ga0207644_10168317 | 3300025931 | Bacteria | 1709 |
| 404 | Ga0207706_10001951 | 3300025933 | Bacteria | 20250 |
| 405 | Ga0207706_10031406 | 3300025933 | Bacteria | 4732 |
| 406 | Ga0207706_10107221 | 3300025933 | Bacteria | 2458 |
| 407 | Ga0207686_10040030 | 3300025934 | Bacteria | 2847 |
| 408 | Ga0207709_10046211 | 3300025935 | Bacteria | 2641 |
| 409 | Ga0207709_11070263 | 3300025935 | Bacteria | 661 |
| 410 | Ga0207670_10010766 | 3300025936 | Bacteria | 5279 |
| 411 | Ga0207670_10287453 | 3300025936 | Bacteria | 1283 |
| 412 | Ga0207670_10940782 | 3300025936 | Unclassified | 725 |
| 413 | Ga0207669_10009103 | 3300025937 | Bacteria | 4709 |
| 414 | Ga0207669_10143757 | 3300025937 | Bacteria | 1660 |
| 415 | Ga0207704_10147067 | 3300025938 | Bacteria | 1657 |
| 416 | Ga0207704_10194389 | 3300025938 | Bacteria | 1479 |
| 417 | Ga0207704_10730297 | 3300025938 | Bacteria | 822 |
| 418 | Ga0207665_10010692 | 3300025939 | Bacteria | 6027 |
| 419 | Ga0207665_10056512 | 3300025939 | Bacteria | 2649 |
| 420 | Ga0207691_10003871 | 3300025940 | Bacteria | 14534 |
| 421 | Ga0207711_10067882 | 3300025941 | Bacteria | 3087 |
| 422 | Ga0207711_10258303 | 3300025941 | Bacteria | 1600 |
| 423 | Ga0207711_10458547 | 3300025941 | Bacteria | 1187 |
| 424 | Ga0207689_10427275 | 3300025942 | Bacteria | 1106 |
| 425 | Ga0207661_11233706 | 3300025944 | Bacteria | 688 |
| 426 | Ga0207667_10162030 | 3300025949 | Bacteria | 2300 |
| 427 | Ga0207651_10011209 | 3300025960 | Bacteria | 5007 |
| 428 | Ga0207651_10249006 | 3300025960 | Bacteria | 1453 |
| 429 | Ga0207712_10055423 | 3300025961 | Bacteria | 2789 |
| 430 | Ga0207712_10059335 | 3300025961 | Bacteria | 2708 |
| 431 | Ga0207668_10016295 | 3300025972 | Bacteria | 4635 |
| 432 | Ga0207668_10174511 | 3300025972 | Bacteria | 1689 |
| 433 | Ga0207640_10014312 | 3300025981 | Bacteria | 4563 |
| 434 | Ga0207640_10042677 | 3300025981 | Bacteria | 2893 |
| 435 | Ga0207640_11537970 | 3300025981 | Bacteria | 598 |
| 436 | Ga0207658_10040184 | 3300025986 | Bacteria | 3379 |
| 437 | Ga0207677_10141753 | 3300026023 | Bacteria | 1841 |
| 438 | Ga0207677_10669700 | 3300026023 | Bacteria | 918 |
| 439 | Ga0207703_10031732 | 3300026035 | Bacteria | 4179 |
| 440 | Ga0207703_10161891 | 3300026035 | Bacteria | 1961 |
| 441 | Ga0207703_10192389 | 3300026035 | Bacteria | 1808 |
| 442 | Ga0207703_10511556 | 3300026035 | Bacteria | 1128 |
| 443 | Ga0207703_10654048 | 3300026035 | Bacteria | 997 |
| 444 | Ga0207703_12086675 | 3300026035 | Unclassified | 543 |
| 445 | Ga0207639_11384694 | 3300026041 | Unclassified | 660 |
| 446 | Ga0207678_10002768 | 3300026067 | Bacteria | 15873 |
| 447 | Ga0207678_10186238 | 3300026067 | Bacteria | 1773 |
| 448 | Ga0207678_10756640 | 3300026067 | Bacteria | 857 |
| 449 | Ga0207708_10002790 | 3300026075 | Bacteria | 12839 |
| 450 | Ga0207708_10050754 | 3300026075 | Bacteria | 3158 |
| 451 | Ga0207708_10235913 | 3300026075 | Bacteria | 1470 |
| 452 | Ga0207702_10053403 | 3300026078 | Bacteria | 3420 |
| 453 | Ga0207702_10449297 | 3300026078 | Bacteria | 1250 |
| 454 | Ga0207641_10045450 | 3300026088 | Bacteria | 3697 |
| 455 | Ga0207641_11419190 | 3300026088 | Bacteria | 695 |
| 456 | Ga0207648_10006819 | 3300026089 | Bacteria | 11318 |
| 457 | Ga0207648_10194263 | 3300026089 | Bacteria | 1799 |
| 458 | Ga0207648_10234355 | 3300026089 | Bacteria | 1633 |
| 459 | Ga0207676_10047493 | 3300026095 | Bacteria | 3327 |
| 460 | Ga0207674_10009360 | 3300026116 | Bacteria | 11207 |
| 461 | Ga0207675_100020221 | 3300026118 | Bacteria | 6207 |
| 462 | Ga0207675_100090578 | 3300026118 | Bacteria | 2876 |
| 463 | Ga0207675_100293099 | 3300026118 | Bacteria | 1583 |
| 464 | Ga0207675_100653709 | 3300026118 | Bacteria | 1057 |
| 465 | Ga0207675_100790412 | 3300026118 | Unclassified | 962 |
| 466 | Ga0207675_101508726 | 3300026118 | Bacteria | 693 |
| 467 | Ga0207675_101616005 | 3300026118 | Bacteria | 668 |
| 468 | Ga0207683_10002293 | 3300026121 | Bacteria | 16776 |
| 469 | Ga0207683_10150509 | 3300026121 | Bacteria | 2100 |
| 470 | Ga0207683_10200415 | 3300026121 | Bacteria | 1814 |
| 471 | Ga0207683_10720540 | 3300026121 | Bacteria | 925 |
| 472 | Ga0207698_10159585 | 3300026142 | Bacteria | 1970 |
| 473 | Ga0207698_10593227 | 3300026142 | Bacteria | 1091 |
| 474 | Ga0209970_1006642 | 3300027614 | Bacteria | 1899 |
| 475 | Ga0209971_1002817 | 3300027682 | Unclassified | 4154 |
| 476 | Ga0209974_10009773 | 3300027876 | Bacteria | 3251 |
| 477 | Ga0268266_10362980 | 3300028379 | Bacteria | 1363 |
| 478 | Ga0268266_10594924 | 3300028379 | Bacteria | 1062 |
| 479 | Ga0268265_10098020 | 3300028380 | Bacteria | 2360 |
| 480 | Ga0268265_10172630 | 3300028380 | Bacteria | 1849 |
| 481 | Ga0268264_10003129 | 3300028381 | Bacteria | 14342 |
| 482 | Ga0268264_10017032 | 3300028381 | Bacteria | 5950 |
| 483 | Ga0268264_10260694 | 3300028381 | Bacteria | 1614 |
| 484 | Ga0268264_10392093 | 3300028381 | Bacteria | 1332 |
| 485 | Ga0268264_10479594 | 3300028381 | Bacteria | 1209 |
| 486 | Ga0265338_10180818 | 3300028800 | Bacteria | 1608 |
| 487 | Ga0265339_10132081 | 3300031249 | Bacteria | 1276 |
| 488 | Ga0307406_10490238 | 3300031901 | Bacteria | 994 |
| 489 | Ga0307416_100343355 | 3300032002 | Bacteria | 1507 |
| 490 | Ga0307415_100147821 | 3300032126 | Bacteria | 1804 |
| 491 | Ga0307415_100732655 | 3300032126 | Bacteria | 896 |
| 492 | Ga0373928_0044102 | 3300035084 | Bacteria | 1034 |
| 493 | Ga0373949_0048767 | 3300035090 | Bacteria | 1062 |
| 494 | Ga0373952_0028704 | 3300035092 | Bacteria | 1222 |
| 495 | Ga0373939_0075100 | 3300035114 | Bacteria | 1110 |
| 496 | Ga0373954_0257842 | 3300035118 | Bacteria | 859 |
| 497 | Ga0373956_0119138 | 3300035119 | Bacteria | 1232 |
| 498 | Ga0373957_0406174 | 3300035120 | Bacteria | 586 |
| 499 | Ga0373960_0083955 | 3300035121 | Bacteria | 1008 |
| 500 | Ga0373943_0056285 | 3300035170 | Bacteria | 1951 |
| 501 | Ga0373942_0007904 | 3300035207 | Bacteria | 2472 |
| 502 | Ga0373961_0048768 | 3300035241 | Bacteria | 1249 |
| 503 | Ga0373931_0021457 | 3300035691 | Bacteria | 3241 |
| 504 | Ga0373931_0229344 | 3300035691 | Bacteria | 1121 |
| 505 | Ga0373931_0469578 | 3300035691 | Bacteria | 807 |
| 506 | Ga0373931_0678286 | 3300035691 | Bacteria | 679 |
| 507 | Ga0373927_0010886 | 3300035695 | Bacteria | 6058 |
| 508 | Ga0373947_0012884 | 3300035725 | Bacteria | 4794 |
| 509 | Ga0373947_0152394 | 3300035725 | Bacteria | 1490 |
| 510 | Ga0373947_0458579 | 3300035725 | Bacteria | 864 |
| 511 | Ga0373937_0251318 | 3300036401 | Bacteria | 1667 |
| 512 | Ga0373937_0282057 | 3300036401 | Bacteria | 1569 |
| 513 | Ga0373937_0438247 | 3300036401 | Bacteria | 1240 |
| 514 | Ga0316582_0518310 | 3300036647 | Bacteria | 822 |
| 515 | Ga0373925_0174885 | 3300037068 | Bacteria | 1696 |
| 516 | Ga0395899_0021775 | 3300037312 | Bacteria | 4862 |
| 517 | Ga0395899_0377524 | 3300037312 | Unclassified | 943 |
| 518 | Ga0395900_0012733 | 3300037418 | Bacteria | 8596 |
| 519 | Ga0395900_0025557 | 3300037418 | Bacteria | 6045 |
| 520 | Ga0395898_0033197 | 3300037466 | Bacteria | 5152 |
| 521 | Ga0395898_0042371 | 3300037466 | Bacteria | 4492 |
| 522 | Ga0395905_0004262 | 3300037471 | Bacteria | 14931 |
| 523 | Ga0395905_0006144 | 3300037471 | Bacteria | 12122 |
| 524 | Ga0436364_1031932 | 3300037853 | Bacteria | 1472 |
| 525 | Ga0395901_0003803 | 3300038443 | Bacteria | 15211 |
| 526 | Ga0395901_0028011 | 3300038443 | Bacteria | 5794 |
| 527 | Ga0400483_075551 | 3300039062 | Bacteria | 3285 |
| 528 | Ga0436365_0245712 | 3300039437 | Bacteria | 3046 |
| 529 | Ga0436365_0883975 | 3300039437 | Unclassified | 595 |
| 530 | Ga0436365_1600768 | 3300039437 | Bacteria | 34772 |
| 531 | Ga0436360_0125292 | 3300039438 | Bacteria | 1146 |
| 532 | Ga0436362_1007980 | 3300039453 | Bacteria | 3437 |
| 533 | Ga0436362_1269541 | 3300039453 | Bacteria | 896 |
| 534 | Ga0451804_0573469 | 3300041463 | Bacteria | 695 |
| 535 | Ga0451807_1087109 | 3300041486 | Bacteria | 1045 |
| 536 | Ga0451833_1169028 | 3300041491 | Bacteria | 580 |
| 537 | Ga0439434_0072263 | 3300042435 | Bacteria | 1087 |
| 538 | Ga0451577_0051380 | 3300042876 | Bacteria | 3680 |
| 539 | Ga0451577_1014590 | 3300042876 | Bacteria | 745 |
| 540 | Ga0466969_0077225 | 3300044656 | Bacteria | 1594 |
| 541 | Ga0453683_0095122 | 3300044673 | Bacteria | 1869 |
| 542 | Ga0453683_0251566 | 3300044673 | Bacteria | 1126 |
| 543 | Ga0453683_0381740 | 3300044673 | Bacteria | 907 |
| 544 | Ga0466965_0222587 | 3300044683 | Bacteria | 1006 |
| 545 | Ga0466961_0022490 | 3300044693 | Bacteria | 4056 |
| 546 | Ga0466961_0260144 | 3300044693 | Bacteria | 1064 |
| 547 | Ga0466961_0411574 | 3300044693 | Bacteria | 820 |
| 548 | Ga0466963_0148501 | 3300044694 | Bacteria | 1627 |
| 549 | Ga0466963_0422093 | 3300044694 | Bacteria | 940 |
| 550 | Ga0466971_0317212 | 3300044719 | Bacteria | 751 |
| 551 | Ga0466968_0124962 | 3300044735 | Bacteria | 1167 |
| 552 | Ga0466957_1088381 | 3300044842 | Bacteria | 576 |
| 553 | Ga0466960_0333023 | 3300044901 | Bacteria | 862 |
| 554 | Ga0466959_0476059 | 3300045049 | Bacteria | 845 |
| 555 | Ga0451576_0006869 | 3300045051 | Bacteria | 13784 |
| 556 | Ga0451576_0098809 | 3300045051 | Bacteria | 3036 |
| 557 | Ga0451576_0180746 | 3300045051 | Bacteria | 2202 |
| 558 | Ga0466958_0076727 | 3300045836 | Bacteria | 2052 |
| 559 | Ga0466967_0006868 | 3300045976 | Bacteria | 8125 |
| 560 | Ga0466967_0032004 | 3300045976 | Bacteria | 4437 |
| 561 | Ga0466967_0150335 | 3300045976 | Bacteria | 2176 |
| 562 | Ga0466967_0281399 | 3300045976 | Bacteria | 1596 |
| 563 | Ga0466967_1659015 | 3300045976 | Bacteria | 637 |
| 564 | Ga0495592_0358687 | 3300046454 | Bacteria | 933 |
| 565 | Ga0495592_0847511 | 3300046454 | Bacteria | 540 |
| 566 | Ga0495603_0001217 | 3300046455 | Bacteria | 15028 |
| 567 | Ga0495603_0208751 | 3300046455 | Bacteria | 1128 |
| 568 | Ga0495629_0000385 | 3300046459 | Bacteria | 36974 |
| 569 | Ga0495629_0040413 | 3300046459 | Bacteria | 3281 |
| 570 | Ga0495641_0011833 | 3300046461 | Bacteria | 4934 |
| 571 | Ga0495641_0213351 | 3300046461 | Bacteria | 866 |
| 572 | Ga0495653_0070000 | 3300046463 | Bacteria | 2627 |
| 573 | Ga0495653_0347314 | 3300046463 | Bacteria | 955 |
| 574 | Ga0495580_0003243 | 3300046472 | Bacteria | 13911 |
| 575 | Ga0495582_0012588 | 3300046473 | Bacteria | 4663 |
| 576 | Ga0495582_0231782 | 3300046473 | Bacteria | 1057 |
| 577 | Ga0495639_0015635 | 3300046475 | Bacteria | 3291 |
| 578 | Ga0495639_0020577 | 3300046475 | Bacteria | 2884 |
| 579 | Ga0495662_0130643 | 3300046476 | Unclassified | 1235 |
| 580 | Ga0495584_0099747 | 3300046491 | Bacteria | 1467 |
| 581 | Ga0495594_0000204 | 3300046499 | Bacteria | 28874 |
| 582 | Ga0495618_0432296 | 3300046514 | Bacteria | 801 |
| 583 | Ga0495630_0054601 | 3300046517 | Bacteria | 2993 |
| 584 | Ga0495630_0057709 | 3300046517 | Bacteria | 2910 |
| 585 | Ga0495630_0546543 | 3300046517 | Bacteria | 888 |
| 586 | Ga0495644_0019894 | 3300046523 | Bacteria | 2563 |
| 587 | Ga0495644_0264855 | 3300046523 | Bacteria | 669 |
| 588 | Ga0495663_0048731 | 3300046525 | Unclassified | 1307 |
| 589 | Ga0495666_0101735 | 3300046526 | Bacteria | 1353 |
| 590 | Ga0495665_0003791 | 3300046531 | Bacteria | 8183 |
| 591 | Ga0495640_0041878 | 3300046533 | Bacteria | 3198 |
| 592 | Ga0495586_0031779 | 3300046535 | Bacteria | 2829 |
| 593 | Ga0495622_0001090 | 3300046557 | Bacteria | 14195 |
| 594 | Ga0495633_0117197 | 3300046558 | Unclassified | 1234 |
| 595 | Ga0495667_0186509 | 3300046559 | Bacteria | 1330 |
| 596 | Ga0495656_0673431 | 3300046615 | Bacteria | 556 |
| 597 | Ga0495668_0381449 | 3300046616 | Bacteria | 774 |
| 598 | Ga0495668_0581771 | 3300046616 | Unclassified | 618 |
| 599 | Ga0495634_0004946 | 3300046642 | Bacteria | 10302 |
| 600 | Ga0495588_0006678 | 3300046674 | Bacteria | 5211 |
| 601 | Ga0495657_0028026 | 3300046675 | Bacteria | 3966 |
| 602 | Ga0495599_0180423 | 3300046678 | Bacteria | 1302 |
| 603 | Ga0495623_0171296 | 3300046679 | Bacteria | 1268 |
| 604 | Ga0495646_0189315 | 3300046680 | Bacteria | 1125 |
| 605 | Ga0495647_0064193 | 3300046681 | Bacteria | 1455 |
| 606 | Ga0495647_0079194 | 3300046681 | Bacteria | 1330 |
| 607 | Ga0495658_0003653 | 3300046683 | Bacteria | 7615 |
| 608 | Ga0495658_0466992 | 3300046683 | Bacteria | 807 |
| 609 | Ga0495613_0005090 | 3300046689 | Bacteria | 9851 |
| 610 | Ga0495613_0019028 | 3300046689 | Bacteria | 5117 |
| 611 | Ga0495613_0143372 | 3300046689 | Bacteria | 1706 |
| 612 | Ga0495624_0382828 | 3300046690 | Bacteria | 845 |
| 613 | Ga0495671_0312475 | 3300046692 | Bacteria | 755 |
| 614 | Ga0495581_0018699 | 3300047315 | Bacteria | 4024 |
| 615 | Ga0495604_0340138 | 3300047317 | Bacteria | 999 |
| 616 | Ga0495636_0114924 | 3300047318 | Bacteria | 1187 |
| 617 | Ga0495674_0737133 | 3300047319 | Bacteria | 771 |
| 618 | Ga0495676_0183936 | 3300047321 | Bacteria | 1462 |
| 619 | Ga0495676_0356667 | 3300047321 | Bacteria | 977 |
| 620 | Ga0495680_0185045 | 3300047322 | Bacteria | 1501 |
| 621 | Ga0495680_0434752 | 3300047322 | Bacteria | 901 |
| 622 | Ga0495593_0007946 | 3300047673 | Bacteria | 6179 |
| 623 | Ga0495602_0603344 | 3300048088 | Bacteria | 755 |
| 624 | Ga0495614_0003051 | 3300048089 | Bacteria | 7464 |
| 625 | Ga0495614_0105125 | 3300048089 | Bacteria | 1237 |
| 626 | Ga0496100_0009464 | 3300048903 | Bacteria | 5477 |
| 627 | Ga0496100_0020781 | 3300048903 | Bacteria | 3942 |
| 628 | Ga0496100_0296700 | 3300048903 | Bacteria | 1209 |
| 629 | Ga0496100_0400155 | 3300048903 | Bacteria | 1046 |
| 630 | Ga0496100_0422900 | 3300048903 | Bacteria | 1018 |
| 631 | Ga0496101_0007069 | 3300048904 | Bacteria | 7257 |
| 632 | Ga0496101_0013491 | 3300048904 | Bacteria | 5475 |
| 633 | Ga0496101_0024354 | 3300048904 | Bacteria | 4189 |
| 634 | Ga0496101_0125839 | 3300048904 | Bacteria | 1942 |
| 635 | Ga0496102_0012774 | 3300048905 | Bacteria | 7268 |
| 636 | Ga0496102_0084178 | 3300048905 | Bacteria | 2935 |
| 637 | Ga0496102_0109013 | 3300048905 | Bacteria | 2580 |
| 638 | Ga0496102_0258037 | 3300048905 | Bacteria | 1643 |
| 639 | Ga0496102_0564784 | 3300048905 | Bacteria | 1060 |
| 640 | Ga0496102_1134853 | 3300048905 | Bacteria | 701 |
| 641 | Ga0496102_1502026 | 3300048905 | Bacteria | 592 |
| 642 | Ga0496103_0009946 | 3300048906 | Bacteria | 5624 |
| 643 | Ga0496103_0072143 | 3300048906 | Bacteria | 2162 |
| 644 | Ga0496103_0550342 | 3300048906 | Bacteria | 737 |
| 645 | Ga0496104_0006146 | 3300048907 | Bacteria | 10541 |
| 646 | Ga0496104_0042281 | 3300048907 | Bacteria | 4275 |
| 647 | Ga0496104_0058033 | 3300048907 | Bacteria | 3663 |
| 648 | Ga0496104_0161276 | 3300048907 | Bacteria | 2151 |
| 649 | Ga0496105_0002967 | 3300048908 | Bacteria | 12454 |
| 650 | Ga0496105_0021506 | 3300048908 | Bacteria | 5220 |
| 651 | Ga0496105_0065103 | 3300048908 | Bacteria | 3008 |
| 652 | Ga0496105_0519165 | 3300048908 | Bacteria | 933 |
| 653 | Ga0496106_0012257 | 3300048909 | Bacteria | 6330 |
| 654 | Ga0496106_0063506 | 3300048909 | Bacteria | 2806 |
| 655 | Ga0496106_0688150 | 3300048909 | Bacteria | 815 |
| 656 | Ga0496107_0002150 | 3300048910 | Bacteria | 12656 |
| 657 | Ga0496107_0002685 | 3300048910 | Bacteria | 11658 |
| 658 | Ga0496107_0083705 | 3300048910 | Bacteria | 2326 |
| 659 | Ga0496107_0095375 | 3300048910 | Bacteria | 2177 |
| 660 | Ga0496107_0277670 | 3300048910 | Bacteria | 1247 |
| 661 | Ga0496108_0012508 | 3300048911 | Bacteria | 6911 |
| 662 | Ga0496108_0021677 | 3300048911 | Bacteria | 5281 |
| 663 | Ga0496108_0036232 | 3300048911 | Bacteria | 4105 |
| 664 | Ga0496108_0204747 | 3300048911 | Bacteria | 1712 |
| 665 | Ga0496108_0274780 | 3300048911 | Bacteria | 1467 |
| 666 | Ga0496108_0278771 | 3300048911 | Bacteria | 1455 |
| 667 | Ga0496108_0495547 | 3300048911 | Bacteria | 1067 |
| 668 | Ga0496109_0067830 | 3300048912 | Bacteria | 3268 |
| 669 | Ga0496109_0132020 | 3300048912 | Bacteria | 2331 |
| 670 | Ga0496109_0273295 | 3300048912 | Bacteria | 1592 |
| 671 | Ga0496109_0353020 | 3300048912 | Bacteria | 1389 |
| 672 | Ga0496109_0370538 | 3300048912 | Unclassified | 1353 |
| 673 | Ga0496109_0879594 | 3300048912 | Bacteria | 834 |
| 674 | Ga0496110_0008754 | 3300048913 | Bacteria | 8153 |
| 675 | Ga0496110_0057106 | 3300048913 | Bacteria | 3436 |
| 676 | Ga0496110_0124347 | 3300048913 | Bacteria | 2326 |
| 677 | Ga0496110_0135054 | 3300048913 | Bacteria | 2229 |
| 678 | Ga0496110_0222570 | 3300048913 | Bacteria | 1716 |
| 679 | Ga0496110_0721864 | 3300048913 | Bacteria | 899 |
| 680 | Ga0496110_1574027 | 3300048913 | Unclassified | 567 |
| 681 | Ga0496111_0022322 | 3300048914 | Bacteria | 4429 |
| 682 | Ga0496111_0027488 | 3300048914 | Bacteria | 4024 |
| 683 | Ga0496111_0043897 | 3300048914 | Bacteria | 3214 |
| 684 | Ga0496111_0600537 | 3300048914 | Bacteria | 806 |
| 685 | Ga0496112_0073122 | 3300048915 | Bacteria | 3389 |
| 686 | Ga0496112_0084190 | 3300048915 | Bacteria | 3145 |
| 687 | Ga0496112_0168698 | 3300048915 | Bacteria | 2154 |
| 688 | Ga0496112_0229749 | 3300048915 | Bacteria | 1810 |
| 689 | Ga0496112_0231833 | 3300048915 | Bacteria | 1801 |
| 690 | Ga0496113_0020616 | 3300048916 | Bacteria | 4638 |
| 691 | Ga0496113_0094527 | 3300048916 | Bacteria | 2309 |
| 692 | Ga0496113_0168704 | 3300048916 | Bacteria | 1733 |
| 693 | Ga0496113_0177987 | 3300048916 | Bacteria | 1685 |
| 694 | Ga0496113_0690143 | 3300048916 | Unclassified | 815 |
| 695 | Ga0496113_0751984 | 3300048916 | Bacteria | 776 |
| 696 | Ga0496114_0022712 | 3300048917 | Bacteria | 5113 |
| 697 | Ga0496114_0036032 | 3300048917 | Bacteria | 4089 |
| 698 | Ga0496114_0131244 | 3300048917 | Bacteria | 2163 |
| 699 | Ga0496114_0199059 | 3300048917 | Bacteria | 1754 |
| 700 | Ga0496114_0254701 | 3300048917 | Bacteria | 1545 |
| 701 | Ga0496114_0859252 | 3300048917 | Bacteria | 788 |
| 702 | Ga0496115_0011411 | 3300048918 | Bacteria | 6661 |
| 703 | Ga0496115_0049700 | 3300048918 | Bacteria | 3357 |
| 704 | Ga0496115_0134096 | 3300048918 | Bacteria | 2042 |
| 705 | Ga0496126_0254603 | 3300048929 | Bacteria | 1462 |
| 706 | Ga0501031_0031225 | 3300049568 | Bacteria | 3475 |
| 707 | Ga0501031_0088824 | 3300049568 | Bacteria | 2015 |
| 708 | Ga0501031_0095987 | 3300049568 | Bacteria | 1935 |
| 709 | Ga0501031_0236894 | 3300049568 | Bacteria | 1187 |
| 710 | Ga0501031_0249503 | 3300049568 | Bacteria | 1153 |
| 711 | Ga0501031_0275221 | 3300049568 | Bacteria | 1092 |
| 712 | Ga0501032_0101602 | 3300049569 | Bacteria | 1905 |
| 713 | Ga0501033_0322253 | 3300049570 | Bacteria | 1085 |
| 714 | Ga0501034_0349187 | 3300049571 | Bacteria | 1408 |
| 715 | Ga0501034_0453683 | 3300049571 | Bacteria | 1200 |
| 716 | Ga0501034_0734413 | 3300049571 | Unclassified | 884 |
| 717 | Ga0501036_0012638 | 3300049572 | Bacteria | 7003 |
| 718 | Ga0501036_0026101 | 3300049572 | Unclassified | 4930 |
| 719 | Ga0501036_0200297 | 3300049572 | Bacteria | 1679 |
| 720 | Ga0501036_1053926 | 3300049572 | Bacteria | 665 |
| 721 | Ga0501037_0077159 | 3300049573 | Bacteria | 2418 |
| 722 | Ga0501037_0109582 | 3300049573 | Bacteria | 1989 |
| 723 | Ga0501038_0041329 | 3300049574 | Bacteria | 4021 |
| 724 | Ga0501038_0122882 | 3300049574 | Bacteria | 2139 |
| 725 | Ga0501038_0160972 | 3300049574 | Bacteria | 1824 |
| 726 | Ga0501039_0034461 | 3300049575 | Bacteria | 3906 |
| 727 | Ga0501039_0091458 | 3300049575 | Bacteria | 2371 |
| 728 | Ga0501039_0095357 | 3300049575 | Bacteria | 2319 |
| 729 | Ga0501039_0868305 | 3300049575 | Bacteria | 703 |
| 730 | Ga0501040_0006274 | 3300049576 | Bacteria | 7719 |
| 731 | Ga0501040_0015203 | 3300049576 | Bacteria | 5085 |
| 732 | Ga0501040_0015226 | 3300049576 | Bacteria | 5081 |
| 733 | Ga0501040_0071196 | 3300049576 | Bacteria | 2400 |
| 734 | Ga0501040_0884478 | 3300049576 | Unclassified | 647 |
| 735 | Ga0501041_0042343 | 3300049577 | Bacteria | 2767 |
| 736 | Ga0501041_0075837 | 3300049577 | Bacteria | 2068 |
| 737 | Ga0501041_0083757 | 3300049577 | Bacteria | 1966 |
| 738 | Ga0501041_0323098 | 3300049577 | Bacteria | 974 |
| 739 | Ga0501042_0010879 | 3300049578 | Bacteria | 6122 |
| 740 | Ga0501042_0024981 | 3300049578 | Bacteria | 4193 |
| 741 | Ga0501042_0047288 | 3300049578 | Bacteria | 3068 |
| 742 | Ga0501042_0058236 | 3300049578 | Bacteria | 2757 |
| 743 | Ga0501042_0510206 | 3300049578 | Bacteria | 873 |
| 744 | Ga0501042_1287336 | 3300049578 | Bacteria | 533 |
| 745 | Ga0501043_0081391 | 3300049579 | Unclassified | 2544 |
| 746 | Ga0501043_0104021 | 3300049579 | Bacteria | 2231 |
| 747 | Ga0501043_0157941 | 3300049579 | Bacteria | 1773 |
| 748 | Ga0501043_0381695 | 3300049579 | Bacteria | 1067 |
| 749 | Ga0501046_0003267 | 3300049580 | Bacteria | 14882 |
| 750 | Ga0501046_0030177 | 3300049580 | Bacteria | 4401 |
| 751 | Ga0501046_0104556 | 3300049580 | Bacteria | 2170 |
| 752 | Ga0501046_0131010 | 3300049580 | Bacteria | 1902 |
| 753 | Ga0501046_0645047 | 3300049580 | Bacteria | 749 |
| 754 | Ga0501047_0037381 | 3300049581 | Bacteria | 4695 |
| 755 | Ga0501048_0014833 | 3300049582 | Bacteria | 5762 |
| 756 | Ga0501048_0048615 | 3300049582 | Bacteria | 3025 |
| 757 | Ga0501048_0104759 | 3300049582 | Bacteria | 1996 |
| 758 | Ga0501048_0188044 | 3300049582 | Bacteria | 1463 |
| 759 | Ga0501048_0375718 | 3300049582 | Bacteria | 1014 |
| 760 | Ga0501048_0438464 | 3300049582 | Bacteria | 935 |
| 761 | Ga0501067_0190321 | 3300049583 | Bacteria | 1143 |
| 762 | Ga0501068_0164778 | 3300049584 | Bacteria | 1398 |
| 763 | Ga0501068_0184367 | 3300049584 | Bacteria | 1320 |
| 764 | Ga0501068_0638364 | 3300049584 | Bacteria | 695 |
| 765 | Ga0501069_0473553 | 3300049585 | Bacteria | 746 |
| 766 | Ga0501070_0084737 | 3300049586 | Bacteria | 2624 |
| 767 | Ga0501070_0106934 | 3300049586 | Bacteria | 2312 |
| 768 | Ga0501071_0010244 | 3300049587 | Bacteria | 6275 |
| 769 | Ga0501071_0012935 | 3300049587 | Bacteria | 5676 |
| 770 | Ga0501071_0021458 | 3300049587 | Bacteria | 4497 |
| 771 | Ga0501071_0107154 | 3300049587 | Bacteria | 2063 |
| 772 | Ga0501071_0828565 | 3300049587 | Bacteria | 713 |
| 773 | Ga0501072_0013945 | 3300049588 | Bacteria | 6158 |
| 774 | Ga0501072_0097897 | 3300049588 | Bacteria | 2332 |
| 775 | Ga0501072_0167416 | 3300049588 | Bacteria | 1753 |
| 776 | Ga0501072_0644961 | 3300049588 | Bacteria | 834 |
| 777 | Ga0501073_0103918 | 3300049589 | Bacteria | 1972 |
| 778 | Ga0501073_0406912 | 3300049589 | Bacteria | 940 |
| 779 | Ga0501073_0544964 | 3300049589 | Bacteria | 802 |
| 780 | Ga0501073_0694645 | 3300049589 | Bacteria | 702 |
| 781 | Ga0501074_0011573 | 3300049590 | Bacteria | 6415 |
| 782 | Ga0501074_0047094 | 3300049590 | Bacteria | 3117 |
| 783 | Ga0501074_0218517 | 3300049590 | Unclassified | 1357 |
| 784 | Ga0501074_0263733 | 3300049590 | Unclassified | 1225 |
| 785 | Ga0501074_0333013 | 3300049590 | Bacteria | 1077 |
| 786 | Ga0501075_0029502 | 3300049591 | Unclassified | 4057 |
| 787 | Ga0501075_0153867 | 3300049591 | Bacteria | 1753 |
| 788 | Ga0501075_0188339 | 3300049591 | Bacteria | 1574 |
| 789 | Ga0501075_0242709 | 3300049591 | Bacteria | 1373 |
| 790 | Ga0501075_0258237 | 3300049591 | Unclassified | 1328 |
| 791 | Ga0501075_0310897 | 3300049591 | Unclassified | 1201 |
| 792 | Ga0501075_0476545 | 3300049591 | Bacteria | 952 |
| 793 | Ga0501075_0550522 | 3300049591 | Bacteria | 880 |
| 794 | Ga0501075_1222491 | 3300049591 | Bacteria | 570 |
| 795 | Ga0501076_0003473 | 3300049592 | Bacteria | 11070 |
| 796 | Ga0501076_0004706 | 3300049592 | Bacteria | 9733 |
| 797 | Ga0501076_0184736 | 3300049592 | Bacteria | 1700 |
| 798 | Ga0501076_0897779 | 3300049592 | Unclassified | 731 |
| 799 | Ga0501076_1112967 | 3300049592 | Bacteria | 650 |
| 800 | Ga0501077_0004965 | 3300049593 | Bacteria | 8067 |
| 801 | Ga0501077_0049226 | 3300049593 | Bacteria | 2678 |
| 802 | Ga0501077_0052545 | 3300049593 | Bacteria | 2587 |
| 803 | Ga0501077_0161285 | 3300049593 | Bacteria | 1424 |
| 804 | Ga0501077_0310215 | 3300049593 | Bacteria | 1005 |
| 805 | Ga0501079_0020940 | 3300049741 | Bacteria | 4998 |
| 806 | Ga0501079_0022189 | 3300049741 | Bacteria | 4865 |
| 807 | Ga0501079_0030447 | 3300049741 | Bacteria | 4146 |
| 808 | Ga0501079_0031436 | 3300049741 | Bacteria | 4080 |
| 809 | Ga0501079_0302816 | 3300049741 | Bacteria | 1251 |
| 810 | Ga0501080_0082762 | 3300049742 | Bacteria | 2981 |
| 811 | Ga0501080_0125298 | 3300049742 | Bacteria | 2379 |
| 812 | Ga0501080_0219117 | 3300049742 | Bacteria | 1742 |
| 813 | Ga0501080_0508466 | 3300049742 | Unclassified | 1076 |
| 814 | Ga0501080_1176650 | 3300049742 | Bacteria | 660 |
| 815 | Ga0501081_0043713 | 3300049743 | Unclassified | 3073 |
| 816 | Ga0501081_0073122 | 3300049743 | Bacteria | 2391 |
| 817 | Ga0501081_0197350 | 3300049743 | Bacteria | 1459 |
| 818 | Ga0501081_0212128 | 3300049743 | Bacteria | 1406 |
| 819 | Ga0501081_0345774 | 3300049743 | Bacteria | 1096 |
| 820 | Ga0501081_0459968 | 3300049743 | Bacteria | 946 |
| 821 | Ga0501083_0088034 | 3300049744 | Bacteria | 2053 |
| 822 | Ga0501083_0089291 | 3300049744 | Bacteria | 2037 |
| 823 | Ga0501083_0129533 | 3300049744 | Bacteria | 1654 |
| 824 | Ga0501083_0147188 | 3300049744 | Bacteria | 1542 |
| 825 | Ga0501035_0047839 | 3300049822 | Bacteria | 3838 |
| 826 | Ga0501035_0115542 | 3300049822 | Bacteria | 2349 |
| 827 | Ga0501035_0487358 | 3300049822 | Bacteria | 1016 |
| 828 | Ga0501044_0509502 | 3300049823 | Bacteria | 1104 |
| 829 | Ga0501044_1652779 | 3300049823 | Bacteria | 505 |
| 830 | Ga0501045_0004324 | 3300049824 | Bacteria | 9796 |
| 831 | Ga0501045_0113524 | 3300049824 | Bacteria | 2009 |
| 832 | Ga0501045_0159546 | 3300049824 | Bacteria | 1678 |
| 833 | Ga0501045_0187220 | 3300049824 | Bacteria | 1542 |
| 834 | Ga0501045_0329808 | 3300049824 | Bacteria | 1136 |
| 835 | Ga0501045_0497110 | 3300049824 | Bacteria | 906 |
| 836 | nmdc:mga03n38_1664_c1 | 3300050490 | Bacteria | 6526 |
| 837 | nmdc:mga03n38_8320_c1 | 3300050490 | Bacteria | 3717 |
| 838 | nmdc:mga00v17_124876_c1 | 3300050491 | Bacteria | 1641 |
| 839 | nmdc:mga00v17_71774_c1 | 3300050491 | Bacteria | 2147 |
| 840 | nmdc:mga06z11_110693_c1 | 3300050494 | Bacteria | 1520 |
| 841 | nmdc:mga06z11_169849_c1 | 3300050494 | Bacteria | 1251 |
| 842 | nmdc:mga06z11_189165_c1 | 3300050494 | Bacteria | 1191 |
| 843 | nmdc:mga06z11_557053_c1 | 3300050494 | Bacteria | 696 |
| 844 | nmdc:mga07m45_731886_c1 | 3300050496 | Bacteria | 568 |
| 845 | nmdc:mga07m45_77491_c1 | 3300050496 | Bacteria | 1896 |
| 846 | nmdc:mga05p37_1074544_c1 | 3300050507 | Bacteria | 846 |
| 847 | nmdc:mga05p37_1174251_c1 | 3300050507 | Bacteria | 796 |
| 848 | nmdc:mga05p37_800422_c1 | 3300050507 | Bacteria | 1031 |
| 849 | nmdc:mga05p37_87919_c1 | 3300050507 | Bacteria | 3831 |
| 850 | nmdc:mga09592_386010_c1 | 3300050508 | Bacteria | 1211 |
| 851 | nmdc:mga0qj67_298025_c1 | 3300050509 | Bacteria | 1306 |
| 852 | nmdc:mga06r32_32109_c1 | 3300050510 | Bacteria | 4937 |
| 853 | nmdc:mga08y16_524867_c1 | 3300050511 | Bacteria | 1200 |
| 854 | nmdc:mga08y16_602913_c1 | 3300050511 | Bacteria | 1107 |
| 855 | nmdc:mga0n895_1476786_c1 | 3300050512 | Bacteria | 647 |
| 856 | nmdc:mga0n895_413164_c1 | 3300050512 | Bacteria | 1364 |
| 857 | nmdc:mga0rr50_113655_c1 | 3300050513 | Bacteria | 2146 |
| 858 | nmdc:mga0rr50_354492_c1 | 3300050513 | Bacteria | 1234 |
| 859 | nmdc:mga0a205_119966_c1 | 3300050515 | Bacteria | 2529 |
| 860 | nmdc:mga0a205_16276_c1 | 3300050515 | Bacteria | 6964 |
| 861 | Ga0495655_0001416 | 3300053083 | Bacteria | 3681 |
| 862 | Ga0495595_0008209 | 3300053084 | Bacteria | 4286 |
| 863 | Ga0495619_0002327 | 3300053085 | Bacteria | 12509 |
| 864 | Ga0495619_0843270 | 3300053085 | Bacteria | 618 |
| 865 | Ga0495619_0998459 | 3300053085 | Bacteria | 560 |
| 866 | Ga0500566_0172702 | 3300053094 | Bacteria | 1116 |
| 867 | Ga0501084_0004010 | 3300054114 | Bacteria | 11994 |
| 868 | Ga0501084_0006296 | 3300054114 | Bacteria | 9755 |
| 869 | Ga0501084_0057302 | 3300054114 | Bacteria | 3260 |
| 870 | Ga0501084_0132942 | 3300054114 | Bacteria | 2095 |
| 871 | Ga0501084_0217360 | 3300054114 | Bacteria | 1613 |
| 872 | Ga0501084_0290927 | 3300054114 | Bacteria | 1380 |
| 873 | Ga0501082_0039760 | 3300060353 | Bacteria | 4057 |
| 874 | Ga0501082_0075568 | 3300060353 | Bacteria | 2902 |
| 875 | Ga0501082_0145495 | 3300060353 | Bacteria | 2057 |
| 876 | Ga0501082_0314499 | 3300060353 | Bacteria | 1364 |
| 877 | Ga0501082_0611487 | 3300060353 | Bacteria | 954 |
| 878 | Ga0501082_0741625 | 3300060353 | Bacteria | 860 |
| 879 | Ga0466962_0296005 | 3300061719 | Bacteria | 800 |
| 880 | Ga0530510_0005318 | 3300061734 | Bacteria | 8899 |
| 881 | Ga0530510_0020237 | 3300061734 | Bacteria | 4731 |
| 882 | Ga0530510_0043730 | 3300061734 | Bacteria | 3236 |
| 883 | Ga0530510_0134545 | 3300061734 | Bacteria | 1819 |
| 884 | Ga0530510_0251020 | 3300061734 | Bacteria | 1318 |
| 885 | 2753265128 | 2751185782 | Bacteria | 11227053 |
| 886 | 2831939240 | 2831935698 | Bacteria | 5963223 |
| 887 | 2832010411 | 2832004796 | Bacteria | 6538017 |
| 888 | 2866065398 | 2866065130 | Bacteria | 6518152 |
| 889 | 8055412880 | 8055412473 | Bacteria | 6257500 |
| 890 | 8056064542 | 8056060235 | Bacteria | 7259403 |
| 891 | Ga0501039_0356750 | |||
| 892 | ARSoilOldRDRAFT_c015108 | |||
| 893 | LJQas_1006945 | |||
| 894 | LJQas_1025160 | |||
| 895 | JGI24737J22298_10108869 | |||
| 896 | JGI24737J22298_10114969 | |||
| 897 | JGI24735J21928_10174210 | |||
| 898 | JGI24750J21931_1041447 | |||
| 899 | JGI24738J21930_10058078 | |||
| 900 | JGI24744J21845_10036654 | |||
| 901 | JGI24035J26624_1002156 | |||
| 902 | JGI25406J46586_10000706 | |||
| 903 | JGI25406J46586_10042144 | |||
| 904 | rootL2_10009494 | |||
| 905 | Ga0058860_10009735 | |||
| 906 | Ga0058862_10041721 | |||
| 907 | Ga0065704_10315842 | |||
| 908 | Ga0070658_10376947 | |||
| 909 | Ga0070676_10001066 | |||
| 910 | Ga0070676_10483617 | |||
| 911 | Ga0070683_100007756 | |||
| 912 | Ga0070683_101059987 | |||
| 913 | Ga0070690_100000777 | |||
| 914 | Ga0070690_100459722 | |||
| 915 | Ga0070670_100077709 | |||
| 916 | Ga0068869_100428078 | |||
| 917 | Ga0068869_100620665 | |||
| 918 | Ga0068869_100980973 | |||
| 919 | Ga0070666_10002088 | |||
| 920 | Ga0070666_10013029 | |||
| 921 | Ga0070666_10466538 | |||
| 922 | Ga0070680_100053579 | |||
| 923 | Ga0070682_100008021 | |||
| 924 | Ga0070682_100191862 | |||
| 925 | Ga0068868_100079392 | |||
| 926 | Ga0068868_100205570 | |||
| 927 | Ga0070660_100057712 | |||
| 928 | Ga0070689_100014211 | |||
| 929 | Ga0070689_100109361 | |||
| 930 | Ga0070689_100293363 | |||
| 931 | Ga0070691_10000723 | |||
| 932 | Ga0070691_10102472 | |||
| 933 | Ga0070691_10132552 | |||
| 934 | Ga0070687_100029762 | |||
| 935 | Ga0070661_100002521 | |||
| 936 | Ga0070661_100159674 | |||
| 937 | Ga0070692_10054384 | |||
| 938 | Ga0070692_10232889 | |||
| 939 | Ga0070668_100033029 | |||
| 940 | Ga0070668_100091550 | |||
| 941 | Ga0070668_100101902 | |||
| 942 | Ga0070668_100557337 | |||
| 943 | Ga0070669_100002002 | |||
| 944 | Ga0070669_100247657 | |||
| 945 | Ga0070669_101698926 | |||
| 946 | Ga0070675_100013413 | |||
| 947 | Ga0070671_100002241 | |||
| 948 | Ga0070671_100029097 | |||
| 949 | Ga0070671_100172935 | |||
| 950 | Ga0070674_100027890 | |||
| 951 | Ga0070674_101833843 | |||
| 952 | Ga0070673_100004960 | |||
| 953 | Ga0070688_100004185 | |||
| 954 | Ga0070688_100263940 | |||
| 955 | Ga0070688_100534947 | |||
| 956 | Ga0070659_100002341 | |||
| 957 | Ga0070659_100612419 | |||
| 958 | Ga0070659_100655041 | |||
| 959 | Ga0070667_100004484 | |||
| 960 | Ga0070667_100145144 | |||
| 961 | Ga0070667_100326095 | |||
| 962 | Ga0070709_10017137 | |||
| 963 | Ga0070709_10018674 | |||
| 964 | Ga0070709_10120610 | |||
| 965 | Ga0070709_10821481 | |||
| 966 | Ga0070714_100211493 | |||
| 967 | Ga0070713_100063258 | |||
| 968 | Ga0070713_100186498 | |||
| 969 | Ga0070713_101434501 | |||
| 970 | Ga0070710_10207777 | |||
| 971 | Ga0070710_10435113 | |||
| 972 | Ga0070701_10002468 | |||
| 973 | Ga0070701_10209269 | |||
| 974 | Ga0070701_10224882 | |||
| 975 | Ga0070701_10701998 | |||
| 976 | Ga0070711_100005851 | |||
| 977 | Ga0070711_100345540 | |||
| 978 | Ga0070711_100971566 | |||
| 979 | Ga0070705_100000953 | |||
| 980 | Ga0070705_100034712 | |||
| 981 | Ga0070700_100003255 | |||
| 982 | Ga0070700_100721045 | |||
| 983 | Ga0070694_100081419 | |||
| 984 | Ga0070694_100531951 | |||
| 985 | Ga0070708_101017802 | |||
| 986 | Ga0070663_100002175 | |||
| 987 | Ga0070663_100130725 | |||
| 988 | Ga0070663_100861796 | |||
| 989 | Ga0070678_100001476 | |||
| 990 | Ga0070678_100182608 | |||
| 991 | Ga0070678_100940511 | |||
| 992 | Ga0070662_100002241 | |||
| 993 | Ga0070681_10074252 | |||
| 994 | Ga0070681_10292624 | |||
| 995 | Ga0068867_100025080 | |||
| 996 | Ga0068867_100679641 | |||
| 997 | Ga0068867_100925005 | |||
| 998 | Ga0070685_10095172 | |||
| 999 | Ga0070685_11056448 | |||
| 1000 | Ga0070707_100046218 | |||
| 1001 | Ga0070707_100117663 | |||
| 1002 | Ga0070707_100118028 | |||
| 1003 | Ga0070698_100041373 | |||
| 1004 | Ga0070698_100672394 | |||
| 1005 | Ga0070699_100037382 | |||
| 1006 | Ga0070699_100210228 | |||
| 1007 | Ga0070699_100526345 | |||
| 1008 | Ga0070684_100004076 | |||
| 1009 | Ga0070697_100005667 | |||
| 1010 | Ga0070697_100011810 | |||
| 1011 | Ga0070697_100058318 | |||
| 1012 | Ga0070697_100118918 | |||
| 1013 | Ga0070697_100208842 | |||
| 1014 | Ga0070697_100991578 | |||
| 1015 | Ga0068853_100015634 | |||
| 1016 | Ga0070672_100001482 | |||
| 1017 | Ga0070686_100037021 | |||
| 1018 | Ga0070686_100119898 | |||
| 1019 | Ga0070695_100081342 | |||
| 1020 | Ga0070695_100374998 | |||
| 1021 | Ga0070696_100016390 | |||
| 1022 | Ga0070696_100058130 | |||
| 1023 | Ga0070696_100309548 | |||
| 1024 | Ga0070693_100000537 | |||
| 1025 | Ga0070693_100155288 | |||
| 1026 | Ga0070665_100008176 | |||
| 1027 | Ga0070665_100140343 | |||
| 1028 | Ga0070665_100446474 | |||
| 1029 | Ga0070665_101644757 | |||
| 1030 | Ga0070704_100031051 | |||
| 1031 | Ga0070704_100050389 | |||
| 1032 | Ga0070704_100187376 | |||
| 1033 | Ga0070704_100515601 | |||
| 1034 | Ga0070704_100759549 | |||
| 1035 | Ga0068855_100029568 | |||
| 1036 | Ga0068855_100549720 | |||
| 1037 | Ga0070664_100004165 | |||
| 1038 | Ga0068857_100024971 | |||
| 1039 | Ga0068854_100000726 | |||
| 1040 | Ga0068854_100387045 | |||
| 1041 | Ga0068856_100030395 | |||
| 1042 | Ga0068856_100219268 | |||
| 1043 | Ga0070702_100000778 | |||
| 1044 | Ga0070702_100087126 | |||
| 1045 | Ga0068852_100005119 | |||
| 1046 | Ga0068852_100283518 | |||
| 1047 | Ga0068859_100003323 | |||
| 1048 | Ga0068859_100081132 | |||
| 1049 | Ga0068859_100978400 | |||
| 1050 | Ga0068864_100008263 | |||
| 1051 | Ga0068864_100914735 | |||
| 1052 | Ga0068866_10014394 | |||
| 1053 | Ga0068866_10584265 | |||
| 1054 | Ga0068861_100055834 | |||
| 1055 | Ga0068861_100107599 | |||
| 1056 | Ga0068861_100281767 | |||
| 1057 | Ga0068861_100888082 | |||
| 1058 | Ga0068851_10368695 | |||
| 1059 | Ga0068870_10022113 | |||
| 1060 | Ga0068870_10110574 | |||
| 1061 | Ga0068863_100154312 | |||
| 1062 | Ga0068863_100606972 | |||
| 1063 | Ga0068858_100005508 | |||
| 1064 | Ga0068858_100026659 | |||
| 1065 | Ga0068858_100041820 | |||
| 1066 | Ga0068858_100084744 | |||
| 1067 | Ga0068858_101437190 | |||
| 1068 | Ga0068860_100024050 | |||
| 1069 | Ga0068860_100052733 | |||
| 1070 | Ga0068860_100199588 | |||
| 1071 | Ga0068860_100340906 | |||
| 1072 | Ga0068860_102217292 | |||
| 1073 | Ga0068862_100063678 | |||
| 1074 | Ga0068862_100087457 | |||
| 1075 | Ga0068862_100200293 | |||
| 1076 | Ga0081455_10068043 | |||
| 1077 | Ga0081455_10805742 | |||
| 1078 | Ga0081540_1137050 | |||
| 1079 | Ga0081539_10001105 | |||
| 1080 | Ga0081539_10016410 | |||
| 1081 | Ga0081539_10030693 | |||
| 1082 | Ga0081539_10172782 | |||
| 1083 | Ga0070717_10010249 | |||
| 1084 | Ga0070717_10252915 | |||
| 1085 | Ga0075363_100071779 | |||
| 1086 | Ga0075364_10084886 | |||
| 1087 | Ga0075364_10096349 | |||
| 1088 | Ga0075364_10183980 | |||
| 1089 | Ga0070715_10001621 | |||
| 1090 | Ga0070715_10091691 | |||
| 1091 | Ga0070715_10147947 | |||
| 1092 | Ga0070716_100017459 | |||
| 1093 | Ga0070716_100034194 | |||
| 1094 | Ga0070716_100039670 | |||
| 1095 | Ga0070716_100882243 | |||
| 1096 | Ga0070712_100001629 | |||
| 1097 | Ga0070712_100050086 | |||
| 1098 | Ga0070712_100728590 | |||
| 1099 | Ga0070712_100791773 | |||
| 1100 | Ga0070712_100804222 | |||
| 1101 | Ga0070712_101040904 | |||
| 1102 | Ga0075367_10208597 | |||
| 1103 | Ga0075367_10278731 | |||
| 1104 | Ga0075367_10466930 | |||
| 1105 | Ga0097621_100267647 | |||
| 1106 | Ga0097621_100881104 | |||
| 1107 | Ga0075370_10117162 | |||
| 1108 | Ga0075370_10421557 | |||
| 1109 | Ga0068871_100045272 | |||
| 1110 | Ga0068871_100106281 | |||
| 1111 | Ga0068871_100612252 | |||
| 1112 | Ga0068871_100988743 | |||
| 1113 | Ga0075428_100266022 | |||
| 1114 | Ga0075428_100318125 | |||
| 1115 | Ga0075428_100451700 | |||
| 1116 | Ga0075428_101854167 | |||
| 1117 | Ga0075430_100003402 | |||
| 1118 | Ga0075431_100020686 | |||
| 1119 | Ga0075433_10211783 | |||
| 1120 | Ga0075433_10564702 | |||
| 1121 | Ga0075434_100203910 | |||
| 1122 | Ga0075434_101438472 | |||
| 1123 | Ga0075434_101771112 | |||
| 1124 | Ga0075429_100111367 | |||
| 1125 | Ga0068865_100002602 | |||
| 1126 | Ga0068865_100065904 | |||
| 1127 | Ga0068865_100927027 | |||
| 1128 | Ga0075436_100034677 | |||
| 1129 | Ga0097620_100003323 | |||
| 1130 | Ga0097620_100081132 | |||
| 1131 | Ga0097620_100978561 | |||
| 1132 | Ga0075435_100240239 | |||
| 1133 | Ga0105250_10016328 | |||
| 1134 | Ga0105240_10052290 | |||
| 1135 | Ga0111539_10328068 | |||
| 1136 | Ga0111539_10627301 | |||
| 1137 | Ga0111539_10823756 | |||
| 1138 | Ga0105245_10002949 | |||
| 1139 | Ga0105245_10012595 | |||
| 1140 | Ga0105245_10367057 | |||
| 1141 | Ga0105245_10872240 | |||
| 1142 | Ga0105245_11316582 | |||
| 1143 | Ga0105247_10006205 | |||
| 1144 | Ga0105247_10011889 | |||
| 1145 | Ga0105247_10146652 | |||
| 1146 | Ga0105247_10235540 | |||
| 1147 | Ga0105247_10955780 | |||
| 1148 | Ga0114129_10669990 | |||
| 1149 | Ga0114129_11321763 | |||
| 1150 | Ga0114129_11391393 | |||
| 1151 | Ga0105243_10001793 | |||
| 1152 | Ga0105243_10139409 | |||
| 1153 | Ga0105243_10168054 | |||
| 1154 | Ga0105243_11490012 | |||
| 1155 | Ga0105243_11574912 | |||
| 1156 | Ga0105243_11774947 | |||
| 1157 | Ga0105241_10025245 | |||
| 1158 | Ga0105241_10469059 | |||
| 1159 | Ga0105241_11525019 | |||
| 1160 | Ga0105242_10010633 | |||
| 1161 | Ga0105242_10014227 | |||
| 1162 | Ga0105242_10850121 | |||
| 1163 | Ga0105248_10089951 | |||
| 1164 | Ga0105248_10118190 | |||
| 1165 | Ga0105248_10645382 | |||
| 1166 | Ga0105248_11849909 | |||
| 1167 | Ga0105237_10008490 | |||
| 1168 | Ga0105237_11268936 | |||
| 1169 | Ga0105238_10368676 | |||
| 1170 | Ga0105238_10738217 | |||
| 1171 | Ga0105238_11334603 | |||
| 1172 | Ga0105238_11660148 | |||
| 1173 | Ga0105249_10002808 | |||
| 1174 | Ga0105249_10021712 | |||
| 1175 | Ga0105249_10214482 | |||
| 1176 | Ga0105249_10335721 | |||
| 1177 | Ga0105249_10740563 | |||
| 1178 | Ga0105249_12562011 | |||
| 1179 | Ga0105239_10075472 | |||
| 1180 | Ga0105239_10275933 | |||
| 1181 | Ga0105246_10006704 | |||
| 1182 | Ga0105246_10120725 | |||
| 1183 | Ga0105246_10211919 | |||
| 1184 | Ga0105246_11958924 | |||
| 1185 | Ga0157373_10017570 | |||
| 1186 | Ga0157371_10003182 | |||
| 1187 | Ga0157370_10014817 | |||
| 1188 | Ga0157369_10012918 | |||
| 1189 | Ga0157374_10000023 | |||
| 1190 | Ga0157374_10024865 | |||
| 1191 | Ga0157374_10302203 | |||
| 1192 | Ga0157378_10012911 | |||
| 1193 | Ga0157378_10025102 | |||
| 1194 | Ga0157378_10073867 | |||
| 1195 | Ga0157378_10343225 | |||
| 1196 | Ga0157378_10464193 | |||
| 1197 | Ga0157378_10598529 | |||
| 1198 | Ga0157378_11036120 | |||
| 1199 | Ga0163162_10070193 | |||
| 1200 | Ga0163162_10292876 | |||
| 1201 | Ga0163162_10986037 | |||
| 1202 | Ga0163162_11278391 | |||
| 1203 | Ga0157372_10014732 | |||
| 1204 | Ga0157372_10742299 | |||
| 1205 | Ga0157375_10003246 | |||
| 1206 | Ga0157375_10013731 | |||
| 1207 | Ga0157375_10027983 | |||
| 1208 | Ga0157375_10595996 | |||
| 1209 | Ga0157375_10692509 | |||
| 1210 | Ga0157375_11695706 | |||
| 1211 | Ga0157375_11871509 | |||
| 1212 | Ga0163163_10167506 | |||
| 1213 | Ga0163163_10320951 | |||
| 1214 | Ga0163163_10325482 | |||
| 1215 | Ga0163163_10328159 | |||
| 1216 | Ga0157380_10001996 | |||
| 1217 | Ga0157380_10024730 | |||
| 1218 | Ga0157380_10368874 | |||
| 1219 | Ga0157380_10888541 | |||
| 1220 | Ga0157380_12375439 | |||
| 1221 | Ga0182008_10017704 | |||
| 1222 | Ga0157377_10003789 | |||
| 1223 | Ga0157377_10572144 | |||
| 1224 | Ga0157379_10014653 | |||
| 1225 | Ga0157379_10034184 | |||
| 1226 | Ga0157379_10058706 | |||
| 1227 | Ga0157376_10010944 | |||
| 1228 | Ga0157376_10037343 | |||
| 1229 | Ga0157376_10374486 | |||
| 1230 | Ga0157376_11080734 | |||
| 1231 | Ga0163161_10003417 | |||
| 1232 | Ga0163161_10028783 | |||
| 1233 | Ga0163161_10564947 | |||
| 1234 | Ga0163161_10636765 | |||
| 1235 | Ga0163161_10806718 | |||
| 1236 | Ga0206356_11601678 | |||
| 1237 | Ga0206354_10326588 | |||
| 1238 | Ga0206353_11478257 | |||
| 1239 | Ga0213876_10005718 | |||
| 1240 | Ga0213876_10459708 | |||
| 1241 | Ga0207697_10342099 | |||
| 1242 | Ga0207656_10237813 | |||
| 1243 | Ga0207692_10002916 | |||
| 1244 | Ga0207642_10050465 | |||
| 1245 | Ga0207642_10059024 | |||
| 1246 | Ga0207710_10004861 | |||
| 1247 | Ga0207710_10006413 | |||
| 1248 | Ga0207710_10168278 | |||
| 1249 | Ga0207688_10012337 | |||
| 1250 | Ga0207688_10476638 | |||
| 1251 | Ga0207680_10193984 | |||
| 1252 | Ga0207680_10550905 | |||
| 1253 | Ga0207647_10042219 | |||
| 1254 | Ga0207647_10482866 | |||
| 1255 | Ga0207647_10507206 | |||
| 1256 | Ga0207685_10010359 | |||
| 1257 | Ga0207685_10183590 | |||
| 1258 | Ga0207699_10024036 | |||
| 1259 | Ga0207645_10011279 | |||
| 1260 | Ga0207643_10286231 | |||
| 1261 | Ga0207705_10253353 | |||
| 1262 | Ga0207654_10044226 | |||
| 1263 | Ga0207654_10104401 | |||
| 1264 | Ga0207654_10683589 | |||
| 1265 | Ga0207707_10141953 | |||
| 1266 | Ga0207707_10373058 | |||
| 1267 | Ga0207695_10099556 | |||
| 1268 | Ga0207671_10078480 | |||
| 1269 | Ga0207693_10002134 | |||
| 1270 | Ga0207693_10028377 | |||
| 1271 | Ga0207693_10304651 | |||
| 1272 | Ga0207693_10596580 | |||
| 1273 | Ga0207693_10762160 | |||
| 1274 | Ga0207663_10010044 | |||
| 1275 | Ga0207663_10041733 | |||
| 1276 | Ga0207660_10016953 | |||
| 1277 | Ga0207662_10002384 | |||
| 1278 | Ga0207662_10574292 | |||
| 1279 | Ga0207657_10003901 | |||
| 1280 | Ga0207657_10336508 | |||
| 1281 | Ga0207649_10135154 | |||
| 1282 | Ga0207649_10185837 | |||
| 1283 | Ga0207646_10008729 | |||
| 1284 | Ga0207681_10081385 | |||
| 1285 | Ga0207681_11429106 | |||
| 1286 | Ga0207650_10082584 | |||
| 1287 | Ga0207687_10011259 | |||
| 1288 | Ga0207687_10201856 | |||
| 1289 | Ga0207700_10030016 | |||
| 1290 | Ga0207664_10945661 | |||
| 1291 | Ga0207644_10013578 | |||
| 1292 | Ga0207644_10150127 | |||
| 1293 | Ga0207644_10168317 | |||
| 1294 | Ga0207706_10001951 | |||
| 1295 | Ga0207706_10031406 | |||
| 1296 | Ga0207706_10107221 | |||
| 1297 | Ga0207686_10040030 | |||
| 1298 | Ga0207709_10046211 | |||
| 1299 | Ga0207709_11070263 | |||
| 1300 | Ga0207670_10010766 | |||
| 1301 | Ga0207670_10287453 | |||
| 1302 | Ga0207670_10940782 | |||
| 1303 | Ga0207669_10009103 | |||
| 1304 | Ga0207669_10143757 | |||
| 1305 | Ga0207704_10147067 | |||
| 1306 | Ga0207704_10194389 | |||
| 1307 | Ga0207704_10730297 | |||
| 1308 | Ga0207665_10010692 | |||
| 1309 | Ga0207665_10056512 | |||
| 1310 | Ga0207691_10003871 | |||
| 1311 | Ga0207711_10067882 | |||
| 1312 | Ga0207711_10258303 | |||
| 1313 | Ga0207711_10458547 | |||
| 1314 | Ga0207689_10427275 | |||
| 1315 | Ga0207661_11233706 | |||
| 1316 | Ga0207667_10162030 | |||
| 1317 | Ga0207651_10011209 | |||
| 1318 | Ga0207651_10249006 | |||
| 1319 | Ga0207712_10055423 | |||
| 1320 | Ga0207712_10059335 | |||
| 1321 | Ga0207668_10016295 | |||
| 1322 | Ga0207668_10174511 | |||
| 1323 | Ga0207640_10014312 | |||
| 1324 | Ga0207640_10042677 | |||
| 1325 | Ga0207640_11537970 | |||
| 1326 | Ga0207658_10040184 | |||
| 1327 | Ga0207677_10141753 | |||
| 1328 | Ga0207677_10669700 | |||
| 1329 | Ga0207703_10031732 | |||
| 1330 | Ga0207703_10161891 | |||
| 1331 | Ga0207703_10192389 | |||
| 1332 | Ga0207703_10511556 | |||
| 1333 | Ga0207703_10654048 | |||
| 1334 | Ga0207703_12086675 | |||
| 1335 | Ga0207639_11384694 | |||
| 1336 | Ga0207678_10002768 | |||
| 1337 | Ga0207678_10186238 | |||
| 1338 | Ga0207678_10756640 | |||
| 1339 | Ga0207708_10002790 | |||
| 1340 | Ga0207708_10050754 | |||
| 1341 | Ga0207708_10235913 | |||
| 1342 | Ga0207702_10053403 | |||
| 1343 | Ga0207702_10449297 | |||
| 1344 | Ga0207641_10045450 | |||
| 1345 | Ga0207641_11419190 | |||
| 1346 | Ga0207648_10006819 | |||
| 1347 | Ga0207648_10194263 | |||
| 1348 | Ga0207648_10234355 | |||
| 1349 | Ga0207676_10047493 | |||
| 1350 | Ga0207674_10009360 | |||
| 1351 | Ga0207675_100020221 | |||
| 1352 | Ga0207675_100090578 | |||
| 1353 | Ga0207675_100293099 | |||
| 1354 | Ga0207675_100653709 | |||
| 1355 | Ga0207675_100790412 | |||
| 1356 | Ga0207675_101508726 | |||
| 1357 | Ga0207675_101616005 | |||
| 1358 | Ga0207683_10002293 | |||
| 1359 | Ga0207683_10150509 | |||
| 1360 | Ga0207683_10200415 | |||
| 1361 | Ga0207683_10720540 | |||
| 1362 | Ga0207698_10159585 | |||
| 1363 | Ga0207698_10593227 | |||
| 1364 | Ga0209970_1006642 | |||
| 1365 | Ga0209971_1002817 | |||
| 1366 | Ga0209974_10009773 | |||
| 1367 | Ga0268266_10362980 | |||
| 1368 | Ga0268266_10594924 | |||
| 1369 | Ga0268265_10098020 | |||
| 1370 | Ga0268265_10172630 | |||
| 1371 | Ga0268264_10003129 | |||
| 1372 | Ga0268264_10017032 | |||
| 1373 | Ga0268264_10260694 | |||
| 1374 | Ga0268264_10392093 | |||
| 1375 | Ga0268264_10479594 | |||
| 1376 | Ga0265338_10180818 | |||
| 1377 | Ga0265339_10132081 | |||
| 1378 | Ga0307406_10490238 | |||
| 1379 | Ga0307416_100343355 | |||
| 1380 | Ga0307415_100147821 | |||
| 1381 | Ga0307415_100732655 | |||
| 1382 | Ga0373928_0044102 | |||
| 1383 | Ga0373949_0048767 | |||
| 1384 | Ga0373952_0028704 | |||
| 1385 | Ga0373939_0075100 | |||
| 1386 | Ga0373954_0257842 | |||
| 1387 | Ga0373956_0119138 | |||
| 1388 | Ga0373957_0406174 | |||
| 1389 | Ga0373960_0083955 | |||
| 1390 | Ga0373943_0056285 | |||
| 1391 | Ga0373942_0007904 | |||
| 1392 | Ga0373961_0048768 | |||
| 1393 | Ga0373931_0021457 | |||
| 1394 | Ga0373931_0229344 | |||
| 1395 | Ga0373931_0469578 | |||
| 1396 | Ga0373931_0678286 | |||
| 1397 | Ga0373927_0010886 | |||
| 1398 | Ga0373947_0012884 | |||
| 1399 | Ga0373947_0152394 | |||
| 1400 | Ga0373947_0458579 | |||
| 1401 | Ga0373937_0251318 | |||
| 1402 | Ga0373937_0282057 | |||
| 1403 | Ga0373937_0438247 | |||
| 1404 | Ga0316582_0518310 | |||
| 1405 | Ga0373925_0174885 | |||
| 1406 | Ga0395899_0021775 | |||
| 1407 | Ga0395899_0377524 | |||
| 1408 | Ga0395900_0012733 | |||
| 1409 | Ga0395900_0025557 | |||
| 1410 | Ga0395898_0033197 | |||
| 1411 | Ga0395898_0042371 | |||
| 1412 | Ga0395905_0004262 | |||
| 1413 | Ga0395905_0006144 | |||
| 1414 | Ga0436364_1031932 | |||
| 1415 | Ga0395901_0003803 | |||
| 1416 | Ga0395901_0028011 | |||
| 1417 | Ga0400483_075551 | |||
| 1418 | Ga0436365_0245712 | |||
| 1419 | Ga0436365_0883975 | |||
| 1420 | Ga0436365_1600768 | |||
| 1421 | Ga0436360_0125292 | |||
| 1422 | Ga0436362_1007980 | |||
| 1423 | Ga0436362_1269541 | |||
| 1424 | Ga0451804_0573469 | |||
| 1425 | Ga0451807_1087109 | |||
| 1426 | Ga0451833_1169028 | |||
| 1427 | Ga0439434_0072263 | |||
| 1428 | Ga0451577_0051380 | |||
| 1429 | Ga0451577_1014590 | |||
| 1430 | Ga0466969_0077225 | |||
| 1431 | Ga0453683_0095122 | |||
| 1432 | Ga0453683_0251566 | |||
| 1433 | Ga0453683_0381740 | |||
| 1434 | Ga0466965_0222587 | |||
| 1435 | Ga0466961_0022490 | |||
| 1436 | Ga0466961_0260144 | |||
| 1437 | Ga0466961_0411574 | |||
| 1438 | Ga0466963_0148501 | |||
| 1439 | Ga0466963_0422093 | |||
| 1440 | Ga0466971_0317212 | |||
| 1441 | Ga0466968_0124962 | |||
| 1442 | Ga0466957_1088381 | |||
| 1443 | Ga0466960_0333023 | |||
| 1444 | Ga0466959_0476059 | |||
| 1445 | Ga0451576_0006869 | |||
| 1446 | Ga0451576_0098809 | |||
| 1447 | Ga0451576_0180746 | |||
| 1448 | Ga0466958_0076727 | |||
| 1449 | Ga0466967_0006868 | |||
| 1450 | Ga0466967_0032004 | |||
| 1451 | Ga0466967_0150335 | |||
| 1452 | Ga0466967_0281399 | |||
| 1453 | Ga0466967_1659015 | |||
| 1454 | Ga0495592_0358687 | |||
| 1455 | Ga0495592_0847511 | |||
| 1456 | Ga0495603_0001217 | |||
| 1457 | Ga0495603_0208751 | |||
| 1458 | Ga0495629_0000385 | |||
| 1459 | Ga0495629_0040413 | |||
| 1460 | Ga0495641_0011833 | |||
| 1461 | Ga0495641_0213351 | |||
| 1462 | Ga0495653_0070000 | |||
| 1463 | Ga0495653_0347314 | |||
| 1464 | Ga0495580_0003243 | |||
| 1465 | Ga0495582_0012588 | |||
| 1466 | Ga0495582_0231782 | |||
| 1467 | Ga0495639_0015635 | |||
| 1468 | Ga0495639_0020577 | |||
| 1469 | Ga0495662_0130643 | |||
| 1470 | Ga0495584_0099747 | |||
| 1471 | Ga0495594_0000204 | |||
| 1472 | Ga0495618_0432296 | |||
| 1473 | Ga0495630_0054601 | |||
| 1474 | Ga0495630_0057709 | |||
| 1475 | Ga0495630_0546543 | |||
| 1476 | Ga0495644_0019894 | |||
| 1477 | Ga0495644_0264855 | |||
| 1478 | Ga0495663_0048731 | |||
| 1479 | Ga0495666_0101735 | |||
| 1480 | Ga0495665_0003791 | |||
| 1481 | Ga0495640_0041878 | |||
| 1482 | Ga0495586_0031779 | |||
| 1483 | Ga0495622_0001090 | |||
| 1484 | Ga0495633_0117197 | |||
| 1485 | Ga0495667_0186509 | |||
| 1486 | Ga0495656_0673431 | |||
| 1487 | Ga0495668_0381449 | |||
| 1488 | Ga0495668_0581771 | |||
| 1489 | Ga0495634_0004946 | |||
| 1490 | Ga0495588_0006678 | |||
| 1491 | Ga0495657_0028026 | |||
| 1492 | Ga0495599_0180423 | |||
| 1493 | Ga0495623_0171296 | |||
| 1494 | Ga0495646_0189315 | |||
| 1495 | Ga0495647_0064193 | |||
| 1496 | Ga0495647_0079194 | |||
| 1497 | Ga0495658_0003653 | |||
| 1498 | Ga0495658_0466992 | |||
| 1499 | Ga0495613_0005090 | |||
| 1500 | Ga0495613_0019028 | |||
| 1501 | Ga0495613_0143372 | |||
| 1502 | Ga0495624_0382828 | |||
| 1503 | Ga0495671_0312475 | |||
| 1504 | Ga0495581_0018699 | |||
| 1505 | Ga0495604_0340138 | |||
| 1506 | Ga0495636_0114924 | |||
| 1507 | Ga0495674_0737133 | |||
| 1508 | Ga0495676_0183936 | |||
| 1509 | Ga0495676_0356667 | |||
| 1510 | Ga0495680_0185045 | |||
| 1511 | Ga0495680_0434752 | |||
| 1512 | Ga0495593_0007946 | |||
| 1513 | Ga0495602_0603344 | |||
| 1514 | Ga0495614_0003051 | |||
| 1515 | Ga0495614_0105125 | |||
| 1516 | Ga0496100_0009464 | |||
| 1517 | Ga0496100_0020781 | |||
| 1518 | Ga0496100_0296700 | |||
| 1519 | Ga0496100_0400155 | |||
| 1520 | Ga0496100_0422900 | |||
| 1521 | Ga0496101_0007069 | |||
| 1522 | Ga0496101_0013491 | |||
| 1523 | Ga0496101_0024354 | |||
| 1524 | Ga0496101_0125839 | |||
| 1525 | Ga0496102_0012774 | |||
| 1526 | Ga0496102_0084178 | |||
| 1527 | Ga0496102_0109013 | |||
| 1528 | Ga0496102_0258037 | |||
| 1529 | Ga0496102_0564784 | |||
| 1530 | Ga0496102_1134853 | |||
| 1531 | Ga0496102_1502026 | |||
| 1532 | Ga0496103_0009946 | |||
| 1533 | Ga0496103_0072143 | |||
| 1534 | Ga0496103_0550342 | |||
| 1535 | Ga0496104_0006146 | |||
| 1536 | Ga0496104_0042281 | |||
| 1537 | Ga0496104_0058033 | |||
| 1538 | Ga0496104_0161276 | |||
| 1539 | Ga0496105_0002967 | |||
| 1540 | Ga0496105_0021506 | |||
| 1541 | Ga0496105_0065103 | |||
| 1542 | Ga0496105_0519165 | |||
| 1543 | Ga0496106_0012257 | |||
| 1544 | Ga0496106_0063506 | |||
| 1545 | Ga0496106_0688150 | |||
| 1546 | Ga0496107_0002150 | |||
| 1547 | Ga0496107_0002685 | |||
| 1548 | Ga0496107_0083705 | |||
| 1549 | Ga0496107_0095375 | |||
| 1550 | Ga0496107_0277670 | |||
| 1551 | Ga0496108_0012508 | |||
| 1552 | Ga0496108_0021677 | |||
| 1553 | Ga0496108_0036232 | |||
| 1554 | Ga0496108_0204747 | |||
| 1555 | Ga0496108_0274780 | |||
| 1556 | Ga0496108_0278771 | |||
| 1557 | Ga0496108_0495547 | |||
| 1558 | Ga0496109_0067830 | |||
| 1559 | Ga0496109_0132020 | |||
| 1560 | Ga0496109_0273295 | |||
| 1561 | Ga0496109_0353020 | |||
| 1562 | Ga0496109_0370538 | |||
| 1563 | Ga0496109_0879594 | |||
| 1564 | Ga0496110_0008754 | |||
| 1565 | Ga0496110_0057106 | |||
| 1566 | Ga0496110_0124347 | |||
| 1567 | Ga0496110_0135054 | |||
| 1568 | Ga0496110_0222570 | |||
| 1569 | Ga0496110_0721864 | |||
| 1570 | Ga0496110_1574027 | |||
| 1571 | Ga0496111_0022322 | |||
| 1572 | Ga0496111_0027488 | |||
| 1573 | Ga0496111_0043897 | |||
| 1574 | Ga0496111_0600537 | |||
| 1575 | Ga0496112_0073122 | |||
| 1576 | Ga0496112_0084190 | |||
| 1577 | Ga0496112_0168698 | |||
| 1578 | Ga0496112_0229749 | |||
| 1579 | Ga0496112_0231833 | |||
| 1580 | Ga0496113_0020616 | |||
| 1581 | Ga0496113_0094527 | |||
| 1582 | Ga0496113_0168704 | |||
| 1583 | Ga0496113_0177987 | |||
| 1584 | Ga0496113_0690143 | |||
| 1585 | Ga0496113_0751984 | |||
| 1586 | Ga0496114_0022712 | |||
| 1587 | Ga0496114_0036032 | |||
| 1588 | Ga0496114_0131244 | |||
| 1589 | Ga0496114_0199059 | |||
| 1590 | Ga0496114_0254701 | |||
| 1591 | Ga0496114_0859252 | |||
| 1592 | Ga0496115_0011411 | |||
| 1593 | Ga0496115_0049700 | |||
| 1594 | Ga0496115_0134096 | |||
| 1595 | Ga0496126_0254603 | |||
| 1596 | Ga0501031_0031225 | |||
| 1597 | Ga0501031_0088824 | |||
| 1598 | Ga0501031_0095987 | |||
| 1599 | Ga0501031_0236894 | |||
| 1600 | Ga0501031_0249503 | |||
| 1601 | Ga0501031_0275221 | |||
| 1602 | Ga0501032_0101602 | |||
| 1603 | Ga0501033_0322253 | |||
| 1604 | Ga0501034_0349187 | |||
| 1605 | Ga0501034_0453683 | |||
| 1606 | Ga0501034_0734413 | |||
| 1607 | Ga0501036_0012638 | |||
| 1608 | Ga0501036_0026101 | |||
| 1609 | Ga0501036_0200297 | |||
| 1610 | Ga0501036_1053926 | |||
| 1611 | Ga0501037_0077159 | |||
| 1612 | Ga0501037_0109582 | |||
| 1613 | Ga0501038_0041329 | |||
| 1614 | Ga0501038_0122882 | |||
| 1615 | Ga0501038_0160972 | |||
| 1616 | Ga0501039_0034461 | |||
| 1617 | Ga0501039_0091458 | |||
| 1618 | Ga0501039_0095357 | |||
| 1619 | Ga0501039_0868305 | |||
| 1620 | Ga0501040_0006274 | |||
| 1621 | Ga0501040_0015203 | |||
| 1622 | Ga0501040_0015226 | |||
| 1623 | Ga0501040_0071196 | |||
| 1624 | Ga0501040_0884478 | |||
| 1625 | Ga0501041_0042343 | |||
| 1626 | Ga0501041_0075837 | |||
| 1627 | Ga0501041_0083757 | |||
| 1628 | Ga0501041_0323098 | |||
| 1629 | Ga0501042_0010879 | |||
| 1630 | Ga0501042_0024981 | |||
| 1631 | Ga0501042_0047288 | |||
| 1632 | Ga0501042_0058236 | |||
| 1633 | Ga0501042_0510206 | |||
| 1634 | Ga0501042_1287336 | |||
| 1635 | Ga0501043_0081391 | |||
| 1636 | Ga0501043_0104021 | |||
| 1637 | Ga0501043_0157941 | |||
| 1638 | Ga0501043_0381695 | |||
| 1639 | Ga0501046_0003267 | |||
| 1640 | Ga0501046_0030177 | |||
| 1641 | Ga0501046_0104556 | |||
| 1642 | Ga0501046_0131010 | |||
| 1643 | Ga0501046_0645047 | |||
| 1644 | Ga0501047_0037381 | |||
| 1645 | Ga0501048_0014833 | |||
| 1646 | Ga0501048_0048615 | |||
| 1647 | Ga0501048_0104759 | |||
| 1648 | Ga0501048_0188044 | |||
| 1649 | Ga0501048_0375718 | |||
| 1650 | Ga0501048_0438464 | |||
| 1651 | Ga0501067_0190321 | |||
| 1652 | Ga0501068_0164778 | |||
| 1653 | Ga0501068_0184367 | |||
| 1654 | Ga0501068_0638364 | |||
| 1655 | Ga0501069_0473553 | |||
| 1656 | Ga0501070_0084737 | |||
| 1657 | Ga0501070_0106934 | |||
| 1658 | Ga0501071_0010244 | |||
| 1659 | Ga0501071_0012935 | |||
| 1660 | Ga0501071_0021458 | |||
| 1661 | Ga0501071_0107154 | |||
| 1662 | Ga0501071_0828565 | |||
| 1663 | Ga0501072_0013945 | |||
| 1664 | Ga0501072_0097897 | |||
| 1665 | Ga0501072_0167416 | |||
| 1666 | Ga0501072_0644961 | |||
| 1667 | Ga0501073_0103918 | |||
| 1668 | Ga0501073_0406912 | |||
| 1669 | Ga0501073_0544964 | |||
| 1670 | Ga0501073_0694645 | |||
| 1671 | Ga0501074_0011573 | |||
| 1672 | Ga0501074_0047094 | |||
| 1673 | Ga0501074_0218517 | |||
| 1674 | Ga0501074_0263733 | |||
| 1675 | Ga0501074_0333013 | |||
| 1676 | Ga0501075_0029502 | |||
| 1677 | Ga0501075_0153867 | |||
| 1678 | Ga0501075_0188339 | |||
| 1679 | Ga0501075_0242709 | |||
| 1680 | Ga0501075_0258237 | |||
| 1681 | Ga0501075_0310897 | |||
| 1682 | Ga0501075_0476545 | |||
| 1683 | Ga0501075_0550522 | |||
| 1684 | Ga0501075_1222491 | |||
| 1685 | Ga0501076_0003473 | |||
| 1686 | Ga0501076_0004706 | |||
| 1687 | Ga0501076_0184736 | |||
| 1688 | Ga0501076_0897779 | |||
| 1689 | Ga0501076_1112967 | |||
| 1690 | Ga0501077_0004965 | |||
| 1691 | Ga0501077_0049226 | |||
| 1692 | Ga0501077_0052545 | |||
| 1693 | Ga0501077_0161285 | |||
| 1694 | Ga0501077_0310215 | |||
| 1695 | Ga0501079_0020940 | |||
| 1696 | Ga0501079_0022189 | |||
| 1697 | Ga0501079_0030447 | |||
| 1698 | Ga0501079_0031436 | |||
| 1699 | Ga0501079_0302816 | |||
| 1700 | Ga0501080_0082762 | |||
| 1701 | Ga0501080_0125298 | |||
| 1702 | Ga0501080_0219117 | |||
| 1703 | Ga0501080_0508466 | |||
| 1704 | Ga0501080_1176650 | |||
| 1705 | Ga0501081_0043713 | |||
| 1706 | Ga0501081_0073122 | |||
| 1707 | Ga0501081_0197350 | |||
| 1708 | Ga0501081_0212128 | |||
| 1709 | Ga0501081_0345774 | |||
| 1710 | Ga0501081_0459968 | |||
| 1711 | Ga0501083_0088034 | |||
| 1712 | Ga0501083_0089291 | |||
| 1713 | Ga0501083_0129533 | |||
| 1714 | Ga0501083_0147188 | |||
| 1715 | Ga0501035_0047839 | |||
| 1716 | Ga0501035_0115542 | |||
| 1717 | Ga0501035_0487358 | |||
| 1718 | Ga0501044_0509502 | |||
| 1719 | Ga0501044_1652779 | |||
| 1720 | Ga0501045_0004324 | |||
| 1721 | Ga0501045_0113524 | |||
| 1722 | Ga0501045_0159546 | |||
| 1723 | Ga0501045_0187220 | |||
| 1724 | Ga0501045_0329808 | |||
| 1725 | Ga0501045_0497110 | |||
| 1726 | nmdc:mga03n38_1664_c1 | |||
| 1727 | nmdc:mga03n38_8320_c1 | |||
| 1728 | nmdc:mga00v17_124876_c1 | |||
| 1729 | nmdc:mga00v17_71774_c1 | |||
| 1730 | nmdc:mga06z11_110693_c1 | |||
| 1731 | nmdc:mga06z11_169849_c1 | |||
| 1732 | nmdc:mga06z11_189165_c1 | |||
| 1733 | nmdc:mga06z11_557053_c1 | |||
| 1734 | nmdc:mga07m45_731886_c1 | |||
| 1735 | nmdc:mga07m45_77491_c1 | |||
| 1736 | nmdc:mga05p37_1074544_c1 | |||
| 1737 | nmdc:mga05p37_1174251_c1 | |||
| 1738 | nmdc:mga05p37_800422_c1 | |||
| 1739 | nmdc:mga05p37_87919_c1 | |||
| 1740 | nmdc:mga09592_386010_c1 | |||
| 1741 | nmdc:mga0qj67_298025_c1 | |||
| 1742 | nmdc:mga06r32_32109_c1 | |||
| 1743 | nmdc:mga08y16_524867_c1 | |||
| 1744 | nmdc:mga08y16_602913_c1 | |||
| 1745 | nmdc:mga0n895_1476786_c1 | |||
| 1746 | nmdc:mga0n895_413164_c1 | |||
| 1747 | nmdc:mga0rr50_113655_c1 | |||
| 1748 | nmdc:mga0rr50_354492_c1 | |||
| 1749 | nmdc:mga0a205_119966_c1 | |||
| 1750 | nmdc:mga0a205_16276_c1 | |||
| 1751 | Ga0495655_0001416 | |||
| 1752 | Ga0495595_0008209 | |||
| 1753 | Ga0495619_0002327 | |||
| 1754 | Ga0495619_0843270 | |||
| 1755 | Ga0495619_0998459 | |||
| 1756 | Ga0500566_0172702 | |||
| 1757 | Ga0501084_0004010 | |||
| 1758 | Ga0501084_0006296 | |||
| 1759 | Ga0501084_0057302 | |||
| 1760 | Ga0501084_0132942 | |||
| 1761 | Ga0501084_0217360 | |||
| 1762 | Ga0501084_0290927 | |||
| 1763 | Ga0501082_0039760 | |||
| 1764 | Ga0501082_0075568 | |||
| 1765 | Ga0501082_0145495 | |||
| 1766 | Ga0501082_0314499 | |||
| 1767 | Ga0501082_0611487 | |||
| 1768 | Ga0501082_0741625 | |||
| 1769 | Ga0466962_0296005 | |||
| 1770 | Ga0530510_0005318 | |||
| 1771 | Ga0530510_0020237 | |||
| 1772 | Ga0530510_0043730 | |||
| 1773 | Ga0530510_0134545 | |||
| 1774 | Ga0530510_0251020 | |||
| 1775 | 2753265128 | |||
| 1776 | 2831939240 | |||
| 1777 | 2832010411 | |||
| 1778 | 2866065398 | |||
| 1779 | 8055412880 | |||
| 1780 | 8056064542 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.9062 | 3 | 161 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.9034 | 1 | 161 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8906 | 3 | 161 |
| 1lxn-assembly1.cif.gz_A | x-ray structure of mth1187 northeast structural genomics consortium target tt272 | 0.6821 | 103 | 161 |
| 2y9j-assembly1.cif.gz_Y | three-dimensional model of salmonella's needle complex at subnanometer resolution | 0.6756 | 99 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1in0B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9856 | 99 | 161 | 3.30.70.860 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9164 | 9 | 98 | 3.30.70.990 |
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.913 | 9 | 93 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9069 | 9 | 98 | 3.30.70.990 |
| 1in0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.899 | 9 | 98 | 3.30.70.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XNU2-F1-model_v4 | DUF520 family protein | 0.9829 | 99 | 161 |
GO:0000166
GO:0005829 |
| AF-A0A3M1KNS2-F1-model_v4 | UPF0234 protein D6761_00160 | 0.9825 | 1 | 161 |
GO:0000166
GO:0005829 |
| AF-A0A2V6DJI2-F1-model_v4 | YajQ family cyclic di-GMP-binding protein | 0.9785 | 1 | 109 |
GO:0000166
GO:0005829 |
| AF-A0A3M1KNS2-F1-model_v4 | UPF0234 protein D6761_00160 | 0.9766 | 1 | 161 |
GO:0000166
GO:0005829 |
| AF-A0A3M1KYF8-F1-model_v4 | UPF0234 protein D6760_06475 | 0.9741 | 1 | 161 |
GO:0000166
GO:0005829 |