F484787

General Info

Members Datasets Scaffolds Average Seq Length
889 311 1778 241

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10123052|Ga0070681_101230523
Length 297
Sequence MRRVGRRQLVRKALRPQVDADTSGRTLDYSEIPDTSATNPLRSCIRASDTETVSSAAAEAPKSTSTRTVIVADDTAFVRDRFRAALERAGHRVISLSTGNELIARVRTDPTTIDLVVADLRIPHGNGVNLIRTLRNIDATRPPIVVFSGTIASSAEVRELAALNVGGYVNEYTSLQHILPSLTPHLFPDTFNRRTGPRVVLGIPVAYRFGNTIAAAVTLNISRGGVAVRTTNPLAKGIVVKVRFRMPMSNRDIDVQAKVAWSDKRVGMGLEFSGLSESDEKVIRDYVDSHFFTNRKA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.39
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10123052 3300005458 Bacteria 2527
2 Ga0065704_10005744 3300005289 Bacteria 5062
3 Ga0065712_10083501 3300005290 Bacteria 2832
4 Ga0065715_10023114 3300005293 Bacteria 1539
5 Ga0065715_10039956 3300005293 Bacteria 1354
6 Ga0065707_10107417 3300005295 Bacteria 2555
7 Ga0065707_10117009 3300005295 Bacteria 2222
8 Ga0065707_10168072 3300005295 Bacteria 1506
9 Ga0065707_10246396 3300005295 Bacteria 1139
10 Ga0070676_10057125 3300005328 Bacteria 2308
11 Ga0070676_10064197 3300005328 Bacteria 2189
12 Ga0070676_10173484 3300005328 Bacteria 1397
13 Ga0070670_100108010 3300005331 Bacteria 2398
14 Ga0070670_100255531 3300005331 Bacteria 1527
15 Ga0070670_100293183 3300005331 Unclassified 1422
16 Ga0070670_100330531 3300005331 Bacteria 1337
17 Ga0070670_100363136 3300005331 Unclassified 1274
18 Ga0068869_100062718 3300005334 Bacteria 2729
19 Ga0068869_100123755 3300005334 Bacteria 1981
20 Ga0070666_10041845 3300005335 Bacteria 3063
21 Ga0070680_100059714 3300005336 Unclassified 3121
22 Ga0070680_100164524 3300005336 Bacteria 1865
23 Ga0070682_100033947 3300005337 Bacteria 3103
24 Ga0070682_100156409 3300005337 Bacteria 1570
25 Ga0068868_100019812 3300005338 Bacteria 5046
26 Ga0068868_100032665 3300005338 Bacteria 4006
27 Ga0068868_100194618 3300005338 Bacteria 1687
28 Ga0070660_100044926 3300005339 Bacteria 3380
29 Ga0070660_100128337 3300005339 Bacteria 2028
30 Ga0070689_100035206 3300005340 Bacteria 3825
31 Ga0070689_100102727 3300005340 Bacteria 2264
32 Ga0070689_100279866 3300005340 Unclassified 1384
33 Ga0070689_100806268 3300005340 Bacteria 826
34 Ga0070691_10012395 3300005341 Bacteria 3903
35 Ga0070687_100047738 3300005343 Bacteria 2198
36 Ga0070687_100148953 3300005343 Bacteria 1371
37 Ga0070661_100093875 3300005344 Bacteria 2223
38 Ga0070668_100026798 3300005347 Bacteria 4374
39 Ga0070668_100231570 3300005347 Bacteria 1527
40 Ga0070668_100482275 3300005347 Bacteria 1071
41 Ga0070669_100000264 3300005353 Bacteria 42905
42 Ga0070669_100001306 3300005353 Bacteria 17985
43 Ga0070669_100039290 3300005353 Bacteria 3438
44 Ga0070669_100086807 3300005353 Bacteria 2338
45 Ga0070669_100131497 3300005353 Bacteria 1920
46 Ga0070669_100227282 3300005353 Bacteria 1477
47 Ga0070675_100000587 3300005354 Bacteria 24915
48 Ga0070675_100000749 3300005354 Bacteria 22592
49 Ga0070675_100006777 3300005354 Bacteria 8801
50 Ga0070675_100044403 3300005354 Bacteria 3634
51 Ga0070675_100069482 3300005354 Bacteria 2918
52 Ga0070675_100077710 3300005354 Bacteria 2763
53 Ga0070675_100311735 3300005354 Bacteria 1388
54 Ga0070675_100518947 3300005354 Bacteria 1075
55 Ga0070671_100013365 3300005355 Bacteria 6618
56 Ga0070671_100078870 3300005355 Bacteria 2752
57 Ga0070674_100021858 3300005356 Bacteria 4116
58 Ga0070674_100061509 3300005356 Bacteria 2621
59 Ga0070674_100296196 3300005356 Bacteria 1288
60 Ga0070673_100006409 3300005364 Bacteria 7651
61 Ga0070673_100027917 3300005364 Bacteria 4191
62 Ga0070673_100054853 3300005364 Bacteria 3137
63 Ga0070673_100248466 3300005364 Bacteria 1550
64 Ga0070673_100810474 3300005364 Bacteria 865
65 Ga0070688_100002708 3300005365 Bacteria 8990
66 Ga0070688_100086907 3300005365 Bacteria 2035
67 Ga0070688_100184002 3300005365 Bacteria 1451
68 Ga0070688_100277566 3300005365 Bacteria 1203
69 Ga0070688_100374672 3300005365 Unclassified 1048
70 Ga0070659_100154244 3300005366 Bacteria 1875
71 Ga0070659_100321575 3300005366 Bacteria 1293
72 Ga0070667_100059552 3300005367 Bacteria 3230
73 Ga0070667_100066193 3300005367 Unclassified 3069
74 Ga0070667_100365118 3300005367 Bacteria 1309
75 Ga0070709_10056885 3300005434 Bacteria 2475
76 Ga0070709_10141857 3300005434 Bacteria 1652
77 Ga0070714_100031292 3300005435 Bacteria 4438
78 Ga0070713_100030380 3300005436 Bacteria 4290
79 Ga0070713_100114830 3300005436 Bacteria 2353
80 Ga0070701_10029848 3300005438 Bacteria 2693
81 Ga0070701_10060686 3300005438 Bacteria 1992
82 Ga0070711_100278738 3300005439 Bacteria 1322
83 Ga0070705_100008229 3300005440 Bacteria 5161
84 Ga0070705_100047999 3300005440 Bacteria 2471
85 Ga0070705_100105192 3300005440 Bacteria 1791
86 Ga0070700_100002184 3300005441 Bacteria 9939
87 Ga0070700_100197304 3300005441 Bacteria 1411
88 Ga0070700_100222398 3300005441 Bacteria 1338
89 Ga0070700_100342985 3300005441 Bacteria 1105
90 Ga0070694_100000569 3300005444 Bacteria 20444
91 Ga0070694_100003072 3300005444 Bacteria 9937
92 Ga0070694_100018429 3300005444 Bacteria 4430
93 Ga0070694_100057307 3300005444 Bacteria 2648
94 Ga0070694_100095404 3300005444 Bacteria 2094
95 Ga0070708_100274525 3300005445 Bacteria 1586
96 Ga0070678_100150274 3300005456 Bacteria 1876
97 Ga0070678_100181389 3300005456 Bacteria 1724
98 Ga0070678_100268073 3300005456 Bacteria 1439
99 Ga0070678_100569612 3300005456 Bacteria 1007
100 Ga0070662_100174856 3300005457 Bacteria 1689
101 Ga0070662_100271413 3300005457 Bacteria 1370
102 Ga0070662_100277333 3300005457 Bacteria 1356
103 Ga0070662_100347165 3300005457 Bacteria 1215
104 Ga0070662_100512086 3300005457 Bacteria 1002
105 Ga0070681_10014561 3300005458 Bacteria 7827
106 Ga0068867_100004297 3300005459 Bacteria 10027
107 Ga0068867_100071461 3300005459 Bacteria 2596
108 Ga0068867_100105258 3300005459 Bacteria 2160
109 Ga0068867_100158957 3300005459 Bacteria 1781
110 Ga0068867_100181492 3300005459 Bacteria 1674
111 Ga0068867_100578119 3300005459 Bacteria 977
112 Ga0070685_10019330 3300005466 Bacteria 3674
113 Ga0070685_10046806 3300005466 Bacteria 2484
114 Ga0070706_100134086 3300005467 Bacteria 2312
115 Ga0070707_100023835 3300005468 Bacteria 5790
116 Ga0070707_100113752 3300005468 Bacteria 2626
117 Ga0070707_100588363 3300005468 Bacteria 1075
118 Ga0070698_100020802 3300005471 Bacteria 6877
119 Ga0070698_100031883 3300005471 Bacteria 5463
120 Ga0070698_100185237 3300005471 Bacteria 2020
121 Ga0070698_100277424 3300005471 Bacteria 1608
122 Ga0070699_100001533 3300005518 Bacteria 21114
123 Ga0070699_100002607 3300005518 Bacteria 16110
124 Ga0070699_100002875 3300005518 Bacteria 15347
125 Ga0070699_100094444 3300005518 Bacteria 2618
126 Ga0070699_100266742 3300005518 Bacteria 1532
127 Ga0070679_100029446 3300005530 Bacteria 5418
128 Ga0070679_100363404 3300005530 Bacteria 1395
129 Ga0070679_100648002 3300005530 Bacteria 999
130 Ga0070684_100018523 3300005535 Bacteria 5737
131 Ga0070684_100116823 3300005535 Bacteria 2397
132 Ga0070684_100140327 3300005535 Bacteria 2185
133 Ga0070684_100518628 3300005535 Unclassified 1105
134 Ga0070697_100020689 3300005536 Bacteria 5208
135 Ga0070697_100042287 3300005536 Bacteria 3688
136 Ga0070697_100231654 3300005536 Bacteria 1576
137 Ga0070697_100467990 3300005536 Bacteria 1099
138 Ga0070697_100540095 3300005536 Bacteria 1022
139 Ga0070672_100053482 3300005543 Bacteria 3157
140 Ga0070672_100090297 3300005543 Bacteria 2470
141 Ga0070672_100216223 3300005543 Bacteria 1606
142 Ga0070672_100216523 3300005543 Bacteria 1605
143 Ga0070672_100305422 3300005543 Bacteria 1349
144 Ga0070672_100604284 3300005543 Bacteria 955
145 Ga0070686_100003404 3300005544 Bacteria 8722
146 Ga0070686_100049550 3300005544 Bacteria 2665
147 Ga0070686_100093525 3300005544 Bacteria 2016
148 Ga0070686_100426937 3300005544 Bacteria 1014
149 Ga0070686_100529778 3300005544 Bacteria 918
150 Ga0070695_100000124 3300005545 Bacteria 34655
151 Ga0070695_100011723 3300005545 Bacteria 5248
152 Ga0070695_100016127 3300005545 Bacteria 4518
153 Ga0070695_100113344 3300005545 Bacteria 1844
154 Ga0070695_100334056 3300005545 Bacteria 1130
155 Ga0070696_100000603 3300005546 Bacteria 23027
156 Ga0070696_100010316 3300005546 Bacteria 6257
157 Ga0070696_100016578 3300005546 Bacteria 4965
158 Ga0070696_100033595 3300005546 Bacteria 3525
159 Ga0070696_100061580 3300005546 Bacteria 2625
160 Ga0070696_100063983 3300005546 Bacteria 2577
161 Ga0070696_100448167 3300005546 Unclassified 1018
162 Ga0070665_100006321 3300005548 Bacteria 12089
163 Ga0070665_100023606 3300005548 Bacteria 6193
164 Ga0070665_100043689 3300005548 Bacteria 4502
165 Ga0070665_100424045 3300005548 Bacteria 1339
166 Ga0070704_100000097 3300005549 Bacteria 30350
167 Ga0070704_100000945 3300005549 Bacteria 14686
168 Ga0070704_100014012 3300005549 Bacteria 4996
169 Ga0070704_100016350 3300005549 Bacteria 4685
170 Ga0068855_100026283 3300005563 Bacteria 6964
171 Ga0070664_100156424 3300005564 Bacteria 2014
172 Ga0070664_100778772 3300005564 Bacteria 894
173 Ga0068857_100015032 3300005577 Bacteria 6753
174 Ga0068857_100662456 3300005577 Bacteria 990
175 Ga0068854_100007559 3300005578 Bacteria 6947
176 Ga0068854_100175873 3300005578 Unclassified 1669
177 Ga0070702_100008161 3300005615 Bacteria 5059
178 Ga0070702_100010116 3300005615 Unclassified 4636
179 Ga0070702_100307540 3300005615 Unclassified 1099
180 Ga0068859_100020009 3300005617 Bacteria 6721
181 Ga0068859_100025466 3300005617 Bacteria 5934
182 Ga0068859_100074934 3300005617 Bacteria 3424
183 Ga0068859_100258701 3300005617 Bacteria 1831
184 Ga0068859_100266118 3300005617 Bacteria 1806
185 Ga0068859_100341142 3300005617 Bacteria 1592
186 Ga0068859_100477024 3300005617 Bacteria 1343
187 Ga0068864_100002718 3300005618 Bacteria 14568
188 Ga0068864_100047876 3300005618 Bacteria 3674
189 Ga0068864_100212799 3300005618 Bacteria 1781
190 Ga0068864_100713177 3300005618 Unclassified 981
191 Ga0068866_10075320 3300005718 Bacteria 1797
192 Ga0068866_10126763 3300005718 Bacteria 1446
193 Ga0068861_100024254 3300005719 Bacteria 4386
194 Ga0068861_100213883 3300005719 Bacteria 1625
195 Ga0068861_100254332 3300005719 Bacteria 1500
196 Ga0068861_100475427 3300005719 Bacteria 1125
197 Ga0068861_100884160 3300005719 Unclassified 845
198 Ga0068870_10001652 3300005840 Bacteria 9113
199 Ga0068870_10034993 3300005840 Bacteria 2574
200 Ga0068863_100019269 3300005841 Bacteria 6526
201 Ga0068863_100023402 3300005841 Bacteria 5901
202 Ga0068863_100167931 3300005841 Unclassified 2104
203 Ga0068863_100257172 3300005841 Bacteria 1688
204 Ga0068863_100518815 3300005841 Bacteria 1175
205 Ga0068858_100032722 3300005842 Bacteria 4829
206 Ga0068858_100060345 3300005842 Unclassified 3505
207 Ga0068858_100062205 3300005842 Bacteria 3451
208 Ga0068858_100218896 3300005842 Bacteria 1803
209 Ga0068858_100279141 3300005842 Bacteria 1591
210 Ga0068858_100620487 3300005842 Bacteria 1050
211 Ga0068858_100792027 3300005842 Bacteria 925
212 Ga0068860_100003758 3300005843 Bacteria 15606
213 Ga0068860_100183793 3300005843 Bacteria 2021
214 Ga0068860_100201283 3300005843 Bacteria 1930
215 Ga0068860_100301865 3300005843 Bacteria 1569
216 Ga0068860_100336865 3300005843 Unclassified 1483
217 Ga0068860_100437203 3300005843 Bacteria 1299
218 Ga0068860_100632049 3300005843 Bacteria 1078
219 Ga0068862_100000749 3300005844 Bacteria 32563
220 Ga0068862_100054573 3300005844 Bacteria 3421
221 Ga0068862_100152196 3300005844 Bacteria 2060
222 Ga0068862_100879165 3300005844 Bacteria 880
223 Ga0081455_10134584 3300005937 Bacteria 1928
224 Ga0081538_10067139 3300005981 Bacteria 2004
225 Ga0081540_1052203 3300005983 Unclassified 2015
226 Ga0081539_10014609 3300005985 Bacteria 5788
227 Ga0081539_10098834 3300005985 Bacteria 1492
228 Ga0070717_10322744 3300006028 Unclassified 1376
229 Ga0075432_10156968 3300006058 Bacteria 878
230 Ga0070715_10014762 3300006163 Bacteria 2900
231 Ga0070715_10116063 3300006163 Bacteria 1270
232 Ga0075366_10260244 3300006195 Bacteria 1059
233 Ga0097621_100000491 3300006237 Bacteria 27694
234 Ga0097621_100005792 3300006237 Bacteria 8726
235 Ga0097621_100024795 3300006237 Bacteria 4688
236 Ga0097621_100104325 3300006237 Unclassified 2389
237 Ga0097621_100449954 3300006237 Archaea 1160
238 Ga0068871_100002113 3300006358 Bacteria 13450
239 Ga0068871_100018319 3300006358 Bacteria 5318
240 Ga0068871_100033643 3300006358 Bacteria 4061
241 Ga0068871_100154601 3300006358 Bacteria 1958
242 Ga0068871_100155682 3300006358 Bacteria 1951
243 Ga0075428_100023605 3300006844 Bacteria 6808
244 Ga0075428_100029572 3300006844 Bacteria 6061
245 Ga0075428_100030937 3300006844 Bacteria 5919
246 Ga0075428_100205646 3300006844 Bacteria 2127
247 Ga0075428_100598306 3300006844 Bacteria 1178
248 Ga0075428_100678150 3300006844 Bacteria 1098
249 Ga0075430_100508993 3300006846 Unclassified 994
250 Ga0075431_100007886 3300006847 Bacteria 10609
251 Ga0075431_100018548 3300006847 Bacteria 7087
252 Ga0075431_100203534 3300006847 Bacteria 2025
253 Ga0075433_10053857 3300006852 Bacteria 3509
254 Ga0075433_10133008 3300006852 Bacteria 2210
255 Ga0075433_10160059 3300006852 Bacteria 2003
256 Ga0075433_10224574 3300006852 Bacteria 1668
257 Ga0075433_10225771 3300006852 Bacteria 1663
258 Ga0075433_10450443 3300006852 Unclassified 1135
259 Ga0075434_100000049 3300006871 Bacteria 57417
260 Ga0075434_100003854 3300006871 Bacteria 13417
261 Ga0075434_100004767 3300006871 Bacteria 12279
262 Ga0075434_100021121 3300006871 Bacteria 6328
263 Ga0075434_100030808 3300006871 Bacteria 5286
264 Ga0075434_100056893 3300006871 Bacteria 3887
265 Ga0075434_100194093 3300006871 Bacteria 2051
266 Ga0075434_100199351 3300006871 Bacteria 2021
267 Ga0075434_100267905 3300006871 Unclassified 1727
268 Ga0075429_100011138 3300006880 Bacteria 7785
269 Ga0075429_100029270 3300006880 Bacteria 4784
270 Ga0075429_100116338 3300006880 Bacteria 2337
271 Ga0075429_100147587 3300006880 Bacteria 2059
272 Ga0075429_100212881 3300006880 Bacteria 1693
273 Ga0068865_100009422 3300006881 Bacteria 6055
274 Ga0068865_100245946 3300006881 Bacteria 1409
275 Ga0068865_100454671 3300006881 Unclassified 1059
276 Ga0075436_100006478 3300006914 Bacteria 8020
277 Ga0075436_100010035 3300006914 Bacteria 6480
278 Ga0075436_100269876 3300006914 Bacteria 1215
279 Ga0097620_100020009 3300006931 Bacteria 6721
280 Ga0097620_100025467 3300006931 Bacteria 5934
281 Ga0097620_100074936 3300006931 Bacteria 3424
282 Ga0097620_100258702 3300006931 Bacteria 1831
283 Ga0097620_100266110 3300006931 Bacteria 1806
284 Ga0097620_100341133 3300006931 Bacteria 1592
285 Ga0097620_100477032 3300006931 Bacteria 1343
286 Ga0075435_100000059 3300007076 Bacteria 56189
287 Ga0075435_100008041 3300007076 Bacteria 7548
288 Ga0075435_100015546 3300007076 Bacteria 5724
289 Ga0075435_100015594 3300007076 Bacteria 5717
290 Ga0075435_100017361 3300007076 Bacteria 5446
291 Ga0075435_100131065 3300007076 Bacteria 2098
292 Ga0075435_100141737 3300007076 Bacteria 2017
293 Ga0075435_100144953 3300007076 Bacteria 1994
294 Ga0075435_100157889 3300007076 Bacteria 1909
295 Ga0075435_100283200 3300007076 Bacteria 1415
296 Ga0099794_10101708 3300007265 Bacteria 1435
297 Ga0105240_10039818 3300009093 Bacteria 6016
298 Ga0105240_10222432 3300009093 Bacteria 2198
299 Ga0105240_10246761 3300009093 Bacteria 2067
300 Ga0105240_10612423 3300009093 Unclassified 1198
301 Ga0111539_10000302 3300009094 Bacteria 59849
302 Ga0111539_10001892 3300009094 Bacteria 27846
303 Ga0111539_10004585 3300009094 Bacteria 18059
304 Ga0111539_10021248 3300009094 Bacteria 7992
305 Ga0111539_10077568 3300009094 Bacteria 3910
306 Ga0111539_10141396 3300009094 Bacteria 2817
307 Ga0111539_10255836 3300009094 Bacteria 2039
308 Ga0111539_10328499 3300009094 Bacteria 1780
309 Ga0111539_10424749 3300009094 Bacteria 1548
310 Ga0105245_10090614 3300009098 Bacteria 2813
311 Ga0105245_10342672 3300009098 Bacteria 1478
312 Ga0105245_10879218 3300009098 Bacteria 937
313 Ga0105245_10960064 3300009098 Bacteria 898
314 Ga0105247_10242507 3300009101 Unclassified 1229
315 Ga0114129_10001012 3300009147 Bacteria 36639
316 Ga0114129_10003005 3300009147 Bacteria 23633
317 Ga0114129_10004708 3300009147 Bacteria 19259
318 Ga0114129_10019189 3300009147 Bacteria 9740
319 Ga0114129_10021328 3300009147 Bacteria 9198
320 Ga0114129_10022388 3300009147 Bacteria 8973
321 Ga0114129_10025206 3300009147 Bacteria 8428
322 Ga0114129_10028404 3300009147 Bacteria 7927
323 Ga0114129_10059634 3300009147 Bacteria 5335
324 Ga0114129_10101348 3300009147 Bacteria 3984
325 Ga0114129_10138111 3300009147 Bacteria 3343
326 Ga0114129_10163607 3300009147 Bacteria 3038
327 Ga0114129_10213102 3300009147 Bacteria 2610
328 Ga0114129_10275532 3300009147 Bacteria 2249
329 Ga0105243_10110520 3300009148 Bacteria 2299
330 Ga0105242_10014200 3300009176 Bacteria 6166
331 Ga0105242_10034773 3300009176 Bacteria 4040
332 Ga0105242_10048359 3300009176 Bacteria 3457
333 Ga0105242_10093310 3300009176 Bacteria 2537
334 Ga0105242_10098056 3300009176 Bacteria 2479
335 Ga0105242_10358264 3300009176 Bacteria 1349
336 Ga0105242_10374223 3300009176 Unclassified 1322
337 Ga0105242_10392319 3300009176 Bacteria 1293
338 Ga0105248_10015366 3300009177 Bacteria 8444
339 Ga0105248_10024459 3300009177 Bacteria 6715
340 Ga0105248_10041426 3300009177 Bacteria 5163
341 Ga0105248_10058826 3300009177 Bacteria 4316
342 Ga0105248_10090604 3300009177 Bacteria 3443
343 Ga0105248_10176754 3300009177 Bacteria 2405
344 Ga0105249_10002028 3300009553 Bacteria 17573
345 Ga0105249_10072455 3300009553 Bacteria 3184
346 Ga0105249_10497617 3300009553 Bacteria 1264
347 Ga0105239_10087519 3300010375 Bacteria 3434
348 Ga0105239_10569413 3300010375 Bacteria 1291
349 Ga0157374_10096436 3300013296 Bacteria 2829
350 Ga0157374_10239279 3300013296 Bacteria 1785
351 Ga0157374_10346066 3300013296 Bacteria 1476
352 Ga0157378_10154208 3300013297 Bacteria 2142
353 Ga0157378_10220642 3300013297 Bacteria 1802
354 Ga0157378_10352609 3300013297 Unclassified 1438
355 Ga0157378_10380729 3300013297 Bacteria 1385
356 Ga0157378_10940896 3300013297 Unclassified 896
357 Ga0163162_10033862 3300013306 Bacteria 5079
358 Ga0163162_10035463 3300013306 Bacteria 4969
359 Ga0163162_10137317 3300013306 Bacteria 2556
360 Ga0163162_10714462 3300013306 Unclassified 1123
361 Ga0157372_10133743 3300013307 Bacteria 2855
362 Ga0157375_10423732 3300013308 Bacteria 1497
363 Ga0157375_10508944 3300013308 Bacteria 1368
364 Ga0157375_11120788 3300013308 Bacteria 921
365 Ga0163163_10013754 3300014325 Bacteria 7417
366 Ga0163163_10023292 3300014325 Bacteria 5875
367 Ga0163163_10077144 3300014325 Bacteria 3328
368 Ga0163163_10206330 3300014325 Unclassified 2013
369 Ga0163163_10263912 3300014325 Bacteria 1773
370 Ga0163163_10560549 3300014325 Unclassified 1205
371 Ga0163163_10876563 3300014325 Unclassified 961
372 Ga0163163_10955127 3300014325 Bacteria 920
373 Ga0157380_10147420 3300014326 Bacteria 2030
374 Ga0157380_10158824 3300014326 Bacteria 1963
375 Ga0157377_10019531 3300014745 Bacteria 3542
376 Ga0157377_10041517 3300014745 Bacteria 2552
377 Ga0157377_10063454 3300014745 Bacteria 2116
378 Ga0157379_10015595 3300014968 Bacteria 6672
379 Ga0157379_10296337 3300014968 Bacteria 1474
380 Ga0157376_10005986 3300014969 Bacteria 8547
381 Ga0157376_10008590 3300014969 Bacteria 7380
382 Ga0157376_10276704 3300014969 Bacteria 1579
383 Ga0182005_1060022 3300015265 Bacteria 1039
384 Ga0163161_10112387 3300017792 Bacteria 2038
385 Ga0163161_10281652 3300017792 Bacteria 1304
386 Ga0207697_10077726 3300025315 Bacteria 1396
387 Ga0207653_10067328 3300025885 Bacteria 1218
388 Ga0207682_10023520 3300025893 Bacteria 2434
389 Ga0207642_10107688 3300025899 Bacteria 1412
390 Ga0207642_10109452 3300025899 Unclassified 1404
391 Ga0207642_10125043 3300025899 Bacteria 1333
392 Ga0207642_10143281 3300025899 Bacteria 1262
393 Ga0207710_10135426 3300025900 Unclassified 1186
394 Ga0207688_10085967 3300025901 Bacteria 1801
395 Ga0207688_10130627 3300025901 Bacteria 1472
396 Ga0207688_10131187 3300025901 Bacteria 1469
397 Ga0207688_10296100 3300025901 Unclassified 988
398 Ga0207680_10004861 3300025903 Bacteria 6393
399 Ga0207680_10049266 3300025903 Bacteria 2507
400 Ga0207699_10015659 3300025906 Bacteria 3945
401 Ga0207699_10314503 3300025906 Bacteria 1097
402 Ga0207645_10004578 3300025907 Bacteria 10197
403 Ga0207645_10020293 3300025907 Bacteria 4351
404 Ga0207645_10029897 3300025907 Bacteria 3511
405 Ga0207645_10102076 3300025907 Bacteria 1851
406 Ga0207645_10131190 3300025907 Bacteria 1631
407 Ga0207645_10139877 3300025907 Bacteria 1577
408 Ga0207643_10013421 3300025908 Bacteria 4436
409 Ga0207643_10013830 3300025908 Bacteria 4377
410 Ga0207643_10051052 3300025908 Bacteria 2347
411 Ga0207643_10129875 3300025908 Bacteria 1498
412 Ga0207705_10131076 3300025909 Bacteria 1866
413 Ga0207684_10131770 3300025910 Bacteria 2145
414 Ga0207684_10449720 3300025910 Bacteria 1106
415 Ga0207707_10013353 3300025912 Bacteria 7159
416 Ga0207707_10046833 3300025912 Bacteria 3766
417 Ga0207707_10143601 3300025912 Bacteria 2086
418 Ga0207695_10081035 3300025913 Bacteria 3286
419 Ga0207695_10181056 3300025913 Bacteria 2028
420 Ga0207671_10186003 3300025914 Bacteria 1618
421 Ga0207660_10059359 3300025917 Unclassified 2746
422 Ga0207660_10075487 3300025917 Bacteria 2463
423 Ga0207660_10300696 3300025917 Bacteria 1277
424 Ga0207657_10131568 3300025919 Bacteria 2050
425 Ga0207649_10224193 3300025920 Bacteria 1341
426 Ga0207652_10033860 3300025921 Bacteria 4303
427 Ga0207652_10047508 3300025921 Bacteria 3667
428 Ga0207646_10022608 3300025922 Bacteria 5790
429 Ga0207646_10036407 3300025922 Bacteria 4442
430 Ga0207646_10247538 3300025922 Bacteria 1610
431 Ga0207646_10589939 3300025922 Bacteria 998
432 Ga0207646_10843104 3300025922 Bacteria 815
433 Ga0207681_10004895 3300025923 Bacteria 8230
434 Ga0207681_10008133 3300025923 Bacteria 6417
435 Ga0207681_10015023 3300025923 Bacteria 4825
436 Ga0207681_10028024 3300025923 Bacteria 3646
437 Ga0207681_10037192 3300025923 Bacteria 3216
438 Ga0207681_10081464 3300025923 Bacteria 2285
439 Ga0207650_10011773 3300025925 Bacteria 6032
440 Ga0207650_10027640 3300025925 Bacteria 4062
441 Ga0207650_10103024 3300025925 Bacteria 2200
442 Ga0207650_10178800 3300025925 Bacteria 1690
443 Ga0207650_10312515 3300025925 Bacteria 1286
444 Ga0207659_10001094 3300025926 Bacteria 16053
445 Ga0207659_10009668 3300025926 Bacteria 6031
446 Ga0207659_10019956 3300025926 Bacteria 4422
447 Ga0207659_10024502 3300025926 Bacteria 4044
448 Ga0207659_10025012 3300025926 Bacteria 4008
449 Ga0207659_10050879 3300025926 Bacteria 2945
450 Ga0207659_10393909 3300025926 Bacteria 1157
451 Ga0207687_10056093 3300025927 Bacteria 2762
452 Ga0207687_10271429 3300025927 Bacteria 1356
453 Ga0207700_10059927 3300025928 Bacteria 2881
454 Ga0207700_10224890 3300025928 Unclassified 1593
455 Ga0207644_10038521 3300025931 Bacteria 3368
456 Ga0207644_10057432 3300025931 Bacteria 2810
457 Ga0207644_10131705 3300025931 Unclassified 1915
458 Ga0207644_10153394 3300025931 Unclassified 1784
459 Ga0207644_10364242 3300025931 Bacteria 1176
460 Ga0207690_10127836 3300025932 Bacteria 1855
461 Ga0207706_10015058 3300025933 Bacteria 7001
462 Ga0207706_10019924 3300025933 Bacteria 6028
463 Ga0207706_10096822 3300025933 Bacteria 2595
464 Ga0207706_10112625 3300025933 Bacteria 2394
465 Ga0207706_10177607 3300025933 Bacteria 1870
466 Ga0207706_10210215 3300025933 Bacteria 1705
467 Ga0207706_10265998 3300025933 Bacteria 1497
468 Ga0207706_10290315 3300025933 Bacteria 1426
469 Ga0207706_10364732 3300025933 Bacteria 1255
470 Ga0207706_10391283 3300025933 Bacteria 1206
471 Ga0207686_10036908 3300025934 Bacteria 2945
472 Ga0207686_10037348 3300025934 Bacteria 2930
473 Ga0207686_10277135 3300025934 Bacteria 1236
474 Ga0207709_10183604 3300025935 Unclassified 1479
475 Ga0207709_10300004 3300025935 Bacteria 1194
476 Ga0207670_10027558 3300025936 Bacteria 3593
477 Ga0207670_10090698 3300025936 Bacteria 2160
478 Ga0207669_10302878 3300025937 Bacteria 1215
479 Ga0207669_10338354 3300025937 Bacteria 1158
480 Ga0207669_10534644 3300025937 Bacteria 943
481 Ga0207669_10583872 3300025937 Bacteria 906
482 Ga0207704_10004994 3300025938 Bacteria 6101
483 Ga0207704_10009533 3300025938 Bacteria 4688
484 Ga0207704_10023654 3300025938 Bacteria 3315
485 Ga0207665_10061466 3300025939 Bacteria 2546
486 Ga0207665_10208183 3300025939 Bacteria 1427
487 Ga0207691_10053260 3300025940 Bacteria 3695
488 Ga0207691_10074820 3300025940 Bacteria 3054
489 Ga0207691_10124544 3300025940 Bacteria 2281
490 Ga0207691_10142090 3300025940 Bacteria 2115
491 Ga0207691_10145152 3300025940 Bacteria 2089
492 Ga0207691_10174062 3300025940 Bacteria 1883
493 Ga0207691_10339974 3300025940 Bacteria 1285
494 Ga0207691_10456333 3300025940 Bacteria 1087
495 Ga0207711_10039867 3300025941 Bacteria 3996
496 Ga0207711_10056174 3300025941 Bacteria 3382
497 Ga0207711_10065938 3300025941 Bacteria 3130
498 Ga0207711_10159170 3300025941 Bacteria 2042
499 Ga0207711_10305220 3300025941 Bacteria 1469
500 Ga0207711_10316551 3300025941 Bacteria 1441
501 Ga0207711_10393780 3300025941 Bacteria 1286
502 Ga0207711_10437161 3300025941 Bacteria 1217
503 Ga0207689_10025024 3300025942 Bacteria 5004
504 Ga0207689_10141646 3300025942 Bacteria 1981
505 Ga0207661_10099803 3300025944 Unclassified 2436
506 Ga0207679_10237714 3300025945 Unclassified 1542
507 Ga0207679_10250392 3300025945 Bacteria 1506
508 Ga0207679_10274261 3300025945 Bacteria 1444
509 Ga0207679_10732270 3300025945 Bacteria 899
510 Ga0207667_10280624 3300025949 Bacteria 1702
511 Ga0207651_10075494 3300025960 Bacteria 2405
512 Ga0207651_10112204 3300025960 Bacteria 2049
513 Ga0207651_10235954 3300025960 Bacteria 1488
514 Ga0207651_10328295 3300025960 Bacteria 1281
515 Ga0207712_10041060 3300025961 Bacteria 3178
516 Ga0207712_10085105 3300025961 Bacteria 2313
517 Ga0207668_10264670 3300025972 Bacteria 1403
518 Ga0207640_10007862 3300025981 Bacteria 5883
519 Ga0207640_10127994 3300025981 Unclassified 1831
520 Ga0207640_10516939 3300025981 Bacteria 997
521 Ga0207658_10041384 3300025986 Bacteria 3336
522 Ga0207658_10400663 3300025986 Bacteria 1206
523 Ga0207677_10043367 3300026023 Bacteria 2990
524 Ga0207677_10072795 3300026023 Bacteria 2431
525 Ga0207677_10183864 3300026023 Bacteria 1646
526 Ga0207677_10216283 3300026023 Unclassified 1534
527 Ga0207703_10016709 3300026035 Bacteria 5724
528 Ga0207703_10018624 3300026035 Bacteria 5422
529 Ga0207703_10048022 3300026035 Bacteria 3443
530 Ga0207703_10062132 3300026035 Bacteria 3060
531 Ga0207703_10067881 3300026035 Bacteria 2936
532 Ga0207703_10161436 3300026035 Bacteria 1963
533 Ga0207703_10323391 3300026035 Bacteria 1413
534 Ga0207639_10303548 3300026041 Bacteria 1412
535 Ga0207639_10305470 3300026041 Bacteria 1408
536 Ga0207639_10608362 3300026041 Bacteria 1008
537 Ga0207639_10720423 3300026041 Bacteria 926
538 Ga0207708_10002562 3300026075 Bacteria 13377
539 Ga0207708_10116697 3300026075 Unclassified 2077
540 Ga0207708_10122903 3300026075 Bacteria 2023
541 Ga0207708_10199866 3300026075 Bacteria 1595
542 Ga0207708_10216290 3300026075 Bacteria 1533
543 Ga0207708_10284302 3300026075 Bacteria 1341
544 Ga0207708_10483341 3300026075 Bacteria 1036
545 Ga0207702_10165652 3300026078 Unclassified 2022
546 Ga0207641_10024834 3300026088 Bacteria 4940
547 Ga0207641_10029889 3300026088 Bacteria 4507
548 Ga0207641_10051109 3300026088 Unclassified 3500
549 Ga0207641_10154222 3300026088 Bacteria 2083
550 Ga0207641_10668175 3300026088 Unclassified 1021
551 Ga0207648_10008209 3300026089 Bacteria 10143
552 Ga0207648_10027796 3300026089 Bacteria 5019
553 Ga0207648_10042137 3300026089 Bacteria 4008
554 Ga0207648_10050180 3300026089 Bacteria 3649
555 Ga0207648_10050966 3300026089 Bacteria 3618
556 Ga0207648_10223202 3300026089 Unclassified 1675
557 Ga0207648_10740454 3300026089 Bacteria 913
558 Ga0207676_10010823 3300026095 Bacteria 6506
559 Ga0207676_10115499 3300026095 Bacteria 2254
560 Ga0207676_10167989 3300026095 Bacteria 1908
561 Ga0207676_10400533 3300026095 Bacteria 1282
562 Ga0207674_10017024 3300026116 Bacteria 7936
563 Ga0207674_10072771 3300026116 Bacteria 3452
564 Ga0207674_10078599 3300026116 Bacteria 3304
565 Ga0207675_100003438 3300026118 Bacteria 15481
566 Ga0207675_100034055 3300026118 Bacteria 4747
567 Ga0207675_100058008 3300026118 Bacteria 3613
568 Ga0207675_100236706 3300026118 Bacteria 1763
569 Ga0207675_100408103 3300026118 Unclassified 1340
570 Ga0207675_100600072 3300026118 Bacteria 1104
571 Ga0207683_10025931 3300026121 Bacteria 5059
572 Ga0207683_10168473 3300026121 Bacteria 1983
573 Ga0207683_10251697 3300026121 Bacteria 1612
574 Ga0207683_10797775 3300026121 Bacteria 876
575 Ga0209588_1074277 3300027671 Bacteria 1098
576 Ga0209974_10035288 3300027876 Bacteria 1661
577 Ga0207428_10008383 3300027907 Bacteria 9335
578 Ga0207428_10027280 3300027907 Bacteria 4756
579 Ga0207428_10046000 3300027907 Bacteria 3511
580 Ga0207428_10084674 3300027907 Bacteria 2470
581 Ga0207428_10121814 3300027907 Bacteria 2000
582 Ga0207428_10145031 3300027907 Bacteria 1810
583 Ga0207428_10195697 3300027907 Bacteria 1522
584 Ga0207428_10480537 3300027907 Bacteria 904
585 Ga0268266_10010811 3300028379 Bacteria 7950
586 Ga0268266_10011705 3300028379 Bacteria 7611
587 Ga0268266_10029494 3300028379 Bacteria 4663
588 Ga0268266_10058628 3300028379 Bacteria 3315
589 Ga0268265_10002669 3300028380 Bacteria 13228
590 Ga0268265_10024669 3300028380 Bacteria 4258
591 Ga0268265_10129357 3300028380 Bacteria 2095
592 Ga0268265_10163584 3300028380 Bacteria 1893
593 Ga0268265_10225527 3300028380 Bacteria 1643
594 Ga0268265_10459994 3300028380 Bacteria 1190
595 Ga0268264_10004891 3300028381 Bacteria 11353
596 Ga0268264_10048002 3300028381 Bacteria 3551
597 Ga0268264_10078272 3300028381 Bacteria 2818
598 Ga0268264_10217305 3300028381 Bacteria 1758
599 Ga0268264_10266903 3300028381 Unclassified 1597
600 Ga0268264_10718692 3300028381 Bacteria 993
601 Ga0307513_10449732 3300031456 Bacteria 1013
602 Ga0265314_10033821 3300031711 Bacteria 3741
603 Ga0265314_10054186 3300031711 Bacteria 2777
604 Ga0307407_10025155 3300031903 Bacteria 3134
605 Ga0307412_10283680 3300031911 Bacteria 1301
606 Ga0307409_100185594 3300031995 Bacteria 1845
607 Ga0307416_100181786 3300032002 Bacteria 1972
608 Ga0307416_100872172 3300032002 Bacteria 999
609 Ga0307411_10070786 3300032005 Bacteria 2361
610 Ga0373930_0002318 3300034816 Bacteria 2939
611 Ga0373948_0037372 3300034817 Bacteria 1003
612 Ga0373958_0000280 3300034819 Bacteria 6039
613 Ga0373958_0051375 3300034819 Bacteria 871
614 Ga0373959_0002455 3300034820 Bacteria 2947
615 Ga0373938_0009755 3300034957 Bacteria 1746
616 Ga0373926_0018070 3300035083 Bacteria 2424
617 Ga0373926_0079232 3300035083 Bacteria 1213
618 Ga0373928_0007027 3300035084 Bacteria 2170
619 Ga0373928_0015460 3300035084 Bacteria 1554
620 Ga0373929_0000330 3300035085 Bacteria 8780
621 Ga0373934_0009339 3300035086 Bacteria 3672
622 Ga0373934_0017305 3300035086 Bacteria 2751
623 Ga0373934_0107884 3300035086 Bacteria 1128
624 Ga0373934_0200018 3300035086 Unclassified 823
625 Ga0373940_0002448 3300035088 Bacteria 3612
626 Ga0373949_0002142 3300035090 Bacteria 5187
627 Ga0373951_0005326 3300035091 Bacteria 2994
628 Ga0373952_0000702 3300035092 Bacteria 5964
629 Ga0373923_0127845 3300035111 Bacteria 1140
630 Ga0373932_0000898 3300035112 Bacteria 8713
631 Ga0373936_0024840 3300035113 Bacteria 2342
632 Ga0373939_0000740 3300035114 Bacteria 8070
633 Ga0373939_0054501 3300035114 Bacteria 1253
634 Ga0373945_0165630 3300035116 Bacteria 903
635 Ga0373953_0015253 3300035117 Bacteria 2780
636 Ga0373953_0166333 3300035117 Bacteria 949
637 Ga0373954_0164095 3300035118 Unclassified 1087
638 Ga0373957_0072849 3300035120 Bacteria 1346
639 Ga0373960_0001105 3300035121 Bacteria 5822
640 Ga0373943_0049659 3300035170 Unclassified 2059
641 Ga0373943_0106659 3300035170 Bacteria 1472
642 Ga0373946_0001638 3300035171 Bacteria 7812
643 Ga0373946_0032466 3300035171 Bacteria 2097
644 Ga0373955_0008367 3300035172 Bacteria 4802
645 Ga0373955_0104414 3300035172 Bacteria 1631
646 Ga0373955_0111540 3300035172 Bacteria 1582
647 Ga0373942_0001164 3300035207 Bacteria 6980
648 Ga0373961_0008211 3300035241 Bacteria 2537
649 Ga0373962_0001539 3300035242 Bacteria 5455
650 Ga0373962_0008449 3300035242 Bacteria 2534
651 Ga0373931_0001339 3300035691 Bacteria 10529
652 Ga0373935_0030617 3300035692 Bacteria 3336
653 Ga0373947_0038985 3300035725 Bacteria 2826
654 Ga0373947_0207548 3300035725 Unclassified 1284
655 Ga0373947_0482571 3300035725 Bacteria 841
656 Ga0373937_0018849 3300036401 Bacteria 6170
657 Ga0373937_0060753 3300036401 Bacteria 3473
658 Ga0373937_0064760 3300036401 Bacteria 3363
659 Ga0373937_0080422 3300036401 Bacteria 3014
660 Ga0373937_0112797 3300036401 Bacteria 2529
661 Ga0373937_0172902 3300036401 Bacteria 2027
662 Ga0373937_0186764 3300036401 Bacteria 1947
663 Ga0373937_0651844 3300036401 Bacteria 998
664 Ga0373937_0681030 3300036401 Unclassified 974
665 Ga0373937_0718911 3300036401 Bacteria 946
666 Ga0373925_0003499 3300037068 Bacteria 12135
667 Ga0373925_0052955 3300037068 Bacteria 3033
668 Ga0373925_0078941 3300037068 Bacteria 2500
669 Ga0373925_0104291 3300037068 Bacteria 2183
670 Ga0395905_0585186 3300037471 Bacteria 1018
671 Ga0439435_0117079 3300042436 Bacteria 832
672 Ga0439464_0010728 3300042439 Bacteria 2421
673 Ga0439464_0024401 3300042439 Bacteria 1672
674 Ga0453683_0296418 3300044673 Unclassified 1034
675 Ga0466963_0006293 3300044694 Bacteria 7020
676 Ga0451576_0010882 3300045051 Bacteria 10408
677 Ga0451576_0030058 3300045051 Bacteria 5809
678 Ga0451576_0032414 3300045051 Bacteria 5563
679 Ga0451576_0097711 3300045051 Bacteria 3054
680 Ga0466958_0500127 3300045836 Unclassified 789
681 Ga0495592_0022751 3300046454 Bacteria 4767
682 Ga0495603_0057252 3300046455 Bacteria 2307
683 Ga0495629_0048012 3300046459 Bacteria 2994
684 Ga0495651_0278237 3300046462 Bacteria 1132
685 Ga0495580_0063019 3300046472 Unclassified 2601
686 Ga0495582_0167053 3300046473 Bacteria 1252
687 Ga0495639_0098274 3300046475 Bacteria 1380
688 Ga0495639_0223175 3300046475 Bacteria 927
689 Ga0495662_0144998 3300046476 Bacteria 1169
690 Ga0495664_0132254 3300046477 Bacteria 1511
691 Ga0495584_0054333 3300046491 Bacteria 2016
692 Ga0495594_0024051 3300046499 Bacteria 3269
693 Ga0495594_0292169 3300046499 Unclassified 929
694 Ga0495608_0087619 3300046511 Bacteria 2016
695 Ga0495608_0262334 3300046511 Bacteria 1075
696 Ga0495618_0356591 3300046514 Bacteria 901
697 Ga0495628_0503672 3300046516 Bacteria 874
698 Ga0495630_0002524 3300046517 Bacteria 12693
699 Ga0495652_0046933 3300046529 Bacteria 3707
700 Ga0495640_0081431 3300046533 Bacteria 2152
701 Ga0495586_0031291 3300046535 Bacteria 2849
702 Ga0495587_0039137 3300046536 Bacteria 2840
703 Ga0495587_0041294 3300046536 Bacteria 2753
704 Ga0495598_0047797 3300046537 Bacteria 1277
705 Ga0495609_0021996 3300046538 Bacteria 2940
706 Ga0495621_0003970 3300046539 Bacteria 4115
707 Ga0495645_0011107 3300046543 Bacteria 6332
708 Ga0495645_0020671 3300046543 Bacteria 4753
709 Ga0495645_0196252 3300046543 Bacteria 1372
710 Ga0495645_0338771 3300046543 Bacteria 972
711 Ga0495667_0049737 3300046559 Bacteria 2767
712 Ga0495656_0159667 3300046615 Unclassified 1095
713 Ga0495634_0153617 3300046642 Bacteria 1454
714 Ga0495657_0132838 3300046675 Bacteria 1558
715 Ga0495647_0016158 3300046681 Bacteria 2625
716 Ga0495647_0040111 3300046681 Bacteria 1778
717 Ga0495658_0072565 3300046683 Bacteria 2002
718 Ga0495658_0097146 3300046683 Unclassified 1753
719 Ga0495669_0022217 3300046684 Bacteria 2755
720 Ga0495669_0039187 3300046684 Bacteria 2098
721 Ga0495669_0119386 3300046684 Bacteria 1235
722 Ga0495669_0189203 3300046684 Bacteria 982
723 Ga0495613_0001120 3300046689 Bacteria 20390
724 Ga0495613_0060387 3300046689 Bacteria 2777
725 Ga0495613_0088719 3300046689 Bacteria 2241
726 Ga0495649_0056727 3300046694 Bacteria 2114
727 Ga0495581_0062195 3300047315 Bacteria 2157
728 Ga0495604_0079607 3300047317 Bacteria 2457
729 Ga0495674_0025768 3300047319 Bacteria 5386
730 Ga0495674_0118205 3300047319 Bacteria 2242
731 Ga0495680_0109127 3300047322 Bacteria 2053
732 Ga0495680_0116286 3300047322 Bacteria 1978
733 Ga0495675_0182867 3300047444 Bacteria 1283
734 Ga0495677_0184230 3300047445 Bacteria 810
735 Ga0495684_0000815 3300047471 Bacteria 25228
736 Ga0495684_0041817 3300047471 Bacteria 3512
737 Ga0496100_0020620 3300048903 Bacteria 3955
738 Ga0496101_0000466 3300048904 Bacteria 25564
739 Ga0496102_0101278 3300048905 Bacteria 2676
740 Ga0496102_0414584 3300048905 Bacteria 1265
741 Ga0496104_0049150 3300048907 Bacteria 3977
742 Ga0496104_0057164 3300048907 Bacteria 3691
743 Ga0496104_0072111 3300048907 Bacteria 3284
744 Ga0496104_0129925 3300048907 Bacteria 2420
745 Ga0496104_0131801 3300048907 Bacteria 2401
746 Ga0496104_0186632 3300048907 Bacteria 1984
747 Ga0496105_0071832 3300048908 Bacteria 2860
748 Ga0496105_0081824 3300048908 Bacteria 2667
749 Ga0496106_0008838 3300048909 Bacteria 7445
750 Ga0496106_0022220 3300048909 Bacteria 4712
751 Ga0496106_0254729 3300048909 Unclassified 1404
752 Ga0496106_0703669 3300048909 Bacteria 805
753 Ga0496108_0051086 3300048911 Bacteria 3463
754 Ga0496108_0184369 3300048911 Bacteria 1808
755 Ga0496109_0003744 3300048912 Bacteria 12710
756 Ga0496109_0122352 3300048912 Bacteria 2425
757 Ga0496109_0642979 3300048912 Bacteria 998
758 Ga0496109_0926257 3300048912 Bacteria 809
759 Ga0496110_0001714 3300048913 Bacteria 16145
760 Ga0496110_0195418 3300048913 Bacteria 1837
761 Ga0496111_0069806 3300048914 Bacteria 2555
762 Ga0496112_0003060 3300048915 Bacteria 13696
763 Ga0496112_0053531 3300048915 Bacteria 3964
764 Ga0496112_0159923 3300048915 Bacteria 2219
765 Ga0496112_0175183 3300048915 Bacteria 2110
766 Ga0496112_0565525 3300048915 Bacteria 1070
767 Ga0496113_0123091 3300048916 Bacteria 2030
768 Ga0496113_0153694 3300048916 Unclassified 1816
769 Ga0496113_0183075 3300048916 Bacteria 1661
770 Ga0496114_0008145 3300048917 Bacteria 8304
771 Ga0496114_0050125 3300048917 Bacteria 3475
772 Ga0496114_0310975 3300048917 Bacteria 1392
773 Ga0496114_0652414 3300048917 Unclassified 925
774 Ga0496115_0070632 3300048918 Bacteria 2831
775 Ga0496115_0343744 3300048918 Unclassified 1217
776 Ga0501298_030727 3300049521 Bacteria 1053
777 Ga0501031_0131828 3300049568 Bacteria 1633
778 Ga0501032_0182692 3300049569 Bacteria 1373
779 Ga0501036_0099355 3300049572 Bacteria 2461
780 Ga0501036_0151628 3300049572 Bacteria 1955
781 Ga0501037_0411344 3300049573 Bacteria 927
782 Ga0501039_0071651 3300049575 Bacteria 2693
783 Ga0501041_0032186 3300049577 Bacteria 3170
784 Ga0501041_0048293 3300049577 Bacteria 2592
785 Ga0501046_0244371 3300049580 Bacteria 1323
786 Ga0501048_0157728 3300049582 Bacteria 1605
787 Ga0501067_0036193 3300049583 Bacteria 2742
788 Ga0501068_0032699 3300049584 Bacteria 3093
789 Ga0501070_0614116 3300049586 Unclassified 866
790 Ga0501072_0056636 3300049588 Bacteria 3089
791 Ga0501075_0148311 3300049591 Bacteria 1788
792 Ga0501075_0194137 3300049591 Bacteria 1549
793 Ga0501075_0195472 3300049591 Bacteria 1543
794 Ga0501076_0156589 3300049592 Bacteria 1855
795 Ga0501076_0238443 3300049592 Bacteria 1487
796 Ga0501079_0177019 3300049741 Bacteria 1664
797 Ga0501081_0015446 3300049743 Bacteria 5038
798 Ga0501081_0170112 3300049743 Bacteria 1573
799 Ga0501279_006163 3300049775 Bacteria 1583
800 Ga0501035_0189384 3300049822 Bacteria 1769
801 Ga0501045_0021438 3300049824 Bacteria 4622
802 nmdc:mga0k408_334056_c1 3300050493 Bacteria 904
803 nmdc:mga05p37_11228_c1 3300050507 Bacteria 10650
804 nmdc:mga05p37_1186499_c1 3300050507 Bacteria 790
805 nmdc:mga05p37_15459_c1 3300050507 Bacteria 9172
806 nmdc:mga05p37_1599_c1 3300050507 Bacteria 26280
807 nmdc:mga05p37_171972_c1 3300050507 Bacteria 2642
808 nmdc:mga05p37_18381_c1 3300050507 Bacteria 5693
809 nmdc:mga05p37_21209_c1 3300050507 Bacteria 7866
810 nmdc:mga05p37_242725_c1 3300050507 Bacteria 2165
811 nmdc:mga05p37_258_c1 3300050507 Bacteria 54798
812 nmdc:mga05p37_27882_c1 3300050507 Bacteria 6880
813 nmdc:mga05p37_30227_c1 3300050507 Bacteria 6609
814 nmdc:mga05p37_34531_c1 3300050507 Bacteria 6195
815 nmdc:mga05p37_4283_c1 3300050507 Bacteria 16664
816 nmdc:mga05p37_4593_c1 3300050507 Bacteria 16146
817 nmdc:mga05p37_72231_c1 3300050507 Bacteria 4246
818 nmdc:mga05p37_90291_c1 3300050507 Bacteria 3776
819 nmdc:mga09592_20733_c1 3300050508 Bacteria 5409
820 nmdc:mga09592_4876_c1 3300050508 Bacteria 10865
821 nmdc:mga09592_72325_c1 3300050508 Bacteria 2928
822 nmdc:mga0qj67_160137_c1 3300050509 Bacteria 1827
823 nmdc:mga0qj67_42553_c1 3300050509 Unclassified 3576
824 nmdc:mga06r32_12341_c1 3300050510 Bacteria 7705
825 nmdc:mga06r32_59790_c1 3300050510 Bacteria 3666
826 nmdc:mga06r32_7219_c1 3300050510 Bacteria 10013
827 nmdc:mga06r32_80498_c1 3300050510 Bacteria 3170
828 nmdc:mga08y16_1203_c1 3300050511 Bacteria 25560
829 nmdc:mga08y16_2048_c1 3300050511 Bacteria 20654
830 nmdc:mga08y16_25050_c1 3300050511 Bacteria 6294
831 nmdc:mga08y16_315298_c1 3300050511 Bacteria 1610
832 nmdc:mga08y16_324638_c1 3300050511 Bacteria 1584
833 nmdc:mga08y16_340613_c1 3300050511 Bacteria 1541
834 nmdc:mga08y16_340931_c1 3300050511 Bacteria 1541
835 nmdc:mga08y16_38655_c1 3300050511 Bacteria 5009
836 nmdc:mga08y16_42089_c1 3300050511 Bacteria 4784
837 nmdc:mga08y16_683_c1 3300050511 Bacteria 32086
838 nmdc:mga08y16_72047_c1 3300050511 Bacteria 3600
839 nmdc:mga08y16_803877_c1 3300050511 Bacteria 933
840 nmdc:mga0n895_10897_c1 3300050512 Bacteria 8075
841 nmdc:mga0n895_183222_c1 3300050512 Bacteria 2126
842 nmdc:mga0n895_190314_c1 3300050512 Bacteria 2083
843 nmdc:mga0n895_275145_c1 3300050512 Bacteria 1708
844 nmdc:mga0n895_321218_c1 3300050512 Bacteria 1569
845 nmdc:mga0n895_7160_c1 3300050512 Bacteria 9544
846 nmdc:mga0n895_7363_c1 3300050512 Bacteria 9439
847 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
848 nmdc:mga0rr50_10783_c1 3300050513 Bacteria 5824
849 nmdc:mga0rr50_111426_c1 3300050513 Bacteria 2166
850 nmdc:mga0rr50_13432_c1 3300050513 Bacteria 5331
851 nmdc:mga0rr50_177481_c1 3300050513 Bacteria 1739
852 nmdc:mga0rr50_189058_c1 3300050513 Bacteria 1687
853 nmdc:mga0rr50_2477_c1 3300050513 Bacteria 10426
854 nmdc:mga0rr50_27749_c1 3300050513 Bacteria 3970
855 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
856 nmdc:mga0rr50_293108_c1 3300050513 Bacteria 1360
857 nmdc:mga0rr50_315048_c1 3300050513 Unclassified 1311
858 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
859 nmdc:mga08x19_144111_c1 3300050514 Bacteria 1610
860 nmdc:mga08x19_15867_c1 3300050514 Bacteria 4588
861 nmdc:mga08x19_247736_c1 3300050514 Bacteria 1230
862 nmdc:mga08x19_26134_c1 3300050514 Bacteria 3641
863 nmdc:mga08x19_53776_c1 3300050514 Bacteria 2591
864 nmdc:mga0a205_12438_c2 3300050515 Bacteria 3699
865 nmdc:mga0a205_190754_c1 3300050515 Bacteria 1942
866 nmdc:mga0a205_19609_c1 3300050515 Bacteria 6378
867 nmdc:mga0a205_2495_c1 3300050515 Bacteria 16223
868 nmdc:mga0a205_31381_c1 3300050515 Bacteria 5091
869 nmdc:mga0a205_45473_c1 3300050515 Bacteria 4233
870 nmdc:mga0a205_4835_c1 3300050515 Bacteria 12115
871 nmdc:mga0a205_578242_c1 3300050515 Unclassified 977
872 nmdc:mga0a205_83668_c1 3300050515 Bacteria 3082
873 Ga0495601_0014998 3300053077 Bacteria 4680
874 Ga0495601_0074766 3300053077 Bacteria 2168
875 Ga0495595_0122606 3300053084 Bacteria 1267
876 Ga0495619_0014190 3300053085 Bacteria 5031
877 Ga0495619_0032259 3300053085 Bacteria 3398
878 Ga0495619_0045239 3300053085 Bacteria 2892
879 Ga0495619_0065221 3300053085 Bacteria 2429
880 Ga0501084_0133021 3300054114 Bacteria 2094
881 Ga0501084_0216947 3300054114 Bacteria 1614
882 Ga0590071_000032 3300059421 Bacteria 36750
883 Ga0590071_040217 3300059421 Unclassified 1124
884 Ga0590074_000020 3300059423 Bacteria 19078
885 Ga0590075_023782 3300059424 Bacteria 1535
886 Ga0590077_000571 3300059426 Bacteria 10170
887 Ga0590077_032640 3300059426 Bacteria 1141
888 Ga0501082_0026016 3300060353 Bacteria 5044
889 Ga0530510_0081664 3300061734 Bacteria 2354
890 Ga0070681_10123052
891 Ga0065704_10005744
892 Ga0065712_10083501
893 Ga0065715_10023114
894 Ga0065715_10039956
895 Ga0065707_10107417
896 Ga0065707_10117009
897 Ga0065707_10168072
898 Ga0065707_10246396
899 Ga0070676_10057125
900 Ga0070676_10064197
901 Ga0070676_10173484
902 Ga0070670_100108010
903 Ga0070670_100255531
904 Ga0070670_100293183
905 Ga0070670_100330531
906 Ga0070670_100363136
907 Ga0068869_100062718
908 Ga0068869_100123755
909 Ga0070666_10041845
910 Ga0070680_100059714
911 Ga0070680_100164524
912 Ga0070682_100033947
913 Ga0070682_100156409
914 Ga0068868_100019812
915 Ga0068868_100032665
916 Ga0068868_100194618
917 Ga0070660_100044926
918 Ga0070660_100128337
919 Ga0070689_100035206
920 Ga0070689_100102727
921 Ga0070689_100279866
922 Ga0070689_100806268
923 Ga0070691_10012395
924 Ga0070687_100047738
925 Ga0070687_100148953
926 Ga0070661_100093875
927 Ga0070668_100026798
928 Ga0070668_100231570
929 Ga0070668_100482275
930 Ga0070669_100000264
931 Ga0070669_100001306
932 Ga0070669_100039290
933 Ga0070669_100086807
934 Ga0070669_100131497
935 Ga0070669_100227282
936 Ga0070675_100000587
937 Ga0070675_100000749
938 Ga0070675_100006777
939 Ga0070675_100044403
940 Ga0070675_100069482
941 Ga0070675_100077710
942 Ga0070675_100311735
943 Ga0070675_100518947
944 Ga0070671_100013365
945 Ga0070671_100078870
946 Ga0070674_100021858
947 Ga0070674_100061509
948 Ga0070674_100296196
949 Ga0070673_100006409
950 Ga0070673_100027917
951 Ga0070673_100054853
952 Ga0070673_100248466
953 Ga0070673_100810474
954 Ga0070688_100002708
955 Ga0070688_100086907
956 Ga0070688_100184002
957 Ga0070688_100277566
958 Ga0070688_100374672
959 Ga0070659_100154244
960 Ga0070659_100321575
961 Ga0070667_100059552
962 Ga0070667_100066193
963 Ga0070667_100365118
964 Ga0070709_10056885
965 Ga0070709_10141857
966 Ga0070714_100031292
967 Ga0070713_100030380
968 Ga0070713_100114830
969 Ga0070701_10029848
970 Ga0070701_10060686
971 Ga0070711_100278738
972 Ga0070705_100008229
973 Ga0070705_100047999
974 Ga0070705_100105192
975 Ga0070700_100002184
976 Ga0070700_100197304
977 Ga0070700_100222398
978 Ga0070700_100342985
979 Ga0070694_100000569
980 Ga0070694_100003072
981 Ga0070694_100018429
982 Ga0070694_100057307
983 Ga0070694_100095404
984 Ga0070708_100274525
985 Ga0070678_100150274
986 Ga0070678_100181389
987 Ga0070678_100268073
988 Ga0070678_100569612
989 Ga0070662_100174856
990 Ga0070662_100271413
991 Ga0070662_100277333
992 Ga0070662_100347165
993 Ga0070662_100512086
994 Ga0070681_10014561
995 Ga0068867_100004297
996 Ga0068867_100071461
997 Ga0068867_100105258
998 Ga0068867_100158957
999 Ga0068867_100181492
1000 Ga0068867_100578119
1001 Ga0070685_10019330
1002 Ga0070685_10046806
1003 Ga0070706_100134086
1004 Ga0070707_100023835
1005 Ga0070707_100113752
1006 Ga0070707_100588363
1007 Ga0070698_100020802
1008 Ga0070698_100031883
1009 Ga0070698_100185237
1010 Ga0070698_100277424
1011 Ga0070699_100001533
1012 Ga0070699_100002607
1013 Ga0070699_100002875
1014 Ga0070699_100094444
1015 Ga0070699_100266742
1016 Ga0070679_100029446
1017 Ga0070679_100363404
1018 Ga0070679_100648002
1019 Ga0070684_100018523
1020 Ga0070684_100116823
1021 Ga0070684_100140327
1022 Ga0070684_100518628
1023 Ga0070697_100020689
1024 Ga0070697_100042287
1025 Ga0070697_100231654
1026 Ga0070697_100467990
1027 Ga0070697_100540095
1028 Ga0070672_100053482
1029 Ga0070672_100090297
1030 Ga0070672_100216223
1031 Ga0070672_100216523
1032 Ga0070672_100305422
1033 Ga0070672_100604284
1034 Ga0070686_100003404
1035 Ga0070686_100049550
1036 Ga0070686_100093525
1037 Ga0070686_100426937
1038 Ga0070686_100529778
1039 Ga0070695_100000124
1040 Ga0070695_100011723
1041 Ga0070695_100016127
1042 Ga0070695_100113344
1043 Ga0070695_100334056
1044 Ga0070696_100000603
1045 Ga0070696_100010316
1046 Ga0070696_100016578
1047 Ga0070696_100033595
1048 Ga0070696_100061580
1049 Ga0070696_100063983
1050 Ga0070696_100448167
1051 Ga0070665_100006321
1052 Ga0070665_100023606
1053 Ga0070665_100043689
1054 Ga0070665_100424045
1055 Ga0070704_100000097
1056 Ga0070704_100000945
1057 Ga0070704_100014012
1058 Ga0070704_100016350
1059 Ga0068855_100026283
1060 Ga0070664_100156424
1061 Ga0070664_100778772
1062 Ga0068857_100015032
1063 Ga0068857_100662456
1064 Ga0068854_100007559
1065 Ga0068854_100175873
1066 Ga0070702_100008161
1067 Ga0070702_100010116
1068 Ga0070702_100307540
1069 Ga0068859_100020009
1070 Ga0068859_100025466
1071 Ga0068859_100074934
1072 Ga0068859_100258701
1073 Ga0068859_100266118
1074 Ga0068859_100341142
1075 Ga0068859_100477024
1076 Ga0068864_100002718
1077 Ga0068864_100047876
1078 Ga0068864_100212799
1079 Ga0068864_100713177
1080 Ga0068866_10075320
1081 Ga0068866_10126763
1082 Ga0068861_100024254
1083 Ga0068861_100213883
1084 Ga0068861_100254332
1085 Ga0068861_100475427
1086 Ga0068861_100884160
1087 Ga0068870_10001652
1088 Ga0068870_10034993
1089 Ga0068863_100019269
1090 Ga0068863_100023402
1091 Ga0068863_100167931
1092 Ga0068863_100257172
1093 Ga0068863_100518815
1094 Ga0068858_100032722
1095 Ga0068858_100060345
1096 Ga0068858_100062205
1097 Ga0068858_100218896
1098 Ga0068858_100279141
1099 Ga0068858_100620487
1100 Ga0068858_100792027
1101 Ga0068860_100003758
1102 Ga0068860_100183793
1103 Ga0068860_100201283
1104 Ga0068860_100301865
1105 Ga0068860_100336865
1106 Ga0068860_100437203
1107 Ga0068860_100632049
1108 Ga0068862_100000749
1109 Ga0068862_100054573
1110 Ga0068862_100152196
1111 Ga0068862_100879165
1112 Ga0081455_10134584
1113 Ga0081538_10067139
1114 Ga0081540_1052203
1115 Ga0081539_10014609
1116 Ga0081539_10098834
1117 Ga0070717_10322744
1118 Ga0075432_10156968
1119 Ga0070715_10014762
1120 Ga0070715_10116063
1121 Ga0075366_10260244
1122 Ga0097621_100000491
1123 Ga0097621_100005792
1124 Ga0097621_100024795
1125 Ga0097621_100104325
1126 Ga0097621_100449954
1127 Ga0068871_100002113
1128 Ga0068871_100018319
1129 Ga0068871_100033643
1130 Ga0068871_100154601
1131 Ga0068871_100155682
1132 Ga0075428_100023605
1133 Ga0075428_100029572
1134 Ga0075428_100030937
1135 Ga0075428_100205646
1136 Ga0075428_100598306
1137 Ga0075428_100678150
1138 Ga0075430_100508993
1139 Ga0075431_100007886
1140 Ga0075431_100018548
1141 Ga0075431_100203534
1142 Ga0075433_10053857
1143 Ga0075433_10133008
1144 Ga0075433_10160059
1145 Ga0075433_10224574
1146 Ga0075433_10225771
1147 Ga0075433_10450443
1148 Ga0075434_100000049
1149 Ga0075434_100003854
1150 Ga0075434_100004767
1151 Ga0075434_100021121
1152 Ga0075434_100030808
1153 Ga0075434_100056893
1154 Ga0075434_100194093
1155 Ga0075434_100199351
1156 Ga0075434_100267905
1157 Ga0075429_100011138
1158 Ga0075429_100029270
1159 Ga0075429_100116338
1160 Ga0075429_100147587
1161 Ga0075429_100212881
1162 Ga0068865_100009422
1163 Ga0068865_100245946
1164 Ga0068865_100454671
1165 Ga0075436_100006478
1166 Ga0075436_100010035
1167 Ga0075436_100269876
1168 Ga0097620_100020009
1169 Ga0097620_100025467
1170 Ga0097620_100074936
1171 Ga0097620_100258702
1172 Ga0097620_100266110
1173 Ga0097620_100341133
1174 Ga0097620_100477032
1175 Ga0075435_100000059
1176 Ga0075435_100008041
1177 Ga0075435_100015546
1178 Ga0075435_100015594
1179 Ga0075435_100017361
1180 Ga0075435_100131065
1181 Ga0075435_100141737
1182 Ga0075435_100144953
1183 Ga0075435_100157889
1184 Ga0075435_100283200
1185 Ga0099794_10101708
1186 Ga0105240_10039818
1187 Ga0105240_10222432
1188 Ga0105240_10246761
1189 Ga0105240_10612423
1190 Ga0111539_10000302
1191 Ga0111539_10001892
1192 Ga0111539_10004585
1193 Ga0111539_10021248
1194 Ga0111539_10077568
1195 Ga0111539_10141396
1196 Ga0111539_10255836
1197 Ga0111539_10328499
1198 Ga0111539_10424749
1199 Ga0105245_10090614
1200 Ga0105245_10342672
1201 Ga0105245_10879218
1202 Ga0105245_10960064
1203 Ga0105247_10242507
1204 Ga0114129_10001012
1205 Ga0114129_10003005
1206 Ga0114129_10004708
1207 Ga0114129_10019189
1208 Ga0114129_10021328
1209 Ga0114129_10022388
1210 Ga0114129_10025206
1211 Ga0114129_10028404
1212 Ga0114129_10059634
1213 Ga0114129_10101348
1214 Ga0114129_10138111
1215 Ga0114129_10163607
1216 Ga0114129_10213102
1217 Ga0114129_10275532
1218 Ga0105243_10110520
1219 Ga0105242_10014200
1220 Ga0105242_10034773
1221 Ga0105242_10048359
1222 Ga0105242_10093310
1223 Ga0105242_10098056
1224 Ga0105242_10358264
1225 Ga0105242_10374223
1226 Ga0105242_10392319
1227 Ga0105248_10015366
1228 Ga0105248_10024459
1229 Ga0105248_10041426
1230 Ga0105248_10058826
1231 Ga0105248_10090604
1232 Ga0105248_10176754
1233 Ga0105249_10002028
1234 Ga0105249_10072455
1235 Ga0105249_10497617
1236 Ga0105239_10087519
1237 Ga0105239_10569413
1238 Ga0157374_10096436
1239 Ga0157374_10239279
1240 Ga0157374_10346066
1241 Ga0157378_10154208
1242 Ga0157378_10220642
1243 Ga0157378_10352609
1244 Ga0157378_10380729
1245 Ga0157378_10940896
1246 Ga0163162_10033862
1247 Ga0163162_10035463
1248 Ga0163162_10137317
1249 Ga0163162_10714462
1250 Ga0157372_10133743
1251 Ga0157375_10423732
1252 Ga0157375_10508944
1253 Ga0157375_11120788
1254 Ga0163163_10013754
1255 Ga0163163_10023292
1256 Ga0163163_10077144
1257 Ga0163163_10206330
1258 Ga0163163_10263912
1259 Ga0163163_10560549
1260 Ga0163163_10876563
1261 Ga0163163_10955127
1262 Ga0157380_10147420
1263 Ga0157380_10158824
1264 Ga0157377_10019531
1265 Ga0157377_10041517
1266 Ga0157377_10063454
1267 Ga0157379_10015595
1268 Ga0157379_10296337
1269 Ga0157376_10005986
1270 Ga0157376_10008590
1271 Ga0157376_10276704
1272 Ga0182005_1060022
1273 Ga0163161_10112387
1274 Ga0163161_10281652
1275 Ga0207697_10077726
1276 Ga0207653_10067328
1277 Ga0207682_10023520
1278 Ga0207642_10107688
1279 Ga0207642_10109452
1280 Ga0207642_10125043
1281 Ga0207642_10143281
1282 Ga0207710_10135426
1283 Ga0207688_10085967
1284 Ga0207688_10130627
1285 Ga0207688_10131187
1286 Ga0207688_10296100
1287 Ga0207680_10004861
1288 Ga0207680_10049266
1289 Ga0207699_10015659
1290 Ga0207699_10314503
1291 Ga0207645_10004578
1292 Ga0207645_10020293
1293 Ga0207645_10029897
1294 Ga0207645_10102076
1295 Ga0207645_10131190
1296 Ga0207645_10139877
1297 Ga0207643_10013421
1298 Ga0207643_10013830
1299 Ga0207643_10051052
1300 Ga0207643_10129875
1301 Ga0207705_10131076
1302 Ga0207684_10131770
1303 Ga0207684_10449720
1304 Ga0207707_10013353
1305 Ga0207707_10046833
1306 Ga0207707_10143601
1307 Ga0207695_10081035
1308 Ga0207695_10181056
1309 Ga0207671_10186003
1310 Ga0207660_10059359
1311 Ga0207660_10075487
1312 Ga0207660_10300696
1313 Ga0207657_10131568
1314 Ga0207649_10224193
1315 Ga0207652_10033860
1316 Ga0207652_10047508
1317 Ga0207646_10022608
1318 Ga0207646_10036407
1319 Ga0207646_10247538
1320 Ga0207646_10589939
1321 Ga0207646_10843104
1322 Ga0207681_10004895
1323 Ga0207681_10008133
1324 Ga0207681_10015023
1325 Ga0207681_10028024
1326 Ga0207681_10037192
1327 Ga0207681_10081464
1328 Ga0207650_10011773
1329 Ga0207650_10027640
1330 Ga0207650_10103024
1331 Ga0207650_10178800
1332 Ga0207650_10312515
1333 Ga0207659_10001094
1334 Ga0207659_10009668
1335 Ga0207659_10019956
1336 Ga0207659_10024502
1337 Ga0207659_10025012
1338 Ga0207659_10050879
1339 Ga0207659_10393909
1340 Ga0207687_10056093
1341 Ga0207687_10271429
1342 Ga0207700_10059927
1343 Ga0207700_10224890
1344 Ga0207644_10038521
1345 Ga0207644_10057432
1346 Ga0207644_10131705
1347 Ga0207644_10153394
1348 Ga0207644_10364242
1349 Ga0207690_10127836
1350 Ga0207706_10015058
1351 Ga0207706_10019924
1352 Ga0207706_10096822
1353 Ga0207706_10112625
1354 Ga0207706_10177607
1355 Ga0207706_10210215
1356 Ga0207706_10265998
1357 Ga0207706_10290315
1358 Ga0207706_10364732
1359 Ga0207706_10391283
1360 Ga0207686_10036908
1361 Ga0207686_10037348
1362 Ga0207686_10277135
1363 Ga0207709_10183604
1364 Ga0207709_10300004
1365 Ga0207670_10027558
1366 Ga0207670_10090698
1367 Ga0207669_10302878
1368 Ga0207669_10338354
1369 Ga0207669_10534644
1370 Ga0207669_10583872
1371 Ga0207704_10004994
1372 Ga0207704_10009533
1373 Ga0207704_10023654
1374 Ga0207665_10061466
1375 Ga0207665_10208183
1376 Ga0207691_10053260
1377 Ga0207691_10074820
1378 Ga0207691_10124544
1379 Ga0207691_10142090
1380 Ga0207691_10145152
1381 Ga0207691_10174062
1382 Ga0207691_10339974
1383 Ga0207691_10456333
1384 Ga0207711_10039867
1385 Ga0207711_10056174
1386 Ga0207711_10065938
1387 Ga0207711_10159170
1388 Ga0207711_10305220
1389 Ga0207711_10316551
1390 Ga0207711_10393780
1391 Ga0207711_10437161
1392 Ga0207689_10025024
1393 Ga0207689_10141646
1394 Ga0207661_10099803
1395 Ga0207679_10237714
1396 Ga0207679_10250392
1397 Ga0207679_10274261
1398 Ga0207679_10732270
1399 Ga0207667_10280624
1400 Ga0207651_10075494
1401 Ga0207651_10112204
1402 Ga0207651_10235954
1403 Ga0207651_10328295
1404 Ga0207712_10041060
1405 Ga0207712_10085105
1406 Ga0207668_10264670
1407 Ga0207640_10007862
1408 Ga0207640_10127994
1409 Ga0207640_10516939
1410 Ga0207658_10041384
1411 Ga0207658_10400663
1412 Ga0207677_10043367
1413 Ga0207677_10072795
1414 Ga0207677_10183864
1415 Ga0207677_10216283
1416 Ga0207703_10016709
1417 Ga0207703_10018624
1418 Ga0207703_10048022
1419 Ga0207703_10062132
1420 Ga0207703_10067881
1421 Ga0207703_10161436
1422 Ga0207703_10323391
1423 Ga0207639_10303548
1424 Ga0207639_10305470
1425 Ga0207639_10608362
1426 Ga0207639_10720423
1427 Ga0207708_10002562
1428 Ga0207708_10116697
1429 Ga0207708_10122903
1430 Ga0207708_10199866
1431 Ga0207708_10216290
1432 Ga0207708_10284302
1433 Ga0207708_10483341
1434 Ga0207702_10165652
1435 Ga0207641_10024834
1436 Ga0207641_10029889
1437 Ga0207641_10051109
1438 Ga0207641_10154222
1439 Ga0207641_10668175
1440 Ga0207648_10008209
1441 Ga0207648_10027796
1442 Ga0207648_10042137
1443 Ga0207648_10050180
1444 Ga0207648_10050966
1445 Ga0207648_10223202
1446 Ga0207648_10740454
1447 Ga0207676_10010823
1448 Ga0207676_10115499
1449 Ga0207676_10167989
1450 Ga0207676_10400533
1451 Ga0207674_10017024
1452 Ga0207674_10072771
1453 Ga0207674_10078599
1454 Ga0207675_100003438
1455 Ga0207675_100034055
1456 Ga0207675_100058008
1457 Ga0207675_100236706
1458 Ga0207675_100408103
1459 Ga0207675_100600072
1460 Ga0207683_10025931
1461 Ga0207683_10168473
1462 Ga0207683_10251697
1463 Ga0207683_10797775
1464 Ga0209588_1074277
1465 Ga0209974_10035288
1466 Ga0207428_10008383
1467 Ga0207428_10027280
1468 Ga0207428_10046000
1469 Ga0207428_10084674
1470 Ga0207428_10121814
1471 Ga0207428_10145031
1472 Ga0207428_10195697
1473 Ga0207428_10480537
1474 Ga0268266_10010811
1475 Ga0268266_10011705
1476 Ga0268266_10029494
1477 Ga0268266_10058628
1478 Ga0268265_10002669
1479 Ga0268265_10024669
1480 Ga0268265_10129357
1481 Ga0268265_10163584
1482 Ga0268265_10225527
1483 Ga0268265_10459994
1484 Ga0268264_10004891
1485 Ga0268264_10048002
1486 Ga0268264_10078272
1487 Ga0268264_10217305
1488 Ga0268264_10266903
1489 Ga0268264_10718692
1490 Ga0307513_10449732
1491 Ga0265314_10033821
1492 Ga0265314_10054186
1493 Ga0307407_10025155
1494 Ga0307412_10283680
1495 Ga0307409_100185594
1496 Ga0307416_100181786
1497 Ga0307416_100872172
1498 Ga0307411_10070786
1499 Ga0373930_0002318
1500 Ga0373948_0037372
1501 Ga0373958_0000280
1502 Ga0373958_0051375
1503 Ga0373959_0002455
1504 Ga0373938_0009755
1505 Ga0373926_0018070
1506 Ga0373926_0079232
1507 Ga0373928_0007027
1508 Ga0373928_0015460
1509 Ga0373929_0000330
1510 Ga0373934_0009339
1511 Ga0373934_0017305
1512 Ga0373934_0107884
1513 Ga0373934_0200018
1514 Ga0373940_0002448
1515 Ga0373949_0002142
1516 Ga0373951_0005326
1517 Ga0373952_0000702
1518 Ga0373923_0127845
1519 Ga0373932_0000898
1520 Ga0373936_0024840
1521 Ga0373939_0000740
1522 Ga0373939_0054501
1523 Ga0373945_0165630
1524 Ga0373953_0015253
1525 Ga0373953_0166333
1526 Ga0373954_0164095
1527 Ga0373957_0072849
1528 Ga0373960_0001105
1529 Ga0373943_0049659
1530 Ga0373943_0106659
1531 Ga0373946_0001638
1532 Ga0373946_0032466
1533 Ga0373955_0008367
1534 Ga0373955_0104414
1535 Ga0373955_0111540
1536 Ga0373942_0001164
1537 Ga0373961_0008211
1538 Ga0373962_0001539
1539 Ga0373962_0008449
1540 Ga0373931_0001339
1541 Ga0373935_0030617
1542 Ga0373947_0038985
1543 Ga0373947_0207548
1544 Ga0373947_0482571
1545 Ga0373937_0018849
1546 Ga0373937_0060753
1547 Ga0373937_0064760
1548 Ga0373937_0080422
1549 Ga0373937_0112797
1550 Ga0373937_0172902
1551 Ga0373937_0186764
1552 Ga0373937_0651844
1553 Ga0373937_0681030
1554 Ga0373937_0718911
1555 Ga0373925_0003499
1556 Ga0373925_0052955
1557 Ga0373925_0078941
1558 Ga0373925_0104291
1559 Ga0395905_0585186
1560 Ga0439435_0117079
1561 Ga0439464_0010728
1562 Ga0439464_0024401
1563 Ga0453683_0296418
1564 Ga0466963_0006293
1565 Ga0451576_0010882
1566 Ga0451576_0030058
1567 Ga0451576_0032414
1568 Ga0451576_0097711
1569 Ga0466958_0500127
1570 Ga0495592_0022751
1571 Ga0495603_0057252
1572 Ga0495629_0048012
1573 Ga0495651_0278237
1574 Ga0495580_0063019
1575 Ga0495582_0167053
1576 Ga0495639_0098274
1577 Ga0495639_0223175
1578 Ga0495662_0144998
1579 Ga0495664_0132254
1580 Ga0495584_0054333
1581 Ga0495594_0024051
1582 Ga0495594_0292169
1583 Ga0495608_0087619
1584 Ga0495608_0262334
1585 Ga0495618_0356591
1586 Ga0495628_0503672
1587 Ga0495630_0002524
1588 Ga0495652_0046933
1589 Ga0495640_0081431
1590 Ga0495586_0031291
1591 Ga0495587_0039137
1592 Ga0495587_0041294
1593 Ga0495598_0047797
1594 Ga0495609_0021996
1595 Ga0495621_0003970
1596 Ga0495645_0011107
1597 Ga0495645_0020671
1598 Ga0495645_0196252
1599 Ga0495645_0338771
1600 Ga0495667_0049737
1601 Ga0495656_0159667
1602 Ga0495634_0153617
1603 Ga0495657_0132838
1604 Ga0495647_0016158
1605 Ga0495647_0040111
1606 Ga0495658_0072565
1607 Ga0495658_0097146
1608 Ga0495669_0022217
1609 Ga0495669_0039187
1610 Ga0495669_0119386
1611 Ga0495669_0189203
1612 Ga0495613_0001120
1613 Ga0495613_0060387
1614 Ga0495613_0088719
1615 Ga0495649_0056727
1616 Ga0495581_0062195
1617 Ga0495604_0079607
1618 Ga0495674_0025768
1619 Ga0495674_0118205
1620 Ga0495680_0109127
1621 Ga0495680_0116286
1622 Ga0495675_0182867
1623 Ga0495677_0184230
1624 Ga0495684_0000815
1625 Ga0495684_0041817
1626 Ga0496100_0020620
1627 Ga0496101_0000466
1628 Ga0496102_0101278
1629 Ga0496102_0414584
1630 Ga0496104_0049150
1631 Ga0496104_0057164
1632 Ga0496104_0072111
1633 Ga0496104_0129925
1634 Ga0496104_0131801
1635 Ga0496104_0186632
1636 Ga0496105_0071832
1637 Ga0496105_0081824
1638 Ga0496106_0008838
1639 Ga0496106_0022220
1640 Ga0496106_0254729
1641 Ga0496106_0703669
1642 Ga0496108_0051086
1643 Ga0496108_0184369
1644 Ga0496109_0003744
1645 Ga0496109_0122352
1646 Ga0496109_0642979
1647 Ga0496109_0926257
1648 Ga0496110_0001714
1649 Ga0496110_0195418
1650 Ga0496111_0069806
1651 Ga0496112_0003060
1652 Ga0496112_0053531
1653 Ga0496112_0159923
1654 Ga0496112_0175183
1655 Ga0496112_0565525
1656 Ga0496113_0123091
1657 Ga0496113_0153694
1658 Ga0496113_0183075
1659 Ga0496114_0008145
1660 Ga0496114_0050125
1661 Ga0496114_0310975
1662 Ga0496114_0652414
1663 Ga0496115_0070632
1664 Ga0496115_0343744
1665 Ga0501298_030727
1666 Ga0501031_0131828
1667 Ga0501032_0182692
1668 Ga0501036_0099355
1669 Ga0501036_0151628
1670 Ga0501037_0411344
1671 Ga0501039_0071651
1672 Ga0501041_0032186
1673 Ga0501041_0048293
1674 Ga0501046_0244371
1675 Ga0501048_0157728
1676 Ga0501067_0036193
1677 Ga0501068_0032699
1678 Ga0501070_0614116
1679 Ga0501072_0056636
1680 Ga0501075_0148311
1681 Ga0501075_0194137
1682 Ga0501075_0195472
1683 Ga0501076_0156589
1684 Ga0501076_0238443
1685 Ga0501079_0177019
1686 Ga0501081_0015446
1687 Ga0501081_0170112
1688 Ga0501279_006163
1689 Ga0501035_0189384
1690 Ga0501045_0021438
1691 nmdc:mga0k408_334056_c1
1692 nmdc:mga05p37_11228_c1
1693 nmdc:mga05p37_1186499_c1
1694 nmdc:mga05p37_15459_c1
1695 nmdc:mga05p37_1599_c1
1696 nmdc:mga05p37_171972_c1
1697 nmdc:mga05p37_18381_c1
1698 nmdc:mga05p37_21209_c1
1699 nmdc:mga05p37_242725_c1
1700 nmdc:mga05p37_258_c1
1701 nmdc:mga05p37_27882_c1
1702 nmdc:mga05p37_30227_c1
1703 nmdc:mga05p37_34531_c1
1704 nmdc:mga05p37_4283_c1
1705 nmdc:mga05p37_4593_c1
1706 nmdc:mga05p37_72231_c1
1707 nmdc:mga05p37_90291_c1
1708 nmdc:mga09592_20733_c1
1709 nmdc:mga09592_4876_c1
1710 nmdc:mga09592_72325_c1
1711 nmdc:mga0qj67_160137_c1
1712 nmdc:mga0qj67_42553_c1
1713 nmdc:mga06r32_12341_c1
1714 nmdc:mga06r32_59790_c1
1715 nmdc:mga06r32_7219_c1
1716 nmdc:mga06r32_80498_c1
1717 nmdc:mga08y16_1203_c1
1718 nmdc:mga08y16_2048_c1
1719 nmdc:mga08y16_25050_c1
1720 nmdc:mga08y16_315298_c1
1721 nmdc:mga08y16_324638_c1
1722 nmdc:mga08y16_340613_c1
1723 nmdc:mga08y16_340931_c1
1724 nmdc:mga08y16_38655_c1
1725 nmdc:mga08y16_42089_c1
1726 nmdc:mga08y16_683_c1
1727 nmdc:mga08y16_72047_c1
1728 nmdc:mga08y16_803877_c1
1729 nmdc:mga0n895_10897_c1
1730 nmdc:mga0n895_183222_c1
1731 nmdc:mga0n895_190314_c1
1732 nmdc:mga0n895_275145_c1
1733 nmdc:mga0n895_321218_c1
1734 nmdc:mga0n895_7160_c1
1735 nmdc:mga0n895_7363_c1
1736 nmdc:mga0n895_95_c1
1737 nmdc:mga0rr50_10783_c1
1738 nmdc:mga0rr50_111426_c1
1739 nmdc:mga0rr50_13432_c1
1740 nmdc:mga0rr50_177481_c1
1741 nmdc:mga0rr50_189058_c1
1742 nmdc:mga0rr50_2477_c1
1743 nmdc:mga0rr50_27749_c1
1744 nmdc:mga0rr50_28_c1
1745 nmdc:mga0rr50_293108_c1
1746 nmdc:mga0rr50_315048_c1
1747 nmdc:mga08x19_121_c1
1748 nmdc:mga08x19_144111_c1
1749 nmdc:mga08x19_15867_c1
1750 nmdc:mga08x19_247736_c1
1751 nmdc:mga08x19_26134_c1
1752 nmdc:mga08x19_53776_c1
1753 nmdc:mga0a205_12438_c2
1754 nmdc:mga0a205_190754_c1
1755 nmdc:mga0a205_19609_c1
1756 nmdc:mga0a205_2495_c1
1757 nmdc:mga0a205_31381_c1
1758 nmdc:mga0a205_45473_c1
1759 nmdc:mga0a205_4835_c1
1760 nmdc:mga0a205_578242_c1
1761 nmdc:mga0a205_83668_c1
1762 Ga0495601_0014998
1763 Ga0495601_0074766
1764 Ga0495595_0122606
1765 Ga0495619_0014190
1766 Ga0495619_0032259
1767 Ga0495619_0045239
1768 Ga0495619_0065221
1769 Ga0501084_0133021
1770 Ga0501084_0216947
1771 Ga0590071_000032
1772 Ga0590071_040217
1773 Ga0590074_000020
1774 Ga0590075_023782
1775 Ga0590077_000571
1776 Ga0590077_032640
1777 Ga0501082_0026016
1778 Ga0530510_0081664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

192

289

0.97

PF00072

Response_reg

Response regulator receiver domain

69

180

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.9056 13 135
1nat-assembly1.cif.gz_A crystal structure of spoof from bacillus subtilis 0.8843 14 133
3f7a-assembly1.cif.gz_A structure of orthorhombic crystal form of pseudomonas aeruginosa rssb 0.8836 13 135
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.8834 14 135
3hdg-assembly4.cif.gz_B crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes 0.8813 13 130
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9419 14 93 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9362 15 93 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9357 13 93 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9355 14 95 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9312 15 93 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2M9ZQE4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.921 13 133 GO:0000155
AF-A0A7Y5WC09-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9191 13 135 GO:0000155
GO:0005524
GO:0006355
AF-A0A7V4B076-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9137 13 135 GO:0000155
GO:0016020
AF-A0A3B9HWH5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9134 13 133 GO:0000155
GO:0005524
GO:0006355
GO:0016020
AF-A0A202DWP3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9129 13 135 GO:0000155

Map