F484692

General Info

Members Datasets Scaffolds Average Seq Length
886 394 731 121

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10284323|Ga0105244_102843231
Length 141
Sequence MGTIRQWPGPAPAEYPTLMPQGSHLESGKDAESLALRHLEQQGLRLLAQNWSCKRGELDLVMLDGDTVVFVEVRYRKNTQWGGAAGSIDARKRKKLIFAAQYFLQRESRWANSPCRFDVIAIEGALDTAPRLNWLRNAFDS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
25 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
28 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
29 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
32 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
33 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
34 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
35 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
36 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
37 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
38 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
39 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
40 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
41 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
42 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
43 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
44 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
45 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
46 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
47 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
48 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
49 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
50 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
51 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
52 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
53 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
54 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
55 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
56 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
57 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
58 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
59 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
60 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
61 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
62 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
63 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
64 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
65 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
66 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
67 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
68 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
69 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
70 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
71 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
72 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
73 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
74 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
75 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
76 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
77 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
78 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
79 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
80 2739367700 Dyella sp. YR388 Isolate Unclassified
81 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
82 2773857670 Pseudomonas sp. 478 Isolate Unclassified
83 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
84 2773857673 Pseudomonas sp. 443 Isolate Unclassified
85 2784132063 Pseudomonas sp. 424 Isolate Unclassified
86 2784132072 Pseudomonas sp. 460 Isolate Unclassified
87 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
88 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
89 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
90 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
91 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
92 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
93 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
94 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
95 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
96 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
97 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
98 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
99 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
100 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
101 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
102 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
103 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
104 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
105 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
106 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
107 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
108 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
109 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
110 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
111 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
112 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
113 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
114 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
115 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
116 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
117 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
118 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
119 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
120 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
121 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
122 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
123 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
124 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
125 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
126 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
127 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
128 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
129 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
130 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
131 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
132 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
133 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
134 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
135 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
136 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
137 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
138 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
139 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
140 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
141 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
142 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
143 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
144 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
145 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
146 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
147 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
148 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
149 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
150 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
151 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
152 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
153 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
154 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
155 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
158 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
159 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
160 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
161 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
162 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
163 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
165 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
166 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
167 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
168 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
169 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
170 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
171 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
172 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
173 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
174 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
175 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
180 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
181 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
182 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
183 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
184 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
185 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
188 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
189 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
190 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
191 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
192 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
193 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
202 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
219 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
236 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
237 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
238 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
239 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
240 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
258 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
259 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
267 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
268 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
269 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
270 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
271 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
272 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
273 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
280 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
281 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
282 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
297 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
341 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
342 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
343 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
344 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
374 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
378 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
379 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
382 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
383 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
384 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
385 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
386 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
387 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
388 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
389 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
390 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
391 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
392 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
393 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
394 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.51
Metatranscriptomes 0
Isolates 17.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 5.76
Nodule 2.71
Rhizoplane 5.08
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_63 2124908027 Bacteria 63450
2 MRS2a_Contig_6365 2124908027 Bacteria 1672
3 JGI25162J39368_1002343 3300002737 Bacteria 7528
4 JGI25162J39368_1002368 3300002737 Bacteria 7454
5 JGI25164J39214_1001140 3300002772 Bacteria 7528
6 JGI25164J39214_1001148 3300002772 Bacteria 7454
7 JGI25165J46597_1002064 3300003214 Bacteria 7528
8 JGI25165J46597_1002076 3300003214 Bacteria 7454
9 rootH1_10113058 3300003323 Bacteria 1731
10 Ga0055536_1002477 3300003781 Bacteria 10365
11 Ga0055536_1009168 3300003781 Bacteria 4136
12 Ga0055536_1009170 3300003781 Bacteria 4135
13 Ga0055530_10002925 3300003791 Bacteria 10344
14 Ga0055530_10003090 3300003791 Bacteria 9889
15 Ga0055530_10003689 3300003791 Bacteria 8546
16 Ga0055540_1002354 3300003792 Bacteria 10114
17 Ga0055540_1002654 3300003792 Bacteria 9248
18 Ga0055540_1002780 3300003792 Bacteria 8962
19 Ga0055531_10000348 3300003794 Bacteria 45293
20 Ga0055531_10090088 3300003794 Bacteria 653
21 Ga0065714_10000200 3300005288 Bacteria 7519
22 Ga0065714_10010890 3300005288 Bacteria 2161
23 Ga0065714_10016682 3300005288 Bacteria 2476
24 Ga0065714_10019055 3300005288 Bacteria 2100
25 Ga0065714_10065997 3300005288 Bacteria 7859
26 Ga0065714_10074076 3300005288 Bacteria 3085
27 Ga0065714_10116478 3300005288 Bacteria 1402
28 Ga0065714_10148665 3300005288 Bacteria 1120
29 Ga0065704_10027423 3300005289 Bacteria 1241
30 Ga0065704_10030190 3300005289 Bacteria 1276
31 Ga0065704_10031494 3300005289 Bacteria 1051
32 Ga0065704_10072936 3300005289 Bacteria 7776
33 Ga0065704_10080368 3300005289 Bacteria 3958
34 Ga0065704_10321926 3300005289 Bacteria 851
35 Ga0065712_10000146 3300005290 Bacteria 63767
36 Ga0065712_10000717 3300005290 Bacteria 8614
37 Ga0065715_10153109 3300005293 Bacteria 1697
38 Ga0070676_10582923 3300005328 Bacteria 804
39 Ga0070714_100717935 3300005435 Bacteria 965
40 Ga0070662_100651465 3300005457 Bacteria 888
41 Ga0070665_100659418 3300005548 Bacteria 1059
42 Ga0070665_100672402 3300005548 Bacteria 1048
43 Ga0070702_101795896 3300005615 Bacteria 512
44 Ga0070717_10948683 3300006028 Bacteria 783
45 Ga0075363_100305575 3300006048 Bacteria 924
46 Ga0075364_10084038 3300006051 Bacteria 2107
47 Ga0075364_10151254 3300006051 Bacteria 1564
48 Ga0075364_10549449 3300006051 Bacteria 789
49 Ga0075432_10004050 3300006058 Bacteria 5003
50 Ga0075432_10084883 3300006058 Bacteria 1152
51 Ga0075432_10099805 3300006058 Bacteria 1071
52 Ga0075432_10516211 3300006058 Bacteria 535
53 Ga0075362_10179175 3300006177 Bacteria 1026
54 Ga0075362_10190353 3300006177 Bacteria 996
55 Ga0075369_10126777 3300006186 Bacteria 1158
56 Ga0075366_10680393 3300006195 Bacteria 639
57 Ga0075370_10312948 3300006353 Bacteria 935
58 Ga0075370_10516229 3300006353 Bacteria 722
59 Ga0075436_100477209 3300006914 Bacteria 910
60 Ga0075436_100984525 3300006914 Bacteria 632
61 Ga0079104_1002687 3300006946 Bacteria 9162
62 Ga0079104_1003518 3300006946 Bacteria 7216
63 Ga0099826_10037988 3300006948 Bacteria 3387
64 Ga0105251_10000004 3300009011 Bacteria 285212
65 Ga0105251_10004443 3300009011 Bacteria 9541
66 Ga0105251_10007066 3300009011 Bacteria 6997
67 Ga0105251_10152037 3300009011 Bacteria 1045
68 Ga0105251_10376619 3300009011 Bacteria 650
69 Ga0105244_10001043 3300009036 Bacteria 23186
70 Ga0105244_10005209 3300009036 Bacteria 8698
71 Ga0105244_10017949 3300009036 Bacteria 3983
72 Ga0105244_10018410 3300009036 Bacteria 3919
73 Ga0105244_10042431 3300009036 Bacteria 2352
74 Ga0105244_10049032 3300009036 Bacteria 2160
75 Ga0105244_10162520 3300009036 Bacteria 1066
76 Ga0105244_10284323 3300009036 Bacteria 767
77 Ga0105250_10002390 3300009092 Bacteria 9469
78 Ga0105250_10011759 3300009092 Bacteria 3627
79 Ga0105250_10072110 3300009092 Bacteria 1396
80 Ga0105250_10134459 3300009092 Bacteria 1022
81 Ga0105250_10190386 3300009092 Bacteria 863
82 Ga0105250_10223713 3300009092 Bacteria 799
83 Ga0105243_10002016 3300009148 Bacteria 17266
84 Ga0105243_10021965 3300009148 Bacteria 4847
85 Ga0105243_10035653 3300009148 Bacteria 3858
86 Ga0105243_10088108 3300009148 Bacteria 2550
87 Ga0105243_10100894 3300009148 Bacteria 2396
88 Ga0105243_10935939 3300009148 Bacteria 864
89 Ga0105242_10108381 3300009176 Bacteria 2364
90 Ga0105242_11007755 3300009176 Bacteria 841
91 Ga0105238_11068549 3300009551 Bacteria 829
92 Ga0105249_10068245 3300009553 Bacteria 3279
93 Ga0105246_10003691 3300011119 Bacteria 9267
94 Ga0105246_10007602 3300011119 Bacteria 6647
95 Ga0105246_10051958 3300011119 Bacteria 2815
96 Ga0157336_1021986 3300012477 Bacteria 584
97 Ga0157345_1000406 3300012498 Bacteria 4559
98 Ga0157347_1012782 3300012502 Bacteria 910
99 Ga0157373_10006663 3300013100 Bacteria 8605
100 Ga0157373_10011669 3300013100 Bacteria 6452
101 Ga0157373_10035499 3300013100 Bacteria 3579
102 Ga0157373_10081575 3300013100 Bacteria 2280
103 Ga0157373_10612783 3300013100 Bacteria 793
104 Ga0157371_10016794 3300013102 Bacteria 5452
105 Ga0157371_10022390 3300013102 Bacteria 4632
106 Ga0157371_10029549 3300013102 Bacteria 3961
107 Ga0157371_10048074 3300013102 Bacteria 3033
108 Ga0157371_10423721 3300013102 Bacteria 976
109 Ga0157370_10100977 3300013104 Bacteria 2702
110 Ga0157370_10129888 3300013104 Bacteria 2350
111 Ga0157370_10308121 3300013104 Bacteria 1461
112 Ga0157370_10440361 3300013104 Bacteria 1198
113 Ga0157370_10470853 3300013104 Bacteria 1154
114 Ga0157370_10538873 3300013104 Bacteria 1070
115 Ga0157369_10004082 3300013105 Bacteria 17282
116 Ga0157369_11743848 3300013105 Bacteria 633
117 Ga0163162_10031182 3300013306 Bacteria 5286
118 Ga0157372_10041925 3300013307 Bacteria 5061
119 Ga0157375_10099065 3300013308 Bacteria 2993
120 Ga0157375_11539420 3300013308 Bacteria 785
121 Ga0157380_11096178 3300014326 Bacteria 835
122 Ga0182008_10005981 3300014497 Bacteria 6851
123 Ga0182008_10019027 3300014497 Bacteria 3550
124 Ga0182008_10021627 3300014497 Bacteria 3303
125 Ga0182008_10039351 3300014497 Bacteria 2363
126 Ga0182008_10112047 3300014497 Bacteria 1352
127 Ga0182008_10184842 3300014497 Bacteria 1056
128 Ga0182006_1013528 3300015261 Bacteria 3539
129 Ga0182006_1018530 3300015261 Bacteria 2940
130 Ga0182006_1022967 3300015261 Bacteria 2586
131 Ga0182006_1031971 3300015261 Bacteria 2117
132 Ga0182007_10010960 3300015262 Bacteria 3552
133 Ga0182007_10243394 3300015262 Bacteria 643
134 Ga0182005_1011004 3300015265 Bacteria 2589
135 Ga0182005_1025175 3300015265 Bacteria 1624
136 Ga0163161_10033270 3300017792 Bacteria 3684
137 Ga0163161_10098800 3300017792 Bacteria 2170
138 Ga0163161_10198086 3300017792 Bacteria 1547
139 Ga0163161_10618130 3300017792 Bacteria 895
140 Ga0209760_100534 3300025207 Bacteria 7232
141 Ga0209674_116692 3300025226 Bacteria 608
142 Ga0209672_100625 3300025228 Bacteria 18270
143 Ga0209563_102480 3300025230 Bacteria 4154
144 Ga0207427_100007 3300025231 Bacteria 746220
145 Ga0209437_100006 3300025233 Bacteria 1042724
146 Ga0209759_1015308 3300025256 Bacteria 1984
147 Ga0209233_1000059 3300025261 Bacteria 414562
148 Ga0209675_1004261 3300025291 Bacteria 6445
149 Ga0209676_1000010 3300025292 Bacteria 954025
150 Ga0209676_1017459 3300025292 Bacteria 2539
151 Ga0209676_1019618 3300025292 Bacteria 2322
152 Ga0209050_1000019 3300025298 Bacteria 608757
153 Ga0209050_1000027 3300025298 Bacteria 483261
154 Ga0209050_1004537 3300025298 Bacteria 9334
155 Ga0209051_1000102 3300025303 Bacteria 162911
156 Ga0209051_1000383 3300025303 Bacteria 62847
157 Ga0209051_1008728 3300025303 Bacteria 5328
158 Ga0209257_1000119 3300025304 Bacteria 225893
159 Ga0209257_1011631 3300025304 Bacteria 4205
160 Ga0207696_1000054 3300025711 Bacteria 266962
161 Ga0207696_1000213 3300025711 Bacteria 87128
162 Ga0207696_1003221 3300025711 Bacteria 7529
163 Ga0207696_1008374 3300025711 Bacteria 3965
164 Ga0207696_1049746 3300025711 Bacteria 1201
165 Ga0207655_1000005 3300025728 Bacteria 917277
166 Ga0207655_1000015 3300025728 Bacteria 600662
167 Ga0207655_1001289 3300025728 Bacteria 23749
168 Ga0207655_1004342 3300025728 Bacteria 10097
169 Ga0207655_1009983 3300025728 Bacteria 5822
170 Ga0207655_1012220 3300025728 Bacteria 5038
171 Ga0207655_1015195 3300025728 Bacteria 4297
172 Ga0207655_1015443 3300025728 Bacteria 4245
173 Ga0207655_1016868 3300025728 Bacteria 3970
174 Ga0207655_1048185 3300025728 Bacteria 1752
175 Ga0207655_1053401 3300025728 Bacteria 1616
176 Ga0207655_1108396 3300025728 Bacteria 943
177 Ga0207713_1000013 3300025735 Bacteria 475751
178 Ga0207713_1005285 3300025735 Bacteria 8122
179 Ga0207713_1005703 3300025735 Bacteria 7730
180 Ga0207713_1007779 3300025735 Bacteria 6256
181 Ga0207713_1009866 3300025735 Bacteria 5341
182 Ga0207713_1014244 3300025735 Bacteria 4145
183 Ga0207713_1018723 3300025735 Bacteria 3418
184 Ga0207713_1022092 3300025735 Bacteria 3031
185 Ga0207713_1120972 3300025735 Bacteria 878
186 Ga0207645_10662098 3300025907 Bacteria 709
187 Ga0207681_10038543 3300025923 Bacteria 3167
188 Ga0207664_10817785 3300025929 Bacteria 838
189 Ga0207706_10052083 3300025933 Bacteria 3614
190 Ga0207686_11047115 3300025934 Bacteria 664
191 Ga0207709_10000224 3300025935 Bacteria 71687
192 Ga0207709_10001009 3300025935 Bacteria 20872
193 Ga0207709_10003502 3300025935 Bacteria 9294
194 Ga0207709_10099832 3300025935 Bacteria 1916
195 Ga0207709_10427187 3300025935 Bacteria 1019
196 Ga0207678_10080860 3300026067 Bacteria 2782
197 Ga0209281_1000015 3300027111 Bacteria 590084
198 Ga0209281_1002030 3300027111 Bacteria 9176
199 Ga0209281_1002560 3300027111 Bacteria 7081
200 Ga0209371_1000372 3300027312 Bacteria 48390
201 Ga0209969_1005590 3300027360 Bacteria 1768
202 Ga0209981_1009128 3300027378 Bacteria 1354
203 Ga0209981_1018505 3300027378 Bacteria 987
204 Ga0209996_1001815 3300027395 Bacteria 2614
205 Ga0209984_1000904 3300027424 Bacteria 3177
206 Ga0210000_1043629 3300027462 Bacteria 714
207 Ga0209995_1000370 3300027471 Bacteria 6974
208 Ga0209968_1009181 3300027526 Bacteria 1511
209 Ga0209983_1001799 3300027665 Bacteria 4764
210 Ga0209983_1014344 3300027665 Bacteria 1633
211 Ga0209971_1000990 3300027682 Bacteria 7309
212 Ga0209974_10008818 3300027876 Bacteria 3437
213 Ga0209974_10042207 3300027876 Bacteria 1519
214 Ga0207428_10019963 3300027907 Bacteria 5707
215 Ga0207428_10095682 3300027907 Bacteria 2301
216 Ga0207428_10097055 3300027907 Bacteria 2281
217 Ga0207428_10175017 3300027907 Bacteria 1624
218 Ga0207428_10371753 3300027907 Bacteria 1050
219 Ga0268266_11170812 3300028379 Bacteria 743
220 Ga0307517_10304678 3300028786 Bacteria 891
221 Ga0307515_10523950 3300028794 Bacteria 795
222 Ga0268256_1000316 3300030500 Bacteria 48390
223 Ga0307511_10041014 3300030521 Bacteria 3917
224 Ga0316177_1067959 3300030731 Bacteria 707
225 Ga0314311_1053106 3300030733 Bacteria 2373
226 Ga0316179_1118252 3300030734 Bacteria 3410
227 Ga0316178_1061339 3300030735 Bacteria 40218
228 Ga0316183_1164786 3300030742 Bacteria 2969
229 Ga0307513_10677141 3300031456 Bacteria 738
230 Ga0307408_100000020 3300031548 Bacteria 340408
231 Ga0307408_100026677 3300031548 Bacteria 3971
232 Ga0307408_100052194 3300031548 Bacteria 2949
233 Ga0307408_100084620 3300031548 Bacteria 2379
234 Ga0307408_100155822 3300031548 Bacteria 1808
235 Ga0307516_10758312 3300031730 Bacteria 630
236 Ga0307405_10016467 3300031731 Bacteria 4032
237 Ga0307405_10045984 3300031731 Bacteria 2678
238 Ga0307413_10004776 3300031824 Bacteria 5950
239 Ga0307413_10327181 3300031824 Bacteria 1173
240 Ga0307413_10332244 3300031824 Bacteria 1165
241 Ga0307413_10412353 3300031824 Bacteria 1061
242 Ga0307410_11095442 3300031852 Bacteria 690
243 Ga0307406_10068257 3300031901 Bacteria 2320
244 Ga0307406_10081625 3300031901 Bacteria 2150
245 Ga0307407_10164372 3300031903 Bacteria 1455
246 Ga0307407_10252854 3300031903 Bacteria 1208
247 Ga0307407_10535555 3300031903 Bacteria 863
248 Ga0307412_10026347 3300031911 Bacteria 3612
249 Ga0307412_10042695 3300031911 Bacteria 2948
250 Ga0307412_10043739 3300031911 Bacteria 2918
251 Ga0307412_10323155 3300031911 Bacteria 1228
252 Ga0307409_100153497 3300031995 Bacteria 2003
253 Ga0307409_100347020 3300031995 Bacteria 1399
254 Ga0307409_101039419 3300031995 Bacteria 838
255 Ga0307416_101199984 3300032002 Bacteria 864
256 Ga0307416_102661354 3300032002 Bacteria 597
257 Ga0307414_10022843 3300032004 Bacteria 3954
258 Ga0307414_10347300 3300032004 Bacteria 1272
259 Ga0307414_10407538 3300032004 Bacteria 1182
260 Ga0307414_10428881 3300032004 Bacteria 1155
261 Ga0307414_10574864 3300032004 Bacteria 1007
262 Ga0307414_11071539 3300032004 Bacteria 743
263 Ga0307411_10092469 3300032005 Bacteria 2115
264 Ga0307411_10113658 3300032005 Bacteria 1943
265 Ga0307411_10143139 3300032005 Bacteria 1765
266 Ga0307411_10199398 3300032005 Bacteria 1535
267 Ga0307510_10049362 3300033180 Bacteria 4476
268 Ga0237819_00850 3300038705 Bacteria 9625
269 Ga0439436_0001947 3300041404 Bacteria 6113
270 Ga0439438_004835 3300041405 Bacteria 5071
271 Ga0439438_005991 3300041405 Bacteria 4379
272 Ga0439438_012496 3300041405 Bacteria 2602
273 Ga0439438_013016 3300041405 Bacteria 2525
274 Ga0439438_033892 3300041405 Bacteria 1347
275 Ga0439438_035560 3300041405 Bacteria 1308
276 Ga0439447_005256 3300041407 Bacteria 4323
277 Ga0439447_007191 3300041407 Bacteria 3553
278 Ga0439447_007499 3300041407 Bacteria 3456
279 Ga0439447_028240 3300041407 Bacteria 1426
280 Ga0439466_0002455 3300041411 Bacteria 7268
281 Ga0439466_0012706 3300041411 Bacteria 3095
282 Ga0439466_0030461 3300041411 Bacteria 1850
283 Ga0439466_0039442 3300041411 Bacteria 1583
284 Ga0439466_0059830 3300041411 Bacteria 1229
285 Ga0439466_0088008 3300041411 Bacteria 975
286 Ga0439465_0088938 3300041413 Bacteria 1055
287 Ga0439432_006875 3300042006 Bacteria 4052
288 Ga0439432_017053 3300042006 Bacteria 2439
289 Ga0439451_015210 3300042009 Bacteria 1550
290 Ga0439452_002068 3300042010 Bacteria 7620
291 Ga0439452_003491 3300042010 Bacteria 5494
292 Ga0439452_005492 3300042010 Bacteria 4074
293 Ga0439452_006171 3300042010 Bacteria 3776
294 Ga0439452_018818 3300042010 Bacteria 1834
295 Ga0439452_055582 3300042010 Bacteria 897
296 Ga0439456_008547 3300042013 Bacteria 2115
297 Ga0439456_009482 3300042013 Bacteria 2010
298 Ga0439456_064912 3300042013 Bacteria 805
299 Ga0439463_000398 3300042016 Bacteria 12029
300 Ga0439463_118357 3300042016 Bacteria 684
301 Ga0450911_002061 3300042115 Bacteria 4138
302 Ga0450911_014547 3300042115 Bacteria 1045
303 Ga0450911_021889 3300042115 Bacteria 833
304 Ga0450919_003656 3300042121 Bacteria 1909
305 Ga0450919_015498 3300042121 Bacteria 860
306 Ga0450920_002273 3300042122 Bacteria 3254
307 Ga0450922_003438 3300042124 Bacteria 1459
308 Ga0450922_007710 3300042124 Bacteria 1012
309 Ga0450923_009756 3300042125 Bacteria 1687
310 Ga0450923_019088 3300042125 Bacteria 1318
311 Ga0450903_006890 3300042138 Bacteria 1880
312 Ga0450906_038611 3300042145 Bacteria 842
313 Ga0450907_001573 3300042146 Bacteria 4854
314 Ga0450910_002470 3300042147 Bacteria 2427
315 Ga0439446_0002625 3300042156 Bacteria 4340
316 Ga0439446_0281111 3300042156 Bacteria 580
317 Ga0450908_004130 3300042184 Bacteria 2805
318 Ga0439434_0004449 3300042435 Bacteria 4099
319 Ga0439464_0002011 3300042439 Bacteria 4930
320 Ga0439464_0005339 3300042439 Bacteria 3318
321 Ga0439464_0007803 3300042439 Bacteria 2801
322 Ga0450893_0004562 3300042532 Bacteria 2207
323 Ga0450893_0025484 3300042532 Bacteria 1037
324 Ga0450901_007621 3300042533 Bacteria 1114
325 Ga0495617_005254 3300046452 Bacteria 4609
326 Ga0495617_018827 3300046452 Bacteria 2335
327 Ga0495617_019507 3300046452 Bacteria 2293
328 Ga0495617_038146 3300046452 Bacteria 1608
329 Ga0495617_051979 3300046452 Bacteria 1362
330 Ga0495617_056646 3300046452 Bacteria 1300
331 Ga0495627_002521 3300046453 Bacteria 8738
332 Ga0495627_009785 3300046453 Bacteria 3513
333 Ga0495627_071325 3300046453 Bacteria 1014
334 Ga0495627_095624 3300046453 Bacteria 851
335 Ga0495627_221450 3300046453 Bacteria 519
336 Ga0495603_0025579 3300046455 Bacteria 3569
337 Ga0495590_0005392 3300046457 Bacteria 5076
338 Ga0495590_0053578 3300046457 Bacteria 1409
339 Ga0495590_0058969 3300046457 Bacteria 1342
340 Ga0495590_0074039 3300046457 Bacteria 1197
341 Ga0495590_0082356 3300046457 Bacteria 1134
342 Ga0495591_000015 3300046458 Bacteria 252107
343 Ga0495591_002895 3300046458 Bacteria 9205
344 Ga0495591_004113 3300046458 Bacteria 7235
345 Ga0495591_006233 3300046458 Bacteria 5317
346 Ga0495591_008874 3300046458 Bacteria 4060
347 Ga0495591_010833 3300046458 Bacteria 3495
348 Ga0495591_011046 3300046458 Bacteria 3444
349 Ga0495591_012960 3300046458 Bacteria 3075
350 Ga0495591_014684 3300046458 Bacteria 2800
351 Ga0495629_0033508 3300046459 Bacteria 3633
352 Ga0495638_0000164 3300046460 Bacteria 103139
353 Ga0495638_0014846 3300046460 Bacteria 5250
354 Ga0495638_0014868 3300046460 Bacteria 5244
355 Ga0495638_0080108 3300046460 Bacteria 1985
356 Ga0495638_0134088 3300046460 Bacteria 1452
357 Ga0495638_0178702 3300046460 Bacteria 1212
358 Ga0495638_0186743 3300046460 Bacteria 1178
359 Ga0495638_0192229 3300046460 Bacteria 1157
360 Ga0495653_0001870 3300046463 Bacteria 16627
361 Ga0495653_0046479 3300046463 Bacteria 3361
362 Ga0495653_0056069 3300046463 Bacteria 3005
363 Ga0495653_0076865 3300046463 Bacteria 2481
364 Ga0495650_0004551 3300046471 Bacteria 9465
365 Ga0495650_0011165 3300046471 Bacteria 4948
366 Ga0495650_0015874 3300046471 Bacteria 3844
367 Ga0495650_0016615 3300046471 Bacteria 3720
368 Ga0495650_0017682 3300046471 Bacteria 3566
369 Ga0495650_0045832 3300046471 Bacteria 1838
370 Ga0495650_0087562 3300046471 Bacteria 1190
371 Ga0495650_0109288 3300046471 Bacteria 1028
372 Ga0495582_0011363 3300046473 Bacteria 4906
373 Ga0495605_0003192 3300046474 Bacteria 9838
374 Ga0495605_0007738 3300046474 Bacteria 6090
375 Ga0495605_0008705 3300046474 Bacteria 5730
376 Ga0495605_0010449 3300046474 Bacteria 5192
377 Ga0495605_0010639 3300046474 Bacteria 5142
378 Ga0495605_0010684 3300046474 Bacteria 5132
379 Ga0495605_0015768 3300046474 Bacteria 4106
380 Ga0495605_0088872 3300046474 Bacteria 1435
381 Ga0495605_0092256 3300046474 Bacteria 1402
382 Ga0495605_0133777 3300046474 Bacteria 1116
383 Ga0495605_0239423 3300046474 Bacteria 779
384 Ga0495639_0002688 3300046475 Bacteria 7725
385 Ga0495639_0026561 3300046475 Bacteria 2559
386 Ga0495584_0004204 3300046491 Bacteria 7769
387 Ga0495584_0009064 3300046491 Bacteria 5140
388 Ga0495584_0061895 3300046491 Bacteria 1881
389 Ga0495584_0079759 3300046491 Bacteria 1647
390 Ga0495584_0092146 3300046491 Bacteria 1528
391 Ga0495584_0119702 3300046491 Bacteria 1333
392 Ga0495584_0383041 3300046491 Bacteria 715
393 Ga0495585_0011356 3300046492 Bacteria 5270
394 Ga0495585_0017278 3300046492 Bacteria 4170
395 Ga0495585_0081114 3300046492 Bacteria 1757
396 Ga0495585_0122382 3300046492 Bacteria 1375
397 Ga0495596_0006544 3300046500 Bacteria 5350
398 Ga0495596_0083574 3300046500 Bacteria 1239
399 Ga0495607_0002286 3300046501 Bacteria 15754
400 Ga0495607_0005389 3300046501 Bacteria 9175
401 Ga0495607_0005406 3300046501 Bacteria 9149
402 Ga0495607_0005433 3300046501 Bacteria 9127
403 Ga0495607_0013447 3300046501 Bacteria 5362
404 Ga0495607_0014534 3300046501 Bacteria 5120
405 Ga0495607_0014535 3300046501 Bacteria 5119
406 Ga0495607_0022540 3300046501 Bacteria 3952
407 Ga0495607_0028261 3300046501 Bacteria 3461
408 Ga0495607_0035661 3300046501 Bacteria 3007
409 Ga0495607_0045578 3300046501 Bacteria 2578
410 Ga0495607_0051559 3300046501 Bacteria 2389
411 Ga0495607_0096806 3300046501 Bacteria 1588
412 Ga0495607_0121885 3300046501 Bacteria 1367
413 Ga0495607_0185660 3300046501 Bacteria 1039
414 Ga0495607_0378176 3300046501 Bacteria 648
415 Ga0495583_0004401 3300046506 Bacteria 10106
416 Ga0495583_0005753 3300046506 Bacteria 8298
417 Ga0495583_0015958 3300046506 Bacteria 4059
418 Ga0495583_0016145 3300046506 Bacteria 4026
419 Ga0495583_0017659 3300046506 Bacteria 3781
420 Ga0495583_0037496 3300046506 Bacteria 2297
421 Ga0495583_0068785 3300046506 Bacteria 1560
422 Ga0495606_0001115 3300046507 Bacteria 38368
423 Ga0495606_0003532 3300046507 Bacteria 16531
424 Ga0495606_0017307 3300046507 Bacteria 5456
425 Ga0495606_0017986 3300046507 Bacteria 5318
426 Ga0495606_0022667 3300046507 Bacteria 4566
427 Ga0495606_0023324 3300046507 Bacteria 4487
428 Ga0495606_0025496 3300046507 Bacteria 4232
429 Ga0495606_0033353 3300046507 Bacteria 3551
430 Ga0495606_0034211 3300046507 Bacteria 3490
431 Ga0495606_0088915 3300046507 Bacteria 1903
432 Ga0495606_0163539 3300046507 Bacteria 1296
433 Ga0495610_0015699 3300046512 Bacteria 4390
434 Ga0495610_0019105 3300046512 Bacteria 3844
435 Ga0495610_0022319 3300046512 Bacteria 3464
436 Ga0495610_0033789 3300046512 Bacteria 2640
437 Ga0495610_0062866 3300046512 Bacteria 1760
438 Ga0495610_0272314 3300046512 Bacteria 662
439 Ga0495616_0009667 3300046513 Bacteria 5621
440 Ga0495616_0016921 3300046513 Bacteria 4026
441 Ga0495616_0018335 3300046513 Bacteria 3844
442 Ga0495616_0055611 3300046513 Bacteria 1958
443 Ga0495616_0148199 3300046513 Bacteria 1063
444 Ga0495616_0226203 3300046513 Bacteria 812
445 Ga0495616_0343692 3300046513 Bacteria 622
446 Ga0495620_0008155 3300046515 Bacteria 5636
447 Ga0495620_0008360 3300046515 Bacteria 5560
448 Ga0495620_0009999 3300046515 Bacteria 5018
449 Ga0495620_0010670 3300046515 Bacteria 4836
450 Ga0495620_0042422 3300046515 Bacteria 1987
451 Ga0495620_0081400 3300046515 Bacteria 1309
452 Ga0495630_0317747 3300046517 Bacteria 1190
453 Ga0495631_0006910 3300046518 Bacteria 5818
454 Ga0495631_0008741 3300046518 Bacteria 5090
455 Ga0495631_0009105 3300046518 Bacteria 4971
456 Ga0495631_0016294 3300046518 Bacteria 3546
457 Ga0495631_0121312 3300046518 Bacteria 1124
458 Ga0495632_0010120 3300046519 Bacteria 5614
459 Ga0495632_0011673 3300046519 Bacteria 5115
460 Ga0495632_0011827 3300046519 Bacteria 5077
461 Ga0495632_0014349 3300046519 Bacteria 4484
462 Ga0495632_0017298 3300046519 Bacteria 3984
463 Ga0495632_0034749 3300046519 Bacteria 2577
464 Ga0495632_0087816 3300046519 Bacteria 1477
465 Ga0495632_0230386 3300046519 Bacteria 835
466 Ga0495632_0326219 3300046519 Bacteria 677
467 Ga0495637_0002754 3300046520 Bacteria 9555
468 Ga0495637_0006137 3300046520 Bacteria 6047
469 Ga0495637_0007676 3300046520 Bacteria 5335
470 Ga0495637_0009878 3300046520 Bacteria 4642
471 Ga0495637_0011097 3300046520 Bacteria 4337
472 Ga0495637_0013267 3300046520 Bacteria 3915
473 Ga0495637_0014581 3300046520 Bacteria 3705
474 Ga0495637_0023155 3300046520 Bacteria 2826
475 Ga0495637_0029375 3300046520 Bacteria 2448
476 Ga0495637_0137673 3300046520 Bacteria 928
477 Ga0495637_0186339 3300046520 Bacteria 767
478 Ga0495643_0001220 3300046522 Bacteria 24866
479 Ga0495643_0014224 3300046522 Bacteria 4738
480 Ga0495643_0014720 3300046522 Bacteria 4647
481 Ga0495643_0016323 3300046522 Bacteria 4363
482 Ga0495643_0022424 3300046522 Bacteria 3603
483 Ga0495643_0072319 3300046522 Bacteria 1808
484 Ga0495643_0092244 3300046522 Bacteria 1561
485 Ga0495643_0134829 3300046522 Bacteria 1236
486 Ga0495644_0011264 3300046523 Bacteria 3445
487 Ga0495644_0024499 3300046523 Bacteria 2295
488 Ga0495648_0002757 3300046524 Bacteria 15864
489 Ga0495648_0020724 3300046524 Bacteria 4575
490 Ga0495648_0068471 3300046524 Bacteria 2070
491 Ga0495648_0141007 3300046524 Bacteria 1268
492 Ga0495648_0157311 3300046524 Bacteria 1178
493 Ga0495648_0285350 3300046524 Bacteria 780
494 Ga0495648_0330859 3300046524 Bacteria 702
495 Ga0495666_0008636 3300046526 Bacteria 5105
496 Ga0495666_0015667 3300046526 Bacteria 3775
497 Ga0495642_0004844 3300046528 Bacteria 5202
498 Ga0495642_0086277 3300046528 Bacteria 1325
499 Ga0495652_0152432 3300046529 Bacteria 1804
500 Ga0495654_0004450 3300046530 Bacteria 8312
501 Ga0495654_0007398 3300046530 Bacteria 6136
502 Ga0495654_0014809 3300046530 Bacteria 4146
503 Ga0495654_0015390 3300046530 Bacteria 4061
504 Ga0495654_0017707 3300046530 Bacteria 3739
505 Ga0495654_0019172 3300046530 Bacteria 3578
506 Ga0495654_0019440 3300046530 Bacteria 3552
507 Ga0495654_0020022 3300046530 Bacteria 3493
508 Ga0495654_0026604 3300046530 Bacteria 2972
509 Ga0495654_0029675 3300046530 Bacteria 2787
510 Ga0495654_0030003 3300046530 Bacteria 2769
511 Ga0495654_0278209 3300046530 Bacteria 689
512 Ga0495586_0040848 3300046535 Bacteria 2497
513 Ga0495587_0012284 3300046536 Bacteria 5399
514 Ga0495587_0022683 3300046536 Bacteria 3862
515 Ga0495609_0003213 3300046538 Bacteria 9486
516 Ga0495609_0007879 3300046538 Bacteria 5267
517 Ga0495609_0039186 3300046538 Bacteria 2134
518 Ga0495609_0046763 3300046538 Bacteria 1937
519 Ga0495597_0001457 3300046542 Bacteria 16939
520 Ga0495597_0027373 3300046542 Bacteria 2614
521 Ga0495597_0047214 3300046542 Bacteria 1906
522 Ga0495597_0175356 3300046542 Bacteria 868
523 Ga0495645_0117725 3300046543 Bacteria 1874
524 Ga0495645_0260279 3300046543 Bacteria 1149
525 Ga0495622_0006744 3300046557 Bacteria 5324
526 Ga0495622_0008637 3300046557 Bacteria 4720
527 Ga0495622_0010751 3300046557 Bacteria 4223
528 Ga0495622_0017003 3300046557 Bacteria 3386
529 Ga0495622_0032167 3300046557 Bacteria 2450
530 Ga0495622_0171494 3300046557 Bacteria 975
531 Ga0495633_0014722 3300046558 Bacteria 4078
532 Ga0495656_0357977 3300046615 Bacteria 757
533 Ga0495656_0555535 3300046615 Bacteria 612
534 Ga0495668_0011841 3300046616 Bacteria 5199
535 Ga0495668_0017874 3300046616 Bacteria 4108
536 Ga0495668_0022974 3300046616 Bacteria 3561
537 Ga0495668_0110354 3300046616 Bacteria 1504
538 Ga0495668_0157801 3300046616 Bacteria 1242
539 Ga0495611_0006133 3300046648 Bacteria 5129
540 Ga0495611_0008856 3300046648 Bacteria 4255
541 Ga0495625_0019890 3300046660 Bacteria 5195
542 Ga0495625_0020325 3300046660 Bacteria 5129
543 Ga0495625_0029611 3300046660 Bacteria 4091
544 Ga0495625_0038359 3300046660 Bacteria 3508
545 Ga0495625_0049169 3300046660 Bacteria 3032
546 Ga0495625_0140695 3300046660 Bacteria 1628
547 Ga0495635_0031268 3300046663 Bacteria 3697
548 Ga0495635_0859036 3300046663 Bacteria 582
549 Ga0495661_0004633 3300046665 Bacteria 9893
550 Ga0495661_0004922 3300046665 Bacteria 9555
551 Ga0495661_0014463 3300046665 Bacteria 5286
552 Ga0495661_0025942 3300046665 Bacteria 3778
553 Ga0495661_0028384 3300046665 Bacteria 3583
554 Ga0495661_0044397 3300046665 Bacteria 2725
555 Ga0495661_0073105 3300046665 Bacteria 1998
556 Ga0495661_0098895 3300046665 Bacteria 1646
557 Ga0495661_0130109 3300046665 Bacteria 1380
558 Ga0495588_0140095 3300046674 Bacteria 1277
559 Ga0495646_0026262 3300046680 Bacteria 3657
560 Ga0495646_0213370 3300046680 Bacteria 1046
561 Ga0495613_0050511 3300046689 Bacteria 3066
562 Ga0495613_0326339 3300046689 Bacteria 1058
563 Ga0495624_0016190 3300046690 Bacteria 5021
564 Ga0495670_0007721 3300046691 Bacteria 5290
565 Ga0495670_0012987 3300046691 Bacteria 4095
566 Ga0495670_0020033 3300046691 Bacteria 3296
567 Ga0495670_0072775 3300046691 Bacteria 1741
568 Ga0495671_0001579 3300046692 Bacteria 15080
569 Ga0495671_0003567 3300046692 Bacteria 9501
570 Ga0495671_0041774 3300046692 Bacteria 2307
571 Ga0495671_0126223 3300046692 Bacteria 1247
572 Ga0495649_0016490 3300046694 Bacteria 4186
573 Ga0495649_0030990 3300046694 Bacteria 2950
574 Ga0495649_0039352 3300046694 Bacteria 2592
575 Ga0495649_0072948 3300046694 Bacteria 1839
576 Ga0495649_0109044 3300046694 Bacteria 1468
577 Ga0495649_0221090 3300046694 Bacteria 979
578 Ga0495649_0274753 3300046694 Bacteria 861
579 Ga0495649_0363234 3300046694 Bacteria 730
580 Ga0495649_0419311 3300046694 Bacteria 670
581 Ga0495589_0009237 3300046794 Bacteria 5128
582 Ga0495589_0026180 3300046794 Bacteria 2956
583 Ga0495589_0037858 3300046794 Bacteria 2415
584 Ga0495589_0266287 3300046794 Bacteria 798
585 Ga0495600_0013552 3300046809 Bacteria 5126
586 Ga0495660_0002084 3300046810 Bacteria 12960
587 Ga0495660_0008386 3300046810 Bacteria 6044
588 Ga0495660_0024657 3300046810 Bacteria 3425
589 Ga0495660_0044680 3300046810 Bacteria 2435
590 Ga0495660_0053373 3300046810 Bacteria 2194
591 Ga0495660_0080051 3300046810 Bacteria 1715
592 Ga0495660_0114313 3300046810 Bacteria 1373
593 Ga0495660_0135049 3300046810 Bacteria 1233
594 Ga0495660_0163747 3300046810 Bacteria 1088
595 Ga0495660_0165733 3300046810 Bacteria 1080
596 Ga0495660_0309168 3300046810 Bacteria 713
597 Ga0495604_0078717 3300047317 Bacteria 2473
598 Ga0495604_0085261 3300047317 Bacteria 2357
599 Ga0495672_0003342 3300047320 Bacteria 13822
600 Ga0495672_0003889 3300047320 Bacteria 12544
601 Ga0495672_0010407 3300047320 Bacteria 6628
602 Ga0495672_0015615 3300047320 Bacteria 5148
603 Ga0495672_0019557 3300047320 Bacteria 4464
604 Ga0495672_0019954 3300047320 Bacteria 4405
605 Ga0495672_0021806 3300047320 Bacteria 4172
606 Ga0495672_0024590 3300047320 Bacteria 3875
607 Ga0495672_0026470 3300047320 Bacteria 3701
608 Ga0495672_0031274 3300047320 Bacteria 3324
609 Ga0495672_0130969 3300047320 Bacteria 1319
610 Ga0495672_0242354 3300047320 Bacteria 879
611 Ga0495672_0336639 3300047320 Bacteria 704
612 Ga0495676_0008239 3300047321 Bacteria 9560
613 Ga0495676_0149993 3300047321 Bacteria 1660
614 Ga0495680_0042103 3300047322 Bacteria 3626
615 Ga0495680_0954627 3300047322 Bacteria 550
616 Ga0495683_0013831 3300047323 Bacteria 4211
617 Ga0495683_0124094 3300047323 Bacteria 1223
618 Ga0495683_0163314 3300047323 Bacteria 1028
619 Ga0495683_0247523 3300047323 Bacteria 783
620 Ga0495683_0293436 3300047323 Bacteria 700
621 Ga0495687_019311 3300047443 Bacteria 3349
622 Ga0495687_071282 3300047443 Bacteria 1392
623 Ga0495675_0008994 3300047444 Bacteria 6208
624 Ga0495679_039489 3300047446 Bacteria 1471
625 Ga0495679_046562 3300047446 Bacteria 1319
626 Ga0495685_090349 3300047447 Bacteria 1015
627 Ga0495673_0003950 3300047469 Bacteria 9498
628 Ga0495673_0006113 3300047469 Bacteria 7147
629 Ga0495673_0010068 3300047469 Bacteria 5171
630 Ga0495673_0016540 3300047469 Bacteria 3769
631 Ga0495673_0021787 3300047469 Bacteria 3155
632 Ga0495673_0026641 3300047469 Bacteria 2761
633 Ga0495673_0026860 3300047469 Bacteria 2746
634 Ga0495673_0031901 3300047469 Bacteria 2463
635 Ga0495673_0066413 3300047469 Bacteria 1529
636 Ga0495673_0099782 3300047469 Bacteria 1175
637 Ga0495673_0117091 3300047469 Bacteria 1058
638 Ga0495681_0004648 3300047470 Bacteria 9308
639 Ga0495681_0007807 3300047470 Bacteria 6777
640 Ga0495681_0011362 3300047470 Bacteria 5306
641 Ga0495681_0012119 3300047470 Bacteria 5080
642 Ga0495681_0012250 3300047470 Bacteria 5051
643 Ga0495681_0012994 3300047470 Bacteria 4861
644 Ga0495681_0017176 3300047470 Bacteria 4029
645 Ga0495681_0036458 3300047470 Bacteria 2431
646 Ga0495681_0040716 3300047470 Bacteria 2260
647 Ga0495681_0053059 3300047470 Bacteria 1899
648 Ga0495681_0085029 3300047470 Bacteria 1405
649 Ga0495684_0294329 3300047471 Bacteria 1167
650 Ga0495686_0015872 3300047472 Bacteria 5123
651 Ga0495686_0029869 3300047472 Bacteria 3543
652 Ga0495686_0046517 3300047472 Bacteria 2742
653 Ga0495686_0050021 3300047472 Bacteria 2627
654 Ga0495686_0182624 3300047472 Bacteria 1214
655 Ga0495593_0014408 3300047673 Bacteria 4495
656 Ga0495593_0056045 3300047673 Bacteria 2072
657 Ga0495602_0091733 3300048088 Bacteria 2518
658 Ga0495626_0001991 3300048091 Bacteria 15074
659 Ga0495626_0009696 3300048091 Bacteria 5191
660 Ga0495626_0014242 3300048091 Bacteria 4106
661 Ga0495626_0014655 3300048091 Bacteria 4035
662 Ga0495626_0018199 3300048091 Bacteria 3532
663 Ga0495626_0033590 3300048091 Bacteria 2457
664 Ga0495626_0036585 3300048091 Bacteria 2337
665 Ga0495626_0088949 3300048091 Bacteria 1360
666 Ga0495626_0171452 3300048091 Bacteria 904
667 Ga0496102_0024615 3300048905 Bacteria 5352
668 Ga0496102_0188033 3300048905 Bacteria 1946
669 Ga0496110_0399333 3300048913 Bacteria 1253
670 Ga0496110_0646356 3300048913 Bacteria 957
671 Ga0496112_0508368 3300048915 Bacteria 1140
672 Ga0496115_0436570 3300048918 Bacteria 1059
673 Ga0496116_0009224 3300048919 Bacteria 8447
674 Ga0496116_0019431 3300048919 Bacteria 5202
675 Ga0496116_0029144 3300048919 Bacteria 3985
676 Ga0496117_0001936 3300048920 Bacteria 27633
677 Ga0496117_0012366 3300048920 Bacteria 7532
678 Ga0496117_0064804 3300048920 Bacteria 2488
679 Ga0496117_0159863 3300048920 Bacteria 1321
680 Ga0496117_0405504 3300048920 Bacteria 686
681 Ga0496118_0103372 3300048921 Bacteria 1916
682 Ga0496118_0156661 3300048921 Bacteria 1415
683 Ga0496118_0196887 3300048921 Bacteria 1198
684 Ga0496119_0389673 3300048922 Bacteria 666
685 Ga0496120_0174616 3300048923 Bacteria 1060
686 Ga0496121_0012137 3300048924 Bacteria 9457
687 Ga0496121_0014201 3300048924 Bacteria 8473
688 Ga0496121_0019552 3300048924 Bacteria 6763
689 Ga0496121_0030231 3300048924 Bacteria 4978
690 Ga0496121_0082684 3300048924 Bacteria 2537
691 Ga0496122_0004546 3300048925 Bacteria 17102
692 Ga0496122_0041678 3300048925 Bacteria 3625
693 Ga0496122_0051867 3300048925 Bacteria 3111
694 Ga0496122_0059033 3300048925 Bacteria 2835
695 Ga0496122_0125994 3300048925 Bacteria 1639
696 Ga0496122_0228335 3300048925 Bacteria 1061
697 Ga0496123_0001488 3300048926 Bacteria 32526
698 Ga0496123_0019101 3300048926 Bacteria 5411
699 Ga0496123_0041371 3300048926 Bacteria 3196
700 Ga0496124_0050108 3300048927 Bacteria 3559
701 Ga0496124_0103082 3300048927 Bacteria 2308
702 Ga0496124_0158414 3300048927 Bacteria 1768
703 Ga0496124_0205167 3300048927 Bacteria 1495
704 Ga0496125_0039982 3300048928 Bacteria 4030
705 Ga0495678_006775 3300049459 Bacteria 6032
706 Ga0495678_012071 3300049459 Bacteria 4106
707 Ga0495678_012391 3300049459 Bacteria 4045
708 Ga0495678_013877 3300049459 Bacteria 3768
709 Ga0495678_026038 3300049459 Bacteria 2503
710 Ga0495678_029425 3300049459 Bacteria 2306
711 Ga0495678_029701 3300049459 Bacteria 2293
712 Ga0495678_090711 3300049459 Bacteria 1077
713 Ga0495678_123974 3300049459 Bacteria 864
714 Ga0495682_0002142 3300049460 Bacteria 9581
715 Ga0495682_0056086 3300049460 Bacteria 1428
716 Ga0495682_0072818 3300049460 Bacteria 1236
717 Ga0501032_0017047 3300049569 Bacteria 5103
718 Ga0501034_0304164 3300049571 Bacteria 1531
719 Ga0501034_0803281 3300049571 Bacteria 833
720 Ga0501037_0239124 3300049573 Bacteria 1273
721 Ga0501038_0214015 3300049574 Bacteria 1540
722 Ga0501039_0265071 3300049575 Bacteria 1350
723 Ga0501039_0302200 3300049575 Bacteria 1258
724 Ga0501241_019596 3300049758 Bacteria 1242
725 Ga0501269_022103 3300049766 Bacteria 796
726 nmdc:mga00v17_206134_c1 3300050491 Bacteria 1272
727 nmdc:mga08x19_666959_c1 3300050514 Bacteria 738
728 nmdc:mga0sz30_142374_c1 3300050516 Bacteria 1059
729 Ga0500572_003167 3300053111 Bacteria 3808
730 Ga0500573_0017545 3300053140 Bacteria 4076
731 Ga0500577_0250819 3300053142 Bacteria 769

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2739367700 2739732539 111
2 iso_pu_bacteria 2808606373 2808905171 111
3 iso_pu_bacteria 640427133 640487028 113
4 iso_pu_bacteria 651053060 651174900 113
5 iso_pu_bacteria 2600254954 2600443501 114
6 iso_pu_bacteria 2600255389 2602009045 114
7 iso_pu_bacteria 2811994881 2812368551 114
8 iso_pu_bacteria 2823421272 2823425111 114
9 iso_pu_bacteria 2919501602 2919501828 114
10 iso_pu_bacteria 2923519811 2923522609 114
11 iso_pu_bacteria 2926063275 2926063501 114
12 iso_pu_bacteria 8034962539 8034963085 114
13 3300025228 Ga0209672_100625 Ga0209672_10062515 115
14 3300046460 Ga0495638_0000164 Ga0495638_0000164_89955_90311 115
15 3300046507 Ga0495606_0001115 Ga0495606_0001115_15577_15933 115
16 iso_pu_bacteria 3007252601 3007254077 115
17 iso_pu_bacteria 2510065053 2510283934 116
18 iso_pu_bacteria 2510065055 2510293393 116
19 iso_pu_bacteria 2510065058 2510312885 116
20 iso_pu_bacteria 2511231004 2511256926 116
21 iso_pu_bacteria 2511231006 2511266935 116
22 iso_pu_bacteria 2511231007 2511272926 116
23 iso_pu_bacteria 2511231008 2511276126 116
24 iso_pu_bacteria 2511231010 2511291216 116
25 iso_pu_bacteria 2511231011 2511293775 116
26 iso_pu_bacteria 2511231012 2511300536 116
27 iso_pu_bacteria 2511231014 2511315510 116
28 iso_pu_bacteria 2511231015 2511320342 116
29 iso_pu_bacteria 2511231016 2511323571 116
30 iso_pu_bacteria 2511231017 2511330728 116
31 iso_pu_bacteria 2511231018 2511336806 116
32 iso_pu_bacteria 2511231019 2511342584 116
33 iso_pu_bacteria 2511231020 2511348106 116
34 iso_pu_bacteria 2511231021 2511357049 116
35 iso_pu_bacteria 2511231022 2511363204 116
36 iso_pu_bacteria 2511231023 2511369748 116
37 iso_pu_bacteria 2511231031 2511414941 116
38 iso_pu_bacteria 2511231156 2511826789 116
39 iso_pu_bacteria 2554235341 2555671992 116
40 iso_pu_bacteria 2599185155 2599329645 116
41 iso_pu_bacteria 2599185160 2599353843 116
42 iso_pu_bacteria 2599185164 2599378951 116
43 iso_pu_bacteria 2599185165 2599386071 116
44 iso_pu_bacteria 2599185181 2599460677 116
45 iso_pu_bacteria 2599185186 2599489698 116
46 iso_pu_bacteria 2599185188 2599502858 116
47 iso_pu_bacteria 2599185212 2599615114 116
48 iso_pu_bacteria 2599185300 2599930115 116
49 iso_pu_bacteria 2599185302 2599945359 116
50 iso_pu_bacteria 2599185304 2599955631 116
51 iso_pu_bacteria 2599185306 2599969343 116
52 iso_pu_bacteria 2599185308 2599980684 116
53 iso_pu_bacteria 2599185309 2599985744 116
54 iso_pu_bacteria 2599185310 2599990638 116
55 iso_pu_bacteria 2599185311 2599995956 116
56 iso_pu_bacteria 2599185312 2600001976 116
57 iso_pu_bacteria 2599185314 2600014500 116
58 iso_pu_bacteria 2599185316 2600025528 116
59 iso_pu_bacteria 2599185317 2600027856 116
60 iso_pu_bacteria 2599185318 2600033426 116
61 iso_pu_bacteria 2599185319 2600040289 116
62 iso_pu_bacteria 2599185320 2600049343 116
63 iso_pu_bacteria 2599185322 2600061609 116
64 iso_pu_bacteria 2599185323 2600064227 116
65 iso_pu_bacteria 2599185325 2600077323 116
66 iso_pu_bacteria 2599185356 2600213291 116
67 iso_pu_bacteria 2600254930 2600357023 116
68 iso_pu_bacteria 2600255313 2601773458 116
69 iso_pu_bacteria 2600255318 2601799706 116
70 iso_pu_bacteria 2603880185 2606074109 116
71 iso_pu_bacteria 2603880199 2606126246 116
72 iso_pu_bacteria 2623620443 2624482654 116
73 iso_pu_bacteria 2623620446 2624490281 116
74 iso_pu_bacteria 2643221565 2643842004 116
75 iso_pu_bacteria 2643221589 2643955414 116
76 iso_pu_bacteria 2643221602 2644023766 116
77 iso_pu_bacteria 2643221633 2644185891 116
78 iso_pu_bacteria 2643221650 2644285801 116
79 iso_pu_bacteria 2651869719 2652545175 116
80 iso_pu_bacteria 2667528176 2671125642 116
81 iso_pu_bacteria 2675903515 2678265159 116
82 iso_pu_bacteria 2713897148 2715752018 116
83 iso_pu_bacteria 2713897149 2715755352 116
84 iso_pu_bacteria 2718217725 2718635866 116
85 iso_pu_bacteria 2738543004 2739196495 116
86 iso_pu_bacteria 2738543015 2739257470 116
87 iso_pu_bacteria 2738543020 2739289270 116
88 iso_pu_bacteria 2738543021 2739294582 116
89 iso_pu_bacteria 2738543025 2739314480 116
90 iso_pu_bacteria 2744054620 2745005615 116
91 iso_pu_bacteria 2773857670 2774122092 116
92 iso_pu_bacteria 2773857672 2774131875 116
93 iso_pu_bacteria 2773857673 2774133535 116
94 iso_pu_bacteria 2784132063 2784262578 116
95 iso_pu_bacteria 2784132072 2784314337 116
96 iso_pu_bacteria 2791355520 2794595538 116
97 iso_pu_bacteria 2808606361 2808855824 116
98 iso_pu_bacteria 2808606376 2808921968 116
99 iso_pu_bacteria 2808606377 2808933355 116
100 iso_pu_bacteria 2808606378 2808935905 116
101 iso_pu_bacteria 2808606380 2808944089 116
102 iso_pu_bacteria 2808606381 2808955463 116
103 iso_pu_bacteria 2808606382 2808959683 116
104 iso_pu_bacteria 2808606383 2808964303 116
105 iso_pu_bacteria 2808606389 2808999191 116
106 iso_pu_bacteria 2808606445 2809218560 116
107 iso_pu_bacteria 2818991456 2819654243 116
108 iso_pu_bacteria 2818991464 2819701515 116
109 iso_pu_bacteria 2825651385 2825655945 116
110 iso_pu_bacteria 2842805378 2842809197 116
111 iso_pu_bacteria 2842832357 2842837509 116
112 iso_pu_bacteria 2842843487 2842845293 116
113 iso_pu_bacteria 2842854478 2842856349 116
114 iso_pu_bacteria 2852657418 2852660601 116
115 iso_pu_bacteria 2878029506 2878034584 116
116 iso_pu_bacteria 2880230671 2880235231 116
117 iso_pu_bacteria 2904518522 2904521604 116
118 iso_pu_bacteria 2913036834 2913041768 116
119 iso_pu_bacteria 2917070673 2917075865 116
120 iso_pu_bacteria 2919063839 2919069575 116
121 iso_pu_bacteria 2919385768 2919388652 116
122 iso_pu_bacteria 2919487758 2919490027 116
123 iso_pu_bacteria 2919697872 2919703755 116
124 iso_pu_bacteria 2923586266 2923590413 116
125 iso_pu_bacteria 2929144301 2929149086 116
126 iso_pu_bacteria 2931369376 2931373491 116
127 iso_pu_bacteria 2935353572 2935356851 116
128 iso_pu_bacteria 2974289157 2974289261 116
129 iso_pu_bacteria 2974298342 2974301304 116
130 iso_pu_bacteria 2984499530 2984503781 116
131 iso_pu_bacteria 2984504281 2984507637 116
132 iso_pu_bacteria 2988728565 2988730689 116
133 iso_pu_bacteria 2998139840 2998144641 116
134 iso_pu_bacteria 3007419365 3007420557 116
135 iso_pu_bacteria 3007614139 3007615669 116
136 iso_pu_bacteria 3007718800 3007723949 116
137 iso_pu_bacteria 3007855910 3007858376 116
138 iso_pu_bacteria 3007866637 3007867571 116
139 iso_pu_bacteria 637000220 637322408 116
140 iso_pu_bacteria 8016728285 8016730224 116
141 iso_pu_bacteria 8019775933 8019782070 116
142 iso_pu_bacteria 8029995093 8029996238 116
143 iso_pu_bacteria 8056125926 8056130883 116
144 iso_pu_bacteria 8056143049 8056144303 116
145 iso_pu_bacteria 8056166840 8056171915 116
146 iso_pu_bacteria 8056172158 8056172596 116
147 iso_pu_bacteria 8056177738 8056179773 116
148 iso_pu_bacteria 8056569372 8056574415 116
149 iso_pu_bacteria 8057798959 8057804897 116
150 3300042532 Ga0450893_0004562 Ga0450893_0004562_757_1182 117
151 iso_pu_bacteria 2599185307 2599973361 117
152 iso_pu_bacteria 2600255283 2601625906 117
153 iso_pu_bacteria 2738543016 2739265346 117
154 iso_pu_bacteria 2826581358 2826585537 117
155 iso_pu_bacteria 2842815866 2842818203 117
156 iso_pu_bacteria 2842849001 2842853095 117
157 3300031548 Ga0307408_100000020 Ga0307408_100000020147 118
158 3300041404 Ga0439436_0001947 Ga0439436_0001947_4098_4466 118
159 3300041405 Ga0439438_005991 Ga0439438_005991_2820_3188 118
160 3300041407 Ga0439447_005256 Ga0439447_005256_1216_1584 118
161 3300041411 Ga0439466_0002455 Ga0439466_0002455_2277_2645 118
162 3300041413 Ga0439465_0088938 Ga0439465_0088938_68_436 118
163 3300042006 Ga0439432_017053 Ga0439432_017053_1958_2326 118
164 3300042010 Ga0439452_003491 Ga0439452_003491_1949_2317 118
165 3300042121 Ga0450919_003656 Ga0450919_003656_710_1078 118
166 3300042125 Ga0450923_009756 Ga0450923_009756_1069_1437 118
167 3300042435 Ga0439434_0004449 Ga0439434_0004449_2072_2440 118
168 3300042439 Ga0439464_0005339 Ga0439464_0005339_1487_1846 118
169 3300046463 Ga0495653_0001870 Ga0495653_0001870_10686_11060 118
170 3300046501 Ga0495607_0051559 Ga0495607_0051559_1512_1886 118
171 3300046507 Ga0495606_0003532 Ga0495606_0003532_10522_10896 118
172 3300046520 Ga0495637_0137673 Ga0495637_0137673_179_553 118
173 3300049459 Ga0495678_090711 Ga0495678_090711_83_457 118
174 3300049569 Ga0501032_0017047 Ga0501032_0017047_3342_3710 118
175 3300049571 Ga0501034_0304164 Ga0501034_0304164_535_903 118
176 3300049571 Ga0501034_0803281 Ga0501034_0803281_99_467 118
177 3300049575 Ga0501039_0265071 Ga0501039_0265071_665_1033 118
178 3300027312 Ga0209371_1000372 Ga0209371_100037229 119
179 3300030500 Ga0268256_1000316 Ga0268256_100031629 119
180 3300031824 Ga0307413_10004776 Ga0307413_100047762 119
181 3300032004 Ga0307414_10347300 Ga0307414_103473002 119
182 3300032004 Ga0307414_10428881 Ga0307414_104288812 119
183 3300042010 Ga0439452_018818 Ga0439452_018818_1355_1753 119
184 3300042439 Ga0439464_0002011 Ga0439464_0002011_1542_1940 119
185 3300042439 Ga0439464_0007803 Ga0439464_0007803_2359_2757 119
186 3300048925 Ga0496122_0228335 Ga0496122_0228335_168_566 119
187 iso_pu_bacteria 3007315729 3007317185 119
188 2124908027 MRS2a_Contig_6365 MRS2a_00259800 120
189 2124908027 MRS2a_Contig_63 MRS2a_00493710 120
190 3300002737 JGI25162J39368_1002343 JGI25162J39368_10023433 120
191 3300002737 JGI25162J39368_1002368 JGI25162J39368_10023683 120
192 3300002772 JGI25164J39214_1001140 JGI25164J39214_10011403 120
193 3300002772 JGI25164J39214_1001148 JGI25164J39214_10011483 120
194 3300003214 JGI25165J46597_1002064 JGI25165J46597_10020643 120
195 3300003214 JGI25165J46597_1002076 JGI25165J46597_10020763 120
196 3300003323 rootH1_10113058 rootH1_101130582 120
197 3300003781 Ga0055536_1002477 Ga0055536_10024774 120
198 3300003781 Ga0055536_1009168 Ga0055536_10091682 120
199 3300003781 Ga0055536_1009170 Ga0055536_10091702 120
200 3300003791 Ga0055530_10002925 Ga0055530_100029259 120
201 3300003791 Ga0055530_10003090 Ga0055530_100030904 120
202 3300003791 Ga0055530_10003689 Ga0055530_100036893 120
203 3300003792 Ga0055540_1002354 Ga0055540_10023545 120
204 3300003792 Ga0055540_1002654 Ga0055540_10026544 120
205 3300003792 Ga0055540_1002780 Ga0055540_10027807 120
206 3300003794 Ga0055531_10000348 Ga0055531_1000034816 120
207 3300003794 Ga0055531_10090088 Ga0055531_100900882 120
208 3300005288 Ga0065714_10000200 Ga0065714_100002003 120
209 3300005288 Ga0065714_10010890 Ga0065714_100108902 120
210 3300005288 Ga0065714_10016682 Ga0065714_100166821 120
211 3300005288 Ga0065714_10019055 Ga0065714_100190552 120
212 3300005288 Ga0065714_10065997 Ga0065714_100659974 120
213 3300005288 Ga0065714_10074076 Ga0065714_100740762 120
214 3300005288 Ga0065714_10116478 Ga0065714_101164782 120
215 3300005288 Ga0065714_10148665 Ga0065714_101486652 120
216 3300005289 Ga0065704_10027423 Ga0065704_100274232 120
217 3300005289 Ga0065704_10030190 Ga0065704_100301902 120
218 3300005289 Ga0065704_10031494 Ga0065704_100314941 120
219 3300005289 Ga0065704_10072936 Ga0065704_100729364 120
220 3300005289 Ga0065704_10080368 Ga0065704_100803682 120
221 3300005289 Ga0065704_10321926 Ga0065704_103219262 120
222 3300005290 Ga0065712_10000146 Ga0065712_1000014654 120
223 3300005290 Ga0065712_10000717 Ga0065712_100007173 120
224 3300005293 Ga0065715_10153109 Ga0065715_101531091 120
225 3300005328 Ga0070676_10582923 Ga0070676_105829232 120
226 3300005435 Ga0070714_100717935 Ga0070714_1007179352 120
227 3300005457 Ga0070662_100651465 Ga0070662_1006514651 120
228 3300005548 Ga0070665_100659418 Ga0070665_1006594182 120
229 3300005548 Ga0070665_100672402 Ga0070665_1006724022 120
230 3300005615 Ga0070702_101795896 Ga0070702_1017958961 120
231 3300006028 Ga0070717_10948683 Ga0070717_109486832 120
232 3300006048 Ga0075363_100305575 Ga0075363_1003055752 120
233 3300006051 Ga0075364_10084038 Ga0075364_100840382 120
234 3300006051 Ga0075364_10151254 Ga0075364_101512542 120
235 3300006051 Ga0075364_10549449 Ga0075364_105494492 120
236 3300006058 Ga0075432_10004050 Ga0075432_100040504 120
237 3300006058 Ga0075432_10084883 Ga0075432_100848832 120
238 3300006058 Ga0075432_10099805 Ga0075432_100998052 120
239 3300006058 Ga0075432_10516211 Ga0075432_105162111 120
240 3300006177 Ga0075362_10179175 Ga0075362_101791752 120
241 3300006177 Ga0075362_10190353 Ga0075362_101903532 120
242 3300006186 Ga0075369_10126777 Ga0075369_101267772 120
243 3300006195 Ga0075366_10680393 Ga0075366_106803931 120
244 3300006353 Ga0075370_10312948 Ga0075370_103129482 120
245 3300006353 Ga0075370_10516229 Ga0075370_105162291 120
246 3300006914 Ga0075436_100477209 Ga0075436_1004772092 120
247 3300006914 Ga0075436_100984525 Ga0075436_1009845251 120
248 3300006946 Ga0079104_1002687 Ga0079104_10026873 120
249 3300006946 Ga0079104_1003518 Ga0079104_10035188 120
250 3300006948 Ga0099826_10037988 Ga0099826_100379883 120
251 3300009011 Ga0105251_10000004 Ga0105251_10000004266 120
252 3300009011 Ga0105251_10004443 Ga0105251_100044439 120
253 3300009011 Ga0105251_10007066 Ga0105251_100070663 120
254 3300009011 Ga0105251_10152037 Ga0105251_101520372 120
255 3300009011 Ga0105251_10376619 Ga0105251_103766192 120
256 3300009036 Ga0105244_10001043 Ga0105244_100010437 120
257 3300009036 Ga0105244_10005209 Ga0105244_100052092 120
258 3300009036 Ga0105244_10017949 Ga0105244_100179492 120
259 3300009036 Ga0105244_10018410 Ga0105244_100184104 120
260 3300009036 Ga0105244_10042431 Ga0105244_100424312 120
261 3300009036 Ga0105244_10049032 Ga0105244_100490322 120
262 3300009036 Ga0105244_10162520 Ga0105244_101625202 120
263 3300009036 Ga0105244_10284323 Ga0105244_102843231 120
264 3300009092 Ga0105250_10002390 Ga0105250_100023903 120
265 3300009092 Ga0105250_10011759 Ga0105250_100117593 120
266 3300009092 Ga0105250_10072110 Ga0105250_100721102 120
267 3300009092 Ga0105250_10134459 Ga0105250_101344591 120
268 3300009092 Ga0105250_10190386 Ga0105250_101903861 120
269 3300009092 Ga0105250_10223713 Ga0105250_102237131 120
270 3300009148 Ga0105243_10002016 Ga0105243_100020169 120
271 3300009148 Ga0105243_10021965 Ga0105243_100219652 120
272 3300009148 Ga0105243_10035653 Ga0105243_100356532 120
273 3300009148 Ga0105243_10088108 Ga0105243_100881082 120
274 3300009148 Ga0105243_10100894 Ga0105243_101008942 120
275 3300009148 Ga0105243_10935939 Ga0105243_109359392 120
276 3300009176 Ga0105242_10108381 Ga0105242_101083811 120
277 3300009176 Ga0105242_11007755 Ga0105242_110077552 120
278 3300009551 Ga0105238_11068549 Ga0105238_110685492 120
279 3300009553 Ga0105249_10068245 Ga0105249_100682452 120
280 3300011119 Ga0105246_10003691 Ga0105246_100036919 120
281 3300011119 Ga0105246_10007602 Ga0105246_100076023 120
282 3300011119 Ga0105246_10051958 Ga0105246_100519584 120
283 3300012477 Ga0157336_1021986 Ga0157336_10219861 120
284 3300012498 Ga0157345_1000406 Ga0157345_10004063 120
285 3300012502 Ga0157347_1012782 Ga0157347_10127822 120
286 3300013100 Ga0157373_10006663 Ga0157373_100066633 120
287 3300013100 Ga0157373_10011669 Ga0157373_100116693 120
288 3300013100 Ga0157373_10035499 Ga0157373_100354991 120
289 3300013100 Ga0157373_10081575 Ga0157373_100815752 120
290 3300013100 Ga0157373_10612783 Ga0157373_106127831 120
291 3300013102 Ga0157371_10016794 Ga0157371_100167945 120
292 3300013102 Ga0157371_10022390 Ga0157371_100223907 120
293 3300013102 Ga0157371_10029549 Ga0157371_100295492 120
294 3300013102 Ga0157371_10048074 Ga0157371_100480743 120
295 3300013102 Ga0157371_10423721 Ga0157371_104237212 120
296 3300013104 Ga0157370_10100977 Ga0157370_101009773 120
297 3300013104 Ga0157370_10129888 Ga0157370_101298881 120
298 3300013104 Ga0157370_10308121 Ga0157370_103081212 120
299 3300013104 Ga0157370_10440361 Ga0157370_104403612 120
300 3300013104 Ga0157370_10470853 Ga0157370_104708532 120
301 3300013104 Ga0157370_10538873 Ga0157370_105388732 120
302 3300013105 Ga0157369_10004082 Ga0157369_100040823 120
303 3300013105 Ga0157369_11743848 Ga0157369_117438482 120
304 3300013306 Ga0163162_10031182 Ga0163162_100311823 120
305 3300013307 Ga0157372_10041925 Ga0157372_100419254 120
306 3300013308 Ga0157375_10099065 Ga0157375_100990652 120
307 3300013308 Ga0157375_11539420 Ga0157375_115394201 120
308 3300014326 Ga0157380_11096178 Ga0157380_110961781 120
309 3300014497 Ga0182008_10005981 Ga0182008_100059817 120
310 3300014497 Ga0182008_10019027 Ga0182008_100190271 120
311 3300014497 Ga0182008_10021627 Ga0182008_100216273 120
312 3300014497 Ga0182008_10039351 Ga0182008_100393511 120
313 3300014497 Ga0182008_10112047 Ga0182008_101120472 120
314 3300014497 Ga0182008_10184842 Ga0182008_101848422 120
315 3300015261 Ga0182006_1013528 Ga0182006_10135281 120
316 3300015261 Ga0182006_1018530 Ga0182006_10185302 120
317 3300015261 Ga0182006_1022967 Ga0182006_10229671 120
318 3300015261 Ga0182006_1031971 Ga0182006_10319712 120
319 3300015262 Ga0182007_10010960 Ga0182007_100109601 120
320 3300015262 Ga0182007_10243394 Ga0182007_102433942 120
321 3300015265 Ga0182005_1011004 Ga0182005_10110041 120
322 3300015265 Ga0182005_1025175 Ga0182005_10251753 120
323 3300017792 Ga0163161_10033270 Ga0163161_100332703 120
324 3300017792 Ga0163161_10098800 Ga0163161_100988002 120
325 3300017792 Ga0163161_10198086 Ga0163161_101980862 120
326 3300017792 Ga0163161_10618130 Ga0163161_106181302 120
327 3300025207 Ga0209760_100534 Ga0209760_1005343 120
328 3300025226 Ga0209674_116692 Ga0209674_1166921 120
329 3300025230 Ga0209563_102480 Ga0209563_1024802 120
330 3300025231 Ga0207427_100007 Ga0207427_100007576 120
331 3300025233 Ga0209437_100006 Ga0209437_100006842 120
332 3300025256 Ga0209759_1015308 Ga0209759_10153083 120
333 3300025261 Ga0209233_1000059 Ga0209233_1000059153 120
334 3300025291 Ga0209675_1004261 Ga0209675_10042613 120
335 3300025292 Ga0209676_1000010 Ga0209676_1000010799 120
336 3300025292 Ga0209676_1017459 Ga0209676_10174592 120
337 3300025292 Ga0209676_1019618 Ga0209676_10196182 120
338 3300025298 Ga0209050_1000019 Ga0209050_100001964 120
339 3300025298 Ga0209050_1000027 Ga0209050_1000027290 120
340 3300025298 Ga0209050_1004537 Ga0209050_10045373 120
341 3300025303 Ga0209051_1000102 Ga0209051_10001024 120
342 3300025303 Ga0209051_1000383 Ga0209051_10003833 120
343 3300025303 Ga0209051_1008728 Ga0209051_10087283 120
344 3300025304 Ga0209257_1000119 Ga0209257_1000119204 120
345 3300025304 Ga0209257_1011631 Ga0209257_10116314 120
346 3300025711 Ga0207696_1000054 Ga0207696_1000054202 120
347 3300025711 Ga0207696_1000213 Ga0207696_100021367 120
348 3300025711 Ga0207696_1003221 Ga0207696_10032217 120
349 3300025711 Ga0207696_1008374 Ga0207696_10083742 120
350 3300025711 Ga0207696_1049746 Ga0207696_10497462 120
351 3300025728 Ga0207655_1000005 Ga0207655_1000005134 120
352 3300025728 Ga0207655_1000015 Ga0207655_1000015223 120
353 3300025728 Ga0207655_1001289 Ga0207655_100128918 120
354 3300025728 Ga0207655_1004342 Ga0207655_10043427 120
355 3300025728 Ga0207655_1009983 Ga0207655_10099835 120
356 3300025728 Ga0207655_1012220 Ga0207655_10122203 120
357 3300025728 Ga0207655_1015195 Ga0207655_10151953 120
358 3300025728 Ga0207655_1015443 Ga0207655_10154434 120
359 3300025728 Ga0207655_1016868 Ga0207655_10168682 120
360 3300025728 Ga0207655_1048185 Ga0207655_10481852 120
361 3300025728 Ga0207655_1053401 Ga0207655_10534012 120
362 3300025728 Ga0207655_1108396 Ga0207655_11083962 120
363 3300025735 Ga0207713_1000013 Ga0207713_1000013310 120
364 3300025735 Ga0207713_1005285 Ga0207713_10052858 120
365 3300025735 Ga0207713_1005703 Ga0207713_10057032 120
366 3300025735 Ga0207713_1007779 Ga0207713_10077797 120
367 3300025735 Ga0207713_1009866 Ga0207713_10098663 120
368 3300025735 Ga0207713_1014244 Ga0207713_10142445 120
369 3300025735 Ga0207713_1018723 Ga0207713_10187234 120
370 3300025735 Ga0207713_1022092 Ga0207713_10220923 120
371 3300025735 Ga0207713_1120972 Ga0207713_11209722 120
372 3300025907 Ga0207645_10662098 Ga0207645_106620982 120
373 3300025923 Ga0207681_10038543 Ga0207681_100385432 120
374 3300025929 Ga0207664_10817785 Ga0207664_108177852 120
375 3300025933 Ga0207706_10052083 Ga0207706_100520833 120
376 3300025934 Ga0207686_11047115 Ga0207686_110471152 120
377 3300025935 Ga0207709_10000224 Ga0207709_1000022420 120
378 3300025935 Ga0207709_10001009 Ga0207709_100010095 120
379 3300025935 Ga0207709_10003502 Ga0207709_100035029 120
380 3300025935 Ga0207709_10099832 Ga0207709_100998322 120
381 3300025935 Ga0207709_10427187 Ga0207709_104271872 120
382 3300026067 Ga0207678_10080860 Ga0207678_100808602 120
383 3300027111 Ga0209281_1000015 Ga0209281_1000015289 120
384 3300027111 Ga0209281_1002030 Ga0209281_10020309 120
385 3300027111 Ga0209281_1002560 Ga0209281_10025603 120
386 3300027360 Ga0209969_1005590 Ga0209969_10055902 120
387 3300027378 Ga0209981_1009128 Ga0209981_10091281 120
388 3300027378 Ga0209981_1018505 Ga0209981_10185052 120
389 3300027395 Ga0209996_1001815 Ga0209996_10018152 120
390 3300027424 Ga0209984_1000904 Ga0209984_10009044 120
391 3300027462 Ga0210000_1043629 Ga0210000_10436291 120
392 3300027471 Ga0209995_1000370 Ga0209995_10003702 120
393 3300027526 Ga0209968_1009181 Ga0209968_10091812 120
394 3300027665 Ga0209983_1001799 Ga0209983_10017997 120
395 3300027665 Ga0209983_1014344 Ga0209983_10143442 120
396 3300027682 Ga0209971_1000990 Ga0209971_10009908 120
397 3300027876 Ga0209974_10008818 Ga0209974_100088183 120
398 3300027876 Ga0209974_10042207 Ga0209974_100422071 120
399 3300027907 Ga0207428_10019963 Ga0207428_100199637 120
400 3300027907 Ga0207428_10095682 Ga0207428_100956821 120
401 3300027907 Ga0207428_10097055 Ga0207428_100970552 120
402 3300027907 Ga0207428_10175017 Ga0207428_101750172 120
403 3300027907 Ga0207428_10371753 Ga0207428_103717532 120
404 3300028379 Ga0268266_11170812 Ga0268266_111708122 120
405 3300028786 Ga0307517_10304678 Ga0307517_103046781 120
406 3300028794 Ga0307515_10523950 Ga0307515_105239502 120
407 3300030521 Ga0307511_10041014 Ga0307511_100410142 120
408 3300030731 Ga0316177_1067959 Ga0316177_10679591 120
409 3300030733 Ga0314311_1053106 Ga0314311_10531062 120
410 3300030734 Ga0316179_1118252 Ga0316179_11182523 120
411 3300030735 Ga0316178_1061339 Ga0316178_10613392 120
412 3300030742 Ga0316183_1164786 Ga0316183_11647862 120
413 3300031456 Ga0307513_10677141 Ga0307513_106771412 120
414 3300031548 Ga0307408_100026677 Ga0307408_1000266773 120
415 3300031548 Ga0307408_100052194 Ga0307408_1000521941 120
416 3300031548 Ga0307408_100084620 Ga0307408_1000846202 120
417 3300031548 Ga0307408_100155822 Ga0307408_1001558222 120
418 3300031730 Ga0307516_10758312 Ga0307516_107583121 120
419 3300031731 Ga0307405_10016467 Ga0307405_100164674 120
420 3300031731 Ga0307405_10045984 Ga0307405_100459842 120
421 3300031824 Ga0307413_10327181 Ga0307413_103271811 120
422 3300031824 Ga0307413_10332244 Ga0307413_103322441 120
423 3300031824 Ga0307413_10412353 Ga0307413_104123532 120
424 3300031852 Ga0307410_11095442 Ga0307410_110954421 120
425 3300031901 Ga0307406_10068257 Ga0307406_100682572 120
426 3300031901 Ga0307406_10081625 Ga0307406_100816252 120
427 3300031903 Ga0307407_10164372 Ga0307407_101643721 120
428 3300031903 Ga0307407_10252854 Ga0307407_102528541 120
429 3300031903 Ga0307407_10535555 Ga0307407_105355552 120
430 3300031911 Ga0307412_10026347 Ga0307412_100263471 120
431 3300031911 Ga0307412_10042695 Ga0307412_100426952 120
432 3300031911 Ga0307412_10043739 Ga0307412_100437392 120
433 3300031911 Ga0307412_10323155 Ga0307412_103231552 120
434 3300031995 Ga0307409_100153497 Ga0307409_1001534972 120
435 3300031995 Ga0307409_100347020 Ga0307409_1003470201 120
436 3300031995 Ga0307409_101039419 Ga0307409_1010394192 120
437 3300032002 Ga0307416_101199984 Ga0307416_1011999841 120
438 3300032002 Ga0307416_102661354 Ga0307416_1026613541 120
439 3300032004 Ga0307414_10022843 Ga0307414_100228433 120
440 3300032004 Ga0307414_10407538 Ga0307414_104075381 120
441 3300032004 Ga0307414_10574864 Ga0307414_105748642 120
442 3300032004 Ga0307414_11071539 Ga0307414_110715392 120
443 3300032005 Ga0307411_10092469 Ga0307411_100924692 120
444 3300032005 Ga0307411_10113658 Ga0307411_101136581 120
445 3300032005 Ga0307411_10143139 Ga0307411_101431391 120
446 3300032005 Ga0307411_10199398 Ga0307411_101993982 120
447 3300033180 Ga0307510_10049362 Ga0307510_100493624 120
448 3300038705 Ga0237819_00850 Ga0237819_00850_6311_6673 120
449 3300041405 Ga0439438_004835 Ga0439438_004835_2899_3261 120
450 3300041405 Ga0439438_012496 Ga0439438_012496_475_837 120
451 3300041405 Ga0439438_013016 Ga0439438_013016_1706_2068 120
452 3300041405 Ga0439438_033892 Ga0439438_033892_832_1194 120
453 3300041405 Ga0439438_035560 Ga0439438_035560_860_1222 120
454 3300041407 Ga0439447_007191 Ga0439447_007191_3029_3391 120
455 3300041407 Ga0439447_007499 Ga0439447_007499_28_390 120
456 3300041407 Ga0439447_028240 Ga0439447_028240_720_1082 120
457 3300041411 Ga0439466_0012706 Ga0439466_0012706_1939_2310 120
458 3300041411 Ga0439466_0030461 Ga0439466_0030461_347_709 120
459 3300041411 Ga0439466_0039442 Ga0439466_0039442_602_964 120
460 3300041411 Ga0439466_0059830 Ga0439466_0059830_742_1104 120
461 3300041411 Ga0439466_0088008 Ga0439466_0088008_178_540 120
462 3300042006 Ga0439432_006875 Ga0439432_006875_633_995 120
463 3300042009 Ga0439451_015210 Ga0439451_015210_173_544 120
464 3300042010 Ga0439452_002068 Ga0439452_002068_4210_4572 120
465 3300042010 Ga0439452_005492 Ga0439452_005492_3064_3426 120
466 3300042010 Ga0439452_006171 Ga0439452_006171_3019_3390 120
467 3300042010 Ga0439452_055582 Ga0439452_055582_169_531 120
468 3300042013 Ga0439456_008547 Ga0439456_008547_171_533 120
469 3300042013 Ga0439456_009482 Ga0439456_009482_129_500 120
470 3300042013 Ga0439456_064912 Ga0439456_064912_358_720 120
471 3300042016 Ga0439463_000398 Ga0439463_000398_11009_11383 120
472 3300042016 Ga0439463_118357 Ga0439463_118357_202_564 120
473 3300042115 Ga0450911_002061 Ga0450911_002061_716_1078 120
474 3300042115 Ga0450911_014547 Ga0450911_014547_557_919 120
475 3300042115 Ga0450911_021889 Ga0450911_021889_126_497 120
476 3300042121 Ga0450919_015498 Ga0450919_015498_152_514 120
477 3300042122 Ga0450920_002273 Ga0450920_002273_164_526 120
478 3300042124 Ga0450922_003438 Ga0450922_003438_174_536 120
479 3300042124 Ga0450922_007710 Ga0450922_007710_95_466 120
480 3300042125 Ga0450923_019088 Ga0450923_019088_346_708 120
481 3300042138 Ga0450903_006890 Ga0450903_006890_59_421 120
482 3300042145 Ga0450906_038611 Ga0450906_038611_309_671 120
483 3300042146 Ga0450907_001573 Ga0450907_001573_2254_2616 120
484 3300042147 Ga0450910_002470 Ga0450910_002470_1839_2201 120
485 3300042156 Ga0439446_0002625 Ga0439446_0002625_2182_2556 120
486 3300042156 Ga0439446_0281111 Ga0439446_0281111_118_480 120
487 3300042184 Ga0450908_004130 Ga0450908_004130_618_980 120
488 3300042532 Ga0450893_0025484 Ga0450893_0025484_439_801 120
489 3300042533 Ga0450901_007621 Ga0450901_007621_385_747 120
490 3300046452 Ga0495617_005254 Ga0495617_005254_2995_3357 120
491 3300046452 Ga0495617_018827 Ga0495617_018827_114_530 120
492 3300046452 Ga0495617_019507 Ga0495617_019507_149_565 120
493 3300046452 Ga0495617_038146 Ga0495617_038146_206_568 120
494 3300046452 Ga0495617_051979 Ga0495617_051979_213_587 120
495 3300046452 Ga0495617_056646 Ga0495617_056646_161_523 120
496 3300046453 Ga0495627_002521 Ga0495627_002521_2303_2674 120
497 3300046453 Ga0495627_009785 Ga0495627_009785_3057_3419 120
498 3300046453 Ga0495627_071325 Ga0495627_071325_558_920 120
499 3300046453 Ga0495627_095624 Ga0495627_095624_163_525 120
500 3300046453 Ga0495627_221450 Ga0495627_221450_82_444 120
501 3300046455 Ga0495603_0025579 Ga0495603_0025579_3052_3414 120
502 3300046457 Ga0495590_0005392 Ga0495590_0005392_3056_3418 120
503 3300046457 Ga0495590_0053578 Ga0495590_0053578_794_1168 120
504 3300046457 Ga0495590_0058969 Ga0495590_0058969_119_481 120
505 3300046457 Ga0495590_0074039 Ga0495590_0074039_681_1043 120
506 3300046457 Ga0495590_0082356 Ga0495590_0082356_617_979 120
507 3300046458 Ga0495591_000015 Ga0495591_000015_43556_43927 120
508 3300046458 Ga0495591_002895 Ga0495591_002895_5702_6076 120
509 3300046458 Ga0495591_004113 Ga0495591_004113_941_1315 120
510 3300046458 Ga0495591_006233 Ga0495591_006233_3068_3430 120
511 3300046458 Ga0495591_008874 Ga0495591_008874_3046_3408 120
512 3300046458 Ga0495591_010833 Ga0495591_010833_3004_3366 120
513 3300046458 Ga0495591_011046 Ga0495591_011046_3064_3426 120
514 3300046458 Ga0495591_012960 Ga0495591_012960_2107_2469 120
515 3300046458 Ga0495591_014684 Ga0495591_014684_1832_2194 120
516 3300046459 Ga0495629_0033508 Ga0495629_0033508_1329_1691 120
517 3300046460 Ga0495638_0014846 Ga0495638_0014846_1843_2205 120
518 3300046460 Ga0495638_0014868 Ga0495638_0014868_1854_2216 120
519 3300046460 Ga0495638_0080108 Ga0495638_0080108_1460_1822 120
520 3300046460 Ga0495638_0134088 Ga0495638_0134088_469_843 120
521 3300046460 Ga0495638_0178702 Ga0495638_0178702_695_1057 120
522 3300046460 Ga0495638_0186743 Ga0495638_0186743_619_981 120
523 3300046460 Ga0495638_0192229 Ga0495638_0192229_73_435 120
524 3300046463 Ga0495653_0046479 Ga0495653_0046479_1471_1833 120
525 3300046463 Ga0495653_0056069 Ga0495653_0056069_1543_1905 120
526 3300046463 Ga0495653_0076865 Ga0495653_0076865_138_500 120
527 3300046471 Ga0495650_0004551 Ga0495650_0004551_5964_6338 120
528 3300046471 Ga0495650_0011165 Ga0495650_0011165_1368_1739 120
529 3300046471 Ga0495650_0015874 Ga0495650_0015874_1714_2076 120
530 3300046471 Ga0495650_0016615 Ga0495650_0016615_1886_2302 120
531 3300046471 Ga0495650_0017682 Ga0495650_0017682_164_526 120
532 3300046471 Ga0495650_0045832 Ga0495650_0045832_611_973 120
533 3300046471 Ga0495650_0087562 Ga0495650_0087562_23_385 120
534 3300046471 Ga0495650_0109288 Ga0495650_0109288_523_885 120
535 3300046473 Ga0495582_0011363 Ga0495582_0011363_3020_3382 120
536 3300046474 Ga0495605_0003192 Ga0495605_0003192_6255_6626 120
537 3300046474 Ga0495605_0007738 Ga0495605_0007738_3053_3415 120
538 3300046474 Ga0495605_0008705 Ga0495605_0008705_3173_3547 120
539 3300046474 Ga0495605_0010449 Ga0495605_0010449_3322_3693 120
540 3300046474 Ga0495605_0010639 Ga0495605_0010639_3064_3426 120
541 3300046474 Ga0495605_0010684 Ga0495605_0010684_3017_3379 120
542 3300046474 Ga0495605_0015768 Ga0495605_0015768_1895_2266 120
543 3300046474 Ga0495605_0088872 Ga0495605_0088872_645_1061 120
544 3300046474 Ga0495605_0092256 Ga0495605_0092256_44_406 120
545 3300046474 Ga0495605_0133777 Ga0495605_0133777_469_831 120
546 3300046474 Ga0495605_0239423 Ga0495605_0239423_120_482 120
547 3300046475 Ga0495639_0002688 Ga0495639_0002688_3054_3416 120
548 3300046475 Ga0495639_0026561 Ga0495639_0026561_533_895 120
549 3300046491 Ga0495584_0004204 Ga0495584_0004204_6907_7281 120
550 3300046491 Ga0495584_0009064 Ga0495584_0009064_1738_2100 120
551 3300046491 Ga0495584_0061895 Ga0495584_0061895_715_1077 120
552 3300046491 Ga0495584_0079759 Ga0495584_0079759_571_933 120
553 3300046491 Ga0495584_0092146 Ga0495584_0092146_593_955 120
554 3300046491 Ga0495584_0119702 Ga0495584_0119702_507_869 120
555 3300046491 Ga0495584_0383041 Ga0495584_0383041_156_518 120
556 3300046492 Ga0495585_0011356 Ga0495585_0011356_1868_2230 120
557 3300046492 Ga0495585_0017278 Ga0495585_0017278_793_1155 120
558 3300046492 Ga0495585_0081114 Ga0495585_0081114_343_717 120
559 3300046492 Ga0495585_0122382 Ga0495585_0122382_59_421 120
560 3300046500 Ga0495596_0006544 Ga0495596_0006544_3101_3463 120
561 3300046500 Ga0495596_0083574 Ga0495596_0083574_783_1145 120
562 3300046501 Ga0495607_0002286 Ga0495607_0002286_10023_10394 120
563 3300046501 Ga0495607_0005389 Ga0495607_0005389_3158_3529 120
564 3300046501 Ga0495607_0005406 Ga0495607_0005406_5665_6039 120
565 3300046501 Ga0495607_0005433 Ga0495607_0005433_3169_3540 120
566 3300046501 Ga0495607_0013447 Ga0495607_0013447_657_1031 120
567 3300046501 Ga0495607_0014534 Ga0495607_0014534_3055_3417 120
568 3300046501 Ga0495607_0014535 Ga0495607_0014535_452_826 120
569 3300046501 Ga0495607_0022540 Ga0495607_0022540_466_852 120
570 3300046501 Ga0495607_0028261 Ga0495607_0028261_527_901 120
571 3300046501 Ga0495607_0035661 Ga0495607_0035661_744_1115 120
572 3300046501 Ga0495607_0045578 Ga0495607_0045578_1834_2208 120
573 3300046501 Ga0495607_0096806 Ga0495607_0096806_597_968 120
574 3300046501 Ga0495607_0121885 Ga0495607_0121885_457_819 120
575 3300046501 Ga0495607_0185660 Ga0495607_0185660_545_907 120
576 3300046501 Ga0495607_0378176 Ga0495607_0378176_77_439 120
577 3300046506 Ga0495583_0004401 Ga0495583_0004401_3210_3581 120
578 3300046506 Ga0495583_0005753 Ga0495583_0005753_3122_3496 120
579 3300046506 Ga0495583_0015958 Ga0495583_0015958_3181_3552 120
580 3300046506 Ga0495583_0016145 Ga0495583_0016145_2319_2693 120
581 3300046506 Ga0495583_0017659 Ga0495583_0017659_3202_3576 120
582 3300046506 Ga0495583_0037496 Ga0495583_0037496_134_496 120
583 3300046506 Ga0495583_0068785 Ga0495583_0068785_610_972 120
584 3300046507 Ga0495606_0017307 Ga0495606_0017307_2075_2437 120
585 3300046507 Ga0495606_0017986 Ga0495606_0017986_1732_2106 120
586 3300046507 Ga0495606_0022667 Ga0495606_0022667_1841_2203 120
587 3300046507 Ga0495606_0023324 Ga0495606_0023324_1106_1480 120
588 3300046507 Ga0495606_0025496 Ga0495606_0025496_727_1101 120
589 3300046507 Ga0495606_0033353 Ga0495606_0033353_174_536 120
590 3300046507 Ga0495606_0034211 Ga0495606_0034211_125_487 120
591 3300046507 Ga0495606_0088915 Ga0495606_0088915_141_503 120
592 3300046507 Ga0495606_0163539 Ga0495606_0163539_570_932 120
593 3300046512 Ga0495610_0015699 Ga0495610_0015699_3190_3552 120
594 3300046512 Ga0495610_0019105 Ga0495610_0019105_449_865 120
595 3300046512 Ga0495610_0022319 Ga0495610_0022319_42_404 120
596 3300046512 Ga0495610_0033789 Ga0495610_0033789_506_868 120
597 3300046512 Ga0495610_0062866 Ga0495610_0062866_185_556 120
598 3300046512 Ga0495610_0272314 Ga0495610_0272314_113_475 120
599 3300046513 Ga0495616_0009667 Ga0495616_0009667_3488_3850 120
600 3300046513 Ga0495616_0016921 Ga0495616_0016921_1863_2279 120
601 3300046513 Ga0495616_0018335 Ga0495616_0018335_1695_2057 120
602 3300046513 Ga0495616_0055611 Ga0495616_0055611_126_542 120
603 3300046513 Ga0495616_0148199 Ga0495616_0148199_618_1004 120
604 3300046513 Ga0495616_0226203 Ga0495616_0226203_377_739 120
605 3300046513 Ga0495616_0343692 Ga0495616_0343692_74_436 120
606 3300046515 Ga0495620_0008155 Ga0495620_0008155_3114_3488 120
607 3300046515 Ga0495620_0008360 Ga0495620_0008360_1870_2232 120
608 3300046515 Ga0495620_0009999 Ga0495620_0009999_1601_1963 120
609 3300046515 Ga0495620_0010670 Ga0495620_0010670_1306_1680 120
610 3300046515 Ga0495620_0042422 Ga0495620_0042422_814_1176 120
611 3300046515 Ga0495620_0081400 Ga0495620_0081400_773_1135 120
612 3300046517 Ga0495630_0317747 Ga0495630_0317747_705_1067 120
613 3300046518 Ga0495631_0006910 Ga0495631_0006910_3088_3462 120
614 3300046518 Ga0495631_0008741 Ga0495631_0008741_1692_2054 120
615 3300046518 Ga0495631_0009105 Ga0495631_0009105_469_840 120
616 3300046518 Ga0495631_0016294 Ga0495631_0016294_3008_3370 120
617 3300046518 Ga0495631_0121312 Ga0495631_0121312_349_711 120
618 3300046519 Ga0495632_0010120 Ga0495632_0010120_999_1373 120
619 3300046519 Ga0495632_0011673 Ga0495632_0011673_3012_3374 120
620 3300046519 Ga0495632_0011827 Ga0495632_0011827_3006_3368 120
621 3300046519 Ga0495632_0014349 Ga0495632_0014349_892_1263 120
622 3300046519 Ga0495632_0017298 Ga0495632_0017298_3041_3403 120
623 3300046519 Ga0495632_0034749 Ga0495632_0034749_462_824 120
624 3300046519 Ga0495632_0087816 Ga0495632_0087816_125_541 120
625 3300046519 Ga0495632_0230386 Ga0495632_0230386_105_467 120
626 3300046519 Ga0495632_0326219 Ga0495632_0326219_62_433 120
627 3300046520 Ga0495637_0002754 Ga0495637_0002754_3218_3592 120
628 3300046520 Ga0495637_0006137 Ga0495637_0006137_3127_3501 120
629 3300046520 Ga0495637_0007676 Ga0495637_0007676_3072_3434 120
630 3300046520 Ga0495637_0009878 Ga0495637_0009878_587_958 120
631 3300046520 Ga0495637_0011097 Ga0495637_0011097_1844_2206 120
632 3300046520 Ga0495637_0013267 Ga0495637_0013267_1760_2122 120
633 3300046520 Ga0495637_0014581 Ga0495637_0014581_3111_3497 120
634 3300046520 Ga0495637_0023155 Ga0495637_0023155_1760_2122 120
635 3300046520 Ga0495637_0029375 Ga0495637_0029375_704_1066 120
636 3300046520 Ga0495637_0186339 Ga0495637_0186339_73_444 120
637 3300046522 Ga0495643_0001220 Ga0495643_0001220_3775_4146 120
638 3300046522 Ga0495643_0014224 Ga0495643_0014224_1460_1834 120
639 3300046522 Ga0495643_0014720 Ga0495643_0014720_2392_2766 120
640 3300046522 Ga0495643_0016323 Ga0495643_0016323_618_980 120
641 3300046522 Ga0495643_0022424 Ga0495643_0022424_3029_3400 120
642 3300046522 Ga0495643_0072319 Ga0495643_0072319_1327_1743 120
643 3300046522 Ga0495643_0092244 Ga0495643_0092244_753_1115 120
644 3300046522 Ga0495643_0134829 Ga0495643_0134829_688_1050 120
645 3300046523 Ga0495644_0011264 Ga0495644_0011264_239_613 120
646 3300046523 Ga0495644_0024499 Ga0495644_0024499_147_563 120
647 3300046524 Ga0495648_0002757 Ga0495648_0002757_12931_13305 120
648 3300046524 Ga0495648_0020724 Ga0495648_0020724_3198_3572 120
649 3300046524 Ga0495648_0068471 Ga0495648_0068471_125_487 120
650 3300046524 Ga0495648_0141007 Ga0495648_0141007_607_969 120
651 3300046524 Ga0495648_0157311 Ga0495648_0157311_619_981 120
652 3300046524 Ga0495648_0285350 Ga0495648_0285350_74_436 120
653 3300046524 Ga0495648_0330859 Ga0495648_0330859_129_491 120
654 3300046526 Ga0495666_0008636 Ga0495666_0008636_3026_3388 120
655 3300046526 Ga0495666_0015667 Ga0495666_0015667_1972_2334 120
656 3300046528 Ga0495642_0004844 Ga0495642_0004844_1773_2135 120
657 3300046528 Ga0495642_0086277 Ga0495642_0086277_97_459 120
658 3300046529 Ga0495652_0152432 Ga0495652_0152432_1239_1610 120
659 3300046530 Ga0495654_0004450 Ga0495654_0004450_5942_6316 120
660 3300046530 Ga0495654_0007398 Ga0495654_0007398_1574_1945 120
661 3300046530 Ga0495654_0014809 Ga0495654_0014809_3065_3427 120
662 3300046530 Ga0495654_0015390 Ga0495654_0015390_1345_1761 120
663 3300046530 Ga0495654_0017707 Ga0495654_0017707_3012_3374 120
664 3300046530 Ga0495654_0019172 Ga0495654_0019172_3033_3395 120
665 3300046530 Ga0495654_0019440 Ga0495654_0019440_3056_3418 120
666 3300046530 Ga0495654_0020022 Ga0495654_0020022_3058_3420 120
667 3300046530 Ga0495654_0026604 Ga0495654_0026604_804_1166 120
668 3300046530 Ga0495654_0029675 Ga0495654_0029675_653_1015 120
669 3300046530 Ga0495654_0030003 Ga0495654_0030003_603_965 120
670 3300046530 Ga0495654_0278209 Ga0495654_0278209_212_583 120
671 3300046535 Ga0495586_0040848 Ga0495586_0040848_1356_1718 120
672 3300046536 Ga0495587_0012284 Ga0495587_0012284_956_1318 120
673 3300046536 Ga0495587_0022683 Ga0495587_0022683_1814_2176 120
674 3300046538 Ga0495609_0003213 Ga0495609_0003213_5923_6297 120
675 3300046538 Ga0495609_0007879 Ga0495609_0007879_1843_2205 120
676 3300046538 Ga0495609_0039186 Ga0495609_0039186_1593_1967 120
677 3300046538 Ga0495609_0046763 Ga0495609_0046763_96_458 120
678 3300046542 Ga0495597_0001457 Ga0495597_0001457_5642_6013 120
679 3300046542 Ga0495597_0027373 Ga0495597_0027373_130_546 120
680 3300046542 Ga0495597_0047214 Ga0495597_0047214_666_1028 120
681 3300046542 Ga0495597_0175356 Ga0495597_0175356_383_745 120
682 3300046543 Ga0495645_0117725 Ga0495645_0117725_1454_1816 120
683 3300046543 Ga0495645_0260279 Ga0495645_0260279_362_739 120
684 3300046557 Ga0495622_0006744 Ga0495622_0006744_1909_2271 120
685 3300046557 Ga0495622_0008637 Ga0495622_0008637_4108_4470 120
686 3300046557 Ga0495622_0010751 Ga0495622_0010751_600_974 120
687 3300046557 Ga0495622_0017003 Ga0495622_0017003_115_477 120
688 3300046557 Ga0495622_0032167 Ga0495622_0032167_1397_1759 120
689 3300046557 Ga0495622_0171494 Ga0495622_0171494_550_921 120
690 3300046558 Ga0495633_0014722 Ga0495633_0014722_665_1027 120
691 3300046615 Ga0495656_0357977 Ga0495656_0357977_152_514 120
692 3300046615 Ga0495656_0555535 Ga0495656_0555535_123_494 120
693 3300046616 Ga0495668_0011841 Ga0495668_0011841_3070_3432 120
694 3300046616 Ga0495668_0017874 Ga0495668_0017874_683_1099 120
695 3300046616 Ga0495668_0022974 Ga0495668_0022974_3050_3412 120
696 3300046616 Ga0495668_0110354 Ga0495668_0110354_445_807 120
697 3300046616 Ga0495668_0157801 Ga0495668_0157801_752_1126 120
698 3300046648 Ga0495611_0006133 Ga0495611_0006133_1713_2075 120
699 3300046648 Ga0495611_0008856 Ga0495611_0008856_1351_1725 120
700 3300046660 Ga0495625_0019890 Ga0495625_0019890_1812_2174 120
701 3300046660 Ga0495625_0020325 Ga0495625_0020325_1712_2074 120
702 3300046660 Ga0495625_0029611 Ga0495625_0029611_678_1040 120
703 3300046660 Ga0495625_0038359 Ga0495625_0038359_2482_2844 120
704 3300046660 Ga0495625_0049169 Ga0495625_0049169_823_1185 120
705 3300046660 Ga0495625_0140695 Ga0495625_0140695_461_823 120
706 3300046663 Ga0495635_0031268 Ga0495635_0031268_2056_2418 120
707 3300046663 Ga0495635_0859036 Ga0495635_0859036_98_460 120
708 3300046665 Ga0495661_0004633 Ga0495661_0004633_3210_3581 120
709 3300046665 Ga0495661_0004922 Ga0495661_0004922_5964_6338 120
710 3300046665 Ga0495661_0014463 Ga0495661_0014463_2561_2935 120
711 3300046665 Ga0495661_0025942 Ga0495661_0025942_325_699 120
712 3300046665 Ga0495661_0028384 Ga0495661_0028384_180_542 120
713 3300046665 Ga0495661_0044397 Ga0495661_0044397_325_711 120
714 3300046665 Ga0495661_0073105 Ga0495661_0073105_137_553 120
715 3300046665 Ga0495661_0098895 Ga0495661_0098895_1145_1507 120
716 3300046665 Ga0495661_0130109 Ga0495661_0130109_423_785 120
717 3300046674 Ga0495588_0140095 Ga0495588_0140095_709_1071 120
718 3300046680 Ga0495646_0026262 Ga0495646_0026262_1807_2169 120
719 3300046680 Ga0495646_0213370 Ga0495646_0213370_181_543 120
720 3300046689 Ga0495613_0050511 Ga0495613_0050511_1430_1792 120
721 3300046689 Ga0495613_0326339 Ga0495613_0326339_557_919 120
722 3300046690 Ga0495624_0016190 Ga0495624_0016190_3032_3394 120
723 3300046691 Ga0495670_0007721 Ga0495670_0007721_1870_2232 120
724 3300046691 Ga0495670_0012987 Ga0495670_0012987_3036_3398 120
725 3300046691 Ga0495670_0020033 Ga0495670_0020033_2774_3136 120
726 3300046691 Ga0495670_0072775 Ga0495670_0072775_1259_1621 120
727 3300046692 Ga0495671_0001579 Ga0495671_0001579_12213_12584 120
728 3300046692 Ga0495671_0003567 Ga0495671_0003567_3128_3502 120
729 3300046692 Ga0495671_0041774 Ga0495671_0041774_477_839 120
730 3300046692 Ga0495671_0126223 Ga0495671_0126223_623_985 120
731 3300046694 Ga0495649_0016490 Ga0495649_0016490_3032_3394 120
732 3300046694 Ga0495649_0030990 Ga0495649_0030990_2219_2590 120
733 3300046694 Ga0495649_0039352 Ga0495649_0039352_1910_2272 120
734 3300046694 Ga0495649_0072948 Ga0495649_0072948_838_1200 120
735 3300046694 Ga0495649_0109044 Ga0495649_0109044_816_1178 120
736 3300046694 Ga0495649_0221090 Ga0495649_0221090_585_947 120
737 3300046694 Ga0495649_0274753 Ga0495649_0274753_84_446 120
738 3300046694 Ga0495649_0363234 Ga0495649_0363234_299_670 120
739 3300046694 Ga0495649_0419311 Ga0495649_0419311_225_587 120
740 3300046794 Ga0495589_0009237 Ga0495589_0009237_3037_3399 120
741 3300046794 Ga0495589_0026180 Ga0495589_0026180_165_581 120
742 3300046794 Ga0495589_0037858 Ga0495589_0037858_1644_2006 120
743 3300046794 Ga0495589_0266287 Ga0495589_0266287_218_580 120
744 3300046809 Ga0495600_0013552 Ga0495600_0013552_2289_2651 120
745 3300046810 Ga0495660_0002084 Ga0495660_0002084_1695_2066 120
746 3300046810 Ga0495660_0008386 Ga0495660_0008386_3128_3502 120
747 3300046810 Ga0495660_0024657 Ga0495660_0024657_1847_2209 120
748 3300046810 Ga0495660_0044680 Ga0495660_0044680_619_1035 120
749 3300046810 Ga0495660_0053373 Ga0495660_0053373_1223_1594 120
750 3300046810 Ga0495660_0080051 Ga0495660_0080051_548_919 120
751 3300046810 Ga0495660_0114313 Ga0495660_0114313_847_1209 120
752 3300046810 Ga0495660_0135049 Ga0495660_0135049_521_883 120
753 3300046810 Ga0495660_0163747 Ga0495660_0163747_177_539 120
754 3300046810 Ga0495660_0165733 Ga0495660_0165733_571_942 120
755 3300046810 Ga0495660_0309168 Ga0495660_0309168_112_474 120
756 3300047317 Ga0495604_0078717 Ga0495604_0078717_303_665 120
757 3300047317 Ga0495604_0085261 Ga0495604_0085261_1338_1700 120
758 3300047320 Ga0495672_0003342 Ga0495672_0003342_10139_10510 120
759 3300047320 Ga0495672_0003889 Ga0495672_0003889_11048_11419 120
760 3300047320 Ga0495672_0010407 Ga0495672_0010407_466_882 120
761 3300047320 Ga0495672_0015615 Ga0495672_0015615_1840_2202 120
762 3300047320 Ga0495672_0019557 Ga0495672_0019557_1953_2324 120
763 3300047320 Ga0495672_0019954 Ga0495672_0019954_2206_2580 120
764 3300047320 Ga0495672_0021806 Ga0495672_0021806_1701_2063 120
765 3300047320 Ga0495672_0024590 Ga0495672_0024590_450_866 120
766 3300047320 Ga0495672_0026470 Ga0495672_0026470_234_605 120
767 3300047320 Ga0495672_0031274 Ga0495672_0031274_1759_2121 120
768 3300047320 Ga0495672_0130969 Ga0495672_0130969_872_1234 120
769 3300047320 Ga0495672_0242354 Ga0495672_0242354_161_523 120
770 3300047320 Ga0495672_0336639 Ga0495672_0336639_118_480 120
771 3300047321 Ga0495676_0008239 Ga0495676_0008239_5956_6330 120
772 3300047321 Ga0495676_0149993 Ga0495676_0149993_697_1059 120
773 3300047322 Ga0495680_0042103 Ga0495680_0042103_1963_2325 120
774 3300047322 Ga0495680_0954627 Ga0495680_0954627_12_374 120
775 3300047323 Ga0495683_0013831 Ga0495683_0013831_1841_2203 120
776 3300047323 Ga0495683_0124094 Ga0495683_0124094_340_714 120
777 3300047323 Ga0495683_0163314 Ga0495683_0163314_554_916 120
778 3300047323 Ga0495683_0247523 Ga0495683_0247523_179_595 120
779 3300047323 Ga0495683_0293436 Ga0495683_0293436_198_560 120
780 3300047443 Ga0495687_019311 Ga0495687_019311_696_1058 120
781 3300047443 Ga0495687_071282 Ga0495687_071282_329_691 120
782 3300047444 Ga0495675_0008994 Ga0495675_0008994_1490_1852 120
783 3300047446 Ga0495679_039489 Ga0495679_039489_691_1053 120
784 3300047446 Ga0495679_046562 Ga0495679_046562_794_1156 120
785 3300047447 Ga0495685_090349 Ga0495685_090349_549_911 120
786 3300047469 Ga0495673_0003950 Ga0495673_0003950_3128_3502 120
787 3300047469 Ga0495673_0006113 Ga0495673_0006113_3652_4026 120
788 3300047469 Ga0495673_0010068 Ga0495673_0010068_3040_3402 120
789 3300047469 Ga0495673_0016540 Ga0495673_0016540_381_797 120
790 3300047469 Ga0495673_0021787 Ga0495673_0021787_61_435 120
791 3300047469 Ga0495673_0026641 Ga0495673_0026641_398_769 120
792 3300047469 Ga0495673_0026860 Ga0495673_0026860_1858_2232 120
793 3300047469 Ga0495673_0031901 Ga0495673_0031901_1720_2094 120
794 3300047469 Ga0495673_0066413 Ga0495673_0066413_455_817 120
795 3300047469 Ga0495673_0099782 Ga0495673_0099782_366_728 120
796 3300047469 Ga0495673_0117091 Ga0495673_0117091_321_695 120
797 3300047470 Ga0495681_0004648 Ga0495681_0004648_3211_3585 120
798 3300047470 Ga0495681_0007807 Ga0495681_0007807_2959_3330 120
799 3300047470 Ga0495681_0011362 Ga0495681_0011362_1929_2291 120
800 3300047470 Ga0495681_0012119 Ga0495681_0012119_1896_2312 120
801 3300047470 Ga0495681_0012250 Ga0495681_0012250_2998_3360 120
802 3300047470 Ga0495681_0012994 Ga0495681_0012994_3064_3426 120
803 3300047470 Ga0495681_0017176 Ga0495681_0017176_3535_3897 120
804 3300047470 Ga0495681_0036458 Ga0495681_0036458_212_574 120
805 3300047470 Ga0495681_0040716 Ga0495681_0040716_1789_2151 120
806 3300047470 Ga0495681_0053059 Ga0495681_0053059_1466_1882 120
807 3300047470 Ga0495681_0085029 Ga0495681_0085029_325_687 120
808 3300047471 Ga0495684_0294329 Ga0495684_0294329_205_567 120
809 3300047472 Ga0495686_0015872 Ga0495686_0015872_3055_3417 120
810 3300047472 Ga0495686_0029869 Ga0495686_0029869_132_494 120
811 3300047472 Ga0495686_0046517 Ga0495686_0046517_317_691 120
812 3300047472 Ga0495686_0050021 Ga0495686_0050021_1583_1945 120
813 3300047472 Ga0495686_0182624 Ga0495686_0182624_720_1082 120
814 3300047673 Ga0495593_0014408 Ga0495593_0014408_2454_2816 120
815 3300047673 Ga0495593_0056045 Ga0495593_0056045_1483_1845 120
816 3300048088 Ga0495602_0091733 Ga0495602_0091733_631_993 120
817 3300048091 Ga0495626_0001991 Ga0495626_0001991_12823_13185 120
818 3300048091 Ga0495626_0009696 Ga0495626_0009696_1777_2139 120
819 3300048091 Ga0495626_0014242 Ga0495626_0014242_3048_3410 120
820 3300048091 Ga0495626_0014655 Ga0495626_0014655_3030_3392 120
821 3300048091 Ga0495626_0018199 Ga0495626_0018199_1064_1426 120
822 3300048091 Ga0495626_0033590 Ga0495626_0033590_715_1077 120
823 3300048091 Ga0495626_0036585 Ga0495626_0036585_645_1007 120
824 3300048091 Ga0495626_0088949 Ga0495626_0088949_874_1236 120
825 3300048091 Ga0495626_0171452 Ga0495626_0171452_428_790 120
826 3300048905 Ga0496102_0024615 Ga0496102_0024615_1955_2317 120
827 3300048905 Ga0496102_0188033 Ga0496102_0188033_632_1006 120
828 3300048913 Ga0496110_0399333 Ga0496110_0399333_425_841 120
829 3300048913 Ga0496110_0646356 Ga0496110_0646356_514_888 120
830 3300048915 Ga0496112_0508368 Ga0496112_0508368_250_624 120
831 3300048918 Ga0496115_0436570 Ga0496115_0436570_11_373 120
832 3300048919 Ga0496116_0009224 Ga0496116_0009224_5002_5373 120
833 3300048919 Ga0496116_0019431 Ga0496116_0019431_3069_3431 120
834 3300048919 Ga0496116_0029144 Ga0496116_0029144_1506_1880 120
835 3300048920 Ga0496117_0001936 Ga0496117_0001936_27186_27557 120
836 3300048920 Ga0496117_0012366 Ga0496117_0012366_3070_3441 120
837 3300048920 Ga0496117_0064804 Ga0496117_0064804_1000_1374 120
838 3300048920 Ga0496117_0159863 Ga0496117_0159863_497_859 120
839 3300048920 Ga0496117_0405504 Ga0496117_0405504_227_601 120
840 3300048921 Ga0496118_0103372 Ga0496118_0103372_223_594 120
841 3300048921 Ga0496118_0156661 Ga0496118_0156661_794_1156 120
842 3300048921 Ga0496118_0196887 Ga0496118_0196887_162_524 120
843 3300048922 Ga0496119_0389673 Ga0496119_0389673_116_478 120
844 3300048923 Ga0496120_0174616 Ga0496120_0174616_177_539 120
845 3300048924 Ga0496121_0012137 Ga0496121_0012137_3206_3580 120
846 3300048924 Ga0496121_0014201 Ga0496121_0014201_3072_3443 120
847 3300048924 Ga0496121_0019552 Ga0496121_0019552_408_782 120
848 3300048924 Ga0496121_0030231 Ga0496121_0030231_3040_3402 120
849 3300048924 Ga0496121_0082684 Ga0496121_0082684_339_701 120
850 3300048925 Ga0496122_0004546 Ga0496122_0004546_5887_6261 120
851 3300048925 Ga0496122_0041678 Ga0496122_0041678_3036_3407 120
852 3300048925 Ga0496122_0051867 Ga0496122_0051867_2007_2369 120
853 3300048925 Ga0496122_0059033 Ga0496122_0059033_240_614 120
854 3300048925 Ga0496122_0125994 Ga0496122_0125994_733_1095 120
855 3300048926 Ga0496123_0001488 Ga0496123_0001488_6080_6454 120
856 3300048926 Ga0496123_0019101 Ga0496123_0019101_1989_2360 120
857 3300048926 Ga0496123_0041371 Ga0496123_0041371_2307_2681 120
858 3300048927 Ga0496124_0050108 Ga0496124_0050108_137_553 120
859 3300048927 Ga0496124_0103082 Ga0496124_0103082_503_877 120
860 3300048927 Ga0496124_0158414 Ga0496124_0158414_765_1136 120
861 3300048927 Ga0496124_0205167 Ga0496124_0205167_416_778 120
862 3300048928 Ga0496125_0039982 Ga0496125_0039982_1870_2232 120
863 3300049459 Ga0495678_006775 Ga0495678_006775_3100_3474 120
864 3300049459 Ga0495678_012071 Ga0495678_012071_708_1070 120
865 3300049459 Ga0495678_012391 Ga0495678_012391_1709_2071 120
866 3300049459 Ga0495678_013877 Ga0495678_013877_368_730 120
867 3300049459 Ga0495678_026038 Ga0495678_026038_1813_2187 120
868 3300049459 Ga0495678_029425 Ga0495678_029425_1673_2035 120
869 3300049459 Ga0495678_029701 Ga0495678_029701_1771_2133 120
870 3300049459 Ga0495678_123974 Ga0495678_123974_461_832 120
871 3300049460 Ga0495682_0002142 Ga0495682_0002142_3203_3577 120
872 3300049460 Ga0495682_0056086 Ga0495682_0056086_132_494 120
873 3300049460 Ga0495682_0072818 Ga0495682_0072818_72_434 120
874 3300049573 Ga0501037_0239124 Ga0501037_0239124_39_419 120
875 3300049574 Ga0501038_0214015 Ga0501038_0214015_792_1172 120
876 3300049575 Ga0501039_0302200 Ga0501039_0302200_155_535 120
877 3300049758 Ga0501241_019596 Ga0501241_019596_192_554 120
878 3300049766 Ga0501269_022103 Ga0501269_022103_93_455 120
879 3300050491 nmdc:mga00v17_206134_c1 nmdc:mga00v17_206134_c1_117_479 120
880 3300050514 nmdc:mga08x19_666959_c1 nmdc:mga08x19_666959_c1_81_443 120
881 3300050516 nmdc:mga0sz30_142374_c1 nmdc:mga0sz30_142374_c1_135_497 120
882 3300053111 Ga0500572_003167 Ga0500572_003167_3055_3417 120
883 3300053140 Ga0500573_0017545 Ga0500573_0017545_3215_3586 120
884 3300053142 Ga0500577_0250819 Ga0500577_0250819_157_528 120
885 iso_pu_bacteria 2844665904 2844666158 120
886 iso_pu_bacteria 2939636861 2939636965 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

31

122

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.9297 13 120
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8946 13 120
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7589 10 115
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7523 15 115
1ipi-assembly1.cif.gz_A crystal structure of the archaeal holliday junction resolvase hjc from pyrococcus furiosus form ii 0.739 10 115
ID Description Score Start End Superfamily
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9306 14 119 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9292 13 120 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8938 13 120 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8896 14 119 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8527 13 115 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A423L244-F1-model_v4 UPF0102 protein BK671_24020 0.9902 1 120 GO:0003676
AF-A0A031G419-F1-model_v4 UPF0102 protein BW33_02461 0.9875 1 120 GO:0003676
GO:0004519
AF-A0A7W4H1T6-F1-model_v4 UPF0102 protein H3H45_01140 0.9826 8 120 GO:0003676
AF-A0A259M8E2-F1-model_v4 YraN family protein 0.9808 27 120 GO:0003676
AF-A0A520SGH3-F1-model_v4 UPF0102 protein EVA63_01285 0.9796 5 119 GO:0003676

Feature Viewer

pLDDT pTM Quality
85.75 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map