F484618

General Info

Members Datasets Scaffolds Average Seq Length
884 384 1768 138

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100190981|Ga0070670_1001909813
Length 156
Sequence MSTTQTYTARHAMGQKVQGEALVARDGFSARYDLDRIAGVFSRPAHKLAGQSYVGKILVLDTAKGGVASAWMLHEMQSRGIVPLAIVFNTVNPILAQGAALGDITMLAGFDVDVTAEIPHGATVEIDPASRTLRVLRGPQPKAQPVEVLRRGEGAG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
214 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
215 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
216 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
217 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
246 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
332 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
333 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
334 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
363 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
366 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
367 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
368 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
380 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.13
Nodule 0.23
Rhizoplane 3.05
Rhizosphere 88.12
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100190981 3300005331 Bacteria 1779
2 JGI24737J22298_10132470 3300001990 Bacteria 736
3 JGI24033J26618_1010977 3300002155 Bacteria 1074
4 JGI25404J52841_10039012 3300003659 Bacteria 1007
5 Ga0065712_10223122 3300005290 Bacteria 1035
6 Ga0065712_10385347 3300005290 Bacteria 747
7 Ga0065715_10259455 3300005293 Bacteria 1142
8 Ga0070658_10057782 3300005327 Bacteria 3156
9 Ga0070658_11675257 3300005327 Bacteria 551
10 Ga0070676_10008367 3300005328 Bacteria 5575
11 Ga0070676_10286535 3300005328 Unclassified 1112
12 Ga0070676_11051426 3300005328 Bacteria 613
13 Ga0070683_100086004 3300005329 Bacteria 2948
14 Ga0070683_100976658 3300005329 Bacteria 813
15 Ga0070690_100000492 3300005330 Bacteria 19788
16 Ga0070690_101229569 3300005330 Bacteria 598
17 Ga0070670_100018260 3300005331 Bacteria 6017
18 Ga0070677_10000291 3300005333 Bacteria 17556
19 Ga0070677_10002723 3300005333 Bacteria 5648
20 Ga0068869_100001545 3300005334 Bacteria 13685
21 Ga0068869_100014114 3300005334 Bacteria 5330
22 Ga0068869_100689902 3300005334 Bacteria 870
23 Ga0068869_100971695 3300005334 Bacteria 738
24 Ga0068869_101899485 3300005334 Unclassified 533
25 Ga0070666_10101998 3300005335 Bacteria 1978
26 Ga0070680_100015031 3300005336 Bacteria 6060
27 Ga0070680_101313577 3300005336 Bacteria 626
28 Ga0070682_100030691 3300005337 Bacteria 3247
29 Ga0070682_100067004 3300005337 Bacteria 2286
30 Ga0068868_100007235 3300005338 Bacteria 7889
31 Ga0068868_100009077 3300005338 Bacteria 7140
32 Ga0068868_100010378 3300005338 Bacteria 6740
33 Ga0068868_100337148 3300005338 Bacteria 1288
34 Ga0068868_100341787 3300005338 Bacteria 1280
35 Ga0070660_100249723 3300005339 Bacteria 1446
36 Ga0070689_100001125 3300005340 Bacteria 16848
37 Ga0070689_100147085 3300005340 Bacteria 1898
38 Ga0070689_100283059 3300005340 Unclassified 1376
39 Ga0070689_101373708 3300005340 Bacteria 638
40 Ga0070691_10202895 3300005341 Bacteria 1042
41 Ga0070687_100019836 3300005343 Bacteria 3135
42 Ga0070687_100383465 3300005343 Bacteria 917
43 Ga0070687_100613205 3300005343 Bacteria 749
44 Ga0070661_100009629 3300005344 Bacteria 6695
45 Ga0070661_100273977 3300005344 Bacteria 1307
46 Ga0070692_10006502 3300005345 Bacteria 5080
47 Ga0070692_10254034 3300005345 Bacteria 1053
48 Ga0070668_100011162 3300005347 Bacteria 6688
49 Ga0070668_100022288 3300005347 Bacteria 4787
50 Ga0070668_100100097 3300005347 Bacteria 2296
51 Ga0070668_100859574 3300005347 Bacteria 809
52 Ga0070668_101123420 3300005347 Unclassified 710
53 Ga0070669_100062820 3300005353 Bacteria 2732
54 Ga0070669_100202973 3300005353 Bacteria 1561
55 Ga0070669_100326344 3300005353 Bacteria 1241
56 Ga0070675_100000096 3300005354 Bacteria 50781
57 Ga0070675_100018898 3300005354 Bacteria 5488
58 Ga0070675_100071081 3300005354 Bacteria 2886
59 Ga0070675_100283774 3300005354 Bacteria 1456
60 Ga0070671_100198801 3300005355 Bacteria 1700
61 Ga0070671_100221242 3300005355 Bacteria 1606
62 Ga0070674_100004394 3300005356 Bacteria 8035
63 Ga0070674_100008748 3300005356 Bacteria 6039
64 Ga0070674_100017136 3300005356 Bacteria 4550
65 Ga0070674_100019460 3300005356 Bacteria 4312
66 Ga0070674_100349486 3300005356 Bacteria 1194
67 Ga0070673_100002524 3300005364 Bacteria 11181
68 Ga0070673_100078706 3300005364 Bacteria 2667
69 Ga0070673_100151464 3300005364 Bacteria 1964
70 Ga0070673_100411125 3300005364 Bacteria 1211
71 Ga0070673_100466180 3300005364 Bacteria 1138
72 Ga0070673_100501471 3300005364 Bacteria 1098
73 Ga0070673_101234648 3300005364 Bacteria 701
74 Ga0070688_100080688 3300005365 Bacteria 2105
75 Ga0070688_100654366 3300005365 Bacteria 809
76 Ga0070659_100407322 3300005366 Bacteria 1149
77 Ga0070659_100562997 3300005366 Bacteria 977
78 Ga0070667_100044307 3300005367 Bacteria 3736
79 Ga0070667_100050950 3300005367 Bacteria 3489
80 Ga0070667_100069745 3300005367 Bacteria 2992
81 Ga0070667_100209180 3300005367 Bacteria 1733
82 Ga0070667_100246694 3300005367 Bacteria 1596
83 Ga0070703_10013950 3300005406 Bacteria 2284
84 Ga0070709_10192187 3300005434 Bacteria 1440
85 Ga0070709_10655212 3300005434 Bacteria 813
86 Ga0070714_100048128 3300005435 Bacteria 3625
87 Ga0070714_100168302 3300005435 Bacteria 1987
88 Ga0070714_101104248 3300005435 Unclassified 773
89 Ga0070713_100086853 3300005436 Bacteria 2683
90 Ga0070713_100374775 3300005436 Bacteria 1325
91 Ga0070701_10009093 3300005438 Bacteria 4338
92 Ga0070701_10127553 3300005438 Unclassified 1442
93 Ga0070711_101706983 3300005439 Bacteria 552
94 Ga0070705_100232681 3300005440 Bacteria 1283
95 Ga0070700_100001048 3300005441 Bacteria 13689
96 Ga0070700_100011229 3300005441 Bacteria 4959
97 Ga0070694_100010402 3300005444 Bacteria 5740
98 Ga0070694_100677420 3300005444 Bacteria 837
99 Ga0070708_100486776 3300005445 Bacteria 1164
100 Ga0070663_100019738 3300005455 Bacteria 4451
101 Ga0070663_100099134 3300005455 Bacteria 2171
102 Ga0070663_100465066 3300005455 Bacteria 1045
103 Ga0070678_100003115 3300005456 Bacteria 9191
104 Ga0070678_100005547 3300005456 Bacteria 7315
105 Ga0070678_100067413 3300005456 Bacteria 2663
106 Ga0070678_100097177 3300005456 Bacteria 2274
107 Ga0070678_100108994 3300005456 Bacteria 2162
108 Ga0070662_100039868 3300005457 Bacteria 3343
109 Ga0070662_100213733 3300005457 Bacteria 1536
110 Ga0070662_100664021 3300005457 Bacteria 880
111 Ga0070662_100832703 3300005457 Bacteria 785
112 Ga0070662_101155100 3300005457 Bacteria 665
113 Ga0070681_10175231 3300005458 Bacteria 2066
114 Ga0070681_10666391 3300005458 Bacteria 956
115 Ga0070681_11256123 3300005458 Unclassified 663
116 Ga0068867_100002363 3300005459 Bacteria 13274
117 Ga0068867_100039681 3300005459 Bacteria 3433
118 Ga0068867_100128933 3300005459 Bacteria 1963
119 Ga0068867_100187622 3300005459 Bacteria 1648
120 Ga0068867_100294895 3300005459 Bacteria 1335
121 Ga0068867_100363029 3300005459 Bacteria 1212
122 Ga0068867_100574636 3300005459 Bacteria 979
123 Ga0068867_101475340 3300005459 Bacteria 633
124 Ga0070685_10070060 3300005466 Bacteria 2076
125 Ga0070685_10206769 3300005466 Bacteria 1279
126 Ga0070698_100243901 3300005471 Bacteria 1730
127 Ga0070679_101460252 3300005530 Bacteria 630
128 Ga0070684_100024557 3300005535 Bacteria 5057
129 Ga0068853_100080286 3300005539 Bacteria 2854
130 Ga0068853_100225036 3300005539 Bacteria 1714
131 Ga0070672_100000072 3300005543 Bacteria 46329
132 Ga0070672_100006544 3300005543 Bacteria 7835
133 Ga0070672_100007585 3300005543 Bacteria 7374
134 Ga0070672_100150349 3300005543 Bacteria 1926
135 Ga0070686_100014510 3300005544 Bacteria 4544
136 Ga0070686_100069474 3300005544 Bacteria 2301
137 Ga0070686_100219706 3300005544 Bacteria 1372
138 Ga0070686_100957162 3300005544 Bacteria 700
139 Ga0070695_100017409 3300005545 Bacteria 4357
140 Ga0070695_100431386 3300005545 Bacteria 1006
141 Ga0070696_100011534 3300005546 Bacteria 5921
142 Ga0070696_101583893 3300005546 Bacteria 562
143 Ga0070693_100000678 3300005547 Bacteria 15118
144 Ga0070665_100045877 3300005548 Bacteria 4389
145 Ga0070665_100148784 3300005548 Bacteria 2345
146 Ga0070665_101008875 3300005548 Bacteria 844
147 Ga0070704_100000669 3300005549 Bacteria 16587
148 Ga0070704_100375977 3300005549 Bacteria 1206
149 Ga0070704_100668504 3300005549 Bacteria 918
150 Ga0068855_100051647 3300005563 Bacteria 4842
151 Ga0068855_100374647 3300005563 Bacteria 1564
152 Ga0068855_100563852 3300005563 Bacteria 1232
153 Ga0070664_100027855 3300005564 Bacteria 4698
154 Ga0070664_100089103 3300005564 Bacteria 2669
155 Ga0070664_100180493 3300005564 Bacteria 1876
156 Ga0070664_100235123 3300005564 Bacteria 1643
157 Ga0070664_101212860 3300005564 Unclassified 712
158 Ga0068854_100006590 3300005578 Bacteria 7395
159 Ga0068854_100053169 3300005578 Bacteria 2907
160 Ga0068856_100095908 3300005614 Bacteria 2954
161 Ga0068856_100100871 3300005614 Bacteria 2879
162 Ga0068856_100134728 3300005614 Bacteria 2476
163 Ga0070702_100017983 3300005615 Bacteria 3657
164 Ga0070702_100032903 3300005615 Bacteria 2848
165 Ga0070702_100093107 3300005615 Bacteria 1832
166 Ga0068852_100018995 3300005616 Bacteria 5429
167 Ga0068852_100178358 3300005616 Bacteria 1996
168 Ga0068852_100827953 3300005616 Bacteria 940
169 Ga0068852_101119113 3300005616 Bacteria 808
170 Ga0068859_100099244 3300005617 Bacteria 2967
171 Ga0068859_100164860 3300005617 Bacteria 2296
172 Ga0068859_101288662 3300005617 Bacteria 805
173 Ga0068864_100005518 3300005618 Bacteria 10364
174 Ga0068864_100030583 3300005618 Bacteria 4565
175 Ga0068864_100061027 3300005618 Bacteria 3265
176 Ga0068866_10015613 3300005718 Bacteria 3376
177 Ga0068866_10051573 3300005718 Bacteria 2095
178 Ga0068866_10459055 3300005718 Bacteria 835
179 Ga0068866_10459849 3300005718 Bacteria 834
180 Ga0068861_100000459 3300005719 Bacteria 23777
181 Ga0068861_100042871 3300005719 Bacteria 3393
182 Ga0068861_100586449 3300005719 Bacteria 1021
183 Ga0068861_100732302 3300005719 Unclassified 922
184 Ga0068851_10000771 3300005834 Bacteria 13794
185 Ga0068851_10003431 3300005834 Bacteria 7052
186 Ga0068851_10020537 3300005834 Bacteria 3199
187 Ga0068870_10070886 3300005840 Bacteria 1901
188 Ga0068870_10168572 3300005840 Bacteria 1305
189 Ga0068870_10218143 3300005840 Bacteria 1166
190 Ga0068870_10394441 3300005840 Bacteria 899
191 Ga0068863_100120376 3300005841 Bacteria 2502
192 Ga0068863_100508631 3300005841 Bacteria 1187
193 Ga0068863_100807366 3300005841 Bacteria 936
194 Ga0068863_100995101 3300005841 Bacteria 841
195 Ga0068858_100025103 3300005842 Bacteria 5546
196 Ga0068858_100038137 3300005842 Bacteria 4457
197 Ga0068858_100050801 3300005842 Bacteria 3837
198 Ga0068860_100032383 3300005843 Bacteria 5023
199 Ga0068860_100136573 3300005843 Bacteria 2355
200 Ga0068860_101607005 3300005843 Bacteria 672
201 Ga0068862_100001223 3300005844 Bacteria 24217
202 Ga0068862_100102286 3300005844 Bacteria 2508
203 Ga0068862_100171526 3300005844 Bacteria 1942
204 Ga0068862_100341699 3300005844 Bacteria 1386
205 Ga0081538_10071337 3300005981 Bacteria 1912
206 Ga0081540_1011875 3300005983 Bacteria 5783
207 Ga0070717_10108352 3300006028 Bacteria 2367
208 Ga0075365_10032086 3300006038 Bacteria 3374
209 Ga0075365_10201051 3300006038 Bacteria 1396
210 Ga0075365_10356840 3300006038 Bacteria 1030
211 Ga0075368_10009515 3300006042 Bacteria 3494
212 Ga0075363_100005526 3300006048 Bacteria 5635
213 Ga0075363_100310665 3300006048 Bacteria 916
214 Ga0075364_10087703 3300006051 Bacteria 2062
215 Ga0070716_100478214 3300006173 Bacteria 914
216 Ga0075362_10030345 3300006177 Bacteria 2334
217 Ga0075367_10020379 3300006178 Bacteria 3691
218 Ga0075367_10810403 3300006178 Bacteria 596
219 Ga0075369_10014234 3300006186 Bacteria 3173
220 Ga0075369_10085943 3300006186 Bacteria 1399
221 Ga0075369_10333621 3300006186 Unclassified 710
222 Ga0075366_10029103 3300006195 Bacteria 3244
223 Ga0075366_10035483 3300006195 Bacteria 2939
224 Ga0075366_10424103 3300006195 Bacteria 819
225 Ga0097621_100018902 3300006237 Bacteria 5278
226 Ga0097621_100027122 3300006237 Bacteria 4501
227 Ga0097621_100095808 3300006237 Bacteria 2490
228 Ga0075370_10024741 3300006353 Bacteria 3319
229 Ga0068871_100014245 3300006358 Bacteria 5922
230 Ga0068871_100045160 3300006358 Bacteria 3545
231 Ga0068871_100110712 3300006358 Bacteria 2309
232 Ga0068871_100174052 3300006358 Bacteria 1847
233 Ga0068871_100492555 3300006358 Bacteria 1104
234 Ga0068871_100759570 3300006358 Bacteria 892
235 Ga0075428_100144438 3300006844 Bacteria 2586
236 Ga0075428_100287018 3300006844 Bacteria 1770
237 Ga0075433_10000073 3300006852 Bacteria 45023
238 Ga0075433_10144570 3300006852 Bacteria 2114
239 Ga0075433_10816214 3300006852 Bacteria 815
240 Ga0075434_100000358 3300006871 Bacteria 33110
241 Ga0075434_100000374 3300006871 Bacteria 32599
242 Ga0075434_100717307 3300006871 Bacteria 1017
243 Ga0068865_100000418 3300006881 Bacteria 23732
244 Ga0068865_100027764 3300006881 Bacteria 3742
245 Ga0068865_100568394 3300006881 Bacteria 954
246 Ga0068865_100784276 3300006881 Bacteria 821
247 Ga0075436_100000181 3300006914 Bacteria 39421
248 Ga0097620_100099238 3300006931 Bacteria 2967
249 Ga0097620_100164861 3300006931 Bacteria 2296
250 Ga0097620_100727571 3300006931 Bacteria 1082
251 Ga0097620_101288765 3300006931 Bacteria 805
252 Ga0099823_1000007 3300006944 Bacteria 111486
253 Ga0075435_100000033 3300007076 Bacteria 70531
254 Ga0075435_100065633 3300007076 Bacteria 2951
255 Ga0075435_100216790 3300007076 Bacteria 1624
256 Ga0105240_10089594 3300009093 Bacteria 3763
257 Ga0105240_10238221 3300009093 Bacteria 2111
258 Ga0111539_10058255 3300009094 Bacteria 4584
259 Ga0111539_10102834 3300009094 Bacteria 3353
260 Ga0111539_10242224 3300009094 Bacteria 2100
261 Ga0111539_10729213 3300009094 Bacteria 1154
262 Ga0111539_11705798 3300009094 Bacteria 730
263 Ga0111539_11820935 3300009094 Bacteria 706
264 Ga0111539_11959191 3300009094 Bacteria 679
265 Ga0105245_10023454 3300009098 Bacteria 5417
266 Ga0105245_10034920 3300009098 Bacteria 4461
267 Ga0105245_10037141 3300009098 Bacteria 4330
268 Ga0105247_10093062 3300009101 Bacteria 1916
269 Ga0105247_11202481 3300009101 Unclassified 604
270 Ga0105247_11467627 3300009101 Bacteria 555
271 Ga0114129_10050860 3300009147 Bacteria 5819
272 Ga0114129_10672839 3300009147 Bacteria 1333
273 Ga0114129_10750792 3300009147 Bacteria 1249
274 Ga0114129_10826975 3300009147 Bacteria 1179
275 Ga0105243_10000827 3300009148 Bacteria 29411
276 Ga0105243_10015744 3300009148 Bacteria 5720
277 Ga0105243_10434143 3300009148 Bacteria 1228
278 Ga0105243_11300690 3300009148 Unclassified 744
279 Ga0105243_11598589 3300009148 Bacteria 678
280 Ga0105243_11899746 3300009148 Bacteria 628
281 Ga0105241_10005741 3300009174 Bacteria 9162
282 Ga0105241_10011390 3300009174 Bacteria 6519
283 Ga0105241_10053005 3300009174 Bacteria 3100
284 Ga0105241_10072437 3300009174 Bacteria 2678
285 Ga0105241_11007797 3300009174 Unclassified 779
286 Ga0105242_10002404 3300009176 Bacteria 14729
287 Ga0105242_10017858 3300009176 Bacteria 5537
288 Ga0105242_10520500 3300009176 Bacteria 1135
289 Ga0105248_10032157 3300009177 Bacteria 5864
290 Ga0105248_10361558 3300009177 Bacteria 1634
291 Ga0105248_10413389 3300009177 Bacteria 1519
292 Ga0105237_10007176 3300009545 Bacteria 12239
293 Ga0105237_10047953 3300009545 Bacteria 4295
294 Ga0105237_11100750 3300009545 Bacteria 801
295 Ga0105238_10091755 3300009551 Bacteria 3024
296 Ga0105238_10305176 3300009551 Bacteria 1576
297 Ga0105238_10434261 3300009551 Bacteria 1309
298 Ga0105238_11097962 3300009551 Bacteria 818
299 Ga0105249_10011757 3300009553 Bacteria 7694
300 Ga0105249_10152171 3300009553 Bacteria 2228
301 Ga0105249_10385722 3300009553 Bacteria 1428
302 Ga0105249_10930499 3300009553 Bacteria 937
303 Ga0099796_10027091 3300010159 Bacteria 1827
304 Ga0105239_10044014 3300010375 Bacteria 4895
305 Ga0105239_10093235 3300010375 Bacteria 3325
306 Ga0105239_10167508 3300010375 Bacteria 2457
307 Ga0105239_10350293 3300010375 Bacteria 1667
308 Ga0105246_10366145 3300011119 Bacteria 1186
309 Ga0105246_10535701 3300011119 Bacteria 1001
310 Ga0105246_11269252 3300011119 Bacteria 681
311 Ga0157373_10002490 3300013100 Bacteria 14031
312 Ga0157371_10132195 3300013102 Bacteria 1776
313 Ga0157371_10468346 3300013102 Bacteria 928
314 Ga0157374_10048265 3300013296 Bacteria 3950
315 Ga0157374_10314588 3300013296 Bacteria 1551
316 Ga0157378_10005019 3300013297 Bacteria 11617
317 Ga0157378_10248930 3300013297 Bacteria 1700
318 Ga0157378_10323649 3300013297 Bacteria 1498
319 Ga0157378_10477196 3300013297 Bacteria 1242
320 Ga0157378_10753155 3300013297 Bacteria 997
321 Ga0157378_10978619 3300013297 Bacteria 879
322 Ga0163162_10042516 3300013306 Bacteria 4548
323 Ga0163162_10137913 3300013306 Bacteria 2551
324 Ga0163162_10618670 3300013306 Bacteria 1208
325 Ga0163162_12196384 3300013306 Bacteria 634
326 Ga0157372_10157662 3300013307 Bacteria 2622
327 Ga0157375_10007615 3300013308 Bacteria 9472
328 Ga0157375_10033089 3300013308 Bacteria 4909
329 Ga0157375_10088114 3300013308 Bacteria 3158
330 Ga0157375_10123870 3300013308 Bacteria 2697
331 Ga0157375_11008312 3300013308 Bacteria 972
332 Ga0163163_10028701 3300014325 Bacteria 5347
333 Ga0163163_10244995 3300014325 Bacteria 1842
334 Ga0163163_10626288 3300014325 Bacteria 1139
335 Ga0163163_10869226 3300014325 Unclassified 965
336 Ga0163163_12283716 3300014325 Bacteria 600
337 Ga0157380_10006081 3300014326 Bacteria 8461
338 Ga0157380_10083237 3300014326 Bacteria 2621
339 Ga0157380_10131014 3300014326 Bacteria 2139
340 Ga0157380_10343529 3300014326 Bacteria 1393
341 Ga0157380_10362839 3300014326 Bacteria 1360
342 Ga0157380_10433409 3300014326 Bacteria 1257
343 Ga0157377_10181872 3300014745 Bacteria 1323
344 Ga0157379_10087644 3300014968 Bacteria 2791
345 Ga0157379_10741681 3300014968 Bacteria 924
346 Ga0157379_11506017 3300014968 Bacteria 655
347 Ga0157376_10034560 3300014969 Bacteria 4083
348 Ga0157376_10045093 3300014969 Bacteria 3628
349 Ga0157376_10075242 3300014969 Bacteria 2881
350 Ga0157376_10147024 3300014969 Bacteria 2121
351 Ga0157376_10152568 3300014969 Bacteria 2085
352 Ga0157376_10897568 3300014969 Bacteria 904
353 Ga0163161_10060700 3300017792 Bacteria 2752
354 Ga0163161_11187558 3300017792 Unclassified 659
355 Ga0206356_10261904 3300020070 Bacteria 2625
356 Ga0213874_10288040 3300021377 Unclassified 615
357 Ga0207697_10005765 3300025315 Bacteria 5707
358 Ga0207697_10206243 3300025315 Bacteria 865
359 Ga0207697_10452061 3300025315 Bacteria 569
360 Ga0207656_10011460 3300025321 Bacteria 3350
361 Ga0207656_10011765 3300025321 Bacteria 3311
362 Ga0207656_10035781 3300025321 Bacteria 2081
363 Ga0207653_10013219 3300025885 Bacteria 2583
364 Ga0207682_10001685 3300025893 Bacteria 10137
365 Ga0207682_10002597 3300025893 Bacteria 8064
366 Ga0207642_10014187 3300025899 Bacteria 2932
367 Ga0207642_10019364 3300025899 Bacteria 2634
368 Ga0207642_10601216 3300025899 Bacteria 685
369 Ga0207642_10676803 3300025899 Unclassified 648
370 Ga0207710_10124828 3300025900 Bacteria 1232
371 Ga0207710_10378873 3300025900 Unclassified 724
372 Ga0207688_10026404 3300025901 Bacteria 3193
373 Ga0207688_10088755 3300025901 Bacteria 1773
374 Ga0207688_10149507 3300025901 Bacteria 1379
375 Ga0207680_10256100 3300025903 Bacteria 1210
376 Ga0207645_10074394 3300025907 Bacteria 2175
377 Ga0207645_10108180 3300025907 Bacteria 1799
378 Ga0207645_10518146 3300025907 Bacteria 808
379 Ga0207643_10029610 3300025908 Bacteria 3045
380 Ga0207643_10039542 3300025908 Bacteria 2653
381 Ga0207643_10346278 3300025908 Bacteria 932
382 Ga0207705_10002709 3300025909 Bacteria 13558
383 Ga0207705_10003859 3300025909 Bacteria 11397
384 Ga0207705_10101731 3300025909 Bacteria 2114
385 Ga0207705_10699852 3300025909 Bacteria 788
386 Ga0207654_10007970 3300025911 Bacteria 5341
387 Ga0207654_10050603 3300025911 Bacteria 2388
388 Ga0207707_10024832 3300025912 Bacteria 5242
389 Ga0207707_10589553 3300025912 Bacteria 942
390 Ga0207695_10055929 3300025913 Bacteria 4109
391 Ga0207671_10009699 3300025914 Bacteria 8019
392 Ga0207660_10005811 3300025917 Bacteria 8009
393 Ga0207660_10020481 3300025917 Bacteria 4439
394 Ga0207660_10805788 3300025917 Bacteria 766
395 Ga0207662_10007157 3300025918 Bacteria 6069
396 Ga0207657_10000488 3300025919 Bacteria 41854
397 Ga0207657_11281665 3300025919 Unclassified 554
398 Ga0207649_10237021 3300025920 Bacteria 1308
399 Ga0207649_10456577 3300025920 Bacteria 965
400 Ga0207652_10038750 3300025921 Bacteria 4041
401 Ga0207652_10061404 3300025921 Bacteria 3245
402 Ga0207681_10023956 3300025923 Bacteria 3911
403 Ga0207681_10173131 3300025923 Bacteria 1638
404 Ga0207681_10216210 3300025923 Bacteria 1480
405 Ga0207681_10294807 3300025923 Bacteria 1281
406 Ga0207694_10068781 3300025924 Bacteria 2765
407 Ga0207694_10636689 3300025924 Bacteria 898
408 Ga0207694_10829324 3300025924 Bacteria 781
409 Ga0207650_10002274 3300025925 Bacteria 13405
410 Ga0207650_10278516 3300025925 Bacteria 1361
411 Ga0207659_10000540 3300025926 Bacteria 22612
412 Ga0207659_10687118 3300025926 Bacteria 876
413 Ga0207687_10015975 3300025927 Bacteria 4925
414 Ga0207687_10039508 3300025927 Bacteria 3232
415 Ga0207687_10098321 3300025927 Bacteria 2148
416 Ga0207687_10301334 3300025927 Bacteria 1291
417 Ga0207700_10006298 3300025928 Bacteria 7160
418 Ga0207700_10015833 3300025928 Bacteria 4989
419 Ga0207664_10021608 3300025929 Bacteria 4789
420 Ga0207664_10169866 3300025929 Bacteria 1866
421 Ga0207644_10012419 3300025931 Bacteria 5656
422 Ga0207644_10047980 3300025931 Bacteria 3050
423 Ga0207644_10402568 3300025931 Bacteria 1119
424 Ga0207644_10430669 3300025931 Bacteria 1082
425 Ga0207644_10533876 3300025931 Bacteria 970
426 Ga0207644_10553193 3300025931 Bacteria 953
427 Ga0207690_10427562 3300025932 Bacteria 1061
428 Ga0207690_10492865 3300025932 Bacteria 990
429 Ga0207706_10035442 3300025933 Bacteria 4436
430 Ga0207706_10441766 3300025933 Bacteria 1126
431 Ga0207706_10910282 3300025933 Bacteria 742
432 Ga0207686_10001001 3300025934 Bacteria 16776
433 Ga0207686_10070443 3300025934 Bacteria 2247
434 Ga0207709_10001601 3300025935 Bacteria 15426
435 Ga0207709_11189132 3300025935 Bacteria 628
436 Ga0207670_10086195 3300025936 Bacteria 2209
437 Ga0207670_10464884 3300025936 Bacteria 1022
438 Ga0207669_10004048 3300025937 Bacteria 6415
439 Ga0207669_10008780 3300025937 Bacteria 4766
440 Ga0207669_10050722 3300025937 Bacteria 2482
441 Ga0207669_10210027 3300025937 Bacteria 1420
442 Ga0207669_10414054 3300025937 Bacteria 1059
443 Ga0207669_10523310 3300025937 Bacteria 953
444 Ga0207704_10001540 3300025938 Bacteria 10349
445 Ga0207704_10019824 3300025938 Bacteria 3543
446 Ga0207704_10033899 3300025938 Bacteria 2909
447 Ga0207704_10273311 3300025938 Bacteria 1281
448 Ga0207665_10303367 3300025939 Bacteria 1194
449 Ga0207665_10486574 3300025939 Bacteria 951
450 Ga0207691_10000369 3300025940 Bacteria 45341
451 Ga0207691_10002535 3300025940 Bacteria 17848
452 Ga0207691_10141464 3300025940 Bacteria 2120
453 Ga0207711_10248499 3300025941 Bacteria 1633
454 Ga0207689_10007766 3300025942 Bacteria 9387
455 Ga0207689_10032928 3300025942 Bacteria 4307
456 Ga0207689_10399268 3300025942 Bacteria 1146
457 Ga0207689_11402429 3300025942 Unclassified 585
458 Ga0207661_10073193 3300025944 Bacteria 2805
459 Ga0207679_10022815 3300025945 Bacteria 4267
460 Ga0207679_10064307 3300025945 Bacteria 2741
461 Ga0207679_10238349 3300025945 Bacteria 1540
462 Ga0207667_10050471 3300025949 Bacteria 4389
463 Ga0207667_10075679 3300025949 Bacteria 3495
464 Ga0207667_10089774 3300025949 Bacteria 3176
465 Ga0207667_10092750 3300025949 Bacteria 3119
466 Ga0207667_10621096 3300025949 Bacteria 1088
467 Ga0207667_11468183 3300025949 Bacteria 654
468 Ga0207651_10001480 3300025960 Bacteria 10685
469 Ga0207651_10099867 3300025960 Bacteria 2150
470 Ga0207651_10117148 3300025960 Bacteria 2012
471 Ga0207651_10165945 3300025960 Bacteria 1736
472 Ga0207651_11533381 3300025960 Unclassified 600
473 Ga0207712_10041274 3300025961 Bacteria 3171
474 Ga0207712_10122044 3300025961 Bacteria 1973
475 Ga0207712_10906710 3300025961 Bacteria 779
476 Ga0207668_10007274 3300025972 Bacteria 6571
477 Ga0207668_10031036 3300025972 Bacteria 3516
478 Ga0207668_10040209 3300025972 Bacteria 3153
479 Ga0207668_10082846 3300025972 Bacteria 2332
480 Ga0207668_11271593 3300025972 Unclassified 662
481 Ga0207640_10061265 3300025981 Bacteria 2491
482 Ga0207658_10097474 3300025986 Bacteria 2295
483 Ga0207658_10128950 3300025986 Bacteria 2029
484 Ga0207658_11320714 3300025986 Unclassified 659
485 Ga0207677_10010469 3300026023 Bacteria 5247
486 Ga0207677_10014057 3300026023 Bacteria 4660
487 Ga0207677_10024318 3300026023 Bacteria 3761
488 Ga0207677_11397519 3300026023 Bacteria 645
489 Ga0207703_10005390 3300026035 Bacteria 10300
490 Ga0207703_10039252 3300026035 Bacteria 3783
491 Ga0207639_10009315 3300026041 Bacteria 6768
492 Ga0207639_10190939 3300026041 Bacteria 1750
493 Ga0207639_10495747 3300026041 Bacteria 1115
494 Ga0207639_10706010 3300026041 Bacteria 936
495 Ga0207678_10002898 3300026067 Bacteria 15570
496 Ga0207678_10011637 3300026067 Bacteria 7726
497 Ga0207678_10110403 3300026067 Bacteria 2346
498 Ga0207708_10007950 3300026075 Bacteria 7860
499 Ga0207708_10010353 3300026075 Bacteria 6924
500 Ga0207708_10638615 3300026075 Bacteria 905
501 Ga0207708_11917424 3300026075 Bacteria 519
502 Ga0207702_10068222 3300026078 Bacteria 3055
503 Ga0207702_10069424 3300026078 Bacteria 3030
504 Ga0207702_10267609 3300026078 Bacteria 1611
505 Ga0207641_10018678 3300026088 Bacteria 5685
506 Ga0207641_10470261 3300026088 Bacteria 1217
507 Ga0207648_10010777 3300026089 Bacteria 8637
508 Ga0207648_10036405 3300026089 Bacteria 4336
509 Ga0207648_10051276 3300026089 Bacteria 3606
510 Ga0207648_10053880 3300026089 Bacteria 3515
511 Ga0207648_10342022 3300026089 Bacteria 1347
512 Ga0207648_10391525 3300026089 Bacteria 1258
513 Ga0207648_10598839 3300026089 Unclassified 1016
514 Ga0207676_10005769 3300026095 Bacteria 8757
515 Ga0207676_10024365 3300026095 Bacteria 4477
516 Ga0207676_10091252 3300026095 Bacteria 2502
517 Ga0207676_11175993 3300026095 Bacteria 760
518 Ga0207676_11639823 3300026095 Bacteria 641
519 Ga0207674_10000273 3300026116 Bacteria 65119
520 Ga0207674_10488269 3300026116 Bacteria 1190
521 Ga0207674_11664821 3300026116 Bacteria 606
522 Ga0207675_100010487 3300026118 Bacteria 8680
523 Ga0207675_100034873 3300026118 Bacteria 4692
524 Ga0207675_100434568 3300026118 Bacteria 1298
525 Ga0207675_100823475 3300026118 Unclassified 942
526 Ga0207683_10004466 3300026121 Bacteria 12077
527 Ga0207683_10015065 3300026121 Bacteria 6581
528 Ga0207683_10076424 3300026121 Bacteria 2965
529 Ga0207683_10126648 3300026121 Bacteria 2295
530 Ga0207683_10228770 3300026121 Bacteria 1695
531 Ga0207683_10471637 3300026121 Bacteria 1158
532 Ga0207698_10007949 3300026142 Bacteria 6683
533 Ga0207698_10027683 3300026142 Bacteria 4028
534 Ga0207698_10063991 3300026142 Bacteria 2881
535 Ga0207698_10682177 3300026142 Bacteria 1021
536 Ga0207698_10796798 3300026142 Bacteria 947
537 Ga0207698_11203739 3300026142 Bacteria 771
538 Ga0209389_1000050 3300027296 Bacteria 111494
539 Ga0209969_1002690 3300027360 Bacteria 2464
540 Ga0209967_1001691 3300027364 Bacteria 2834
541 Ga0209981_1001482 3300027378 Bacteria 2963
542 Ga0209996_1001733 3300027395 Bacteria 2658
543 Ga0210000_1000464 3300027462 Bacteria 5576
544 Ga0209995_1074277 3300027471 Unclassified 583
545 Ga0209999_1000818 3300027543 Bacteria 5136
546 Ga0209813_10002949 3300027866 Bacteria 3938
547 Ga0209813_10008200 3300027866 Bacteria 2630
548 Ga0207428_10367792 3300027907 Unclassified 1056
549 Ga0268266_10015548 3300028379 Bacteria 6525
550 Ga0268266_10159643 3300028379 Bacteria 2039
551 Ga0268266_10596780 3300028379 Bacteria 1061
552 Ga0268266_10777465 3300028379 Unclassified 924
553 Ga0268265_10022840 3300028380 Bacteria 4402
554 Ga0268265_10089940 3300028380 Bacteria 2451
555 Ga0268265_10714412 3300028380 Bacteria 969
556 Ga0268264_10046298 3300028381 Bacteria 3613
557 Ga0268264_10193482 3300028381 Bacteria 1855
558 Ga0268264_10219746 3300028381 Bacteria 1749
559 Ga0307515_10034944 3300028794 Bacteria 8200
560 Ga0307515_10338249 3300028794 Bacteria 1159
561 Ga0307513_10112291 3300031456 Bacteria 2716
562 Ga0307513_10550058 3300031456 Bacteria 867
563 Ga0307405_10014037 3300031731 Bacteria 4294
564 Ga0307405_10510088 3300031731 Bacteria 966
565 Ga0307413_10003943 3300031824 Bacteria 6360
566 Ga0307413_10045524 3300031824 Bacteria 2602
567 Ga0307410_11161197 3300031852 Bacteria 671
568 Ga0307406_10015268 3300031901 Bacteria 4440
569 Ga0307406_10606764 3300031901 Bacteria 903
570 Ga0307406_10770801 3300031901 Bacteria 809
571 Ga0307406_11574844 3300031901 Bacteria 580
572 Ga0307407_10322761 3300031903 Bacteria 1084
573 Ga0307412_10136835 3300031911 Bacteria 1788
574 Ga0307412_10248511 3300031911 Bacteria 1380
575 Ga0307412_11423162 3300031911 Unclassified 628
576 Ga0307412_11513299 3300031911 Bacteria 610
577 Ga0307416_100134090 3300032002 Bacteria 2236
578 Ga0307416_100178335 3300032002 Bacteria 1988
579 Ga0307416_100257418 3300032002 Bacteria 1703
580 Ga0307416_100546265 3300032002 Bacteria 1231
581 Ga0307416_101253222 3300032002 Bacteria 847
582 Ga0307416_101954249 3300032002 Bacteria 690
583 Ga0307416_102009704 3300032002 Bacteria 681
584 Ga0307414_10483678 3300032004 Bacteria 1092
585 Ga0307411_10168454 3300032005 Bacteria 1649
586 Ga0307411_10282474 3300032005 Bacteria 1322
587 Ga0307411_10577645 3300032005 Bacteria 963
588 Ga0307415_100093351 3300032126 Bacteria 2185
589 Ga0307415_100150780 3300032126 Bacteria 1789
590 Ga0307415_100413061 3300032126 Bacteria 1156
591 Ga0307415_101385260 3300032126 Bacteria 669
592 Ga0373930_0080468 3300034816 Bacteria 753
593 Ga0373948_0007414 3300034817 Bacteria 1844
594 Ga0373950_0016776 3300034818 Bacteria 1256
595 Ga0373938_0112342 3300034957 Bacteria 695
596 Ga0373926_0003019 3300035083 Bacteria 5393
597 Ga0373923_0080985 3300035111 Bacteria 1408
598 Ga0373932_0037887 3300035112 Bacteria 1376
599 Ga0373936_0182747 3300035113 Bacteria 920
600 Ga0373945_0110243 3300035116 Bacteria 1085
601 Ga0373945_0344429 3300035116 Bacteria 645
602 Ga0373953_0011973 3300035117 Bacteria 3059
603 Ga0373954_0020803 3300035118 Bacteria 2969
604 Ga0373954_0333571 3300035118 Bacteria 749
605 Ga0373956_0031548 3300035119 Bacteria 2323
606 Ga0373943_0029318 3300035170 Bacteria 2600
607 Ga0373943_0131318 3300035170 Bacteria 1340
608 Ga0373943_0660648 3300035170 Bacteria 618
609 Ga0373946_0019419 3300035171 Bacteria 2618
610 Ga0373924_0016604 3300035410 Bacteria 2812
611 Ga0373931_0049085 3300035691 Bacteria 2240
612 Ga0373935_0012764 3300035692 Bacteria 5059
613 Ga0373935_0294119 3300035692 Bacteria 1146
614 Ga0373927_0082515 3300035695 Bacteria 2084
615 Ga0373927_0303327 3300035695 Unclassified 1051
616 Ga0373927_0495125 3300035695 Bacteria 807
617 Ga0373933_0334608 3300035724 Bacteria 982
618 Ga0373947_0023607 3300035725 Bacteria 3579
619 Ga0373947_0104314 3300035725 Bacteria 1785
620 Ga0373947_0125197 3300035725 Bacteria 1636
621 Ga0373947_0138825 3300035725 Unclassified 1557
622 Ga0373925_0128576 3300037068 Bacteria 1973
623 Ga0373925_0181489 3300037068 Bacteria 1666
624 Ga0373925_0337710 3300037068 Bacteria 1221
625 Ga0373925_0600749 3300037068 Bacteria 906
626 Ga0395899_0008657 3300037312 Bacteria 7830
627 Ga0395899_0406354 3300037312 Bacteria 900
628 Ga0395900_0137466 3300037418 Bacteria 2503
629 Ga0395898_0003183 3300037466 Bacteria 18485
630 Ga0395898_0076007 3300037466 Bacteria 3244
631 Ga0395898_1020054 3300037466 Bacteria 763
632 Ga0395905_0015389 3300037471 Bacteria 7269
633 Ga0436364_0134518 3300037853 Bacteria 932
634 Ga0436364_1183779 3300037853 Bacteria 761
635 Ga0395901_0193928 3300038443 Bacteria 2130
636 Ga0395901_0359932 3300038443 Bacteria 1500
637 Ga0436365_0636050 3300039437 Bacteria 2095
638 Ga0436365_1588688 3300039437 Bacteria 1481
639 Ga0436363_1227575 3300039450 Bacteria 2492
640 Ga0436362_0434243 3300039453 Bacteria 637
641 Ga0436362_0608168 3300039453 Bacteria 1974
642 Ga0451845_0250747 3300041501 Bacteria 573
643 Ga0439431_0073125 3300041997 Bacteria 916
644 Ga0439441_143283 3300042001 Bacteria 560
645 Ga0439456_004589 3300042013 Bacteria 2796
646 Ga0439435_0001074 3300042436 Bacteria 4848
647 Ga0439435_0008212 3300042436 Bacteria 2417
648 Ga0451577_1427442 3300042876 Unclassified 613
649 Ga0466963_0274116 3300044694 Bacteria 1185
650 Ga0466957_0536168 3300044842 Bacteria 814
651 Ga0466959_0195964 3300045049 Bacteria 1408
652 Ga0451576_1484437 3300045051 Bacteria 704
653 Ga0466967_0650882 3300045976 Bacteria 1042
654 Ga0466967_1060698 3300045976 Bacteria 807
655 Ga0495603_0261204 3300046455 Unclassified 996
656 Ga0495629_0121185 3300046459 Bacteria 1822
657 Ga0495641_0093843 3300046461 Bacteria 1341
658 Ga0495641_0503543 3300046461 Bacteria 552
659 Ga0495580_0014590 3300046472 Bacteria 5956
660 Ga0495582_0021827 3300046473 Bacteria 3503
661 Ga0495582_0207832 3300046473 Bacteria 1119
662 Ga0495639_0020238 3300046475 Bacteria 2907
663 Ga0495639_0040600 3300046475 Bacteria 2094
664 Ga0495639_0219338 3300046475 Unclassified 935
665 Ga0495662_0380304 3300046476 Bacteria 693
666 Ga0495664_0004281 3300046477 Bacteria 7789
667 Ga0495664_0017343 3300046477 Bacteria 4114
668 Ga0495664_0302188 3300046477 Bacteria 966
669 Ga0495585_0081416 3300046492 Bacteria 1754
670 Ga0495585_0167180 3300046492 Unclassified 1138
671 Ga0495607_0267469 3300046501 Bacteria 816
672 Ga0495607_0492136 3300046501 Bacteria 545
673 Ga0495618_0036936 3300046514 Bacteria 3066
674 Ga0495618_0106024 3300046514 Bacteria 1799
675 Ga0495628_0026329 3300046516 Bacteria 4744
676 Ga0495630_0049323 3300046517 Bacteria 3151
677 Ga0495630_0546315 3300046517 Unclassified 888
678 Ga0495630_1096452 3300046517 Bacteria 604
679 Ga0495631_0109141 3300046518 Bacteria 1190
680 Ga0495631_0314345 3300046518 Unclassified 666
681 Ga0495644_0073825 3300046523 Bacteria 1283
682 Ga0495644_0342704 3300046523 Unclassified 588
683 Ga0495663_0160991 3300046525 Bacteria 770
684 Ga0495666_0040315 3300046526 Bacteria 2265
685 Ga0495666_0281465 3300046526 Unclassified 754
686 Ga0495665_0017686 3300046531 Bacteria 3833
687 Ga0495665_0386322 3300046531 Bacteria 711
688 Ga0495640_0005320 3300046533 Bacteria 10231
689 Ga0495640_0369704 3300046533 Unclassified 883
690 Ga0495598_0007402 3300046537 Bacteria 2518
691 Ga0495598_0013959 3300046537 Bacteria 2002
692 Ga0495598_0153186 3300046537 Unclassified 806
693 Ga0495598_0220220 3300046537 Bacteria 693
694 Ga0495598_0279895 3300046537 Bacteria 626
695 Ga0495621_0010682 3300046539 Bacteria 2818
696 Ga0495621_0029717 3300046539 Bacteria 1864
697 Ga0495621_0036058 3300046539 Bacteria 1715
698 Ga0495621_0315852 3300046539 Unclassified 650
699 Ga0495645_0289815 3300046543 Bacteria 1073
700 Ga0495667_0150242 3300046559 Bacteria 1500
701 Ga0495656_0164848 3300046615 Bacteria 1079
702 Ga0495656_0206411 3300046615 Bacteria 977
703 Ga0495634_0030985 3300046642 Bacteria 3687
704 Ga0495635_0854808 3300046663 Bacteria 584
705 Ga0495588_0262167 3300046674 Bacteria 911
706 Ga0495588_0284617 3300046674 Bacteria 871
707 Ga0495599_0165101 3300046678 Bacteria 1368
708 Ga0495646_0242080 3300046680 Bacteria 969
709 Ga0495647_0020798 3300046681 Bacteria 2359
710 Ga0495658_0209196 3300046683 Bacteria 1218
711 Ga0495669_0070466 3300046684 Bacteria 1592
712 Ga0495669_0390829 3300046684 Bacteria 674
713 Ga0495613_0258759 3300046689 Bacteria 1213
714 Ga0495613_0587663 3300046689 Bacteria 742
715 Ga0495624_0104897 3300046690 Bacteria 1739
716 Ga0495670_0191380 3300046691 Bacteria 1082
717 Ga0495671_0496717 3300046692 Unclassified 582
718 Ga0495589_0211465 3300046794 Bacteria 913
719 Ga0495600_0293568 3300046809 Bacteria 1027
720 Ga0495604_0232517 3300047317 Bacteria 1264
721 Ga0495604_0451261 3300047317 Bacteria 840
722 Ga0495604_0661787 3300047317 Bacteria 665
723 Ga0495674_0001032 3300047319 Bacteria 26737
724 Ga0495674_0072923 3300047319 Bacteria 2960
725 Ga0495676_0087607 3300047321 Bacteria 2339
726 Ga0495676_0094060 3300047321 Bacteria 2234
727 Ga0495676_1050472 3300047321 Bacteria 519
728 Ga0495680_0597251 3300047322 Unclassified 739
729 Ga0495675_0652664 3300047444 Bacteria 593
730 Ga0495685_100598 3300047447 Bacteria 955
731 Ga0495684_0026273 3300047471 Bacteria 4473
732 Ga0495684_0166240 3300047471 Bacteria 1643
733 Ga0495593_0043110 3300047673 Unclassified 2420
734 Ga0495593_0080656 3300047673 Bacteria 1683
735 Ga0495615_0000790 3300048090 Bacteria 4441
736 Ga0495615_0157457 3300048090 Bacteria 680
737 Ga0496100_0024162 3300048903 Bacteria 3703
738 Ga0496100_0204072 3300048903 Bacteria 1442
739 Ga0496100_0504280 3300048903 Bacteria 933
740 Ga0496102_0177673 3300048905 Bacteria 2005
741 Ga0496104_0026228 3300048907 Bacteria 5378
742 Ga0496105_0664775 3300048908 Bacteria 803
743 Ga0496105_1248962 3300048908 Unclassified 545
744 Ga0496106_0062961 3300048909 Bacteria 2818
745 Ga0496106_0114348 3300048909 Bacteria 2104
746 Ga0496106_0208144 3300048909 Bacteria 1558
747 Ga0496106_1004192 3300048909 Bacteria 656
748 Ga0496106_1019322 3300048909 Bacteria 650
749 Ga0496107_0031082 3300048910 Bacteria 3808
750 Ga0496107_0237799 3300048910 Bacteria 1355
751 Ga0496107_0321737 3300048910 Bacteria 1151
752 Ga0496108_0112535 3300048911 Bacteria 2329
753 Ga0496108_0286813 3300048911 Bacteria 1433
754 Ga0496109_1109037 3300048912 Bacteria 728
755 Ga0496110_0039210 3300048913 Bacteria 4125
756 Ga0496110_0486136 3300048913 Bacteria 1124
757 Ga0496110_0571140 3300048913 Bacteria 1027
758 Ga0496111_0139544 3300048914 Bacteria 1796
759 Ga0496111_0717053 3300048914 Unclassified 727
760 Ga0496112_0040020 3300048915 Bacteria 4582
761 Ga0496113_1367990 3300048916 Unclassified 549
762 Ga0496114_0165586 3300048917 Bacteria 1924
763 Ga0496115_0314071 3300048918 Bacteria 1283
764 Ga0496121_0021631 3300048924 Bacteria 6290
765 Ga0496121_0324504 3300048924 Bacteria 1035
766 Ga0501033_0142265 3300049570 Bacteria 1734
767 Ga0501036_0359652 3300049572 Bacteria 1215
768 Ga0501036_0880178 3300049572 Bacteria 736
769 Ga0501038_0308223 3300049574 Bacteria 1241
770 Ga0501039_0205862 3300049575 Bacteria 1547
771 Ga0501039_0227774 3300049575 Bacteria 1465
772 Ga0501040_0077858 3300049576 Bacteria 2294
773 Ga0501040_0955123 3300049576 Unclassified 621
774 Ga0501040_1151645 3300049576 Bacteria 563
775 Ga0501042_0122101 3300049578 Bacteria 1876
776 Ga0501046_0427566 3300049580 Bacteria 954
777 Ga0501048_0498965 3300049582 Bacteria 873
778 Ga0501048_0556761 3300049582 Bacteria 823
779 Ga0501070_0020612 3300049586 Bacteria 5529
780 Ga0501071_0223933 3300049587 Bacteria 1416
781 Ga0501072_0123583 3300049588 Bacteria 2062
782 Ga0501072_0217018 3300049588 Bacteria 1524
783 Ga0501072_0333407 3300049588 Bacteria 1205
784 Ga0501072_0345695 3300049588 Bacteria 1181
785 Ga0501072_0852969 3300049588 Bacteria 712
786 Ga0501073_0042026 3300049589 Bacteria 3228
787 Ga0501074_0979864 3300049590 Bacteria 594
788 Ga0501075_0185061 3300049591 Bacteria 1589
789 Ga0501075_0186910 3300049591 Bacteria 1580
790 Ga0501075_0435773 3300049591 Bacteria 999
791 Ga0501076_0037009 3300049592 Bacteria 3825
792 Ga0501217_263524 3300049661 Bacteria 559
793 Ga0501235_197190 3300049669 Bacteria 544
794 Ga0501236_056780 3300049670 Bacteria 686
795 Ga0501249_015074 3300049679 Bacteria 1652
796 Ga0501079_0596729 3300049741 Bacteria 869
797 Ga0501080_0014365 3300049742 Bacteria 7291
798 Ga0501080_0737642 3300049742 Bacteria 867
799 Ga0501083_0428243 3300049744 Bacteria 861
800 Ga0501044_0014478 3300049823 Bacteria 8514
801 Ga0501045_0156298 3300049824 Bacteria 1697
802 Ga0501045_0195759 3300049824 Bacteria 1506
803 nmdc:mga03683_129543_c1 3300050489 Bacteria 1128
804 nmdc:mga03n38_245503_c1 3300050490 Bacteria 944
805 nmdc:mga03n38_39861_c1 3300050490 Bacteria 2039
806 nmdc:mga00v17_36326_c1 3300050491 Bacteria 2936
807 nmdc:mga00v17_57980_c1 3300050491 Bacteria 2370
808 nmdc:mga0yw44_129617_c1 3300050492 Bacteria 1631
809 nmdc:mga0yw44_209813_c1 3300050492 Bacteria 1288
810 nmdc:mga0yw44_341918_c1 3300050492 Bacteria 1007
811 nmdc:mga0yw44_480337_c1 3300050492 Bacteria 843
812 nmdc:mga0k408_140411_c1 3300050493 Bacteria 1437
813 nmdc:mga0k408_435808_c1 3300050493 Bacteria 779
814 nmdc:mga0k408_4461_c1 3300050493 Bacteria 7428
815 nmdc:mga06z11_311587_c1 3300050494 Bacteria 938
816 nmdc:mga06z11_7207_c1 3300050494 Bacteria 4564
817 nmdc:mga04h51_3236_c1 3300050495 Bacteria 3937
818 nmdc:mga04h51_9626_c1 3300050495 Bacteria 2628
819 nmdc:mga07m45_73327_c1 3300050496 Bacteria 1949
820 nmdc:mga07m45_76712_c1 3300050496 Bacteria 1906
821 nmdc:mga05p37_1567649_c1 3300050507 Bacteria 651
822 nmdc:mga05p37_161808_c1 3300050507 Bacteria 2733
823 nmdc:mga05p37_766073_c1 3300050507 Bacteria 1061
824 nmdc:mga05p37_880381_c1 3300050507 Bacteria 968
825 nmdc:mga09592_279664_c1 3300050508 Bacteria 1448
826 nmdc:mga09592_757468_c1 3300050508 Bacteria 824
827 nmdc:mga08y16_102980_c1 3300050511 Bacteria 2972
828 nmdc:mga08y16_1400139_c1 3300050511 Bacteria 663
829 nmdc:mga08y16_658606_c1 3300050511 Bacteria 1050
830 nmdc:mga08y16_857803_c1 3300050511 Unclassified 897
831 nmdc:mga0n895_1137_c1 3300050512 Bacteria 19479
832 nmdc:mga0n895_164_c1 3300050512 Bacteria 40868
833 nmdc:mga0n895_718709_c1 3300050512 Bacteria 994
834 nmdc:mga0rr50_1387_c1 3300050513 Bacteria 13256
835 nmdc:mga0rr50_50880_c1 3300050513 Bacteria 3071
836 nmdc:mga0rr50_521_c1 3300050513 Bacteria 20541
837 nmdc:mga08x19_24830_c1 3300050514 Bacteria 3729
838 nmdc:mga08x19_38145_c1 3300050514 Bacteria 3051
839 nmdc:mga08x19_995_c1 3300050514 Bacteria 17694
840 nmdc:mga0a205_1058387_c1 3300050515 Bacteria 658
841 nmdc:mga0a205_161270_c1 3300050515 Bacteria 2139
842 nmdc:mga0a205_503_c1 3300050515 Bacteria 30634
843 nmdc:mga0sz30_166568_c1 3300050516 Bacteria 977
844 nmdc:mga0sz30_224257_c1 3300050516 Bacteria 836
845 Ga0495601_0000439 3300053077 Bacteria 21822
846 Ga0495601_0201516 3300053077 Bacteria 1300
847 Ga0495601_0375877 3300053077 Bacteria 922
848 Ga0495601_0731049 3300053077 Bacteria 630
849 Ga0495612_0001363 3300053078 Bacteria 10067
850 Ga0495612_0038068 3300053078 Bacteria 1954
851 Ga0495612_0054686 3300053078 Bacteria 1645
852 Ga0495612_0172564 3300053078 Bacteria 947
853 Ga0500635_0301926 3300053080 Bacteria 632
854 Ga0495595_0020646 3300053084 Bacteria 2868
855 Ga0495595_0402303 3300053084 Unclassified 694
856 Ga0495619_0004602 3300053085 Bacteria 8806
857 Ga0500646_0002141 3300053090 Bacteria 5149
858 Ga0500647_0027201 3300053091 Bacteria 2702
859 Ga0500583_0008026 3300053092 Bacteria 3758
860 Ga0500566_0000588 3300053094 Bacteria 20372
861 Ga0500640_061469 3300053095 Bacteria 1627
862 Ga0500572_001377 3300053111 Bacteria 6709
863 Ga0500580_136875 3300053113 Bacteria 906
864 Ga0500614_002952 3300053123 Bacteria 3718
865 Ga0500614_035402 3300053123 Bacteria 1244
866 Ga0500559_0014512 3300053136 Bacteria 3329
867 Ga0500568_0121532 3300053139 Bacteria 973
868 Ga0500603_000114 3300053150 Bacteria 18972
869 Ga0500616_0036104 3300053153 Bacteria 2684
870 Ga0500616_0041377 3300053153 Bacteria 2473
871 Ga0500630_001669 3300053159 Bacteria 10645
872 Ga0500638_062053 3300053162 Bacteria 1795
873 Ga0500639_000006 3300053163 Bacteria 165068
874 Ga0500637_0141418 3300053178 Bacteria 1393
875 Ga0500637_0352837 3300053178 Bacteria 782
876 Ga0500576_095256 3300053725 Bacteria 1227
877 Ga0500645_110647 3300053730 Bacteria 771
878 Ga0500596_000782 3300053735 Bacteria 6273
879 Ga0500601_003633 3300053737 Bacteria 1674
880 Ga0501084_1041757 3300054114 Unclassified 687
881 Ga0590071_136097 3300059421 Bacteria 632
882 Ga0501082_0202201 3300060353 Bacteria 1728
883 Ga0501082_0358350 3300060353 Bacteria 1272
884 Ga0530510_0158650 3300061734 Bacteria 1673
885 Ga0070670_100190981
886 JGI24737J22298_10132470
887 JGI24033J26618_1010977
888 JGI25404J52841_10039012
889 Ga0065712_10223122
890 Ga0065712_10385347
891 Ga0065715_10259455
892 Ga0070658_10057782
893 Ga0070658_11675257
894 Ga0070676_10008367
895 Ga0070676_10286535
896 Ga0070676_11051426
897 Ga0070683_100086004
898 Ga0070683_100976658
899 Ga0070690_100000492
900 Ga0070690_101229569
901 Ga0070670_100018260
902 Ga0070677_10000291
903 Ga0070677_10002723
904 Ga0068869_100001545
905 Ga0068869_100014114
906 Ga0068869_100689902
907 Ga0068869_100971695
908 Ga0068869_101899485
909 Ga0070666_10101998
910 Ga0070680_100015031
911 Ga0070680_101313577
912 Ga0070682_100030691
913 Ga0070682_100067004
914 Ga0068868_100007235
915 Ga0068868_100009077
916 Ga0068868_100010378
917 Ga0068868_100337148
918 Ga0068868_100341787
919 Ga0070660_100249723
920 Ga0070689_100001125
921 Ga0070689_100147085
922 Ga0070689_100283059
923 Ga0070689_101373708
924 Ga0070691_10202895
925 Ga0070687_100019836
926 Ga0070687_100383465
927 Ga0070687_100613205
928 Ga0070661_100009629
929 Ga0070661_100273977
930 Ga0070692_10006502
931 Ga0070692_10254034
932 Ga0070668_100011162
933 Ga0070668_100022288
934 Ga0070668_100100097
935 Ga0070668_100859574
936 Ga0070668_101123420
937 Ga0070669_100062820
938 Ga0070669_100202973
939 Ga0070669_100326344
940 Ga0070675_100000096
941 Ga0070675_100018898
942 Ga0070675_100071081
943 Ga0070675_100283774
944 Ga0070671_100198801
945 Ga0070671_100221242
946 Ga0070674_100004394
947 Ga0070674_100008748
948 Ga0070674_100017136
949 Ga0070674_100019460
950 Ga0070674_100349486
951 Ga0070673_100002524
952 Ga0070673_100078706
953 Ga0070673_100151464
954 Ga0070673_100411125
955 Ga0070673_100466180
956 Ga0070673_100501471
957 Ga0070673_101234648
958 Ga0070688_100080688
959 Ga0070688_100654366
960 Ga0070659_100407322
961 Ga0070659_100562997
962 Ga0070667_100044307
963 Ga0070667_100050950
964 Ga0070667_100069745
965 Ga0070667_100209180
966 Ga0070667_100246694
967 Ga0070703_10013950
968 Ga0070709_10192187
969 Ga0070709_10655212
970 Ga0070714_100048128
971 Ga0070714_100168302
972 Ga0070714_101104248
973 Ga0070713_100086853
974 Ga0070713_100374775
975 Ga0070701_10009093
976 Ga0070701_10127553
977 Ga0070711_101706983
978 Ga0070705_100232681
979 Ga0070700_100001048
980 Ga0070700_100011229
981 Ga0070694_100010402
982 Ga0070694_100677420
983 Ga0070708_100486776
984 Ga0070663_100019738
985 Ga0070663_100099134
986 Ga0070663_100465066
987 Ga0070678_100003115
988 Ga0070678_100005547
989 Ga0070678_100067413
990 Ga0070678_100097177
991 Ga0070678_100108994
992 Ga0070662_100039868
993 Ga0070662_100213733
994 Ga0070662_100664021
995 Ga0070662_100832703
996 Ga0070662_101155100
997 Ga0070681_10175231
998 Ga0070681_10666391
999 Ga0070681_11256123
1000 Ga0068867_100002363
1001 Ga0068867_100039681
1002 Ga0068867_100128933
1003 Ga0068867_100187622
1004 Ga0068867_100294895
1005 Ga0068867_100363029
1006 Ga0068867_100574636
1007 Ga0068867_101475340
1008 Ga0070685_10070060
1009 Ga0070685_10206769
1010 Ga0070698_100243901
1011 Ga0070679_101460252
1012 Ga0070684_100024557
1013 Ga0068853_100080286
1014 Ga0068853_100225036
1015 Ga0070672_100000072
1016 Ga0070672_100006544
1017 Ga0070672_100007585
1018 Ga0070672_100150349
1019 Ga0070686_100014510
1020 Ga0070686_100069474
1021 Ga0070686_100219706
1022 Ga0070686_100957162
1023 Ga0070695_100017409
1024 Ga0070695_100431386
1025 Ga0070696_100011534
1026 Ga0070696_101583893
1027 Ga0070693_100000678
1028 Ga0070665_100045877
1029 Ga0070665_100148784
1030 Ga0070665_101008875
1031 Ga0070704_100000669
1032 Ga0070704_100375977
1033 Ga0070704_100668504
1034 Ga0068855_100051647
1035 Ga0068855_100374647
1036 Ga0068855_100563852
1037 Ga0070664_100027855
1038 Ga0070664_100089103
1039 Ga0070664_100180493
1040 Ga0070664_100235123
1041 Ga0070664_101212860
1042 Ga0068854_100006590
1043 Ga0068854_100053169
1044 Ga0068856_100095908
1045 Ga0068856_100100871
1046 Ga0068856_100134728
1047 Ga0070702_100017983
1048 Ga0070702_100032903
1049 Ga0070702_100093107
1050 Ga0068852_100018995
1051 Ga0068852_100178358
1052 Ga0068852_100827953
1053 Ga0068852_101119113
1054 Ga0068859_100099244
1055 Ga0068859_100164860
1056 Ga0068859_101288662
1057 Ga0068864_100005518
1058 Ga0068864_100030583
1059 Ga0068864_100061027
1060 Ga0068866_10015613
1061 Ga0068866_10051573
1062 Ga0068866_10459055
1063 Ga0068866_10459849
1064 Ga0068861_100000459
1065 Ga0068861_100042871
1066 Ga0068861_100586449
1067 Ga0068861_100732302
1068 Ga0068851_10000771
1069 Ga0068851_10003431
1070 Ga0068851_10020537
1071 Ga0068870_10070886
1072 Ga0068870_10168572
1073 Ga0068870_10218143
1074 Ga0068870_10394441
1075 Ga0068863_100120376
1076 Ga0068863_100508631
1077 Ga0068863_100807366
1078 Ga0068863_100995101
1079 Ga0068858_100025103
1080 Ga0068858_100038137
1081 Ga0068858_100050801
1082 Ga0068860_100032383
1083 Ga0068860_100136573
1084 Ga0068860_101607005
1085 Ga0068862_100001223
1086 Ga0068862_100102286
1087 Ga0068862_100171526
1088 Ga0068862_100341699
1089 Ga0081538_10071337
1090 Ga0081540_1011875
1091 Ga0070717_10108352
1092 Ga0075365_10032086
1093 Ga0075365_10201051
1094 Ga0075365_10356840
1095 Ga0075368_10009515
1096 Ga0075363_100005526
1097 Ga0075363_100310665
1098 Ga0075364_10087703
1099 Ga0070716_100478214
1100 Ga0075362_10030345
1101 Ga0075367_10020379
1102 Ga0075367_10810403
1103 Ga0075369_10014234
1104 Ga0075369_10085943
1105 Ga0075369_10333621
1106 Ga0075366_10029103
1107 Ga0075366_10035483
1108 Ga0075366_10424103
1109 Ga0097621_100018902
1110 Ga0097621_100027122
1111 Ga0097621_100095808
1112 Ga0075370_10024741
1113 Ga0068871_100014245
1114 Ga0068871_100045160
1115 Ga0068871_100110712
1116 Ga0068871_100174052
1117 Ga0068871_100492555
1118 Ga0068871_100759570
1119 Ga0075428_100144438
1120 Ga0075428_100287018
1121 Ga0075433_10000073
1122 Ga0075433_10144570
1123 Ga0075433_10816214
1124 Ga0075434_100000358
1125 Ga0075434_100000374
1126 Ga0075434_100717307
1127 Ga0068865_100000418
1128 Ga0068865_100027764
1129 Ga0068865_100568394
1130 Ga0068865_100784276
1131 Ga0075436_100000181
1132 Ga0097620_100099238
1133 Ga0097620_100164861
1134 Ga0097620_100727571
1135 Ga0097620_101288765
1136 Ga0099823_1000007
1137 Ga0075435_100000033
1138 Ga0075435_100065633
1139 Ga0075435_100216790
1140 Ga0105240_10089594
1141 Ga0105240_10238221
1142 Ga0111539_10058255
1143 Ga0111539_10102834
1144 Ga0111539_10242224
1145 Ga0111539_10729213
1146 Ga0111539_11705798
1147 Ga0111539_11820935
1148 Ga0111539_11959191
1149 Ga0105245_10023454
1150 Ga0105245_10034920
1151 Ga0105245_10037141
1152 Ga0105247_10093062
1153 Ga0105247_11202481
1154 Ga0105247_11467627
1155 Ga0114129_10050860
1156 Ga0114129_10672839
1157 Ga0114129_10750792
1158 Ga0114129_10826975
1159 Ga0105243_10000827
1160 Ga0105243_10015744
1161 Ga0105243_10434143
1162 Ga0105243_11300690
1163 Ga0105243_11598589
1164 Ga0105243_11899746
1165 Ga0105241_10005741
1166 Ga0105241_10011390
1167 Ga0105241_10053005
1168 Ga0105241_10072437
1169 Ga0105241_11007797
1170 Ga0105242_10002404
1171 Ga0105242_10017858
1172 Ga0105242_10520500
1173 Ga0105248_10032157
1174 Ga0105248_10361558
1175 Ga0105248_10413389
1176 Ga0105237_10007176
1177 Ga0105237_10047953
1178 Ga0105237_11100750
1179 Ga0105238_10091755
1180 Ga0105238_10305176
1181 Ga0105238_10434261
1182 Ga0105238_11097962
1183 Ga0105249_10011757
1184 Ga0105249_10152171
1185 Ga0105249_10385722
1186 Ga0105249_10930499
1187 Ga0099796_10027091
1188 Ga0105239_10044014
1189 Ga0105239_10093235
1190 Ga0105239_10167508
1191 Ga0105239_10350293
1192 Ga0105246_10366145
1193 Ga0105246_10535701
1194 Ga0105246_11269252
1195 Ga0157373_10002490
1196 Ga0157371_10132195
1197 Ga0157371_10468346
1198 Ga0157374_10048265
1199 Ga0157374_10314588
1200 Ga0157378_10005019
1201 Ga0157378_10248930
1202 Ga0157378_10323649
1203 Ga0157378_10477196
1204 Ga0157378_10753155
1205 Ga0157378_10978619
1206 Ga0163162_10042516
1207 Ga0163162_10137913
1208 Ga0163162_10618670
1209 Ga0163162_12196384
1210 Ga0157372_10157662
1211 Ga0157375_10007615
1212 Ga0157375_10033089
1213 Ga0157375_10088114
1214 Ga0157375_10123870
1215 Ga0157375_11008312
1216 Ga0163163_10028701
1217 Ga0163163_10244995
1218 Ga0163163_10626288
1219 Ga0163163_10869226
1220 Ga0163163_12283716
1221 Ga0157380_10006081
1222 Ga0157380_10083237
1223 Ga0157380_10131014
1224 Ga0157380_10343529
1225 Ga0157380_10362839
1226 Ga0157380_10433409
1227 Ga0157377_10181872
1228 Ga0157379_10087644
1229 Ga0157379_10741681
1230 Ga0157379_11506017
1231 Ga0157376_10034560
1232 Ga0157376_10045093
1233 Ga0157376_10075242
1234 Ga0157376_10147024
1235 Ga0157376_10152568
1236 Ga0157376_10897568
1237 Ga0163161_10060700
1238 Ga0163161_11187558
1239 Ga0206356_10261904
1240 Ga0213874_10288040
1241 Ga0207697_10005765
1242 Ga0207697_10206243
1243 Ga0207697_10452061
1244 Ga0207656_10011460
1245 Ga0207656_10011765
1246 Ga0207656_10035781
1247 Ga0207653_10013219
1248 Ga0207682_10001685
1249 Ga0207682_10002597
1250 Ga0207642_10014187
1251 Ga0207642_10019364
1252 Ga0207642_10601216
1253 Ga0207642_10676803
1254 Ga0207710_10124828
1255 Ga0207710_10378873
1256 Ga0207688_10026404
1257 Ga0207688_10088755
1258 Ga0207688_10149507
1259 Ga0207680_10256100
1260 Ga0207645_10074394
1261 Ga0207645_10108180
1262 Ga0207645_10518146
1263 Ga0207643_10029610
1264 Ga0207643_10039542
1265 Ga0207643_10346278
1266 Ga0207705_10002709
1267 Ga0207705_10003859
1268 Ga0207705_10101731
1269 Ga0207705_10699852
1270 Ga0207654_10007970
1271 Ga0207654_10050603
1272 Ga0207707_10024832
1273 Ga0207707_10589553
1274 Ga0207695_10055929
1275 Ga0207671_10009699
1276 Ga0207660_10005811
1277 Ga0207660_10020481
1278 Ga0207660_10805788
1279 Ga0207662_10007157
1280 Ga0207657_10000488
1281 Ga0207657_11281665
1282 Ga0207649_10237021
1283 Ga0207649_10456577
1284 Ga0207652_10038750
1285 Ga0207652_10061404
1286 Ga0207681_10023956
1287 Ga0207681_10173131
1288 Ga0207681_10216210
1289 Ga0207681_10294807
1290 Ga0207694_10068781
1291 Ga0207694_10636689
1292 Ga0207694_10829324
1293 Ga0207650_10002274
1294 Ga0207650_10278516
1295 Ga0207659_10000540
1296 Ga0207659_10687118
1297 Ga0207687_10015975
1298 Ga0207687_10039508
1299 Ga0207687_10098321
1300 Ga0207687_10301334
1301 Ga0207700_10006298
1302 Ga0207700_10015833
1303 Ga0207664_10021608
1304 Ga0207664_10169866
1305 Ga0207644_10012419
1306 Ga0207644_10047980
1307 Ga0207644_10402568
1308 Ga0207644_10430669
1309 Ga0207644_10533876
1310 Ga0207644_10553193
1311 Ga0207690_10427562
1312 Ga0207690_10492865
1313 Ga0207706_10035442
1314 Ga0207706_10441766
1315 Ga0207706_10910282
1316 Ga0207686_10001001
1317 Ga0207686_10070443
1318 Ga0207709_10001601
1319 Ga0207709_11189132
1320 Ga0207670_10086195
1321 Ga0207670_10464884
1322 Ga0207669_10004048
1323 Ga0207669_10008780
1324 Ga0207669_10050722
1325 Ga0207669_10210027
1326 Ga0207669_10414054
1327 Ga0207669_10523310
1328 Ga0207704_10001540
1329 Ga0207704_10019824
1330 Ga0207704_10033899
1331 Ga0207704_10273311
1332 Ga0207665_10303367
1333 Ga0207665_10486574
1334 Ga0207691_10000369
1335 Ga0207691_10002535
1336 Ga0207691_10141464
1337 Ga0207711_10248499
1338 Ga0207689_10007766
1339 Ga0207689_10032928
1340 Ga0207689_10399268
1341 Ga0207689_11402429
1342 Ga0207661_10073193
1343 Ga0207679_10022815
1344 Ga0207679_10064307
1345 Ga0207679_10238349
1346 Ga0207667_10050471
1347 Ga0207667_10075679
1348 Ga0207667_10089774
1349 Ga0207667_10092750
1350 Ga0207667_10621096
1351 Ga0207667_11468183
1352 Ga0207651_10001480
1353 Ga0207651_10099867
1354 Ga0207651_10117148
1355 Ga0207651_10165945
1356 Ga0207651_11533381
1357 Ga0207712_10041274
1358 Ga0207712_10122044
1359 Ga0207712_10906710
1360 Ga0207668_10007274
1361 Ga0207668_10031036
1362 Ga0207668_10040209
1363 Ga0207668_10082846
1364 Ga0207668_11271593
1365 Ga0207640_10061265
1366 Ga0207658_10097474
1367 Ga0207658_10128950
1368 Ga0207658_11320714
1369 Ga0207677_10010469
1370 Ga0207677_10014057
1371 Ga0207677_10024318
1372 Ga0207677_11397519
1373 Ga0207703_10005390
1374 Ga0207703_10039252
1375 Ga0207639_10009315
1376 Ga0207639_10190939
1377 Ga0207639_10495747
1378 Ga0207639_10706010
1379 Ga0207678_10002898
1380 Ga0207678_10011637
1381 Ga0207678_10110403
1382 Ga0207708_10007950
1383 Ga0207708_10010353
1384 Ga0207708_10638615
1385 Ga0207708_11917424
1386 Ga0207702_10068222
1387 Ga0207702_10069424
1388 Ga0207702_10267609
1389 Ga0207641_10018678
1390 Ga0207641_10470261
1391 Ga0207648_10010777
1392 Ga0207648_10036405
1393 Ga0207648_10051276
1394 Ga0207648_10053880
1395 Ga0207648_10342022
1396 Ga0207648_10391525
1397 Ga0207648_10598839
1398 Ga0207676_10005769
1399 Ga0207676_10024365
1400 Ga0207676_10091252
1401 Ga0207676_11175993
1402 Ga0207676_11639823
1403 Ga0207674_10000273
1404 Ga0207674_10488269
1405 Ga0207674_11664821
1406 Ga0207675_100010487
1407 Ga0207675_100034873
1408 Ga0207675_100434568
1409 Ga0207675_100823475
1410 Ga0207683_10004466
1411 Ga0207683_10015065
1412 Ga0207683_10076424
1413 Ga0207683_10126648
1414 Ga0207683_10228770
1415 Ga0207683_10471637
1416 Ga0207698_10007949
1417 Ga0207698_10027683
1418 Ga0207698_10063991
1419 Ga0207698_10682177
1420 Ga0207698_10796798
1421 Ga0207698_11203739
1422 Ga0209389_1000050
1423 Ga0209969_1002690
1424 Ga0209967_1001691
1425 Ga0209981_1001482
1426 Ga0209996_1001733
1427 Ga0210000_1000464
1428 Ga0209995_1074277
1429 Ga0209999_1000818
1430 Ga0209813_10002949
1431 Ga0209813_10008200
1432 Ga0207428_10367792
1433 Ga0268266_10015548
1434 Ga0268266_10159643
1435 Ga0268266_10596780
1436 Ga0268266_10777465
1437 Ga0268265_10022840
1438 Ga0268265_10089940
1439 Ga0268265_10714412
1440 Ga0268264_10046298
1441 Ga0268264_10193482
1442 Ga0268264_10219746
1443 Ga0307515_10034944
1444 Ga0307515_10338249
1445 Ga0307513_10112291
1446 Ga0307513_10550058
1447 Ga0307405_10014037
1448 Ga0307405_10510088
1449 Ga0307413_10003943
1450 Ga0307413_10045524
1451 Ga0307410_11161197
1452 Ga0307406_10015268
1453 Ga0307406_10606764
1454 Ga0307406_10770801
1455 Ga0307406_11574844
1456 Ga0307407_10322761
1457 Ga0307412_10136835
1458 Ga0307412_10248511
1459 Ga0307412_11423162
1460 Ga0307412_11513299
1461 Ga0307416_100134090
1462 Ga0307416_100178335
1463 Ga0307416_100257418
1464 Ga0307416_100546265
1465 Ga0307416_101253222
1466 Ga0307416_101954249
1467 Ga0307416_102009704
1468 Ga0307414_10483678
1469 Ga0307411_10168454
1470 Ga0307411_10282474
1471 Ga0307411_10577645
1472 Ga0307415_100093351
1473 Ga0307415_100150780
1474 Ga0307415_100413061
1475 Ga0307415_101385260
1476 Ga0373930_0080468
1477 Ga0373948_0007414
1478 Ga0373950_0016776
1479 Ga0373938_0112342
1480 Ga0373926_0003019
1481 Ga0373923_0080985
1482 Ga0373932_0037887
1483 Ga0373936_0182747
1484 Ga0373945_0110243
1485 Ga0373945_0344429
1486 Ga0373953_0011973
1487 Ga0373954_0020803
1488 Ga0373954_0333571
1489 Ga0373956_0031548
1490 Ga0373943_0029318
1491 Ga0373943_0131318
1492 Ga0373943_0660648
1493 Ga0373946_0019419
1494 Ga0373924_0016604
1495 Ga0373931_0049085
1496 Ga0373935_0012764
1497 Ga0373935_0294119
1498 Ga0373927_0082515
1499 Ga0373927_0303327
1500 Ga0373927_0495125
1501 Ga0373933_0334608
1502 Ga0373947_0023607
1503 Ga0373947_0104314
1504 Ga0373947_0125197
1505 Ga0373947_0138825
1506 Ga0373925_0128576
1507 Ga0373925_0181489
1508 Ga0373925_0337710
1509 Ga0373925_0600749
1510 Ga0395899_0008657
1511 Ga0395899_0406354
1512 Ga0395900_0137466
1513 Ga0395898_0003183
1514 Ga0395898_0076007
1515 Ga0395898_1020054
1516 Ga0395905_0015389
1517 Ga0436364_0134518
1518 Ga0436364_1183779
1519 Ga0395901_0193928
1520 Ga0395901_0359932
1521 Ga0436365_0636050
1522 Ga0436365_1588688
1523 Ga0436363_1227575
1524 Ga0436362_0434243
1525 Ga0436362_0608168
1526 Ga0451845_0250747
1527 Ga0439431_0073125
1528 Ga0439441_143283
1529 Ga0439456_004589
1530 Ga0439435_0001074
1531 Ga0439435_0008212
1532 Ga0451577_1427442
1533 Ga0466963_0274116
1534 Ga0466957_0536168
1535 Ga0466959_0195964
1536 Ga0451576_1484437
1537 Ga0466967_0650882
1538 Ga0466967_1060698
1539 Ga0495603_0261204
1540 Ga0495629_0121185
1541 Ga0495641_0093843
1542 Ga0495641_0503543
1543 Ga0495580_0014590
1544 Ga0495582_0021827
1545 Ga0495582_0207832
1546 Ga0495639_0020238
1547 Ga0495639_0040600
1548 Ga0495639_0219338
1549 Ga0495662_0380304
1550 Ga0495664_0004281
1551 Ga0495664_0017343
1552 Ga0495664_0302188
1553 Ga0495585_0081416
1554 Ga0495585_0167180
1555 Ga0495607_0267469
1556 Ga0495607_0492136
1557 Ga0495618_0036936
1558 Ga0495618_0106024
1559 Ga0495628_0026329
1560 Ga0495630_0049323
1561 Ga0495630_0546315
1562 Ga0495630_1096452
1563 Ga0495631_0109141
1564 Ga0495631_0314345
1565 Ga0495644_0073825
1566 Ga0495644_0342704
1567 Ga0495663_0160991
1568 Ga0495666_0040315
1569 Ga0495666_0281465
1570 Ga0495665_0017686
1571 Ga0495665_0386322
1572 Ga0495640_0005320
1573 Ga0495640_0369704
1574 Ga0495598_0007402
1575 Ga0495598_0013959
1576 Ga0495598_0153186
1577 Ga0495598_0220220
1578 Ga0495598_0279895
1579 Ga0495621_0010682
1580 Ga0495621_0029717
1581 Ga0495621_0036058
1582 Ga0495621_0315852
1583 Ga0495645_0289815
1584 Ga0495667_0150242
1585 Ga0495656_0164848
1586 Ga0495656_0206411
1587 Ga0495634_0030985
1588 Ga0495635_0854808
1589 Ga0495588_0262167
1590 Ga0495588_0284617
1591 Ga0495599_0165101
1592 Ga0495646_0242080
1593 Ga0495647_0020798
1594 Ga0495658_0209196
1595 Ga0495669_0070466
1596 Ga0495669_0390829
1597 Ga0495613_0258759
1598 Ga0495613_0587663
1599 Ga0495624_0104897
1600 Ga0495670_0191380
1601 Ga0495671_0496717
1602 Ga0495589_0211465
1603 Ga0495600_0293568
1604 Ga0495604_0232517
1605 Ga0495604_0451261
1606 Ga0495604_0661787
1607 Ga0495674_0001032
1608 Ga0495674_0072923
1609 Ga0495676_0087607
1610 Ga0495676_0094060
1611 Ga0495676_1050472
1612 Ga0495680_0597251
1613 Ga0495675_0652664
1614 Ga0495685_100598
1615 Ga0495684_0026273
1616 Ga0495684_0166240
1617 Ga0495593_0043110
1618 Ga0495593_0080656
1619 Ga0495615_0000790
1620 Ga0495615_0157457
1621 Ga0496100_0024162
1622 Ga0496100_0204072
1623 Ga0496100_0504280
1624 Ga0496102_0177673
1625 Ga0496104_0026228
1626 Ga0496105_0664775
1627 Ga0496105_1248962
1628 Ga0496106_0062961
1629 Ga0496106_0114348
1630 Ga0496106_0208144
1631 Ga0496106_1004192
1632 Ga0496106_1019322
1633 Ga0496107_0031082
1634 Ga0496107_0237799
1635 Ga0496107_0321737
1636 Ga0496108_0112535
1637 Ga0496108_0286813
1638 Ga0496109_1109037
1639 Ga0496110_0039210
1640 Ga0496110_0486136
1641 Ga0496110_0571140
1642 Ga0496111_0139544
1643 Ga0496111_0717053
1644 Ga0496112_0040020
1645 Ga0496113_1367990
1646 Ga0496114_0165586
1647 Ga0496115_0314071
1648 Ga0496121_0021631
1649 Ga0496121_0324504
1650 Ga0501033_0142265
1651 Ga0501036_0359652
1652 Ga0501036_0880178
1653 Ga0501038_0308223
1654 Ga0501039_0205862
1655 Ga0501039_0227774
1656 Ga0501040_0077858
1657 Ga0501040_0955123
1658 Ga0501040_1151645
1659 Ga0501042_0122101
1660 Ga0501046_0427566
1661 Ga0501048_0498965
1662 Ga0501048_0556761
1663 Ga0501070_0020612
1664 Ga0501071_0223933
1665 Ga0501072_0123583
1666 Ga0501072_0217018
1667 Ga0501072_0333407
1668 Ga0501072_0345695
1669 Ga0501072_0852969
1670 Ga0501073_0042026
1671 Ga0501074_0979864
1672 Ga0501075_0185061
1673 Ga0501075_0186910
1674 Ga0501075_0435773
1675 Ga0501076_0037009
1676 Ga0501217_263524
1677 Ga0501235_197190
1678 Ga0501236_056780
1679 Ga0501249_015074
1680 Ga0501079_0596729
1681 Ga0501080_0014365
1682 Ga0501080_0737642
1683 Ga0501083_0428243
1684 Ga0501044_0014478
1685 Ga0501045_0156298
1686 Ga0501045_0195759
1687 nmdc:mga03683_129543_c1
1688 nmdc:mga03n38_245503_c1
1689 nmdc:mga03n38_39861_c1
1690 nmdc:mga00v17_36326_c1
1691 nmdc:mga00v17_57980_c1
1692 nmdc:mga0yw44_129617_c1
1693 nmdc:mga0yw44_209813_c1
1694 nmdc:mga0yw44_341918_c1
1695 nmdc:mga0yw44_480337_c1
1696 nmdc:mga0k408_140411_c1
1697 nmdc:mga0k408_435808_c1
1698 nmdc:mga0k408_4461_c1
1699 nmdc:mga06z11_311587_c1
1700 nmdc:mga06z11_7207_c1
1701 nmdc:mga04h51_3236_c1
1702 nmdc:mga04h51_9626_c1
1703 nmdc:mga07m45_73327_c1
1704 nmdc:mga07m45_76712_c1
1705 nmdc:mga05p37_1567649_c1
1706 nmdc:mga05p37_161808_c1
1707 nmdc:mga05p37_766073_c1
1708 nmdc:mga05p37_880381_c1
1709 nmdc:mga09592_279664_c1
1710 nmdc:mga09592_757468_c1
1711 nmdc:mga08y16_102980_c1
1712 nmdc:mga08y16_1400139_c1
1713 nmdc:mga08y16_658606_c1
1714 nmdc:mga08y16_857803_c1
1715 nmdc:mga0n895_1137_c1
1716 nmdc:mga0n895_164_c1
1717 nmdc:mga0n895_718709_c1
1718 nmdc:mga0rr50_1387_c1
1719 nmdc:mga0rr50_50880_c1
1720 nmdc:mga0rr50_521_c1
1721 nmdc:mga08x19_24830_c1
1722 nmdc:mga08x19_38145_c1
1723 nmdc:mga08x19_995_c1
1724 nmdc:mga0a205_1058387_c1
1725 nmdc:mga0a205_161270_c1
1726 nmdc:mga0a205_503_c1
1727 nmdc:mga0sz30_166568_c1
1728 nmdc:mga0sz30_224257_c1
1729 Ga0495601_0000439
1730 Ga0495601_0201516
1731 Ga0495601_0375877
1732 Ga0495601_0731049
1733 Ga0495612_0001363
1734 Ga0495612_0038068
1735 Ga0495612_0054686
1736 Ga0495612_0172564
1737 Ga0500635_0301926
1738 Ga0495595_0020646
1739 Ga0495595_0402303
1740 Ga0495619_0004602
1741 Ga0500646_0002141
1742 Ga0500647_0027201
1743 Ga0500583_0008026
1744 Ga0500566_0000588
1745 Ga0500640_061469
1746 Ga0500572_001377
1747 Ga0500580_136875
1748 Ga0500614_002952
1749 Ga0500614_035402
1750 Ga0500559_0014512
1751 Ga0500568_0121532
1752 Ga0500603_000114
1753 Ga0500616_0036104
1754 Ga0500616_0041377
1755 Ga0500630_001669
1756 Ga0500638_062053
1757 Ga0500639_000006
1758 Ga0500637_0141418
1759 Ga0500637_0352837
1760 Ga0500576_095256
1761 Ga0500645_110647
1762 Ga0500596_000782
1763 Ga0500601_003633
1764 Ga0501084_1041757
1765 Ga0590071_136097
1766 Ga0501082_0202201
1767 Ga0501082_0358350
1768 Ga0530510_0158650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01989

AcnX_swivel_put

Aconitase X swivel domain

28

107

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.9367 4 135
7cns-assembly1.cif.gz_B crystal structure of thermococcus kodakaraensis aconitase x (holo-form) 0.923 4 135
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.8762 4 135
2hi6-assembly1.cif.gz_A solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101 0.8701 4 135
7cnp-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens aconitase x (apo-form) 0.8 1 125
ID Description Score Start End Superfamily
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.9021 4 134 3.50.30.10
af_Q58802_1_129_3.50.30.10 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8826 4 134 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8762 4 135 3.50.30.10
2hi6A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.8701 4 135 3.50.30.10
af_A0A0R0EFF0_27_190_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6938 68 106 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7W1L3P5-F1-model_v4 DUF126 domain-containing protein 0.9906 1 134 GO:0016829
AF-A0A6N1BEY1-F1-model_v4 deleted 0.9885 12 135
AF-A0A1F4EVD6-F1-model_v4 Phosphomevalonate dehydratase small subunit-like domain-containing protein 0.9878 2 134 GO:0016829
AF-A0A853FAV2-F1-model_v4 DUF126 domain-containing protein 0.9827 1 135 GO:0016829
AF-A0A556UPN3-F1-model_v4 deleted 0.981 1 135

Map