F484544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 882 | 343 | 1764 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100452401|Ga0070694_1004524012 |
| Length | 177 |
| Sequence | MTDPHLTSEAKSQTSPAESAKHFSRFYEEVQEIKAQYPDQRSAALPALRLAQEKHGYVSPEALRECAEALGTTPAFCEAVASFYDMLHLEPIGRHMVEVCTNVSCALVGAQQVLETFEEELGIRAGETTEDGEVTLRPIECLGGCGWATVVSVDHHYRTHVKPADVPAIVQELRSGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 203 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 204 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 205 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 206 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 207 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 208 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 209 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 210 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 211 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 212 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 219 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 220 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 341 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 9.3 |
| Rhizosphere | 90.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100452401 | 3300005444 | Bacteria | 1014 |
| 2 | JGI24744J21845_10001169 | 3300002077 | Bacteria | 5113 |
| 3 | JGI24742J22300_10084959 | 3300002244 | Bacteria | 601 |
| 4 | Ga0070658_10058131 | 3300005327 | Bacteria | 3147 |
| 5 | Ga0070683_100569378 | 3300005329 | Bacteria | 1083 |
| 6 | Ga0070690_100031769 | 3300005330 | Bacteria | 3292 |
| 7 | Ga0068869_100050871 | 3300005334 | Bacteria | 3004 |
| 8 | Ga0070666_10175133 | 3300005335 | Bacteria | 1504 |
| 9 | Ga0070680_100071045 | 3300005336 | Bacteria | 2860 |
| 10 | Ga0070680_100854429 | 3300005336 | Bacteria | 785 |
| 11 | Ga0070682_100001046 | 3300005337 | Bacteria | 16002 |
| 12 | Ga0068868_100058497 | 3300005338 | Bacteria | 3046 |
| 13 | Ga0070689_100287309 | 3300005340 | Bacteria | 1366 |
| 14 | Ga0070691_10090809 | 3300005341 | Bacteria | 1505 |
| 15 | Ga0070691_10159504 | 3300005341 | Bacteria | 1162 |
| 16 | Ga0070691_10570362 | 3300005341 | Bacteria | 664 |
| 17 | Ga0070687_100500620 | 3300005343 | Bacteria | 818 |
| 18 | Ga0070687_100677160 | 3300005343 | Bacteria | 718 |
| 19 | Ga0070692_10002003 | 3300005345 | Bacteria | 7729 |
| 20 | Ga0070668_100012259 | 3300005347 | Bacteria | 6387 |
| 21 | Ga0070668_100034924 | 3300005347 | Bacteria | 3832 |
| 22 | Ga0070675_100202397 | 3300005354 | Bacteria | 1723 |
| 23 | Ga0070675_100605871 | 3300005354 | Bacteria | 993 |
| 24 | Ga0070671_100072789 | 3300005355 | Bacteria | 2870 |
| 25 | Ga0070671_100512946 | 3300005355 | Bacteria | 1032 |
| 26 | Ga0070674_100024562 | 3300005356 | Bacteria | 3913 |
| 27 | Ga0070674_100181585 | 3300005356 | Bacteria | 1612 |
| 28 | Ga0070674_100359338 | 3300005356 | Bacteria | 1179 |
| 29 | Ga0070674_100363118 | 3300005356 | Bacteria | 1173 |
| 30 | Ga0070673_100803033 | 3300005364 | Bacteria | 869 |
| 31 | Ga0070673_101220581 | 3300005364 | Bacteria | 705 |
| 32 | Ga0070688_100201718 | 3300005365 | Bacteria | 1392 |
| 33 | Ga0070688_101299645 | 3300005365 | Unclassified | 587 |
| 34 | Ga0070659_100136339 | 3300005366 | Bacteria | 1996 |
| 35 | Ga0070659_100790410 | 3300005366 | Bacteria | 825 |
| 36 | Ga0070659_100930750 | 3300005366 | Bacteria | 761 |
| 37 | Ga0070667_100046836 | 3300005367 | Bacteria | 3638 |
| 38 | Ga0070667_100499480 | 3300005367 | Bacteria | 1115 |
| 39 | Ga0070709_10048366 | 3300005434 | Bacteria | 2653 |
| 40 | Ga0070709_10298707 | 3300005434 | Bacteria | 1176 |
| 41 | Ga0070714_100094702 | 3300005435 | Bacteria | 2621 |
| 42 | Ga0070713_100002608 | 3300005436 | Bacteria | 11779 |
| 43 | Ga0070713_100345956 | 3300005436 | Bacteria | 1378 |
| 44 | Ga0070713_100524987 | 3300005436 | Bacteria | 1119 |
| 45 | Ga0070710_10129351 | 3300005437 | Bacteria | 1538 |
| 46 | Ga0070710_10808570 | 3300005437 | Bacteria | 670 |
| 47 | Ga0070701_10019274 | 3300005438 | Bacteria | 3220 |
| 48 | Ga0070711_100005726 | 3300005439 | Bacteria | 7452 |
| 49 | Ga0070711_100382950 | 3300005439 | Bacteria | 1138 |
| 50 | Ga0070711_101034839 | 3300005439 | Unclassified | 705 |
| 51 | Ga0070705_101210946 | 3300005440 | Bacteria | 622 |
| 52 | Ga0070700_100005993 | 3300005441 | Bacteria | 6465 |
| 53 | Ga0070700_100837370 | 3300005441 | Bacteria | 744 |
| 54 | Ga0070700_100853401 | 3300005441 | Unclassified | 738 |
| 55 | Ga0070700_100946160 | 3300005441 | Unclassified | 705 |
| 56 | Ga0070694_100377541 | 3300005444 | Bacteria | 1105 |
| 57 | Ga0070708_100773722 | 3300005445 | Unclassified | 903 |
| 58 | Ga0070663_100533528 | 3300005455 | Bacteria | 979 |
| 59 | Ga0070678_100067067 | 3300005456 | Bacteria | 2669 |
| 60 | Ga0070678_100216248 | 3300005456 | Bacteria | 1591 |
| 61 | Ga0070678_100862099 | 3300005456 | Bacteria | 826 |
| 62 | Ga0070662_100002641 | 3300005457 | Bacteria | 11051 |
| 63 | Ga0070662_100540940 | 3300005457 | Bacteria | 975 |
| 64 | Ga0070681_11444782 | 3300005458 | Bacteria | 612 |
| 65 | Ga0068867_100000290 | 3300005459 | Bacteria | 32965 |
| 66 | Ga0068867_100123672 | 3300005459 | Bacteria | 2002 |
| 67 | Ga0070685_10375194 | 3300005466 | Bacteria | 978 |
| 68 | Ga0070685_10587107 | 3300005466 | Bacteria | 800 |
| 69 | Ga0070706_100087854 | 3300005467 | Bacteria | 2882 |
| 70 | Ga0070706_100101363 | 3300005467 | Bacteria | 2675 |
| 71 | Ga0070706_100203140 | 3300005467 | Bacteria | 1851 |
| 72 | Ga0070706_100218127 | 3300005467 | Bacteria | 1781 |
| 73 | Ga0070706_101077316 | 3300005467 | Bacteria | 740 |
| 74 | Ga0070707_100001362 | 3300005468 | Bacteria | 23998 |
| 75 | Ga0070707_100033547 | 3300005468 | Bacteria | 4896 |
| 76 | Ga0070698_100008838 | 3300005471 | Bacteria | 10835 |
| 77 | Ga0070698_100220818 | 3300005471 | Bacteria | 1829 |
| 78 | Ga0070698_100253971 | 3300005471 | Bacteria | 1690 |
| 79 | Ga0070698_100617921 | 3300005471 | Bacteria | 1024 |
| 80 | Ga0070698_101239288 | 3300005471 | Bacteria | 695 |
| 81 | Ga0070698_101971946 | 3300005471 | Unclassified | 537 |
| 82 | Ga0070699_100008741 | 3300005518 | Bacteria | 8776 |
| 83 | Ga0070699_101596644 | 3300005518 | Unclassified | 598 |
| 84 | Ga0070679_101358163 | 3300005530 | Bacteria | 657 |
| 85 | Ga0070679_101788134 | 3300005530 | Unclassified | 563 |
| 86 | Ga0070684_100069573 | 3300005535 | Bacteria | 3095 |
| 87 | Ga0070684_100745322 | 3300005535 | Bacteria | 914 |
| 88 | Ga0070684_100860323 | 3300005535 | Bacteria | 849 |
| 89 | Ga0070684_100999743 | 3300005535 | Bacteria | 785 |
| 90 | Ga0070684_102049697 | 3300005535 | Unclassified | 540 |
| 91 | Ga0070697_100894348 | 3300005536 | Unclassified | 788 |
| 92 | Ga0070697_101465776 | 3300005536 | Bacteria | 610 |
| 93 | Ga0070672_100143591 | 3300005543 | Bacteria | 1971 |
| 94 | Ga0070672_100332673 | 3300005543 | Bacteria | 1292 |
| 95 | Ga0070672_100677723 | 3300005543 | Bacteria | 902 |
| 96 | Ga0070686_100009901 | 3300005544 | Bacteria | 5359 |
| 97 | Ga0070686_100235823 | 3300005544 | Bacteria | 1329 |
| 98 | Ga0070695_100054146 | 3300005545 | Bacteria | 2581 |
| 99 | Ga0070695_100076816 | 3300005545 | Bacteria | 2200 |
| 100 | Ga0070695_100652978 | 3300005545 | Bacteria | 831 |
| 101 | Ga0070696_100483196 | 3300005546 | Bacteria | 983 |
| 102 | Ga0070696_101003362 | 3300005546 | Unclassified | 697 |
| 103 | Ga0070693_100419747 | 3300005547 | Bacteria | 932 |
| 104 | Ga0070665_100394905 | 3300005548 | Bacteria | 1391 |
| 105 | Ga0070704_100162689 | 3300005549 | Bacteria | 1766 |
| 106 | Ga0070704_100244948 | 3300005549 | Bacteria | 1469 |
| 107 | Ga0070704_100294518 | 3300005549 | Bacteria | 1349 |
| 108 | Ga0068855_100073422 | 3300005563 | Bacteria | 3974 |
| 109 | Ga0070664_100457987 | 3300005564 | Bacteria | 1172 |
| 110 | Ga0070664_101113451 | 3300005564 | Unclassified | 744 |
| 111 | Ga0068857_100002943 | 3300005577 | Bacteria | 14030 |
| 112 | Ga0068857_100125918 | 3300005577 | Bacteria | 2308 |
| 113 | Ga0068854_101195780 | 3300005578 | Bacteria | 681 |
| 114 | Ga0068854_101295586 | 3300005578 | Bacteria | 656 |
| 115 | Ga0068856_100002162 | 3300005614 | Bacteria | 20361 |
| 116 | Ga0068856_100575270 | 3300005614 | Bacteria | 1148 |
| 117 | Ga0068856_100904107 | 3300005614 | Bacteria | 902 |
| 118 | Ga0068856_101270323 | 3300005614 | Unclassified | 752 |
| 119 | Ga0070702_100018760 | 3300005615 | Bacteria | 3594 |
| 120 | Ga0070702_101343143 | 3300005615 | Bacteria | 582 |
| 121 | Ga0068852_100461231 | 3300005616 | Bacteria | 1260 |
| 122 | Ga0068864_100868382 | 3300005618 | Bacteria | 890 |
| 123 | Ga0068864_100889562 | 3300005618 | Bacteria | 879 |
| 124 | Ga0068864_101093505 | 3300005618 | Bacteria | 793 |
| 125 | Ga0068866_10000154 | 3300005718 | Bacteria | 31512 |
| 126 | Ga0068866_10072391 | 3300005718 | Bacteria | 1826 |
| 127 | Ga0068861_100001783 | 3300005719 | Bacteria | 13846 |
| 128 | Ga0068861_100137079 | 3300005719 | Bacteria | 1993 |
| 129 | Ga0068861_101020390 | 3300005719 | Bacteria | 791 |
| 130 | Ga0068851_10960056 | 3300005834 | Unclassified | 538 |
| 131 | Ga0068858_100306160 | 3300005842 | Bacteria | 1517 |
| 132 | Ga0068858_100486134 | 3300005842 | Bacteria | 1192 |
| 133 | Ga0068858_101049780 | 3300005842 | Bacteria | 799 |
| 134 | Ga0068860_100065963 | 3300005843 | Bacteria | 3438 |
| 135 | Ga0068860_100812165 | 3300005843 | Bacteria | 949 |
| 136 | Ga0068862_100178671 | 3300005844 | Bacteria | 1904 |
| 137 | Ga0068862_101069525 | 3300005844 | Bacteria | 801 |
| 138 | Ga0081455_10059969 | 3300005937 | Bacteria | 3210 |
| 139 | Ga0081455_10096923 | 3300005937 | Bacteria | 2377 |
| 140 | Ga0081538_10020315 | 3300005981 | Bacteria | 4894 |
| 141 | Ga0081538_10031392 | 3300005981 | Bacteria | 3584 |
| 142 | Ga0081538_10034449 | 3300005981 | Bacteria | 3347 |
| 143 | Ga0081538_10070154 | 3300005981 | Bacteria | 1936 |
| 144 | Ga0081539_10000397 | 3300005985 | Bacteria | 93458 |
| 145 | Ga0081539_10002620 | 3300005985 | Bacteria | 24595 |
| 146 | Ga0081539_10028254 | 3300005985 | Bacteria | 3530 |
| 147 | Ga0081539_10202314 | 3300005985 | Bacteria | 916 |
| 148 | Ga0070717_10014641 | 3300006028 | Bacteria | 6037 |
| 149 | Ga0070717_10567166 | 3300006028 | Bacteria | 1029 |
| 150 | Ga0070717_10712779 | 3300006028 | Bacteria | 912 |
| 151 | Ga0075432_10026251 | 3300006058 | Bacteria | 2000 |
| 152 | Ga0070715_10197078 | 3300006163 | Bacteria | 1021 |
| 153 | Ga0070715_10375126 | 3300006163 | Bacteria | 784 |
| 154 | Ga0070716_100046618 | 3300006173 | Bacteria | 2440 |
| 155 | Ga0070716_100219372 | 3300006173 | Bacteria | 1277 |
| 156 | Ga0070716_100952342 | 3300006173 | Unclassified | 676 |
| 157 | Ga0070712_100316251 | 3300006175 | Bacteria | 1268 |
| 158 | Ga0070712_100729723 | 3300006175 | Bacteria | 847 |
| 159 | Ga0070712_101197639 | 3300006175 | Unclassified | 661 |
| 160 | Ga0070712_101521670 | 3300006175 | Bacteria | 585 |
| 161 | Ga0075367_10017297 | 3300006178 | Bacteria | 3955 |
| 162 | Ga0097621_100396606 | 3300006237 | Bacteria | 1235 |
| 163 | Ga0097621_101085331 | 3300006237 | Bacteria | 751 |
| 164 | Ga0075428_100001324 | 3300006844 | Bacteria | 26239 |
| 165 | Ga0075428_100008062 | 3300006844 | Bacteria | 11697 |
| 166 | Ga0075428_100083469 | 3300006844 | Bacteria | 3486 |
| 167 | Ga0075428_100417806 | 3300006844 | Bacteria | 1437 |
| 168 | Ga0075428_101130303 | 3300006844 | Bacteria | 827 |
| 169 | Ga0075428_101824861 | 3300006844 | Bacteria | 633 |
| 170 | Ga0075430_100045380 | 3300006846 | Bacteria | 3713 |
| 171 | Ga0075430_100137242 | 3300006846 | Bacteria | 2037 |
| 172 | Ga0075431_100120826 | 3300006847 | Bacteria | 2703 |
| 173 | Ga0075431_100798585 | 3300006847 | Bacteria | 917 |
| 174 | Ga0075431_100841653 | 3300006847 | Bacteria | 889 |
| 175 | Ga0075433_10000356 | 3300006852 | Bacteria | 28714 |
| 176 | Ga0075433_10000542 | 3300006852 | Bacteria | 24806 |
| 177 | Ga0075434_100000720 | 3300006871 | Bacteria | 25896 |
| 178 | Ga0075434_100045583 | 3300006871 | Bacteria | 4350 |
| 179 | Ga0075434_101162702 | 3300006871 | Bacteria | 784 |
| 180 | Ga0075429_100069824 | 3300006880 | Bacteria | 3058 |
| 181 | Ga0075429_100184757 | 3300006880 | Bacteria | 1827 |
| 182 | Ga0075429_100370988 | 3300006880 | Bacteria | 1253 |
| 183 | Ga0068865_100022070 | 3300006881 | Bacteria | 4146 |
| 184 | Ga0075436_100071815 | 3300006914 | Bacteria | 2394 |
| 185 | Ga0075435_100009468 | 3300007076 | Bacteria | 7055 |
| 186 | Ga0075435_100082891 | 3300007076 | Bacteria | 2636 |
| 187 | Ga0075435_100551722 | 3300007076 | Bacteria | 998 |
| 188 | Ga0111539_10014838 | 3300009094 | Bacteria | 9716 |
| 189 | Ga0111539_10048781 | 3300009094 | Bacteria | 5053 |
| 190 | Ga0111539_11114693 | 3300009094 | Bacteria | 917 |
| 191 | Ga0111539_11118107 | 3300009094 | Bacteria | 915 |
| 192 | Ga0111539_11889615 | 3300009094 | Bacteria | 692 |
| 193 | Ga0105245_10013922 | 3300009098 | Bacteria | 7004 |
| 194 | Ga0105245_10206647 | 3300009098 | Bacteria | 1888 |
| 195 | Ga0105245_10253651 | 3300009098 | Bacteria | 1710 |
| 196 | Ga0105245_10382387 | 3300009098 | Bacteria | 1402 |
| 197 | Ga0105245_10902183 | 3300009098 | Bacteria | 925 |
| 198 | Ga0105245_11081667 | 3300009098 | Bacteria | 848 |
| 199 | Ga0105247_10112585 | 3300009101 | Bacteria | 1753 |
| 200 | Ga0114129_10005223 | 3300009147 | Bacteria | 18302 |
| 201 | Ga0114129_10010248 | 3300009147 | Bacteria | 13372 |
| 202 | Ga0114129_10031268 | 3300009147 | Bacteria | 7528 |
| 203 | Ga0114129_10124310 | 3300009147 | Bacteria | 3548 |
| 204 | Ga0114129_10211121 | 3300009147 | Bacteria | 2624 |
| 205 | Ga0114129_10506460 | 3300009147 | Bacteria | 1576 |
| 206 | Ga0114129_10547632 | 3300009147 | Bacteria | 1505 |
| 207 | Ga0114129_10868343 | 3300009147 | Bacteria | 1145 |
| 208 | Ga0114129_11062286 | 3300009147 | Bacteria | 1016 |
| 209 | Ga0114129_11740373 | 3300009147 | Bacteria | 760 |
| 210 | Ga0105243_10001079 | 3300009148 | Bacteria | 24973 |
| 211 | Ga0105243_10531728 | 3300009148 | Bacteria | 1120 |
| 212 | Ga0105243_11048200 | 3300009148 | Bacteria | 821 |
| 213 | Ga0105241_10082186 | 3300009174 | Bacteria | 2525 |
| 214 | Ga0105242_10228307 | 3300009176 | Bacteria | 1667 |
| 215 | Ga0105242_10542404 | 3300009176 | Bacteria | 1114 |
| 216 | Ga0105242_10554889 | 3300009176 | Bacteria | 1102 |
| 217 | Ga0105242_10579868 | 3300009176 | Bacteria | 1080 |
| 218 | Ga0105248_10022344 | 3300009177 | Bacteria | 7016 |
| 219 | Ga0105248_10046659 | 3300009177 | Bacteria | 4856 |
| 220 | Ga0105248_10088431 | 3300009177 | Bacteria | 3486 |
| 221 | Ga0105237_10489697 | 3300009545 | Bacteria | 1236 |
| 222 | Ga0105237_10539633 | 3300009545 | Bacteria | 1173 |
| 223 | Ga0105238_10402643 | 3300009551 | Bacteria | 1362 |
| 224 | Ga0105238_10826399 | 3300009551 | Bacteria | 943 |
| 225 | Ga0105249_10001703 | 3300009553 | Bacteria | 19257 |
| 226 | Ga0105249_10004222 | 3300009553 | Bacteria | 12419 |
| 227 | Ga0105249_10272228 | 3300009553 | Bacteria | 1687 |
| 228 | Ga0105239_10001224 | 3300010375 | Bacteria | 34981 |
| 229 | Ga0105239_10125740 | 3300010375 | Bacteria | 2849 |
| 230 | Ga0105239_10297845 | 3300010375 | Bacteria | 1816 |
| 231 | Ga0105239_10319303 | 3300010375 | Bacteria | 1751 |
| 232 | Ga0105239_10331948 | 3300010375 | Bacteria | 1715 |
| 233 | Ga0105239_11492029 | 3300010375 | Bacteria | 781 |
| 234 | Ga0105246_10236035 | 3300011119 | Bacteria | 1443 |
| 235 | Ga0105246_10248227 | 3300011119 | Bacteria | 1411 |
| 236 | Ga0105246_11288065 | 3300011119 | Bacteria | 677 |
| 237 | Ga0157374_10001561 | 3300013296 | Bacteria | 19271 |
| 238 | Ga0157374_10148299 | 3300013296 | Bacteria | 2280 |
| 239 | Ga0157374_10221004 | 3300013296 | Bacteria | 1859 |
| 240 | Ga0157374_10952169 | 3300013296 | Bacteria | 877 |
| 241 | Ga0157378_10058383 | 3300013297 | Bacteria | 3441 |
| 242 | Ga0157378_11285259 | 3300013297 | Bacteria | 773 |
| 243 | Ga0163162_10030158 | 3300013306 | Bacteria | 5373 |
| 244 | Ga0163162_10038088 | 3300013306 | Bacteria | 4799 |
| 245 | Ga0163162_11000464 | 3300013306 | Bacteria | 945 |
| 246 | Ga0157375_10101153 | 3300013308 | Bacteria | 2965 |
| 247 | Ga0157375_10152574 | 3300013308 | Bacteria | 2447 |
| 248 | Ga0157375_10795756 | 3300013308 | Bacteria | 1094 |
| 249 | Ga0157380_10756534 | 3300014326 | Bacteria | 984 |
| 250 | Ga0157380_10889099 | 3300014326 | Bacteria | 916 |
| 251 | Ga0157380_11038071 | 3300014326 | Bacteria | 855 |
| 252 | Ga0157377_10026003 | 3300014745 | Bacteria | 3127 |
| 253 | Ga0157377_10139034 | 3300014745 | Bacteria | 1491 |
| 254 | Ga0157377_10432024 | 3300014745 | Bacteria | 905 |
| 255 | Ga0157377_10455493 | 3300014745 | Bacteria | 884 |
| 256 | Ga0157379_10725708 | 3300014968 | Bacteria | 934 |
| 257 | Ga0157376_10001860 | 3300014969 | Bacteria | 14072 |
| 258 | Ga0157376_10495619 | 3300014969 | Bacteria | 1200 |
| 259 | Ga0163161_11129526 | 3300017792 | Unclassified | 675 |
| 260 | Ga0206356_11460515 | 3300020070 | Bacteria | 1868 |
| 261 | Ga0206350_11629545 | 3300020080 | Unclassified | 522 |
| 262 | Ga0207692_10153677 | 3300025898 | Bacteria | 1320 |
| 263 | Ga0207642_10521606 | 3300025899 | Unclassified | 730 |
| 264 | Ga0207688_10143335 | 3300025901 | Bacteria | 1407 |
| 265 | Ga0207688_10393723 | 3300025901 | Bacteria | 858 |
| 266 | Ga0207685_10023542 | 3300025905 | Bacteria | 2098 |
| 267 | Ga0207699_10044876 | 3300025906 | Bacteria | 2576 |
| 268 | Ga0207645_10287216 | 3300025907 | Bacteria | 1093 |
| 269 | Ga0207643_10068435 | 3300025908 | Bacteria | 2039 |
| 270 | Ga0207684_10080784 | 3300025910 | Bacteria | 2766 |
| 271 | Ga0207684_10203672 | 3300025910 | Bacteria | 1707 |
| 272 | Ga0207684_11035769 | 3300025910 | Bacteria | 685 |
| 273 | Ga0207654_10295011 | 3300025911 | Bacteria | 1101 |
| 274 | Ga0207707_10700090 | 3300025912 | Bacteria | 851 |
| 275 | Ga0207693_10000499 | 3300025915 | Bacteria | 35458 |
| 276 | Ga0207693_10098918 | 3300025915 | Bacteria | 2287 |
| 277 | Ga0207693_10494436 | 3300025915 | Bacteria | 955 |
| 278 | Ga0207663_10373938 | 3300025916 | Bacteria | 1084 |
| 279 | Ga0207663_10563945 | 3300025916 | Bacteria | 891 |
| 280 | Ga0207660_10009541 | 3300025917 | Bacteria | 6281 |
| 281 | Ga0207662_10023652 | 3300025918 | Bacteria | 3531 |
| 282 | Ga0207662_10169147 | 3300025918 | Bacteria | 1401 |
| 283 | Ga0207662_10759592 | 3300025918 | Unclassified | 682 |
| 284 | Ga0207657_10120254 | 3300025919 | Bacteria | 2161 |
| 285 | Ga0207657_10419425 | 3300025919 | Bacteria | 1052 |
| 286 | Ga0207649_10915149 | 3300025920 | Bacteria | 688 |
| 287 | Ga0207652_10399526 | 3300025921 | Bacteria | 1240 |
| 288 | Ga0207652_11488045 | 3300025921 | Unclassified | 581 |
| 289 | Ga0207646_10001072 | 3300025922 | Bacteria | 34848 |
| 290 | Ga0207646_10027364 | 3300025922 | Bacteria | 5201 |
| 291 | Ga0207694_10369284 | 3300025924 | Bacteria | 1190 |
| 292 | Ga0207659_10275556 | 3300025926 | Bacteria | 1374 |
| 293 | Ga0207659_10284400 | 3300025926 | Bacteria | 1353 |
| 294 | Ga0207659_10885338 | 3300025926 | Bacteria | 768 |
| 295 | Ga0207687_10006813 | 3300025927 | Bacteria | 7528 |
| 296 | Ga0207687_10017022 | 3300025927 | Bacteria | 4779 |
| 297 | Ga0207687_10211398 | 3300025927 | Bacteria | 1522 |
| 298 | Ga0207687_10295114 | 3300025927 | Bacteria | 1304 |
| 299 | Ga0207687_10513194 | 3300025927 | Bacteria | 1002 |
| 300 | Ga0207687_10514204 | 3300025927 | Bacteria | 1001 |
| 301 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 302 | Ga0207664_10172970 | 3300025929 | Bacteria | 1850 |
| 303 | Ga0207664_10204532 | 3300025929 | Bacteria | 1706 |
| 304 | Ga0207690_10176212 | 3300025932 | Bacteria | 1606 |
| 305 | Ga0207690_10206542 | 3300025932 | Bacteria | 1495 |
| 306 | Ga0207690_10837944 | 3300025932 | Bacteria | 761 |
| 307 | Ga0207706_10621447 | 3300025933 | Bacteria | 927 |
| 308 | Ga0207686_10000672 | 3300025934 | Bacteria | 21152 |
| 309 | Ga0207686_10227251 | 3300025934 | Bacteria | 1351 |
| 310 | Ga0207686_10422472 | 3300025934 | Bacteria | 1020 |
| 311 | Ga0207709_10000781 | 3300025935 | Bacteria | 24924 |
| 312 | Ga0207709_10040500 | 3300025935 | Bacteria | 2790 |
| 313 | Ga0207709_10547931 | 3300025935 | Bacteria | 909 |
| 314 | Ga0207709_11204638 | 3300025935 | Bacteria | 624 |
| 315 | Ga0207670_11125750 | 3300025936 | Bacteria | 663 |
| 316 | Ga0207669_10032949 | 3300025937 | Bacteria | 2917 |
| 317 | Ga0207669_10484736 | 3300025937 | Bacteria | 986 |
| 318 | Ga0207669_11003620 | 3300025937 | Bacteria | 701 |
| 319 | Ga0207669_11409524 | 3300025937 | Bacteria | 593 |
| 320 | Ga0207704_10001419 | 3300025938 | Bacteria | 10712 |
| 321 | Ga0207704_10276825 | 3300025938 | Bacteria | 1273 |
| 322 | Ga0207665_10143886 | 3300025939 | Bacteria | 1703 |
| 323 | Ga0207665_10536848 | 3300025939 | Bacteria | 907 |
| 324 | Ga0207665_10823486 | 3300025939 | Bacteria | 734 |
| 325 | Ga0207691_10134120 | 3300025940 | Bacteria | 2186 |
| 326 | Ga0207691_10143645 | 3300025940 | Bacteria | 2102 |
| 327 | Ga0207691_10475537 | 3300025940 | Bacteria | 1062 |
| 328 | Ga0207711_11074070 | 3300025941 | Bacteria | 745 |
| 329 | Ga0207661_10497390 | 3300025944 | Bacteria | 1114 |
| 330 | Ga0207661_10524948 | 3300025944 | Bacteria | 1083 |
| 331 | Ga0207661_11499098 | 3300025944 | Bacteria | 618 |
| 332 | Ga0207679_10772938 | 3300025945 | Bacteria | 874 |
| 333 | Ga0207667_10054593 | 3300025949 | Bacteria | 4202 |
| 334 | Ga0207651_10481858 | 3300025960 | Bacteria | 1069 |
| 335 | Ga0207651_12079615 | 3300025960 | Bacteria | 510 |
| 336 | Ga0207712_10007048 | 3300025961 | Bacteria | 7092 |
| 337 | Ga0207712_10134333 | 3300025961 | Bacteria | 1890 |
| 338 | Ga0207712_10155390 | 3300025961 | Bacteria | 1771 |
| 339 | Ga0207668_10027466 | 3300025972 | Bacteria | 3707 |
| 340 | Ga0207668_10212937 | 3300025972 | Bacteria | 1547 |
| 341 | Ga0207640_10294431 | 3300025981 | Bacteria | 1281 |
| 342 | Ga0207658_10012020 | 3300025986 | Bacteria | 5904 |
| 343 | Ga0207658_11371830 | 3300025986 | Bacteria | 647 |
| 344 | Ga0207677_10370358 | 3300026023 | Bacteria | 1206 |
| 345 | Ga0207703_10206384 | 3300026035 | Bacteria | 1749 |
| 346 | Ga0207639_10567265 | 3300026041 | Bacteria | 1044 |
| 347 | Ga0207639_11643715 | 3300026041 | Unclassified | 602 |
| 348 | Ga0207678_10215470 | 3300026067 | Bacteria | 1643 |
| 349 | Ga0207708_10000434 | 3300026075 | Bacteria | 32516 |
| 350 | Ga0207708_10385805 | 3300026075 | Bacteria | 1156 |
| 351 | Ga0207708_10566968 | 3300026075 | Bacteria | 959 |
| 352 | Ga0207708_10712953 | 3300026075 | Bacteria | 858 |
| 353 | Ga0207708_10878221 | 3300026075 | Unclassified | 775 |
| 354 | Ga0207702_10020710 | 3300026078 | Bacteria | 5439 |
| 355 | Ga0207702_10184461 | 3300026078 | Bacteria | 1923 |
| 356 | Ga0207648_10015109 | 3300026089 | Bacteria | 7107 |
| 357 | Ga0207648_10080125 | 3300026089 | Bacteria | 2849 |
| 358 | Ga0207648_10232035 | 3300026089 | Bacteria | 1642 |
| 359 | Ga0207676_10260379 | 3300026095 | Bacteria | 1566 |
| 360 | Ga0207676_10441944 | 3300026095 | Bacteria | 1224 |
| 361 | Ga0207674_10008735 | 3300026116 | Bacteria | 11664 |
| 362 | Ga0207674_10090219 | 3300026116 | Bacteria | 3056 |
| 363 | Ga0207674_11880173 | 3300026116 | Bacteria | 565 |
| 364 | Ga0207675_100022938 | 3300026118 | Bacteria | 5805 |
| 365 | Ga0207675_100079099 | 3300026118 | Bacteria | 3081 |
| 366 | Ga0207675_100079403 | 3300026118 | Bacteria | 3075 |
| 367 | Ga0207683_10006588 | 3300026121 | Bacteria | 9935 |
| 368 | Ga0207683_10302178 | 3300026121 | Bacteria | 1464 |
| 369 | Ga0207698_10043854 | 3300026142 | Bacteria | 3355 |
| 370 | Ga0207428_10042636 | 3300027907 | Bacteria | 3669 |
| 371 | Ga0207428_10287647 | 3300027907 | Bacteria | 1219 |
| 372 | Ga0268266_10212127 | 3300028379 | Bacteria | 1776 |
| 373 | Ga0268264_10243069 | 3300028381 | Bacteria | 1668 |
| 374 | Ga0268264_10821288 | 3300028381 | Bacteria | 930 |
| 375 | Ga0265319_1002809 | 3300028563 | Bacteria | 9324 |
| 376 | Ga0265318_10005078 | 3300028577 | Bacteria | 6235 |
| 377 | Ga0265322_10008197 | 3300028654 | Bacteria | 3046 |
| 378 | Ga0265338_10028546 | 3300028800 | Bacteria | 5560 |
| 379 | Ga0265324_10158984 | 3300029957 | Unclassified | 767 |
| 380 | Ga0265330_10013638 | 3300031235 | Bacteria | 3785 |
| 381 | Ga0265332_10052464 | 3300031238 | Bacteria | 1751 |
| 382 | Ga0265320_10012238 | 3300031240 | Bacteria | 5005 |
| 383 | Ga0265340_10013801 | 3300031247 | Bacteria | 4235 |
| 384 | Ga0265339_10042433 | 3300031249 | Bacteria | 2519 |
| 385 | Ga0265327_10099616 | 3300031251 | Bacteria | 1404 |
| 386 | Ga0265316_10031600 | 3300031344 | Bacteria | 4327 |
| 387 | Ga0307408_100381213 | 3300031548 | Bacteria | 1205 |
| 388 | Ga0307408_101011790 | 3300031548 | Bacteria | 766 |
| 389 | Ga0265342_10009711 | 3300031712 | Bacteria | 6744 |
| 390 | Ga0307405_10024196 | 3300031731 | Bacteria | 3465 |
| 391 | Ga0307405_10046658 | 3300031731 | Bacteria | 2664 |
| 392 | Ga0307405_10387117 | 3300031731 | Bacteria | 1090 |
| 393 | Ga0307413_10066967 | 3300031824 | Bacteria | 2243 |
| 394 | Ga0307413_10607809 | 3300031824 | Bacteria | 896 |
| 395 | Ga0307410_10368565 | 3300031852 | Bacteria | 1152 |
| 396 | Ga0307410_10491496 | 3300031852 | Bacteria | 1008 |
| 397 | Ga0307406_10023139 | 3300031901 | Bacteria | 3695 |
| 398 | Ga0307406_10050675 | 3300031901 | Bacteria | 2633 |
| 399 | Ga0307406_10193560 | 3300031901 | Bacteria | 1491 |
| 400 | Ga0307407_10017709 | 3300031903 | Bacteria | 3583 |
| 401 | Ga0307412_10144709 | 3300031911 | Bacteria | 1745 |
| 402 | Ga0307412_10611604 | 3300031911 | Bacteria | 924 |
| 403 | Ga0307412_11613105 | 3300031911 | Bacteria | 593 |
| 404 | Ga0307409_100090234 | 3300031995 | Bacteria | 2508 |
| 405 | Ga0307409_100250650 | 3300031995 | Bacteria | 1618 |
| 406 | Ga0307409_100259291 | 3300031995 | Bacteria | 1594 |
| 407 | Ga0307409_100369474 | 3300031995 | Bacteria | 1360 |
| 408 | Ga0307409_100604985 | 3300031995 | Bacteria | 1084 |
| 409 | Ga0307409_100881573 | 3300031995 | Bacteria | 907 |
| 410 | Ga0307409_100912144 | 3300031995 | Bacteria | 893 |
| 411 | Ga0307416_100000711 | 3300032002 | Bacteria | 17278 |
| 412 | Ga0307416_100015982 | 3300032002 | Bacteria | 5201 |
| 413 | Ga0307416_100018953 | 3300032002 | Bacteria | 4864 |
| 414 | Ga0307416_100120113 | 3300032002 | Bacteria | 2339 |
| 415 | Ga0307416_102722201 | 3300032002 | Bacteria | 591 |
| 416 | Ga0307416_102836058 | 3300032002 | Unclassified | 580 |
| 417 | Ga0307414_11138288 | 3300032004 | Bacteria | 721 |
| 418 | Ga0307411_10091495 | 3300032005 | Bacteria | 2125 |
| 419 | Ga0307415_100000296 | 3300032126 | Bacteria | 21625 |
| 420 | Ga0307415_100010159 | 3300032126 | Bacteria | 5317 |
| 421 | Ga0307415_100022248 | 3300032126 | Bacteria | 3908 |
| 422 | Ga0307415_100098445 | 3300032126 | Bacteria | 2138 |
| 423 | Ga0373952_0021088 | 3300035092 | Bacteria | 1373 |
| 424 | Ga0373932_0099146 | 3300035112 | Bacteria | 946 |
| 425 | Ga0373962_0210038 | 3300035242 | Bacteria | 662 |
| 426 | Ga0373931_0333610 | 3300035691 | Bacteria | 945 |
| 427 | Ga0373935_0481749 | 3300035692 | Bacteria | 899 |
| 428 | Ga0373925_0109457 | 3300037068 | Bacteria | 2133 |
| 429 | Ga0395899_0007215 | 3300037312 | Bacteria | 8603 |
| 430 | Ga0395899_0007885 | 3300037312 | Bacteria | 8206 |
| 431 | Ga0395899_0019593 | 3300037312 | Bacteria | 5136 |
| 432 | Ga0395899_0027088 | 3300037312 | Bacteria | 4323 |
| 433 | Ga0395899_0092061 | 3300037312 | Bacteria | 2196 |
| 434 | Ga0395899_0159922 | 3300037312 | Bacteria | 1592 |
| 435 | Ga0395899_0198119 | 3300037312 | Bacteria | 1402 |
| 436 | Ga0395899_0198945 | 3300037312 | Bacteria | 1398 |
| 437 | Ga0395899_0267711 | 3300037312 | Bacteria | 1166 |
| 438 | Ga0395899_0415290 | 3300037312 | Bacteria | 888 |
| 439 | Ga0395899_0521558 | 3300037312 | Bacteria | 768 |
| 440 | Ga0395900_0000528 | 3300037418 | Bacteria | 53945 |
| 441 | Ga0395900_0006608 | 3300037418 | Bacteria | 12067 |
| 442 | Ga0395900_0040788 | 3300037418 | Bacteria | 4784 |
| 443 | Ga0395900_0043397 | 3300037418 | Bacteria | 4635 |
| 444 | Ga0395900_0054193 | 3300037418 | Bacteria | 4129 |
| 445 | Ga0395900_0055681 | 3300037418 | Bacteria | 4072 |
| 446 | Ga0395900_0072257 | 3300037418 | Bacteria | 3547 |
| 447 | Ga0395900_0102187 | 3300037418 | Bacteria | 2945 |
| 448 | Ga0395900_0108819 | 3300037418 | Bacteria | 2847 |
| 449 | Ga0395900_0173743 | 3300037418 | Bacteria | 2192 |
| 450 | Ga0395900_0180272 | 3300037418 | Bacteria | 2147 |
| 451 | Ga0395900_0322053 | 3300037418 | Bacteria | 1526 |
| 452 | Ga0395900_0344085 | 3300037418 | Bacteria | 1466 |
| 453 | Ga0395900_0361124 | 3300037418 | Bacteria | 1424 |
| 454 | Ga0395900_0442780 | 3300037418 | Bacteria | 1256 |
| 455 | Ga0395900_0534864 | 3300037418 | Bacteria | 1118 |
| 456 | Ga0395900_0577665 | 3300037418 | Bacteria | 1066 |
| 457 | Ga0395900_0743353 | 3300037418 | Bacteria | 912 |
| 458 | Ga0395900_1189620 | 3300037418 | Bacteria | 678 |
| 459 | Ga0395900_1189870 | 3300037418 | Bacteria | 678 |
| 460 | Ga0395900_1408700 | 3300037418 | Unclassified | 610 |
| 461 | Ga0395898_0002139 | 3300037466 | Bacteria | 24346 |
| 462 | Ga0395898_0012709 | 3300037466 | Bacteria | 8695 |
| 463 | Ga0395898_0017551 | 3300037466 | Bacteria | 7305 |
| 464 | Ga0395898_0020569 | 3300037466 | Bacteria | 6703 |
| 465 | Ga0395898_0023768 | 3300037466 | Bacteria | 6188 |
| 466 | Ga0395898_0033384 | 3300037466 | Bacteria | 5137 |
| 467 | Ga0395898_0039856 | 3300037466 | Bacteria | 4647 |
| 468 | Ga0395898_0067339 | 3300037466 | Bacteria | 3467 |
| 469 | Ga0395898_0075798 | 3300037466 | Bacteria | 3248 |
| 470 | Ga0395898_0086288 | 3300037466 | Bacteria | 3025 |
| 471 | Ga0395898_0115094 | 3300037466 | Bacteria | 2577 |
| 472 | Ga0395898_0158210 | 3300037466 | Bacteria | 2167 |
| 473 | Ga0395898_0282451 | 3300037466 | Bacteria | 1583 |
| 474 | Ga0395898_0344086 | 3300037466 | Bacteria | 1422 |
| 475 | Ga0395898_0449326 | 3300037466 | Bacteria | 1227 |
| 476 | Ga0395898_0768527 | 3300037466 | Bacteria | 904 |
| 477 | Ga0395898_0840238 | 3300037466 | Unclassified | 858 |
| 478 | Ga0395905_0000661 | 3300037471 | Bacteria | 45819 |
| 479 | Ga0395905_0005716 | 3300037471 | Bacteria | 12642 |
| 480 | Ga0395905_0009617 | 3300037471 | Bacteria | 9440 |
| 481 | Ga0395905_0018357 | 3300037471 | Bacteria | 6639 |
| 482 | Ga0395905_0031768 | 3300037471 | Bacteria | 4968 |
| 483 | Ga0395905_0042861 | 3300037471 | Bacteria | 4246 |
| 484 | Ga0395905_0079115 | 3300037471 | Bacteria | 3081 |
| 485 | Ga0395905_0123399 | 3300037471 | Bacteria | 2435 |
| 486 | Ga0395905_0141328 | 3300037471 | Bacteria | 2264 |
| 487 | Ga0395905_0348794 | 3300037471 | Bacteria | 1372 |
| 488 | Ga0395905_0366276 | 3300037471 | Bacteria | 1334 |
| 489 | Ga0395905_0498040 | 3300037471 | Bacteria | 1118 |
| 490 | Ga0395905_0511870 | 3300037471 | Bacteria | 1101 |
| 491 | Ga0395905_0772131 | 3300037471 | Bacteria | 864 |
| 492 | Ga0395905_0886791 | 3300037471 | Bacteria | 795 |
| 493 | Ga0395905_1401165 | 3300037471 | Unclassified | 603 |
| 494 | Ga0395905_1589282 | 3300037471 | Unclassified | 559 |
| 495 | Ga0395901_0001057 | 3300038443 | Bacteria | 29607 |
| 496 | Ga0395901_0003646 | 3300038443 | Bacteria | 15530 |
| 497 | Ga0395901_0010037 | 3300038443 | Bacteria | 9601 |
| 498 | Ga0395901_0010426 | 3300038443 | Bacteria | 9415 |
| 499 | Ga0395901_0027883 | 3300038443 | Bacteria | 5806 |
| 500 | Ga0395901_0048101 | 3300038443 | Bacteria | 4429 |
| 501 | Ga0395901_0051842 | 3300038443 | Bacteria | 4265 |
| 502 | Ga0395901_0069596 | 3300038443 | Bacteria | 3665 |
| 503 | Ga0395901_0077799 | 3300038443 | Bacteria | 3462 |
| 504 | Ga0395901_0091435 | 3300038443 | Bacteria | 3185 |
| 505 | Ga0395901_0119598 | 3300038443 | Bacteria | 2768 |
| 506 | Ga0395901_0151003 | 3300038443 | Bacteria | 2441 |
| 507 | Ga0395901_0228306 | 3300038443 | Bacteria | 1944 |
| 508 | Ga0395901_0253972 | 3300038443 | Bacteria | 1831 |
| 509 | Ga0395901_0265813 | 3300038443 | Bacteria | 1785 |
| 510 | Ga0395901_0406581 | 3300038443 | Bacteria | 1398 |
| 511 | Ga0395901_0561778 | 3300038443 | Bacteria | 1155 |
| 512 | Ga0395901_0636154 | 3300038443 | Bacteria | 1072 |
| 513 | Ga0395901_0775643 | 3300038443 | Bacteria | 949 |
| 514 | Ga0395901_1238691 | 3300038443 | Unclassified | 710 |
| 515 | Ga0395901_1499770 | 3300038443 | Bacteria | 630 |
| 516 | Ga0439438_009923 | 3300041405 | Bacteria | 3052 |
| 517 | Ga0439447_012220 | 3300041407 | Bacteria | 2475 |
| 518 | Ga0439453_0015199 | 3300041408 | Bacteria | 1329 |
| 519 | Ga0439461_0002991 | 3300041410 | Bacteria | 2751 |
| 520 | Ga0439466_0016371 | 3300041411 | Bacteria | 2680 |
| 521 | Ga0439466_0095676 | 3300041411 | Bacteria | 929 |
| 522 | Ga0451851_0629674 | 3300041507 | Bacteria | 554 |
| 523 | Ga0439441_050794 | 3300042001 | Bacteria | 853 |
| 524 | Ga0439448_0273065 | 3300042005 | Bacteria | 598 |
| 525 | Ga0439450_104434 | 3300042008 | Bacteria | 721 |
| 526 | Ga0439450_189859 | 3300042008 | Bacteria | 547 |
| 527 | Ga0439451_007930 | 3300042009 | Bacteria | 2155 |
| 528 | Ga0439454_002693 | 3300042011 | Bacteria | 1903 |
| 529 | Ga0450920_025816 | 3300042122 | Bacteria | 1145 |
| 530 | Ga0450907_057246 | 3300042146 | Unclassified | 672 |
| 531 | Ga0439446_0175855 | 3300042156 | Bacteria | 714 |
| 532 | Ga0439446_0248797 | 3300042156 | Bacteria | 612 |
| 533 | Ga0450908_036736 | 3300042184 | Bacteria | 849 |
| 534 | Ga0450908_068669 | 3300042184 | Unclassified | 628 |
| 535 | Ga0439434_0002257 | 3300042435 | Bacteria | 5594 |
| 536 | Ga0439435_0117045 | 3300042436 | Bacteria | 832 |
| 537 | Ga0439464_0062743 | 3300042439 | Bacteria | 1090 |
| 538 | Ga0450918_020396 | 3300042531 | Bacteria | 1158 |
| 539 | Ga0466964_0509354 | 3300044706 | Unclassified | 647 |
| 540 | Ga0466959_0136514 | 3300045049 | Bacteria | 1736 |
| 541 | Ga0451576_0094753 | 3300045051 | Bacteria | 3105 |
| 542 | Ga0466967_0037672 | 3300045976 | Bacteria | 4141 |
| 543 | Ga0466967_0886640 | 3300045976 | Bacteria | 887 |
| 544 | Ga0495617_108492 | 3300046452 | Bacteria | 899 |
| 545 | Ga0495592_0348556 | 3300046454 | Bacteria | 950 |
| 546 | Ga0495603_0196635 | 3300046455 | Bacteria | 1165 |
| 547 | Ga0495629_0276818 | 3300046459 | Bacteria | 1152 |
| 548 | Ga0495629_0654585 | 3300046459 | Unclassified | 700 |
| 549 | Ga0495641_0075368 | 3300046461 | Bacteria | 1512 |
| 550 | Ga0495641_0228901 | 3300046461 | Bacteria | 834 |
| 551 | Ga0495641_0469964 | 3300046461 | Bacteria | 573 |
| 552 | Ga0495580_0290624 | 3300046472 | Bacteria | 1114 |
| 553 | Ga0495605_0031922 | 3300046474 | Bacteria | 2686 |
| 554 | Ga0495584_0021737 | 3300046491 | Bacteria | 3258 |
| 555 | Ga0495584_0141662 | 3300046491 | Bacteria | 1221 |
| 556 | Ga0495584_0291524 | 3300046491 | Unclassified | 829 |
| 557 | Ga0495584_0299467 | 3300046491 | Bacteria | 817 |
| 558 | Ga0495585_0190406 | 3300046492 | Bacteria | 1050 |
| 559 | Ga0495594_0084953 | 3300046499 | Bacteria | 1770 |
| 560 | Ga0495596_0182289 | 3300046500 | Bacteria | 816 |
| 561 | Ga0495596_0212563 | 3300046500 | Bacteria | 751 |
| 562 | Ga0495607_0022098 | 3300046501 | Bacteria | 3999 |
| 563 | Ga0495607_0149141 | 3300046501 | Bacteria | 1199 |
| 564 | Ga0495618_0122205 | 3300046514 | Bacteria | 1668 |
| 565 | Ga0495618_0369289 | 3300046514 | Bacteria | 882 |
| 566 | Ga0495628_0626390 | 3300046516 | Bacteria | 766 |
| 567 | Ga0495630_1092020 | 3300046517 | Bacteria | 605 |
| 568 | Ga0495631_0076423 | 3300046518 | Bacteria | 1445 |
| 569 | Ga0495632_0279859 | 3300046519 | Bacteria | 743 |
| 570 | Ga0495637_0072469 | 3300046520 | Bacteria | 1387 |
| 571 | Ga0495637_0091439 | 3300046520 | Bacteria | 1199 |
| 572 | Ga0495644_0160770 | 3300046523 | Bacteria | 861 |
| 573 | Ga0495644_0289793 | 3300046523 | Bacteria | 639 |
| 574 | Ga0495663_0008460 | 3300046525 | Bacteria | 2850 |
| 575 | Ga0495663_0075881 | 3300046525 | Bacteria | 1076 |
| 576 | Ga0495663_0208677 | 3300046525 | Bacteria | 684 |
| 577 | Ga0495666_0067277 | 3300046526 | Bacteria | 1707 |
| 578 | Ga0495642_0042323 | 3300046528 | Bacteria | 1855 |
| 579 | Ga0495642_0107583 | 3300046528 | Bacteria | 1190 |
| 580 | Ga0495642_0277280 | 3300046528 | Bacteria | 734 |
| 581 | Ga0495642_0330969 | 3300046528 | Bacteria | 669 |
| 582 | Ga0495665_0092511 | 3300046531 | Bacteria | 1589 |
| 583 | Ga0495640_0203225 | 3300046533 | Bacteria | 1255 |
| 584 | Ga0495598_0005842 | 3300046537 | Bacteria | 2750 |
| 585 | Ga0495598_0360113 | 3300046537 | Bacteria | 562 |
| 586 | Ga0495609_0042648 | 3300046538 | Bacteria | 2038 |
| 587 | Ga0495609_0102527 | 3300046538 | Bacteria | 1239 |
| 588 | Ga0495609_0236774 | 3300046538 | Unclassified | 755 |
| 589 | Ga0495597_0077576 | 3300046542 | Bacteria | 1424 |
| 590 | Ga0495622_0310036 | 3300046557 | Bacteria | 687 |
| 591 | Ga0495633_0090439 | 3300046558 | Bacteria | 1423 |
| 592 | Ga0495633_0529944 | 3300046558 | Unclassified | 531 |
| 593 | Ga0495667_0449538 | 3300046559 | Bacteria | 810 |
| 594 | Ga0495656_0003173 | 3300046615 | Bacteria | 5534 |
| 595 | Ga0495656_0121388 | 3300046615 | Bacteria | 1234 |
| 596 | Ga0495656_0135081 | 3300046615 | Bacteria | 1177 |
| 597 | Ga0495656_0360918 | 3300046615 | Bacteria | 754 |
| 598 | Ga0495668_0046983 | 3300046616 | Bacteria | 2397 |
| 599 | Ga0495634_0086870 | 3300046642 | Bacteria | 2036 |
| 600 | Ga0495611_0181751 | 3300046648 | Bacteria | 983 |
| 601 | Ga0495611_0312242 | 3300046648 | Bacteria | 724 |
| 602 | Ga0495635_0346661 | 3300046663 | Bacteria | 991 |
| 603 | Ga0495635_0469933 | 3300046663 | Bacteria | 830 |
| 604 | Ga0495635_0512927 | 3300046663 | Bacteria | 788 |
| 605 | Ga0495659_0021997 | 3300046664 | Bacteria | 2153 |
| 606 | Ga0495659_0023062 | 3300046664 | Bacteria | 2111 |
| 607 | Ga0495659_0149273 | 3300046664 | Bacteria | 938 |
| 608 | Ga0495659_0203536 | 3300046664 | Bacteria | 813 |
| 609 | Ga0495661_0033110 | 3300046665 | Bacteria | 3262 |
| 610 | Ga0495588_0046383 | 3300046674 | Bacteria | 2229 |
| 611 | Ga0495588_0702528 | 3300046674 | Unclassified | 529 |
| 612 | Ga0495657_0686664 | 3300046675 | Bacteria | 589 |
| 613 | Ga0495647_0121759 | 3300046681 | Bacteria | 1098 |
| 614 | Ga0495647_0140307 | 3300046681 | Bacteria | 1030 |
| 615 | Ga0495658_0202870 | 3300046683 | Bacteria | 1236 |
| 616 | Ga0495658_0281875 | 3300046683 | Bacteria | 1049 |
| 617 | Ga0495669_0062801 | 3300046684 | Bacteria | 1684 |
| 618 | Ga0495624_0035274 | 3300046690 | Bacteria | 3230 |
| 619 | Ga0495670_0021716 | 3300046691 | Bacteria | 3167 |
| 620 | Ga0495670_0046037 | 3300046691 | Bacteria | 2179 |
| 621 | Ga0495670_0104931 | 3300046691 | Bacteria | 1459 |
| 622 | Ga0495589_0043884 | 3300046794 | Bacteria | 2225 |
| 623 | Ga0495589_0201273 | 3300046794 | Bacteria | 940 |
| 624 | Ga0495581_0004869 | 3300047315 | Bacteria | 7767 |
| 625 | Ga0495581_0021948 | 3300047315 | Bacteria | 3700 |
| 626 | Ga0495581_0204859 | 3300047315 | Bacteria | 1154 |
| 627 | Ga0495636_0043928 | 3300047318 | Bacteria | 1860 |
| 628 | Ga0495674_0071600 | 3300047319 | Bacteria | 2992 |
| 629 | Ga0495676_0004151 | 3300047321 | Bacteria | 13213 |
| 630 | Ga0495680_0081152 | 3300047322 | Bacteria | 2449 |
| 631 | Ga0495683_0035790 | 3300047323 | Bacteria | 2523 |
| 632 | Ga0495675_0607961 | 3300047444 | Bacteria | 619 |
| 633 | Ga0495679_067463 | 3300047446 | Bacteria | 1036 |
| 634 | Ga0495685_056886 | 3300047447 | Bacteria | 1322 |
| 635 | Ga0495593_0492423 | 3300047673 | Bacteria | 614 |
| 636 | Ga0495626_0341947 | 3300048091 | Bacteria | 585 |
| 637 | Ga0496100_0288154 | 3300048903 | Bacteria | 1226 |
| 638 | Ga0496100_0421881 | 3300048903 | Bacteria | 1019 |
| 639 | Ga0496100_0572590 | 3300048903 | Bacteria | 875 |
| 640 | Ga0496101_0005772 | 3300048904 | Bacteria | 7914 |
| 641 | Ga0496101_0128409 | 3300048904 | Bacteria | 1923 |
| 642 | Ga0496101_0141502 | 3300048904 | Bacteria | 1834 |
| 643 | Ga0496101_0141761 | 3300048904 | Bacteria | 1832 |
| 644 | Ga0496102_0001550 | 3300048905 | Bacteria | 20301 |
| 645 | Ga0496102_0076483 | 3300048905 | Bacteria | 3079 |
| 646 | Ga0496102_0114636 | 3300048905 | Bacteria | 2514 |
| 647 | Ga0496102_0270115 | 3300048905 | Bacteria | 1603 |
| 648 | Ga0496103_0000709 | 3300048906 | Bacteria | 24669 |
| 649 | Ga0496103_0024392 | 3300048906 | Bacteria | 3651 |
| 650 | Ga0496103_0041314 | 3300048906 | Bacteria | 2835 |
| 651 | Ga0496103_0189100 | 3300048906 | Bacteria | 1324 |
| 652 | Ga0496104_0000803 | 3300048907 | Bacteria | 27008 |
| 653 | Ga0496104_0011491 | 3300048907 | Bacteria | 7933 |
| 654 | Ga0496104_0067409 | 3300048907 | Bacteria | 3400 |
| 655 | Ga0496104_0134388 | 3300048907 | Bacteria | 2376 |
| 656 | Ga0496104_0357110 | 3300048907 | Bacteria | 1374 |
| 657 | Ga0496104_0901404 | 3300048907 | Bacteria | 789 |
| 658 | Ga0496105_0001672 | 3300048908 | Bacteria | 15803 |
| 659 | Ga0496105_0010159 | 3300048908 | Bacteria | 7396 |
| 660 | Ga0496105_0020745 | 3300048908 | Bacteria | 5312 |
| 661 | Ga0496105_0172392 | 3300048908 | Bacteria | 1773 |
| 662 | Ga0496105_0315132 | 3300048908 | Bacteria | 1255 |
| 663 | Ga0496106_0010527 | 3300048909 | Bacteria | 6831 |
| 664 | Ga0496106_0072159 | 3300048909 | Bacteria | 2640 |
| 665 | Ga0496106_0341472 | 3300048909 | Bacteria | 1202 |
| 666 | Ga0496106_0430180 | 3300048909 | Bacteria | 1061 |
| 667 | Ga0496107_0002375 | 3300048910 | Bacteria | 12187 |
| 668 | Ga0496107_0354901 | 3300048910 | Bacteria | 1091 |
| 669 | Ga0496107_0659010 | 3300048910 | Unclassified | 771 |
| 670 | Ga0496108_0008456 | 3300048911 | Bacteria | 8350 |
| 671 | Ga0496108_0037234 | 3300048911 | Bacteria | 4051 |
| 672 | Ga0496108_0107151 | 3300048911 | Bacteria | 2386 |
| 673 | Ga0496108_0248562 | 3300048911 | Bacteria | 1547 |
| 674 | Ga0496108_0910950 | 3300048911 | Unclassified | 754 |
| 675 | Ga0496108_0936846 | 3300048911 | Bacteria | 742 |
| 676 | Ga0496109_0000662 | 3300048912 | Bacteria | 28563 |
| 677 | Ga0496109_0003962 | 3300048912 | Bacteria | 12362 |
| 678 | Ga0496109_0007085 | 3300048912 | Bacteria | 9464 |
| 679 | Ga0496109_0018429 | 3300048912 | Bacteria | 6133 |
| 680 | Ga0496109_0025576 | 3300048912 | Bacteria | 5262 |
| 681 | Ga0496109_0187327 | 3300048912 | Bacteria | 1944 |
| 682 | Ga0496109_0995315 | 3300048912 | Bacteria | 776 |
| 683 | Ga0496110_0000069 | 3300048913 | Bacteria | 51597 |
| 684 | Ga0496110_0002879 | 3300048913 | Bacteria | 13005 |
| 685 | Ga0496110_0003806 | 3300048913 | Bacteria | 11628 |
| 686 | Ga0496110_0004602 | 3300048913 | Bacteria | 10717 |
| 687 | Ga0496110_0014207 | 3300048913 | Bacteria | 6606 |
| 688 | Ga0496110_0058040 | 3300048913 | Bacteria | 3408 |
| 689 | Ga0496110_0555905 | 3300048913 | Bacteria | 1043 |
| 690 | Ga0496110_0561886 | 3300048913 | Bacteria | 1037 |
| 691 | Ga0496110_0704411 | 3300048913 | Unclassified | 911 |
| 692 | Ga0496111_0001356 | 3300048914 | Bacteria | 13855 |
| 693 | Ga0496111_0001848 | 3300048914 | Bacteria | 12482 |
| 694 | Ga0496111_0005616 | 3300048914 | Bacteria | 8067 |
| 695 | Ga0496111_0009977 | 3300048914 | Bacteria | 6352 |
| 696 | Ga0496111_0010981 | 3300048914 | Bacteria | 6093 |
| 697 | Ga0496111_0056769 | 3300048914 | Bacteria | 2833 |
| 698 | Ga0496111_0076966 | 3300048914 | Bacteria | 2432 |
| 699 | Ga0496111_0100563 | 3300048914 | Bacteria | 2124 |
| 700 | Ga0496111_0215093 | 3300048914 | Bacteria | 1428 |
| 701 | Ga0496112_0001443 | 3300048915 | Bacteria | 18248 |
| 702 | Ga0496112_0074821 | 3300048915 | Bacteria | 3349 |
| 703 | Ga0496112_0202690 | 3300048915 | Bacteria | 1943 |
| 704 | Ga0496112_0281173 | 3300048915 | Bacteria | 1611 |
| 705 | Ga0496112_0807110 | 3300048915 | Bacteria | 863 |
| 706 | Ga0496112_0857857 | 3300048915 | Bacteria | 831 |
| 707 | Ga0496112_1337582 | 3300048915 | Bacteria | 632 |
| 708 | Ga0496113_0148359 | 3300048916 | Bacteria | 1849 |
| 709 | Ga0496113_0236824 | 3300048916 | Bacteria | 1456 |
| 710 | Ga0496114_0007482 | 3300048917 | Bacteria | 8636 |
| 711 | Ga0496114_0012525 | 3300048917 | Bacteria | 6791 |
| 712 | Ga0496114_0020054 | 3300048917 | Bacteria | 5423 |
| 713 | Ga0496114_0370776 | 3300048917 | Bacteria | 1267 |
| 714 | Ga0496114_1173216 | 3300048917 | Bacteria | 654 |
| 715 | Ga0496115_0000825 | 3300048918 | Bacteria | 22720 |
| 716 | Ga0496115_0071682 | 3300048918 | Bacteria | 2810 |
| 717 | Ga0496115_0341877 | 3300048918 | Bacteria | 1221 |
| 718 | Ga0496115_0861047 | 3300048918 | Bacteria | 701 |
| 719 | Ga0496121_0835697 | 3300048924 | Bacteria | 537 |
| 720 | Ga0501031_0009418 | 3300049568 | Bacteria | 6346 |
| 721 | Ga0501031_0011087 | 3300049568 | Bacteria | 5875 |
| 722 | Ga0501031_0115168 | 3300049568 | Bacteria | 1756 |
| 723 | Ga0501031_0767091 | 3300049568 | Bacteria | 619 |
| 724 | Ga0501032_0076899 | 3300049569 | Bacteria | 2222 |
| 725 | Ga0501033_0114527 | 3300049570 | Bacteria | 1960 |
| 726 | Ga0501033_0518041 | 3300049570 | Bacteria | 824 |
| 727 | Ga0501033_0626506 | 3300049570 | Bacteria | 736 |
| 728 | Ga0501036_0056709 | 3300049572 | Bacteria | 3319 |
| 729 | Ga0501036_0173118 | 3300049572 | Bacteria | 1818 |
| 730 | Ga0501036_0282143 | 3300049572 | Bacteria | 1390 |
| 731 | Ga0501036_0759901 | 3300049572 | Bacteria | 799 |
| 732 | Ga0501036_1423778 | 3300049572 | Unclassified | 562 |
| 733 | Ga0501037_0224586 | 3300049573 | Bacteria | 1320 |
| 734 | Ga0501038_0192372 | 3300049574 | Bacteria | 1641 |
| 735 | Ga0501038_0371508 | 3300049574 | Bacteria | 1111 |
| 736 | Ga0501039_0004144 | 3300049575 | Bacteria | 10909 |
| 737 | Ga0501039_0039941 | 3300049575 | Bacteria | 3623 |
| 738 | Ga0501039_0351550 | 3300049575 | Bacteria | 1158 |
| 739 | Ga0501039_0678584 | 3300049575 | Bacteria | 806 |
| 740 | Ga0501040_0020185 | 3300049576 | Bacteria | 4439 |
| 741 | Ga0501040_0046535 | 3300049576 | Bacteria | 2961 |
| 742 | Ga0501040_0231730 | 3300049576 | Bacteria | 1315 |
| 743 | Ga0501041_0001903 | 3300049577 | Bacteria | 11701 |
| 744 | Ga0501042_0001051 | 3300049578 | Bacteria | 15754 |
| 745 | Ga0501042_0005040 | 3300049578 | Bacteria | 8467 |
| 746 | Ga0501042_0006441 | 3300049578 | Bacteria | 7619 |
| 747 | Ga0501042_0012515 | 3300049578 | Bacteria | 5750 |
| 748 | Ga0501042_0030354 | 3300049578 | Bacteria | 3816 |
| 749 | Ga0501043_0166228 | 3300049579 | Bacteria | 1723 |
| 750 | Ga0501043_0171356 | 3300049579 | Bacteria | 1693 |
| 751 | Ga0501043_0200743 | 3300049579 | Bacteria | 1548 |
| 752 | Ga0501043_0423402 | 3300049579 | Bacteria | 1003 |
| 753 | Ga0501046_0020910 | 3300049580 | Bacteria | 5404 |
| 754 | Ga0501046_0040516 | 3300049580 | Bacteria | 3721 |
| 755 | Ga0501046_1139531 | 3300049580 | Bacteria | 538 |
| 756 | Ga0501046_1211013 | 3300049580 | Bacteria | 518 |
| 757 | Ga0501048_0024758 | 3300049582 | Bacteria | 4378 |
| 758 | Ga0501048_0027540 | 3300049582 | Bacteria | 4129 |
| 759 | Ga0501048_0038723 | 3300049582 | Bacteria | 3421 |
| 760 | Ga0501048_0398232 | 3300049582 | Bacteria | 984 |
| 761 | Ga0501048_0565149 | 3300049582 | Bacteria | 816 |
| 762 | Ga0501067_0006236 | 3300049583 | Bacteria | 6612 |
| 763 | Ga0501068_0015242 | 3300049584 | Bacteria | 4410 |
| 764 | Ga0501068_0036329 | 3300049584 | Bacteria | 2945 |
| 765 | Ga0501068_0120314 | 3300049584 | Bacteria | 1637 |
| 766 | Ga0501068_0210561 | 3300049584 | Bacteria | 1234 |
| 767 | Ga0501068_0622562 | 3300049584 | Bacteria | 704 |
| 768 | Ga0501069_0102500 | 3300049585 | Bacteria | 1625 |
| 769 | Ga0501069_0701816 | 3300049585 | Bacteria | 610 |
| 770 | Ga0501070_0353778 | 3300049586 | Bacteria | 1192 |
| 771 | Ga0501071_0005719 | 3300049587 | Bacteria | 8020 |
| 772 | Ga0501071_0071460 | 3300049587 | Bacteria | 2530 |
| 773 | Ga0501071_0219109 | 3300049587 | Bacteria | 1432 |
| 774 | Ga0501071_0242359 | 3300049587 | Bacteria | 1359 |
| 775 | Ga0501071_0246051 | 3300049587 | Bacteria | 1349 |
| 776 | Ga0501071_0307130 | 3300049587 | Bacteria | 1203 |
| 777 | Ga0501071_0339917 | 3300049587 | Bacteria | 1141 |
| 778 | Ga0501071_1014750 | 3300049587 | Bacteria | 641 |
| 779 | Ga0501072_0039166 | 3300049588 | Bacteria | 3722 |
| 780 | Ga0501072_0045774 | 3300049588 | Bacteria | 3441 |
| 781 | Ga0501072_0047917 | 3300049588 | Bacteria | 3365 |
| 782 | Ga0501074_0027588 | 3300049590 | Bacteria | 4117 |
| 783 | Ga0501074_0048229 | 3300049590 | Bacteria | 3077 |
| 784 | Ga0501074_0073793 | 3300049590 | Bacteria | 2450 |
| 785 | Ga0501075_0000417 | 3300049591 | Bacteria | 24878 |
| 786 | Ga0501075_0005234 | 3300049591 | Bacteria | 8869 |
| 787 | Ga0501075_0031369 | 3300049591 | Bacteria | 3944 |
| 788 | Ga0501075_0038898 | 3300049591 | Bacteria | 3557 |
| 789 | Ga0501075_0298156 | 3300049591 | Bacteria | 1228 |
| 790 | Ga0501076_0007615 | 3300049592 | Bacteria | 7884 |
| 791 | Ga0501076_0012737 | 3300049592 | Bacteria | 6294 |
| 792 | Ga0501076_0091125 | 3300049592 | Bacteria | 2452 |
| 793 | Ga0501076_0217349 | 3300049592 | Bacteria | 1562 |
| 794 | Ga0501076_0294486 | 3300049592 | Bacteria | 1330 |
| 795 | Ga0501076_0317580 | 3300049592 | Bacteria | 1278 |
| 796 | Ga0501076_0431188 | 3300049592 | Bacteria | 1085 |
| 797 | Ga0501076_0687065 | 3300049592 | Bacteria | 845 |
| 798 | Ga0501077_0012943 | 3300049593 | Bacteria | 5226 |
| 799 | Ga0501077_0036344 | 3300049593 | Bacteria | 3137 |
| 800 | Ga0501077_0104277 | 3300049593 | Bacteria | 1797 |
| 801 | Ga0501077_0162591 | 3300049593 | Bacteria | 1418 |
| 802 | Ga0501077_0300754 | 3300049593 | Bacteria | 1022 |
| 803 | Ga0501208_160018 | 3300049655 | Bacteria | 513 |
| 804 | Ga0501079_0006300 | 3300049741 | Bacteria | 8897 |
| 805 | Ga0501079_0006761 | 3300049741 | Bacteria | 8625 |
| 806 | Ga0501079_0319335 | 3300049741 | Bacteria | 1216 |
| 807 | Ga0501079_0411613 | 3300049741 | Bacteria | 1061 |
| 808 | Ga0501079_0677892 | 3300049741 | Unclassified | 811 |
| 809 | Ga0501080_0057336 | 3300049742 | Bacteria | 3626 |
| 810 | Ga0501080_0091287 | 3300049742 | Bacteria | 2829 |
| 811 | Ga0501080_0123524 | 3300049742 | Bacteria | 2398 |
| 812 | Ga0501080_0260584 | 3300049742 | Bacteria | 1580 |
| 813 | Ga0501080_0808106 | 3300049742 | Bacteria | 822 |
| 814 | Ga0501081_0003476 | 3300049743 | Bacteria | 10064 |
| 815 | Ga0501081_0039204 | 3300049743 | Bacteria | 3241 |
| 816 | Ga0501081_0050396 | 3300049743 | Bacteria | 2868 |
| 817 | Ga0501081_0061639 | 3300049743 | Bacteria | 2601 |
| 818 | Ga0501081_0189163 | 3300049743 | Bacteria | 1490 |
| 819 | Ga0501083_0175986 | 3300049744 | Bacteria | 1398 |
| 820 | Ga0501083_0603097 | 3300049744 | Bacteria | 714 |
| 821 | Ga0501035_0108969 | 3300049822 | Bacteria | 2428 |
| 822 | Ga0501035_0199402 | 3300049822 | Bacteria | 1717 |
| 823 | Ga0501044_0227767 | 3300049823 | Bacteria | 1813 |
| 824 | Ga0501045_0000641 | 3300049824 | Bacteria | 22097 |
| 825 | Ga0501045_0014566 | 3300049824 | Bacteria | 5573 |
| 826 | Ga0501045_0040011 | 3300049824 | Bacteria | 3411 |
| 827 | Ga0501045_0183725 | 3300049824 | Bacteria | 1558 |
| 828 | Ga0501045_0230074 | 3300049824 | Bacteria | 1380 |
| 829 | Ga0501045_0243087 | 3300049824 | Bacteria | 1340 |
| 830 | Ga0501045_0424145 | 3300049824 | Bacteria | 989 |
| 831 | Ga0501045_1165259 | 3300049824 | Unclassified | 563 |
| 832 | nmdc:mga05p37_13440_c1 | 3300050507 | Bacteria | 9810 |
| 833 | nmdc:mga05p37_193701_c1 | 3300050507 | Bacteria | 2466 |
| 834 | nmdc:mga05p37_366031_c1 | 3300050507 | Bacteria | 1693 |
| 835 | nmdc:mga05p37_42536_c1 | 3300050507 | Bacteria | 5583 |
| 836 | nmdc:mga05p37_662919_c1 | 3300050507 | Bacteria | 1166 |
| 837 | nmdc:mga05p37_7656_c1 | 3300050507 | Bacteria | 12743 |
| 838 | nmdc:mga09592_1046281_c1 | 3300050508 | Unclassified | 680 |
| 839 | nmdc:mga09592_38915_c1 | 3300050508 | Bacteria | 3993 |
| 840 | nmdc:mga06r32_159138_c1 | 3300050510 | Bacteria | 2240 |
| 841 | nmdc:mga06r32_769532_c1 | 3300050510 | Bacteria | 925 |
| 842 | nmdc:mga08y16_131094_c1 | 3300050511 | Bacteria | 1070 |
| 843 | nmdc:mga08y16_166795_c1 | 3300050511 | Bacteria | 2288 |
| 844 | nmdc:mga08y16_293013_c1 | 3300050511 | Bacteria | 1678 |
| 845 | nmdc:mga08y16_664050_c1 | 3300050511 | Bacteria | 1045 |
| 846 | nmdc:mga0n895_1119_c1 | 3300050512 | Bacteria | 19568 |
| 847 | nmdc:mga0n895_113216_c1 | 3300050512 | Bacteria | 2730 |
| 848 | nmdc:mga0n895_16096_c1 | 3300050512 | Bacteria | 6854 |
| 849 | nmdc:mga0rr50_4220_c1 | 3300050513 | Bacteria | 6513 |
| 850 | nmdc:mga0rr50_516849_c1 | 3300050513 | Bacteria | 1016 |
| 851 | nmdc:mga0rr50_8094_c1 | 3300050513 | Bacteria | 6525 |
| 852 | nmdc:mga08x19_438674_c1 | 3300050514 | Bacteria | 918 |
| 853 | nmdc:mga08x19_59975_c1 | 3300050514 | Bacteria | 2464 |
| 854 | nmdc:mga08x19_699536_c1 | 3300050514 | Unclassified | 719 |
| 855 | nmdc:mga0a205_2266_c1 | 3300050515 | Bacteria | 16972 |
| 856 | nmdc:mga0a205_42350_c1 | 3300050515 | Bacteria | 4388 |
| 857 | Ga0495601_0272111 | 3300053077 | Bacteria | 1105 |
| 858 | Ga0495601_0351090 | 3300053077 | Bacteria | 959 |
| 859 | Ga0495619_0088783 | 3300053085 | Bacteria | 2091 |
| 860 | Ga0495619_0468502 | 3300053085 | Bacteria | 868 |
| 861 | Ga0501084_0003291 | 3300054114 | Bacteria | 13074 |
| 862 | Ga0501084_0007290 | 3300054114 | Bacteria | 9113 |
| 863 | Ga0501084_0078799 | 3300054114 | Bacteria | 2761 |
| 864 | Ga0501084_0191850 | 3300054114 | Bacteria | 1724 |
| 865 | Ga0501084_0230456 | 3300054114 | Bacteria | 1563 |
| 866 | Ga0501084_0932146 | 3300054114 | Bacteria | 730 |
| 867 | Ga0590071_048109 | 3300059421 | Bacteria | 1032 |
| 868 | Ga0590075_017006 | 3300059424 | Bacteria | 1790 |
| 869 | Ga0501082_0014301 | 3300060353 | Bacteria | 6831 |
| 870 | Ga0501082_0051983 | 3300060353 | Bacteria | 3531 |
| 871 | Ga0501082_0103270 | 3300060353 | Bacteria | 2465 |
| 872 | Ga0501082_0106168 | 3300060353 | Bacteria | 2430 |
| 873 | Ga0501082_0255075 | 3300060353 | Bacteria | 1526 |
| 874 | Ga0501082_0389839 | 3300060353 | Bacteria | 1215 |
| 875 | Ga0501082_0417339 | 3300060353 | Bacteria | 1172 |
| 876 | Ga0530510_0010056 | 3300061734 | Bacteria | 6636 |
| 877 | Ga0530510_0011529 | 3300061734 | Bacteria | 6203 |
| 878 | Ga0530510_0012239 | 3300061734 | Bacteria | 6021 |
| 879 | Ga0530510_0049750 | 3300061734 | Bacteria | 3027 |
| 880 | Ga0530510_0107487 | 3300061734 | Bacteria | 2042 |
| 881 | Ga0530510_0272436 | 3300061734 | Bacteria | 1263 |
| 882 | Ga0530510_0363853 | 3300061734 | Bacteria | 1087 |
| 883 | Ga0070694_100452401 | |||
| 884 | JGI24744J21845_10001169 | |||
| 885 | JGI24742J22300_10084959 | |||
| 886 | Ga0070658_10058131 | |||
| 887 | Ga0070683_100569378 | |||
| 888 | Ga0070690_100031769 | |||
| 889 | Ga0068869_100050871 | |||
| 890 | Ga0070666_10175133 | |||
| 891 | Ga0070680_100071045 | |||
| 892 | Ga0070680_100854429 | |||
| 893 | Ga0070682_100001046 | |||
| 894 | Ga0068868_100058497 | |||
| 895 | Ga0070689_100287309 | |||
| 896 | Ga0070691_10090809 | |||
| 897 | Ga0070691_10159504 | |||
| 898 | Ga0070691_10570362 | |||
| 899 | Ga0070687_100500620 | |||
| 900 | Ga0070687_100677160 | |||
| 901 | Ga0070692_10002003 | |||
| 902 | Ga0070668_100012259 | |||
| 903 | Ga0070668_100034924 | |||
| 904 | Ga0070675_100202397 | |||
| 905 | Ga0070675_100605871 | |||
| 906 | Ga0070671_100072789 | |||
| 907 | Ga0070671_100512946 | |||
| 908 | Ga0070674_100024562 | |||
| 909 | Ga0070674_100181585 | |||
| 910 | Ga0070674_100359338 | |||
| 911 | Ga0070674_100363118 | |||
| 912 | Ga0070673_100803033 | |||
| 913 | Ga0070673_101220581 | |||
| 914 | Ga0070688_100201718 | |||
| 915 | Ga0070688_101299645 | |||
| 916 | Ga0070659_100136339 | |||
| 917 | Ga0070659_100790410 | |||
| 918 | Ga0070659_100930750 | |||
| 919 | Ga0070667_100046836 | |||
| 920 | Ga0070667_100499480 | |||
| 921 | Ga0070709_10048366 | |||
| 922 | Ga0070709_10298707 | |||
| 923 | Ga0070714_100094702 | |||
| 924 | Ga0070713_100002608 | |||
| 925 | Ga0070713_100345956 | |||
| 926 | Ga0070713_100524987 | |||
| 927 | Ga0070710_10129351 | |||
| 928 | Ga0070710_10808570 | |||
| 929 | Ga0070701_10019274 | |||
| 930 | Ga0070711_100005726 | |||
| 931 | Ga0070711_100382950 | |||
| 932 | Ga0070711_101034839 | |||
| 933 | Ga0070705_101210946 | |||
| 934 | Ga0070700_100005993 | |||
| 935 | Ga0070700_100837370 | |||
| 936 | Ga0070700_100853401 | |||
| 937 | Ga0070700_100946160 | |||
| 938 | Ga0070694_100377541 | |||
| 939 | Ga0070708_100773722 | |||
| 940 | Ga0070663_100533528 | |||
| 941 | Ga0070678_100067067 | |||
| 942 | Ga0070678_100216248 | |||
| 943 | Ga0070678_100862099 | |||
| 944 | Ga0070662_100002641 | |||
| 945 | Ga0070662_100540940 | |||
| 946 | Ga0070681_11444782 | |||
| 947 | Ga0068867_100000290 | |||
| 948 | Ga0068867_100123672 | |||
| 949 | Ga0070685_10375194 | |||
| 950 | Ga0070685_10587107 | |||
| 951 | Ga0070706_100087854 | |||
| 952 | Ga0070706_100101363 | |||
| 953 | Ga0070706_100203140 | |||
| 954 | Ga0070706_100218127 | |||
| 955 | Ga0070706_101077316 | |||
| 956 | Ga0070707_100001362 | |||
| 957 | Ga0070707_100033547 | |||
| 958 | Ga0070698_100008838 | |||
| 959 | Ga0070698_100220818 | |||
| 960 | Ga0070698_100253971 | |||
| 961 | Ga0070698_100617921 | |||
| 962 | Ga0070698_101239288 | |||
| 963 | Ga0070698_101971946 | |||
| 964 | Ga0070699_100008741 | |||
| 965 | Ga0070699_101596644 | |||
| 966 | Ga0070679_101358163 | |||
| 967 | Ga0070679_101788134 | |||
| 968 | Ga0070684_100069573 | |||
| 969 | Ga0070684_100745322 | |||
| 970 | Ga0070684_100860323 | |||
| 971 | Ga0070684_100999743 | |||
| 972 | Ga0070684_102049697 | |||
| 973 | Ga0070697_100894348 | |||
| 974 | Ga0070697_101465776 | |||
| 975 | Ga0070672_100143591 | |||
| 976 | Ga0070672_100332673 | |||
| 977 | Ga0070672_100677723 | |||
| 978 | Ga0070686_100009901 | |||
| 979 | Ga0070686_100235823 | |||
| 980 | Ga0070695_100054146 | |||
| 981 | Ga0070695_100076816 | |||
| 982 | Ga0070695_100652978 | |||
| 983 | Ga0070696_100483196 | |||
| 984 | Ga0070696_101003362 | |||
| 985 | Ga0070693_100419747 | |||
| 986 | Ga0070665_100394905 | |||
| 987 | Ga0070704_100162689 | |||
| 988 | Ga0070704_100244948 | |||
| 989 | Ga0070704_100294518 | |||
| 990 | Ga0068855_100073422 | |||
| 991 | Ga0070664_100457987 | |||
| 992 | Ga0070664_101113451 | |||
| 993 | Ga0068857_100002943 | |||
| 994 | Ga0068857_100125918 | |||
| 995 | Ga0068854_101195780 | |||
| 996 | Ga0068854_101295586 | |||
| 997 | Ga0068856_100002162 | |||
| 998 | Ga0068856_100575270 | |||
| 999 | Ga0068856_100904107 | |||
| 1000 | Ga0068856_101270323 | |||
| 1001 | Ga0070702_100018760 | |||
| 1002 | Ga0070702_101343143 | |||
| 1003 | Ga0068852_100461231 | |||
| 1004 | Ga0068864_100868382 | |||
| 1005 | Ga0068864_100889562 | |||
| 1006 | Ga0068864_101093505 | |||
| 1007 | Ga0068866_10000154 | |||
| 1008 | Ga0068866_10072391 | |||
| 1009 | Ga0068861_100001783 | |||
| 1010 | Ga0068861_100137079 | |||
| 1011 | Ga0068861_101020390 | |||
| 1012 | Ga0068851_10960056 | |||
| 1013 | Ga0068858_100306160 | |||
| 1014 | Ga0068858_100486134 | |||
| 1015 | Ga0068858_101049780 | |||
| 1016 | Ga0068860_100065963 | |||
| 1017 | Ga0068860_100812165 | |||
| 1018 | Ga0068862_100178671 | |||
| 1019 | Ga0068862_101069525 | |||
| 1020 | Ga0081455_10059969 | |||
| 1021 | Ga0081455_10096923 | |||
| 1022 | Ga0081538_10020315 | |||
| 1023 | Ga0081538_10031392 | |||
| 1024 | Ga0081538_10034449 | |||
| 1025 | Ga0081538_10070154 | |||
| 1026 | Ga0081539_10000397 | |||
| 1027 | Ga0081539_10002620 | |||
| 1028 | Ga0081539_10028254 | |||
| 1029 | Ga0081539_10202314 | |||
| 1030 | Ga0070717_10014641 | |||
| 1031 | Ga0070717_10567166 | |||
| 1032 | Ga0070717_10712779 | |||
| 1033 | Ga0075432_10026251 | |||
| 1034 | Ga0070715_10197078 | |||
| 1035 | Ga0070715_10375126 | |||
| 1036 | Ga0070716_100046618 | |||
| 1037 | Ga0070716_100219372 | |||
| 1038 | Ga0070716_100952342 | |||
| 1039 | Ga0070712_100316251 | |||
| 1040 | Ga0070712_100729723 | |||
| 1041 | Ga0070712_101197639 | |||
| 1042 | Ga0070712_101521670 | |||
| 1043 | Ga0075367_10017297 | |||
| 1044 | Ga0097621_100396606 | |||
| 1045 | Ga0097621_101085331 | |||
| 1046 | Ga0075428_100001324 | |||
| 1047 | Ga0075428_100008062 | |||
| 1048 | Ga0075428_100083469 | |||
| 1049 | Ga0075428_100417806 | |||
| 1050 | Ga0075428_101130303 | |||
| 1051 | Ga0075428_101824861 | |||
| 1052 | Ga0075430_100045380 | |||
| 1053 | Ga0075430_100137242 | |||
| 1054 | Ga0075431_100120826 | |||
| 1055 | Ga0075431_100798585 | |||
| 1056 | Ga0075431_100841653 | |||
| 1057 | Ga0075433_10000356 | |||
| 1058 | Ga0075433_10000542 | |||
| 1059 | Ga0075434_100000720 | |||
| 1060 | Ga0075434_100045583 | |||
| 1061 | Ga0075434_101162702 | |||
| 1062 | Ga0075429_100069824 | |||
| 1063 | Ga0075429_100184757 | |||
| 1064 | Ga0075429_100370988 | |||
| 1065 | Ga0068865_100022070 | |||
| 1066 | Ga0075436_100071815 | |||
| 1067 | Ga0075435_100009468 | |||
| 1068 | Ga0075435_100082891 | |||
| 1069 | Ga0075435_100551722 | |||
| 1070 | Ga0111539_10014838 | |||
| 1071 | Ga0111539_10048781 | |||
| 1072 | Ga0111539_11114693 | |||
| 1073 | Ga0111539_11118107 | |||
| 1074 | Ga0111539_11889615 | |||
| 1075 | Ga0105245_10013922 | |||
| 1076 | Ga0105245_10206647 | |||
| 1077 | Ga0105245_10253651 | |||
| 1078 | Ga0105245_10382387 | |||
| 1079 | Ga0105245_10902183 | |||
| 1080 | Ga0105245_11081667 | |||
| 1081 | Ga0105247_10112585 | |||
| 1082 | Ga0114129_10005223 | |||
| 1083 | Ga0114129_10010248 | |||
| 1084 | Ga0114129_10031268 | |||
| 1085 | Ga0114129_10124310 | |||
| 1086 | Ga0114129_10211121 | |||
| 1087 | Ga0114129_10506460 | |||
| 1088 | Ga0114129_10547632 | |||
| 1089 | Ga0114129_10868343 | |||
| 1090 | Ga0114129_11062286 | |||
| 1091 | Ga0114129_11740373 | |||
| 1092 | Ga0105243_10001079 | |||
| 1093 | Ga0105243_10531728 | |||
| 1094 | Ga0105243_11048200 | |||
| 1095 | Ga0105241_10082186 | |||
| 1096 | Ga0105242_10228307 | |||
| 1097 | Ga0105242_10542404 | |||
| 1098 | Ga0105242_10554889 | |||
| 1099 | Ga0105242_10579868 | |||
| 1100 | Ga0105248_10022344 | |||
| 1101 | Ga0105248_10046659 | |||
| 1102 | Ga0105248_10088431 | |||
| 1103 | Ga0105237_10489697 | |||
| 1104 | Ga0105237_10539633 | |||
| 1105 | Ga0105238_10402643 | |||
| 1106 | Ga0105238_10826399 | |||
| 1107 | Ga0105249_10001703 | |||
| 1108 | Ga0105249_10004222 | |||
| 1109 | Ga0105249_10272228 | |||
| 1110 | Ga0105239_10001224 | |||
| 1111 | Ga0105239_10125740 | |||
| 1112 | Ga0105239_10297845 | |||
| 1113 | Ga0105239_10319303 | |||
| 1114 | Ga0105239_10331948 | |||
| 1115 | Ga0105239_11492029 | |||
| 1116 | Ga0105246_10236035 | |||
| 1117 | Ga0105246_10248227 | |||
| 1118 | Ga0105246_11288065 | |||
| 1119 | Ga0157374_10001561 | |||
| 1120 | Ga0157374_10148299 | |||
| 1121 | Ga0157374_10221004 | |||
| 1122 | Ga0157374_10952169 | |||
| 1123 | Ga0157378_10058383 | |||
| 1124 | Ga0157378_11285259 | |||
| 1125 | Ga0163162_10030158 | |||
| 1126 | Ga0163162_10038088 | |||
| 1127 | Ga0163162_11000464 | |||
| 1128 | Ga0157375_10101153 | |||
| 1129 | Ga0157375_10152574 | |||
| 1130 | Ga0157375_10795756 | |||
| 1131 | Ga0157380_10756534 | |||
| 1132 | Ga0157380_10889099 | |||
| 1133 | Ga0157380_11038071 | |||
| 1134 | Ga0157377_10026003 | |||
| 1135 | Ga0157377_10139034 | |||
| 1136 | Ga0157377_10432024 | |||
| 1137 | Ga0157377_10455493 | |||
| 1138 | Ga0157379_10725708 | |||
| 1139 | Ga0157376_10001860 | |||
| 1140 | Ga0157376_10495619 | |||
| 1141 | Ga0163161_11129526 | |||
| 1142 | Ga0206356_11460515 | |||
| 1143 | Ga0206350_11629545 | |||
| 1144 | Ga0207692_10153677 | |||
| 1145 | Ga0207642_10521606 | |||
| 1146 | Ga0207688_10143335 | |||
| 1147 | Ga0207688_10393723 | |||
| 1148 | Ga0207685_10023542 | |||
| 1149 | Ga0207699_10044876 | |||
| 1150 | Ga0207645_10287216 | |||
| 1151 | Ga0207643_10068435 | |||
| 1152 | Ga0207684_10080784 | |||
| 1153 | Ga0207684_10203672 | |||
| 1154 | Ga0207684_11035769 | |||
| 1155 | Ga0207654_10295011 | |||
| 1156 | Ga0207707_10700090 | |||
| 1157 | Ga0207693_10000499 | |||
| 1158 | Ga0207693_10098918 | |||
| 1159 | Ga0207693_10494436 | |||
| 1160 | Ga0207663_10373938 | |||
| 1161 | Ga0207663_10563945 | |||
| 1162 | Ga0207660_10009541 | |||
| 1163 | Ga0207662_10023652 | |||
| 1164 | Ga0207662_10169147 | |||
| 1165 | Ga0207662_10759592 | |||
| 1166 | Ga0207657_10120254 | |||
| 1167 | Ga0207657_10419425 | |||
| 1168 | Ga0207649_10915149 | |||
| 1169 | Ga0207652_10399526 | |||
| 1170 | Ga0207652_11488045 | |||
| 1171 | Ga0207646_10001072 | |||
| 1172 | Ga0207646_10027364 | |||
| 1173 | Ga0207694_10369284 | |||
| 1174 | Ga0207659_10275556 | |||
| 1175 | Ga0207659_10284400 | |||
| 1176 | Ga0207659_10885338 | |||
| 1177 | Ga0207687_10006813 | |||
| 1178 | Ga0207687_10017022 | |||
| 1179 | Ga0207687_10211398 | |||
| 1180 | Ga0207687_10295114 | |||
| 1181 | Ga0207687_10513194 | |||
| 1182 | Ga0207687_10514204 | |||
| 1183 | Ga0207700_10000001 | |||
| 1184 | Ga0207664_10172970 | |||
| 1185 | Ga0207664_10204532 | |||
| 1186 | Ga0207690_10176212 | |||
| 1187 | Ga0207690_10206542 | |||
| 1188 | Ga0207690_10837944 | |||
| 1189 | Ga0207706_10621447 | |||
| 1190 | Ga0207686_10000672 | |||
| 1191 | Ga0207686_10227251 | |||
| 1192 | Ga0207686_10422472 | |||
| 1193 | Ga0207709_10000781 | |||
| 1194 | Ga0207709_10040500 | |||
| 1195 | Ga0207709_10547931 | |||
| 1196 | Ga0207709_11204638 | |||
| 1197 | Ga0207670_11125750 | |||
| 1198 | Ga0207669_10032949 | |||
| 1199 | Ga0207669_10484736 | |||
| 1200 | Ga0207669_11003620 | |||
| 1201 | Ga0207669_11409524 | |||
| 1202 | Ga0207704_10001419 | |||
| 1203 | Ga0207704_10276825 | |||
| 1204 | Ga0207665_10143886 | |||
| 1205 | Ga0207665_10536848 | |||
| 1206 | Ga0207665_10823486 | |||
| 1207 | Ga0207691_10134120 | |||
| 1208 | Ga0207691_10143645 | |||
| 1209 | Ga0207691_10475537 | |||
| 1210 | Ga0207711_11074070 | |||
| 1211 | Ga0207661_10497390 | |||
| 1212 | Ga0207661_10524948 | |||
| 1213 | Ga0207661_11499098 | |||
| 1214 | Ga0207679_10772938 | |||
| 1215 | Ga0207667_10054593 | |||
| 1216 | Ga0207651_10481858 | |||
| 1217 | Ga0207651_12079615 | |||
| 1218 | Ga0207712_10007048 | |||
| 1219 | Ga0207712_10134333 | |||
| 1220 | Ga0207712_10155390 | |||
| 1221 | Ga0207668_10027466 | |||
| 1222 | Ga0207668_10212937 | |||
| 1223 | Ga0207640_10294431 | |||
| 1224 | Ga0207658_10012020 | |||
| 1225 | Ga0207658_11371830 | |||
| 1226 | Ga0207677_10370358 | |||
| 1227 | Ga0207703_10206384 | |||
| 1228 | Ga0207639_10567265 | |||
| 1229 | Ga0207639_11643715 | |||
| 1230 | Ga0207678_10215470 | |||
| 1231 | Ga0207708_10000434 | |||
| 1232 | Ga0207708_10385805 | |||
| 1233 | Ga0207708_10566968 | |||
| 1234 | Ga0207708_10712953 | |||
| 1235 | Ga0207708_10878221 | |||
| 1236 | Ga0207702_10020710 | |||
| 1237 | Ga0207702_10184461 | |||
| 1238 | Ga0207648_10015109 | |||
| 1239 | Ga0207648_10080125 | |||
| 1240 | Ga0207648_10232035 | |||
| 1241 | Ga0207676_10260379 | |||
| 1242 | Ga0207676_10441944 | |||
| 1243 | Ga0207674_10008735 | |||
| 1244 | Ga0207674_10090219 | |||
| 1245 | Ga0207674_11880173 | |||
| 1246 | Ga0207675_100022938 | |||
| 1247 | Ga0207675_100079099 | |||
| 1248 | Ga0207675_100079403 | |||
| 1249 | Ga0207683_10006588 | |||
| 1250 | Ga0207683_10302178 | |||
| 1251 | Ga0207698_10043854 | |||
| 1252 | Ga0207428_10042636 | |||
| 1253 | Ga0207428_10287647 | |||
| 1254 | Ga0268266_10212127 | |||
| 1255 | Ga0268264_10243069 | |||
| 1256 | Ga0268264_10821288 | |||
| 1257 | Ga0265319_1002809 | |||
| 1258 | Ga0265318_10005078 | |||
| 1259 | Ga0265322_10008197 | |||
| 1260 | Ga0265338_10028546 | |||
| 1261 | Ga0265324_10158984 | |||
| 1262 | Ga0265330_10013638 | |||
| 1263 | Ga0265332_10052464 | |||
| 1264 | Ga0265320_10012238 | |||
| 1265 | Ga0265340_10013801 | |||
| 1266 | Ga0265339_10042433 | |||
| 1267 | Ga0265327_10099616 | |||
| 1268 | Ga0265316_10031600 | |||
| 1269 | Ga0307408_100381213 | |||
| 1270 | Ga0307408_101011790 | |||
| 1271 | Ga0265342_10009711 | |||
| 1272 | Ga0307405_10024196 | |||
| 1273 | Ga0307405_10046658 | |||
| 1274 | Ga0307405_10387117 | |||
| 1275 | Ga0307413_10066967 | |||
| 1276 | Ga0307413_10607809 | |||
| 1277 | Ga0307410_10368565 | |||
| 1278 | Ga0307410_10491496 | |||
| 1279 | Ga0307406_10023139 | |||
| 1280 | Ga0307406_10050675 | |||
| 1281 | Ga0307406_10193560 | |||
| 1282 | Ga0307407_10017709 | |||
| 1283 | Ga0307412_10144709 | |||
| 1284 | Ga0307412_10611604 | |||
| 1285 | Ga0307412_11613105 | |||
| 1286 | Ga0307409_100090234 | |||
| 1287 | Ga0307409_100250650 | |||
| 1288 | Ga0307409_100259291 | |||
| 1289 | Ga0307409_100369474 | |||
| 1290 | Ga0307409_100604985 | |||
| 1291 | Ga0307409_100881573 | |||
| 1292 | Ga0307409_100912144 | |||
| 1293 | Ga0307416_100000711 | |||
| 1294 | Ga0307416_100015982 | |||
| 1295 | Ga0307416_100018953 | |||
| 1296 | Ga0307416_100120113 | |||
| 1297 | Ga0307416_102722201 | |||
| 1298 | Ga0307416_102836058 | |||
| 1299 | Ga0307414_11138288 | |||
| 1300 | Ga0307411_10091495 | |||
| 1301 | Ga0307415_100000296 | |||
| 1302 | Ga0307415_100010159 | |||
| 1303 | Ga0307415_100022248 | |||
| 1304 | Ga0307415_100098445 | |||
| 1305 | Ga0373952_0021088 | |||
| 1306 | Ga0373932_0099146 | |||
| 1307 | Ga0373962_0210038 | |||
| 1308 | Ga0373931_0333610 | |||
| 1309 | Ga0373935_0481749 | |||
| 1310 | Ga0373925_0109457 | |||
| 1311 | Ga0395899_0007215 | |||
| 1312 | Ga0395899_0007885 | |||
| 1313 | Ga0395899_0019593 | |||
| 1314 | Ga0395899_0027088 | |||
| 1315 | Ga0395899_0092061 | |||
| 1316 | Ga0395899_0159922 | |||
| 1317 | Ga0395899_0198119 | |||
| 1318 | Ga0395899_0198945 | |||
| 1319 | Ga0395899_0267711 | |||
| 1320 | Ga0395899_0415290 | |||
| 1321 | Ga0395899_0521558 | |||
| 1322 | Ga0395900_0000528 | |||
| 1323 | Ga0395900_0006608 | |||
| 1324 | Ga0395900_0040788 | |||
| 1325 | Ga0395900_0043397 | |||
| 1326 | Ga0395900_0054193 | |||
| 1327 | Ga0395900_0055681 | |||
| 1328 | Ga0395900_0072257 | |||
| 1329 | Ga0395900_0102187 | |||
| 1330 | Ga0395900_0108819 | |||
| 1331 | Ga0395900_0173743 | |||
| 1332 | Ga0395900_0180272 | |||
| 1333 | Ga0395900_0322053 | |||
| 1334 | Ga0395900_0344085 | |||
| 1335 | Ga0395900_0361124 | |||
| 1336 | Ga0395900_0442780 | |||
| 1337 | Ga0395900_0534864 | |||
| 1338 | Ga0395900_0577665 | |||
| 1339 | Ga0395900_0743353 | |||
| 1340 | Ga0395900_1189620 | |||
| 1341 | Ga0395900_1189870 | |||
| 1342 | Ga0395900_1408700 | |||
| 1343 | Ga0395898_0002139 | |||
| 1344 | Ga0395898_0012709 | |||
| 1345 | Ga0395898_0017551 | |||
| 1346 | Ga0395898_0020569 | |||
| 1347 | Ga0395898_0023768 | |||
| 1348 | Ga0395898_0033384 | |||
| 1349 | Ga0395898_0039856 | |||
| 1350 | Ga0395898_0067339 | |||
| 1351 | Ga0395898_0075798 | |||
| 1352 | Ga0395898_0086288 | |||
| 1353 | Ga0395898_0115094 | |||
| 1354 | Ga0395898_0158210 | |||
| 1355 | Ga0395898_0282451 | |||
| 1356 | Ga0395898_0344086 | |||
| 1357 | Ga0395898_0449326 | |||
| 1358 | Ga0395898_0768527 | |||
| 1359 | Ga0395898_0840238 | |||
| 1360 | Ga0395905_0000661 | |||
| 1361 | Ga0395905_0005716 | |||
| 1362 | Ga0395905_0009617 | |||
| 1363 | Ga0395905_0018357 | |||
| 1364 | Ga0395905_0031768 | |||
| 1365 | Ga0395905_0042861 | |||
| 1366 | Ga0395905_0079115 | |||
| 1367 | Ga0395905_0123399 | |||
| 1368 | Ga0395905_0141328 | |||
| 1369 | Ga0395905_0348794 | |||
| 1370 | Ga0395905_0366276 | |||
| 1371 | Ga0395905_0498040 | |||
| 1372 | Ga0395905_0511870 | |||
| 1373 | Ga0395905_0772131 | |||
| 1374 | Ga0395905_0886791 | |||
| 1375 | Ga0395905_1401165 | |||
| 1376 | Ga0395905_1589282 | |||
| 1377 | Ga0395901_0001057 | |||
| 1378 | Ga0395901_0003646 | |||
| 1379 | Ga0395901_0010037 | |||
| 1380 | Ga0395901_0010426 | |||
| 1381 | Ga0395901_0027883 | |||
| 1382 | Ga0395901_0048101 | |||
| 1383 | Ga0395901_0051842 | |||
| 1384 | Ga0395901_0069596 | |||
| 1385 | Ga0395901_0077799 | |||
| 1386 | Ga0395901_0091435 | |||
| 1387 | Ga0395901_0119598 | |||
| 1388 | Ga0395901_0151003 | |||
| 1389 | Ga0395901_0228306 | |||
| 1390 | Ga0395901_0253972 | |||
| 1391 | Ga0395901_0265813 | |||
| 1392 | Ga0395901_0406581 | |||
| 1393 | Ga0395901_0561778 | |||
| 1394 | Ga0395901_0636154 | |||
| 1395 | Ga0395901_0775643 | |||
| 1396 | Ga0395901_1238691 | |||
| 1397 | Ga0395901_1499770 | |||
| 1398 | Ga0439438_009923 | |||
| 1399 | Ga0439447_012220 | |||
| 1400 | Ga0439453_0015199 | |||
| 1401 | Ga0439461_0002991 | |||
| 1402 | Ga0439466_0016371 | |||
| 1403 | Ga0439466_0095676 | |||
| 1404 | Ga0451851_0629674 | |||
| 1405 | Ga0439441_050794 | |||
| 1406 | Ga0439448_0273065 | |||
| 1407 | Ga0439450_104434 | |||
| 1408 | Ga0439450_189859 | |||
| 1409 | Ga0439451_007930 | |||
| 1410 | Ga0439454_002693 | |||
| 1411 | Ga0450920_025816 | |||
| 1412 | Ga0450907_057246 | |||
| 1413 | Ga0439446_0175855 | |||
| 1414 | Ga0439446_0248797 | |||
| 1415 | Ga0450908_036736 | |||
| 1416 | Ga0450908_068669 | |||
| 1417 | Ga0439434_0002257 | |||
| 1418 | Ga0439435_0117045 | |||
| 1419 | Ga0439464_0062743 | |||
| 1420 | Ga0450918_020396 | |||
| 1421 | Ga0466964_0509354 | |||
| 1422 | Ga0466959_0136514 | |||
| 1423 | Ga0451576_0094753 | |||
| 1424 | Ga0466967_0037672 | |||
| 1425 | Ga0466967_0886640 | |||
| 1426 | Ga0495617_108492 | |||
| 1427 | Ga0495592_0348556 | |||
| 1428 | Ga0495603_0196635 | |||
| 1429 | Ga0495629_0276818 | |||
| 1430 | Ga0495629_0654585 | |||
| 1431 | Ga0495641_0075368 | |||
| 1432 | Ga0495641_0228901 | |||
| 1433 | Ga0495641_0469964 | |||
| 1434 | Ga0495580_0290624 | |||
| 1435 | Ga0495605_0031922 | |||
| 1436 | Ga0495584_0021737 | |||
| 1437 | Ga0495584_0141662 | |||
| 1438 | Ga0495584_0291524 | |||
| 1439 | Ga0495584_0299467 | |||
| 1440 | Ga0495585_0190406 | |||
| 1441 | Ga0495594_0084953 | |||
| 1442 | Ga0495596_0182289 | |||
| 1443 | Ga0495596_0212563 | |||
| 1444 | Ga0495607_0022098 | |||
| 1445 | Ga0495607_0149141 | |||
| 1446 | Ga0495618_0122205 | |||
| 1447 | Ga0495618_0369289 | |||
| 1448 | Ga0495628_0626390 | |||
| 1449 | Ga0495630_1092020 | |||
| 1450 | Ga0495631_0076423 | |||
| 1451 | Ga0495632_0279859 | |||
| 1452 | Ga0495637_0072469 | |||
| 1453 | Ga0495637_0091439 | |||
| 1454 | Ga0495644_0160770 | |||
| 1455 | Ga0495644_0289793 | |||
| 1456 | Ga0495663_0008460 | |||
| 1457 | Ga0495663_0075881 | |||
| 1458 | Ga0495663_0208677 | |||
| 1459 | Ga0495666_0067277 | |||
| 1460 | Ga0495642_0042323 | |||
| 1461 | Ga0495642_0107583 | |||
| 1462 | Ga0495642_0277280 | |||
| 1463 | Ga0495642_0330969 | |||
| 1464 | Ga0495665_0092511 | |||
| 1465 | Ga0495640_0203225 | |||
| 1466 | Ga0495598_0005842 | |||
| 1467 | Ga0495598_0360113 | |||
| 1468 | Ga0495609_0042648 | |||
| 1469 | Ga0495609_0102527 | |||
| 1470 | Ga0495609_0236774 | |||
| 1471 | Ga0495597_0077576 | |||
| 1472 | Ga0495622_0310036 | |||
| 1473 | Ga0495633_0090439 | |||
| 1474 | Ga0495633_0529944 | |||
| 1475 | Ga0495667_0449538 | |||
| 1476 | Ga0495656_0003173 | |||
| 1477 | Ga0495656_0121388 | |||
| 1478 | Ga0495656_0135081 | |||
| 1479 | Ga0495656_0360918 | |||
| 1480 | Ga0495668_0046983 | |||
| 1481 | Ga0495634_0086870 | |||
| 1482 | Ga0495611_0181751 | |||
| 1483 | Ga0495611_0312242 | |||
| 1484 | Ga0495635_0346661 | |||
| 1485 | Ga0495635_0469933 | |||
| 1486 | Ga0495635_0512927 | |||
| 1487 | Ga0495659_0021997 | |||
| 1488 | Ga0495659_0023062 | |||
| 1489 | Ga0495659_0149273 | |||
| 1490 | Ga0495659_0203536 | |||
| 1491 | Ga0495661_0033110 | |||
| 1492 | Ga0495588_0046383 | |||
| 1493 | Ga0495588_0702528 | |||
| 1494 | Ga0495657_0686664 | |||
| 1495 | Ga0495647_0121759 | |||
| 1496 | Ga0495647_0140307 | |||
| 1497 | Ga0495658_0202870 | |||
| 1498 | Ga0495658_0281875 | |||
| 1499 | Ga0495669_0062801 | |||
| 1500 | Ga0495624_0035274 | |||
| 1501 | Ga0495670_0021716 | |||
| 1502 | Ga0495670_0046037 | |||
| 1503 | Ga0495670_0104931 | |||
| 1504 | Ga0495589_0043884 | |||
| 1505 | Ga0495589_0201273 | |||
| 1506 | Ga0495581_0004869 | |||
| 1507 | Ga0495581_0021948 | |||
| 1508 | Ga0495581_0204859 | |||
| 1509 | Ga0495636_0043928 | |||
| 1510 | Ga0495674_0071600 | |||
| 1511 | Ga0495676_0004151 | |||
| 1512 | Ga0495680_0081152 | |||
| 1513 | Ga0495683_0035790 | |||
| 1514 | Ga0495675_0607961 | |||
| 1515 | Ga0495679_067463 | |||
| 1516 | Ga0495685_056886 | |||
| 1517 | Ga0495593_0492423 | |||
| 1518 | Ga0495626_0341947 | |||
| 1519 | Ga0496100_0288154 | |||
| 1520 | Ga0496100_0421881 | |||
| 1521 | Ga0496100_0572590 | |||
| 1522 | Ga0496101_0005772 | |||
| 1523 | Ga0496101_0128409 | |||
| 1524 | Ga0496101_0141502 | |||
| 1525 | Ga0496101_0141761 | |||
| 1526 | Ga0496102_0001550 | |||
| 1527 | Ga0496102_0076483 | |||
| 1528 | Ga0496102_0114636 | |||
| 1529 | Ga0496102_0270115 | |||
| 1530 | Ga0496103_0000709 | |||
| 1531 | Ga0496103_0024392 | |||
| 1532 | Ga0496103_0041314 | |||
| 1533 | Ga0496103_0189100 | |||
| 1534 | Ga0496104_0000803 | |||
| 1535 | Ga0496104_0011491 | |||
| 1536 | Ga0496104_0067409 | |||
| 1537 | Ga0496104_0134388 | |||
| 1538 | Ga0496104_0357110 | |||
| 1539 | Ga0496104_0901404 | |||
| 1540 | Ga0496105_0001672 | |||
| 1541 | Ga0496105_0010159 | |||
| 1542 | Ga0496105_0020745 | |||
| 1543 | Ga0496105_0172392 | |||
| 1544 | Ga0496105_0315132 | |||
| 1545 | Ga0496106_0010527 | |||
| 1546 | Ga0496106_0072159 | |||
| 1547 | Ga0496106_0341472 | |||
| 1548 | Ga0496106_0430180 | |||
| 1549 | Ga0496107_0002375 | |||
| 1550 | Ga0496107_0354901 | |||
| 1551 | Ga0496107_0659010 | |||
| 1552 | Ga0496108_0008456 | |||
| 1553 | Ga0496108_0037234 | |||
| 1554 | Ga0496108_0107151 | |||
| 1555 | Ga0496108_0248562 | |||
| 1556 | Ga0496108_0910950 | |||
| 1557 | Ga0496108_0936846 | |||
| 1558 | Ga0496109_0000662 | |||
| 1559 | Ga0496109_0003962 | |||
| 1560 | Ga0496109_0007085 | |||
| 1561 | Ga0496109_0018429 | |||
| 1562 | Ga0496109_0025576 | |||
| 1563 | Ga0496109_0187327 | |||
| 1564 | Ga0496109_0995315 | |||
| 1565 | Ga0496110_0000069 | |||
| 1566 | Ga0496110_0002879 | |||
| 1567 | Ga0496110_0003806 | |||
| 1568 | Ga0496110_0004602 | |||
| 1569 | Ga0496110_0014207 | |||
| 1570 | Ga0496110_0058040 | |||
| 1571 | Ga0496110_0555905 | |||
| 1572 | Ga0496110_0561886 | |||
| 1573 | Ga0496110_0704411 | |||
| 1574 | Ga0496111_0001356 | |||
| 1575 | Ga0496111_0001848 | |||
| 1576 | Ga0496111_0005616 | |||
| 1577 | Ga0496111_0009977 | |||
| 1578 | Ga0496111_0010981 | |||
| 1579 | Ga0496111_0056769 | |||
| 1580 | Ga0496111_0076966 | |||
| 1581 | Ga0496111_0100563 | |||
| 1582 | Ga0496111_0215093 | |||
| 1583 | Ga0496112_0001443 | |||
| 1584 | Ga0496112_0074821 | |||
| 1585 | Ga0496112_0202690 | |||
| 1586 | Ga0496112_0281173 | |||
| 1587 | Ga0496112_0807110 | |||
| 1588 | Ga0496112_0857857 | |||
| 1589 | Ga0496112_1337582 | |||
| 1590 | Ga0496113_0148359 | |||
| 1591 | Ga0496113_0236824 | |||
| 1592 | Ga0496114_0007482 | |||
| 1593 | Ga0496114_0012525 | |||
| 1594 | Ga0496114_0020054 | |||
| 1595 | Ga0496114_0370776 | |||
| 1596 | Ga0496114_1173216 | |||
| 1597 | Ga0496115_0000825 | |||
| 1598 | Ga0496115_0071682 | |||
| 1599 | Ga0496115_0341877 | |||
| 1600 | Ga0496115_0861047 | |||
| 1601 | Ga0496121_0835697 | |||
| 1602 | Ga0501031_0009418 | |||
| 1603 | Ga0501031_0011087 | |||
| 1604 | Ga0501031_0115168 | |||
| 1605 | Ga0501031_0767091 | |||
| 1606 | Ga0501032_0076899 | |||
| 1607 | Ga0501033_0114527 | |||
| 1608 | Ga0501033_0518041 | |||
| 1609 | Ga0501033_0626506 | |||
| 1610 | Ga0501036_0056709 | |||
| 1611 | Ga0501036_0173118 | |||
| 1612 | Ga0501036_0282143 | |||
| 1613 | Ga0501036_0759901 | |||
| 1614 | Ga0501036_1423778 | |||
| 1615 | Ga0501037_0224586 | |||
| 1616 | Ga0501038_0192372 | |||
| 1617 | Ga0501038_0371508 | |||
| 1618 | Ga0501039_0004144 | |||
| 1619 | Ga0501039_0039941 | |||
| 1620 | Ga0501039_0351550 | |||
| 1621 | Ga0501039_0678584 | |||
| 1622 | Ga0501040_0020185 | |||
| 1623 | Ga0501040_0046535 | |||
| 1624 | Ga0501040_0231730 | |||
| 1625 | Ga0501041_0001903 | |||
| 1626 | Ga0501042_0001051 | |||
| 1627 | Ga0501042_0005040 | |||
| 1628 | Ga0501042_0006441 | |||
| 1629 | Ga0501042_0012515 | |||
| 1630 | Ga0501042_0030354 | |||
| 1631 | Ga0501043_0166228 | |||
| 1632 | Ga0501043_0171356 | |||
| 1633 | Ga0501043_0200743 | |||
| 1634 | Ga0501043_0423402 | |||
| 1635 | Ga0501046_0020910 | |||
| 1636 | Ga0501046_0040516 | |||
| 1637 | Ga0501046_1139531 | |||
| 1638 | Ga0501046_1211013 | |||
| 1639 | Ga0501048_0024758 | |||
| 1640 | Ga0501048_0027540 | |||
| 1641 | Ga0501048_0038723 | |||
| 1642 | Ga0501048_0398232 | |||
| 1643 | Ga0501048_0565149 | |||
| 1644 | Ga0501067_0006236 | |||
| 1645 | Ga0501068_0015242 | |||
| 1646 | Ga0501068_0036329 | |||
| 1647 | Ga0501068_0120314 | |||
| 1648 | Ga0501068_0210561 | |||
| 1649 | Ga0501068_0622562 | |||
| 1650 | Ga0501069_0102500 | |||
| 1651 | Ga0501069_0701816 | |||
| 1652 | Ga0501070_0353778 | |||
| 1653 | Ga0501071_0005719 | |||
| 1654 | Ga0501071_0071460 | |||
| 1655 | Ga0501071_0219109 | |||
| 1656 | Ga0501071_0242359 | |||
| 1657 | Ga0501071_0246051 | |||
| 1658 | Ga0501071_0307130 | |||
| 1659 | Ga0501071_0339917 | |||
| 1660 | Ga0501071_1014750 | |||
| 1661 | Ga0501072_0039166 | |||
| 1662 | Ga0501072_0045774 | |||
| 1663 | Ga0501072_0047917 | |||
| 1664 | Ga0501074_0027588 | |||
| 1665 | Ga0501074_0048229 | |||
| 1666 | Ga0501074_0073793 | |||
| 1667 | Ga0501075_0000417 | |||
| 1668 | Ga0501075_0005234 | |||
| 1669 | Ga0501075_0031369 | |||
| 1670 | Ga0501075_0038898 | |||
| 1671 | Ga0501075_0298156 | |||
| 1672 | Ga0501076_0007615 | |||
| 1673 | Ga0501076_0012737 | |||
| 1674 | Ga0501076_0091125 | |||
| 1675 | Ga0501076_0217349 | |||
| 1676 | Ga0501076_0294486 | |||
| 1677 | Ga0501076_0317580 | |||
| 1678 | Ga0501076_0431188 | |||
| 1679 | Ga0501076_0687065 | |||
| 1680 | Ga0501077_0012943 | |||
| 1681 | Ga0501077_0036344 | |||
| 1682 | Ga0501077_0104277 | |||
| 1683 | Ga0501077_0162591 | |||
| 1684 | Ga0501077_0300754 | |||
| 1685 | Ga0501208_160018 | |||
| 1686 | Ga0501079_0006300 | |||
| 1687 | Ga0501079_0006761 | |||
| 1688 | Ga0501079_0319335 | |||
| 1689 | Ga0501079_0411613 | |||
| 1690 | Ga0501079_0677892 | |||
| 1691 | Ga0501080_0057336 | |||
| 1692 | Ga0501080_0091287 | |||
| 1693 | Ga0501080_0123524 | |||
| 1694 | Ga0501080_0260584 | |||
| 1695 | Ga0501080_0808106 | |||
| 1696 | Ga0501081_0003476 | |||
| 1697 | Ga0501081_0039204 | |||
| 1698 | Ga0501081_0050396 | |||
| 1699 | Ga0501081_0061639 | |||
| 1700 | Ga0501081_0189163 | |||
| 1701 | Ga0501083_0175986 | |||
| 1702 | Ga0501083_0603097 | |||
| 1703 | Ga0501035_0108969 | |||
| 1704 | Ga0501035_0199402 | |||
| 1705 | Ga0501044_0227767 | |||
| 1706 | Ga0501045_0000641 | |||
| 1707 | Ga0501045_0014566 | |||
| 1708 | Ga0501045_0040011 | |||
| 1709 | Ga0501045_0183725 | |||
| 1710 | Ga0501045_0230074 | |||
| 1711 | Ga0501045_0243087 | |||
| 1712 | Ga0501045_0424145 | |||
| 1713 | Ga0501045_1165259 | |||
| 1714 | nmdc:mga05p37_13440_c1 | |||
| 1715 | nmdc:mga05p37_193701_c1 | |||
| 1716 | nmdc:mga05p37_366031_c1 | |||
| 1717 | nmdc:mga05p37_42536_c1 | |||
| 1718 | nmdc:mga05p37_662919_c1 | |||
| 1719 | nmdc:mga05p37_7656_c1 | |||
| 1720 | nmdc:mga09592_1046281_c1 | |||
| 1721 | nmdc:mga09592_38915_c1 | |||
| 1722 | nmdc:mga06r32_159138_c1 | |||
| 1723 | nmdc:mga06r32_769532_c1 | |||
| 1724 | nmdc:mga08y16_131094_c1 | |||
| 1725 | nmdc:mga08y16_166795_c1 | |||
| 1726 | nmdc:mga08y16_293013_c1 | |||
| 1727 | nmdc:mga08y16_664050_c1 | |||
| 1728 | nmdc:mga0n895_1119_c1 | |||
| 1729 | nmdc:mga0n895_113216_c1 | |||
| 1730 | nmdc:mga0n895_16096_c1 | |||
| 1731 | nmdc:mga0rr50_4220_c1 | |||
| 1732 | nmdc:mga0rr50_516849_c1 | |||
| 1733 | nmdc:mga0rr50_8094_c1 | |||
| 1734 | nmdc:mga08x19_438674_c1 | |||
| 1735 | nmdc:mga08x19_59975_c1 | |||
| 1736 | nmdc:mga08x19_699536_c1 | |||
| 1737 | nmdc:mga0a205_2266_c1 | |||
| 1738 | nmdc:mga0a205_42350_c1 | |||
| 1739 | Ga0495601_0272111 | |||
| 1740 | Ga0495601_0351090 | |||
| 1741 | Ga0495619_0088783 | |||
| 1742 | Ga0495619_0468502 | |||
| 1743 | Ga0501084_0003291 | |||
| 1744 | Ga0501084_0007290 | |||
| 1745 | Ga0501084_0078799 | |||
| 1746 | Ga0501084_0191850 | |||
| 1747 | Ga0501084_0230456 | |||
| 1748 | Ga0501084_0932146 | |||
| 1749 | Ga0590071_048109 | |||
| 1750 | Ga0590075_017006 | |||
| 1751 | Ga0501082_0014301 | |||
| 1752 | Ga0501082_0051983 | |||
| 1753 | Ga0501082_0103270 | |||
| 1754 | Ga0501082_0106168 | |||
| 1755 | Ga0501082_0255075 | |||
| 1756 | Ga0501082_0389839 | |||
| 1757 | Ga0501082_0417339 | |||
| 1758 | Ga0530510_0010056 | |||
| 1759 | Ga0530510_0011529 | |||
| 1760 | Ga0530510_0012239 | |||
| 1761 | Ga0530510_0049750 | |||
| 1762 | Ga0530510_0107487 | |||
| 1763 | Ga0530510_0272436 | |||
| 1764 | Ga0530510_0363853 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e9i-assembly1.cif.gz_E | mycobacterial respiratory complex i, semi-inserted quinone | 0.8962 | 3 | 152 |
| 7p7c-assembly1.cif.gz_E | complex i from e. coli, ddm/lmng-purified, apo, open state | 0.8777 | 1 | 150 |
| 4uq8-assembly1.cif.gz_E | electron cryo-microscopy of bovine complex i | 0.8724 | 42 | 152 |
| 7ak6-assembly1.cif.gz_E | cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a | 0.8704 | 5 | 155 |
| 6zjy-assembly1.cif.gz_2 | respiratory complex i from thermus thermophilus, nad+ dataset, minor state | 0.868 | 6 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9512 | 69 | 150 | 3.40.30.10 |
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.951 | 70 | 154 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9294 | 69 | 150 | 3.40.30.10 |
| af_P9WIV5_106_200_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9278 | 70 | 154 | 3.40.30.10 |
| 2fug202 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8758 | 70 | 155 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1DR85-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE | 0.9217 | 9 | 154 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A838GK68-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) | 0.9164 | 9 | 154 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1Q2MAN0-F1-model_v4 | NADP-reducing hydrogenase subunit HndA (EC 1.12.1.3) | 0.9158 | 15 | 151 |
GO:0046872
GO:0050583 GO:0051537 |
| AF-A0LRI5-F1-model_v4 | NADH dehydrogenase subunit E (EC 1.6.5.3) | 0.9117 | 4 | 154 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A7V3FTB0-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.9113 | 20 | 155 |
GO:0016491
GO:0046872 GO:0051537 |