F484544

General Info

Members Datasets Scaffolds Average Seq Length
882 343 1764 157

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100452401|Ga0070694_1004524012
Length 177
Sequence MTDPHLTSEAKSQTSPAESAKHFSRFYEEVQEIKAQYPDQRSAALPALRLAQEKHGYVSPEALRECAEALGTTPAFCEAVASFYDMLHLEPIGRHMVEVCTNVSCALVGAQQVLETFEEELGIRAGETTEDGEVTLRPIECLGGCGWATVVSVDHHYRTHVKPADVPAIVQELRSGD

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
208 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
212 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
341 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 9.3
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100452401 3300005444 Bacteria 1014
2 JGI24744J21845_10001169 3300002077 Bacteria 5113
3 JGI24742J22300_10084959 3300002244 Bacteria 601
4 Ga0070658_10058131 3300005327 Bacteria 3147
5 Ga0070683_100569378 3300005329 Bacteria 1083
6 Ga0070690_100031769 3300005330 Bacteria 3292
7 Ga0068869_100050871 3300005334 Bacteria 3004
8 Ga0070666_10175133 3300005335 Bacteria 1504
9 Ga0070680_100071045 3300005336 Bacteria 2860
10 Ga0070680_100854429 3300005336 Bacteria 785
11 Ga0070682_100001046 3300005337 Bacteria 16002
12 Ga0068868_100058497 3300005338 Bacteria 3046
13 Ga0070689_100287309 3300005340 Bacteria 1366
14 Ga0070691_10090809 3300005341 Bacteria 1505
15 Ga0070691_10159504 3300005341 Bacteria 1162
16 Ga0070691_10570362 3300005341 Bacteria 664
17 Ga0070687_100500620 3300005343 Bacteria 818
18 Ga0070687_100677160 3300005343 Bacteria 718
19 Ga0070692_10002003 3300005345 Bacteria 7729
20 Ga0070668_100012259 3300005347 Bacteria 6387
21 Ga0070668_100034924 3300005347 Bacteria 3832
22 Ga0070675_100202397 3300005354 Bacteria 1723
23 Ga0070675_100605871 3300005354 Bacteria 993
24 Ga0070671_100072789 3300005355 Bacteria 2870
25 Ga0070671_100512946 3300005355 Bacteria 1032
26 Ga0070674_100024562 3300005356 Bacteria 3913
27 Ga0070674_100181585 3300005356 Bacteria 1612
28 Ga0070674_100359338 3300005356 Bacteria 1179
29 Ga0070674_100363118 3300005356 Bacteria 1173
30 Ga0070673_100803033 3300005364 Bacteria 869
31 Ga0070673_101220581 3300005364 Bacteria 705
32 Ga0070688_100201718 3300005365 Bacteria 1392
33 Ga0070688_101299645 3300005365 Unclassified 587
34 Ga0070659_100136339 3300005366 Bacteria 1996
35 Ga0070659_100790410 3300005366 Bacteria 825
36 Ga0070659_100930750 3300005366 Bacteria 761
37 Ga0070667_100046836 3300005367 Bacteria 3638
38 Ga0070667_100499480 3300005367 Bacteria 1115
39 Ga0070709_10048366 3300005434 Bacteria 2653
40 Ga0070709_10298707 3300005434 Bacteria 1176
41 Ga0070714_100094702 3300005435 Bacteria 2621
42 Ga0070713_100002608 3300005436 Bacteria 11779
43 Ga0070713_100345956 3300005436 Bacteria 1378
44 Ga0070713_100524987 3300005436 Bacteria 1119
45 Ga0070710_10129351 3300005437 Bacteria 1538
46 Ga0070710_10808570 3300005437 Bacteria 670
47 Ga0070701_10019274 3300005438 Bacteria 3220
48 Ga0070711_100005726 3300005439 Bacteria 7452
49 Ga0070711_100382950 3300005439 Bacteria 1138
50 Ga0070711_101034839 3300005439 Unclassified 705
51 Ga0070705_101210946 3300005440 Bacteria 622
52 Ga0070700_100005993 3300005441 Bacteria 6465
53 Ga0070700_100837370 3300005441 Bacteria 744
54 Ga0070700_100853401 3300005441 Unclassified 738
55 Ga0070700_100946160 3300005441 Unclassified 705
56 Ga0070694_100377541 3300005444 Bacteria 1105
57 Ga0070708_100773722 3300005445 Unclassified 903
58 Ga0070663_100533528 3300005455 Bacteria 979
59 Ga0070678_100067067 3300005456 Bacteria 2669
60 Ga0070678_100216248 3300005456 Bacteria 1591
61 Ga0070678_100862099 3300005456 Bacteria 826
62 Ga0070662_100002641 3300005457 Bacteria 11051
63 Ga0070662_100540940 3300005457 Bacteria 975
64 Ga0070681_11444782 3300005458 Bacteria 612
65 Ga0068867_100000290 3300005459 Bacteria 32965
66 Ga0068867_100123672 3300005459 Bacteria 2002
67 Ga0070685_10375194 3300005466 Bacteria 978
68 Ga0070685_10587107 3300005466 Bacteria 800
69 Ga0070706_100087854 3300005467 Bacteria 2882
70 Ga0070706_100101363 3300005467 Bacteria 2675
71 Ga0070706_100203140 3300005467 Bacteria 1851
72 Ga0070706_100218127 3300005467 Bacteria 1781
73 Ga0070706_101077316 3300005467 Bacteria 740
74 Ga0070707_100001362 3300005468 Bacteria 23998
75 Ga0070707_100033547 3300005468 Bacteria 4896
76 Ga0070698_100008838 3300005471 Bacteria 10835
77 Ga0070698_100220818 3300005471 Bacteria 1829
78 Ga0070698_100253971 3300005471 Bacteria 1690
79 Ga0070698_100617921 3300005471 Bacteria 1024
80 Ga0070698_101239288 3300005471 Bacteria 695
81 Ga0070698_101971946 3300005471 Unclassified 537
82 Ga0070699_100008741 3300005518 Bacteria 8776
83 Ga0070699_101596644 3300005518 Unclassified 598
84 Ga0070679_101358163 3300005530 Bacteria 657
85 Ga0070679_101788134 3300005530 Unclassified 563
86 Ga0070684_100069573 3300005535 Bacteria 3095
87 Ga0070684_100745322 3300005535 Bacteria 914
88 Ga0070684_100860323 3300005535 Bacteria 849
89 Ga0070684_100999743 3300005535 Bacteria 785
90 Ga0070684_102049697 3300005535 Unclassified 540
91 Ga0070697_100894348 3300005536 Unclassified 788
92 Ga0070697_101465776 3300005536 Bacteria 610
93 Ga0070672_100143591 3300005543 Bacteria 1971
94 Ga0070672_100332673 3300005543 Bacteria 1292
95 Ga0070672_100677723 3300005543 Bacteria 902
96 Ga0070686_100009901 3300005544 Bacteria 5359
97 Ga0070686_100235823 3300005544 Bacteria 1329
98 Ga0070695_100054146 3300005545 Bacteria 2581
99 Ga0070695_100076816 3300005545 Bacteria 2200
100 Ga0070695_100652978 3300005545 Bacteria 831
101 Ga0070696_100483196 3300005546 Bacteria 983
102 Ga0070696_101003362 3300005546 Unclassified 697
103 Ga0070693_100419747 3300005547 Bacteria 932
104 Ga0070665_100394905 3300005548 Bacteria 1391
105 Ga0070704_100162689 3300005549 Bacteria 1766
106 Ga0070704_100244948 3300005549 Bacteria 1469
107 Ga0070704_100294518 3300005549 Bacteria 1349
108 Ga0068855_100073422 3300005563 Bacteria 3974
109 Ga0070664_100457987 3300005564 Bacteria 1172
110 Ga0070664_101113451 3300005564 Unclassified 744
111 Ga0068857_100002943 3300005577 Bacteria 14030
112 Ga0068857_100125918 3300005577 Bacteria 2308
113 Ga0068854_101195780 3300005578 Bacteria 681
114 Ga0068854_101295586 3300005578 Bacteria 656
115 Ga0068856_100002162 3300005614 Bacteria 20361
116 Ga0068856_100575270 3300005614 Bacteria 1148
117 Ga0068856_100904107 3300005614 Bacteria 902
118 Ga0068856_101270323 3300005614 Unclassified 752
119 Ga0070702_100018760 3300005615 Bacteria 3594
120 Ga0070702_101343143 3300005615 Bacteria 582
121 Ga0068852_100461231 3300005616 Bacteria 1260
122 Ga0068864_100868382 3300005618 Bacteria 890
123 Ga0068864_100889562 3300005618 Bacteria 879
124 Ga0068864_101093505 3300005618 Bacteria 793
125 Ga0068866_10000154 3300005718 Bacteria 31512
126 Ga0068866_10072391 3300005718 Bacteria 1826
127 Ga0068861_100001783 3300005719 Bacteria 13846
128 Ga0068861_100137079 3300005719 Bacteria 1993
129 Ga0068861_101020390 3300005719 Bacteria 791
130 Ga0068851_10960056 3300005834 Unclassified 538
131 Ga0068858_100306160 3300005842 Bacteria 1517
132 Ga0068858_100486134 3300005842 Bacteria 1192
133 Ga0068858_101049780 3300005842 Bacteria 799
134 Ga0068860_100065963 3300005843 Bacteria 3438
135 Ga0068860_100812165 3300005843 Bacteria 949
136 Ga0068862_100178671 3300005844 Bacteria 1904
137 Ga0068862_101069525 3300005844 Bacteria 801
138 Ga0081455_10059969 3300005937 Bacteria 3210
139 Ga0081455_10096923 3300005937 Bacteria 2377
140 Ga0081538_10020315 3300005981 Bacteria 4894
141 Ga0081538_10031392 3300005981 Bacteria 3584
142 Ga0081538_10034449 3300005981 Bacteria 3347
143 Ga0081538_10070154 3300005981 Bacteria 1936
144 Ga0081539_10000397 3300005985 Bacteria 93458
145 Ga0081539_10002620 3300005985 Bacteria 24595
146 Ga0081539_10028254 3300005985 Bacteria 3530
147 Ga0081539_10202314 3300005985 Bacteria 916
148 Ga0070717_10014641 3300006028 Bacteria 6037
149 Ga0070717_10567166 3300006028 Bacteria 1029
150 Ga0070717_10712779 3300006028 Bacteria 912
151 Ga0075432_10026251 3300006058 Bacteria 2000
152 Ga0070715_10197078 3300006163 Bacteria 1021
153 Ga0070715_10375126 3300006163 Bacteria 784
154 Ga0070716_100046618 3300006173 Bacteria 2440
155 Ga0070716_100219372 3300006173 Bacteria 1277
156 Ga0070716_100952342 3300006173 Unclassified 676
157 Ga0070712_100316251 3300006175 Bacteria 1268
158 Ga0070712_100729723 3300006175 Bacteria 847
159 Ga0070712_101197639 3300006175 Unclassified 661
160 Ga0070712_101521670 3300006175 Bacteria 585
161 Ga0075367_10017297 3300006178 Bacteria 3955
162 Ga0097621_100396606 3300006237 Bacteria 1235
163 Ga0097621_101085331 3300006237 Bacteria 751
164 Ga0075428_100001324 3300006844 Bacteria 26239
165 Ga0075428_100008062 3300006844 Bacteria 11697
166 Ga0075428_100083469 3300006844 Bacteria 3486
167 Ga0075428_100417806 3300006844 Bacteria 1437
168 Ga0075428_101130303 3300006844 Bacteria 827
169 Ga0075428_101824861 3300006844 Bacteria 633
170 Ga0075430_100045380 3300006846 Bacteria 3713
171 Ga0075430_100137242 3300006846 Bacteria 2037
172 Ga0075431_100120826 3300006847 Bacteria 2703
173 Ga0075431_100798585 3300006847 Bacteria 917
174 Ga0075431_100841653 3300006847 Bacteria 889
175 Ga0075433_10000356 3300006852 Bacteria 28714
176 Ga0075433_10000542 3300006852 Bacteria 24806
177 Ga0075434_100000720 3300006871 Bacteria 25896
178 Ga0075434_100045583 3300006871 Bacteria 4350
179 Ga0075434_101162702 3300006871 Bacteria 784
180 Ga0075429_100069824 3300006880 Bacteria 3058
181 Ga0075429_100184757 3300006880 Bacteria 1827
182 Ga0075429_100370988 3300006880 Bacteria 1253
183 Ga0068865_100022070 3300006881 Bacteria 4146
184 Ga0075436_100071815 3300006914 Bacteria 2394
185 Ga0075435_100009468 3300007076 Bacteria 7055
186 Ga0075435_100082891 3300007076 Bacteria 2636
187 Ga0075435_100551722 3300007076 Bacteria 998
188 Ga0111539_10014838 3300009094 Bacteria 9716
189 Ga0111539_10048781 3300009094 Bacteria 5053
190 Ga0111539_11114693 3300009094 Bacteria 917
191 Ga0111539_11118107 3300009094 Bacteria 915
192 Ga0111539_11889615 3300009094 Bacteria 692
193 Ga0105245_10013922 3300009098 Bacteria 7004
194 Ga0105245_10206647 3300009098 Bacteria 1888
195 Ga0105245_10253651 3300009098 Bacteria 1710
196 Ga0105245_10382387 3300009098 Bacteria 1402
197 Ga0105245_10902183 3300009098 Bacteria 925
198 Ga0105245_11081667 3300009098 Bacteria 848
199 Ga0105247_10112585 3300009101 Bacteria 1753
200 Ga0114129_10005223 3300009147 Bacteria 18302
201 Ga0114129_10010248 3300009147 Bacteria 13372
202 Ga0114129_10031268 3300009147 Bacteria 7528
203 Ga0114129_10124310 3300009147 Bacteria 3548
204 Ga0114129_10211121 3300009147 Bacteria 2624
205 Ga0114129_10506460 3300009147 Bacteria 1576
206 Ga0114129_10547632 3300009147 Bacteria 1505
207 Ga0114129_10868343 3300009147 Bacteria 1145
208 Ga0114129_11062286 3300009147 Bacteria 1016
209 Ga0114129_11740373 3300009147 Bacteria 760
210 Ga0105243_10001079 3300009148 Bacteria 24973
211 Ga0105243_10531728 3300009148 Bacteria 1120
212 Ga0105243_11048200 3300009148 Bacteria 821
213 Ga0105241_10082186 3300009174 Bacteria 2525
214 Ga0105242_10228307 3300009176 Bacteria 1667
215 Ga0105242_10542404 3300009176 Bacteria 1114
216 Ga0105242_10554889 3300009176 Bacteria 1102
217 Ga0105242_10579868 3300009176 Bacteria 1080
218 Ga0105248_10022344 3300009177 Bacteria 7016
219 Ga0105248_10046659 3300009177 Bacteria 4856
220 Ga0105248_10088431 3300009177 Bacteria 3486
221 Ga0105237_10489697 3300009545 Bacteria 1236
222 Ga0105237_10539633 3300009545 Bacteria 1173
223 Ga0105238_10402643 3300009551 Bacteria 1362
224 Ga0105238_10826399 3300009551 Bacteria 943
225 Ga0105249_10001703 3300009553 Bacteria 19257
226 Ga0105249_10004222 3300009553 Bacteria 12419
227 Ga0105249_10272228 3300009553 Bacteria 1687
228 Ga0105239_10001224 3300010375 Bacteria 34981
229 Ga0105239_10125740 3300010375 Bacteria 2849
230 Ga0105239_10297845 3300010375 Bacteria 1816
231 Ga0105239_10319303 3300010375 Bacteria 1751
232 Ga0105239_10331948 3300010375 Bacteria 1715
233 Ga0105239_11492029 3300010375 Bacteria 781
234 Ga0105246_10236035 3300011119 Bacteria 1443
235 Ga0105246_10248227 3300011119 Bacteria 1411
236 Ga0105246_11288065 3300011119 Bacteria 677
237 Ga0157374_10001561 3300013296 Bacteria 19271
238 Ga0157374_10148299 3300013296 Bacteria 2280
239 Ga0157374_10221004 3300013296 Bacteria 1859
240 Ga0157374_10952169 3300013296 Bacteria 877
241 Ga0157378_10058383 3300013297 Bacteria 3441
242 Ga0157378_11285259 3300013297 Bacteria 773
243 Ga0163162_10030158 3300013306 Bacteria 5373
244 Ga0163162_10038088 3300013306 Bacteria 4799
245 Ga0163162_11000464 3300013306 Bacteria 945
246 Ga0157375_10101153 3300013308 Bacteria 2965
247 Ga0157375_10152574 3300013308 Bacteria 2447
248 Ga0157375_10795756 3300013308 Bacteria 1094
249 Ga0157380_10756534 3300014326 Bacteria 984
250 Ga0157380_10889099 3300014326 Bacteria 916
251 Ga0157380_11038071 3300014326 Bacteria 855
252 Ga0157377_10026003 3300014745 Bacteria 3127
253 Ga0157377_10139034 3300014745 Bacteria 1491
254 Ga0157377_10432024 3300014745 Bacteria 905
255 Ga0157377_10455493 3300014745 Bacteria 884
256 Ga0157379_10725708 3300014968 Bacteria 934
257 Ga0157376_10001860 3300014969 Bacteria 14072
258 Ga0157376_10495619 3300014969 Bacteria 1200
259 Ga0163161_11129526 3300017792 Unclassified 675
260 Ga0206356_11460515 3300020070 Bacteria 1868
261 Ga0206350_11629545 3300020080 Unclassified 522
262 Ga0207692_10153677 3300025898 Bacteria 1320
263 Ga0207642_10521606 3300025899 Unclassified 730
264 Ga0207688_10143335 3300025901 Bacteria 1407
265 Ga0207688_10393723 3300025901 Bacteria 858
266 Ga0207685_10023542 3300025905 Bacteria 2098
267 Ga0207699_10044876 3300025906 Bacteria 2576
268 Ga0207645_10287216 3300025907 Bacteria 1093
269 Ga0207643_10068435 3300025908 Bacteria 2039
270 Ga0207684_10080784 3300025910 Bacteria 2766
271 Ga0207684_10203672 3300025910 Bacteria 1707
272 Ga0207684_11035769 3300025910 Bacteria 685
273 Ga0207654_10295011 3300025911 Bacteria 1101
274 Ga0207707_10700090 3300025912 Bacteria 851
275 Ga0207693_10000499 3300025915 Bacteria 35458
276 Ga0207693_10098918 3300025915 Bacteria 2287
277 Ga0207693_10494436 3300025915 Bacteria 955
278 Ga0207663_10373938 3300025916 Bacteria 1084
279 Ga0207663_10563945 3300025916 Bacteria 891
280 Ga0207660_10009541 3300025917 Bacteria 6281
281 Ga0207662_10023652 3300025918 Bacteria 3531
282 Ga0207662_10169147 3300025918 Bacteria 1401
283 Ga0207662_10759592 3300025918 Unclassified 682
284 Ga0207657_10120254 3300025919 Bacteria 2161
285 Ga0207657_10419425 3300025919 Bacteria 1052
286 Ga0207649_10915149 3300025920 Bacteria 688
287 Ga0207652_10399526 3300025921 Bacteria 1240
288 Ga0207652_11488045 3300025921 Unclassified 581
289 Ga0207646_10001072 3300025922 Bacteria 34848
290 Ga0207646_10027364 3300025922 Bacteria 5201
291 Ga0207694_10369284 3300025924 Bacteria 1190
292 Ga0207659_10275556 3300025926 Bacteria 1374
293 Ga0207659_10284400 3300025926 Bacteria 1353
294 Ga0207659_10885338 3300025926 Bacteria 768
295 Ga0207687_10006813 3300025927 Bacteria 7528
296 Ga0207687_10017022 3300025927 Bacteria 4779
297 Ga0207687_10211398 3300025927 Bacteria 1522
298 Ga0207687_10295114 3300025927 Bacteria 1304
299 Ga0207687_10513194 3300025927 Bacteria 1002
300 Ga0207687_10514204 3300025927 Bacteria 1001
301 Ga0207700_10000001 3300025928 Bacteria 1122509
302 Ga0207664_10172970 3300025929 Bacteria 1850
303 Ga0207664_10204532 3300025929 Bacteria 1706
304 Ga0207690_10176212 3300025932 Bacteria 1606
305 Ga0207690_10206542 3300025932 Bacteria 1495
306 Ga0207690_10837944 3300025932 Bacteria 761
307 Ga0207706_10621447 3300025933 Bacteria 927
308 Ga0207686_10000672 3300025934 Bacteria 21152
309 Ga0207686_10227251 3300025934 Bacteria 1351
310 Ga0207686_10422472 3300025934 Bacteria 1020
311 Ga0207709_10000781 3300025935 Bacteria 24924
312 Ga0207709_10040500 3300025935 Bacteria 2790
313 Ga0207709_10547931 3300025935 Bacteria 909
314 Ga0207709_11204638 3300025935 Bacteria 624
315 Ga0207670_11125750 3300025936 Bacteria 663
316 Ga0207669_10032949 3300025937 Bacteria 2917
317 Ga0207669_10484736 3300025937 Bacteria 986
318 Ga0207669_11003620 3300025937 Bacteria 701
319 Ga0207669_11409524 3300025937 Bacteria 593
320 Ga0207704_10001419 3300025938 Bacteria 10712
321 Ga0207704_10276825 3300025938 Bacteria 1273
322 Ga0207665_10143886 3300025939 Bacteria 1703
323 Ga0207665_10536848 3300025939 Bacteria 907
324 Ga0207665_10823486 3300025939 Bacteria 734
325 Ga0207691_10134120 3300025940 Bacteria 2186
326 Ga0207691_10143645 3300025940 Bacteria 2102
327 Ga0207691_10475537 3300025940 Bacteria 1062
328 Ga0207711_11074070 3300025941 Bacteria 745
329 Ga0207661_10497390 3300025944 Bacteria 1114
330 Ga0207661_10524948 3300025944 Bacteria 1083
331 Ga0207661_11499098 3300025944 Bacteria 618
332 Ga0207679_10772938 3300025945 Bacteria 874
333 Ga0207667_10054593 3300025949 Bacteria 4202
334 Ga0207651_10481858 3300025960 Bacteria 1069
335 Ga0207651_12079615 3300025960 Bacteria 510
336 Ga0207712_10007048 3300025961 Bacteria 7092
337 Ga0207712_10134333 3300025961 Bacteria 1890
338 Ga0207712_10155390 3300025961 Bacteria 1771
339 Ga0207668_10027466 3300025972 Bacteria 3707
340 Ga0207668_10212937 3300025972 Bacteria 1547
341 Ga0207640_10294431 3300025981 Bacteria 1281
342 Ga0207658_10012020 3300025986 Bacteria 5904
343 Ga0207658_11371830 3300025986 Bacteria 647
344 Ga0207677_10370358 3300026023 Bacteria 1206
345 Ga0207703_10206384 3300026035 Bacteria 1749
346 Ga0207639_10567265 3300026041 Bacteria 1044
347 Ga0207639_11643715 3300026041 Unclassified 602
348 Ga0207678_10215470 3300026067 Bacteria 1643
349 Ga0207708_10000434 3300026075 Bacteria 32516
350 Ga0207708_10385805 3300026075 Bacteria 1156
351 Ga0207708_10566968 3300026075 Bacteria 959
352 Ga0207708_10712953 3300026075 Bacteria 858
353 Ga0207708_10878221 3300026075 Unclassified 775
354 Ga0207702_10020710 3300026078 Bacteria 5439
355 Ga0207702_10184461 3300026078 Bacteria 1923
356 Ga0207648_10015109 3300026089 Bacteria 7107
357 Ga0207648_10080125 3300026089 Bacteria 2849
358 Ga0207648_10232035 3300026089 Bacteria 1642
359 Ga0207676_10260379 3300026095 Bacteria 1566
360 Ga0207676_10441944 3300026095 Bacteria 1224
361 Ga0207674_10008735 3300026116 Bacteria 11664
362 Ga0207674_10090219 3300026116 Bacteria 3056
363 Ga0207674_11880173 3300026116 Bacteria 565
364 Ga0207675_100022938 3300026118 Bacteria 5805
365 Ga0207675_100079099 3300026118 Bacteria 3081
366 Ga0207675_100079403 3300026118 Bacteria 3075
367 Ga0207683_10006588 3300026121 Bacteria 9935
368 Ga0207683_10302178 3300026121 Bacteria 1464
369 Ga0207698_10043854 3300026142 Bacteria 3355
370 Ga0207428_10042636 3300027907 Bacteria 3669
371 Ga0207428_10287647 3300027907 Bacteria 1219
372 Ga0268266_10212127 3300028379 Bacteria 1776
373 Ga0268264_10243069 3300028381 Bacteria 1668
374 Ga0268264_10821288 3300028381 Bacteria 930
375 Ga0265319_1002809 3300028563 Bacteria 9324
376 Ga0265318_10005078 3300028577 Bacteria 6235
377 Ga0265322_10008197 3300028654 Bacteria 3046
378 Ga0265338_10028546 3300028800 Bacteria 5560
379 Ga0265324_10158984 3300029957 Unclassified 767
380 Ga0265330_10013638 3300031235 Bacteria 3785
381 Ga0265332_10052464 3300031238 Bacteria 1751
382 Ga0265320_10012238 3300031240 Bacteria 5005
383 Ga0265340_10013801 3300031247 Bacteria 4235
384 Ga0265339_10042433 3300031249 Bacteria 2519
385 Ga0265327_10099616 3300031251 Bacteria 1404
386 Ga0265316_10031600 3300031344 Bacteria 4327
387 Ga0307408_100381213 3300031548 Bacteria 1205
388 Ga0307408_101011790 3300031548 Bacteria 766
389 Ga0265342_10009711 3300031712 Bacteria 6744
390 Ga0307405_10024196 3300031731 Bacteria 3465
391 Ga0307405_10046658 3300031731 Bacteria 2664
392 Ga0307405_10387117 3300031731 Bacteria 1090
393 Ga0307413_10066967 3300031824 Bacteria 2243
394 Ga0307413_10607809 3300031824 Bacteria 896
395 Ga0307410_10368565 3300031852 Bacteria 1152
396 Ga0307410_10491496 3300031852 Bacteria 1008
397 Ga0307406_10023139 3300031901 Bacteria 3695
398 Ga0307406_10050675 3300031901 Bacteria 2633
399 Ga0307406_10193560 3300031901 Bacteria 1491
400 Ga0307407_10017709 3300031903 Bacteria 3583
401 Ga0307412_10144709 3300031911 Bacteria 1745
402 Ga0307412_10611604 3300031911 Bacteria 924
403 Ga0307412_11613105 3300031911 Bacteria 593
404 Ga0307409_100090234 3300031995 Bacteria 2508
405 Ga0307409_100250650 3300031995 Bacteria 1618
406 Ga0307409_100259291 3300031995 Bacteria 1594
407 Ga0307409_100369474 3300031995 Bacteria 1360
408 Ga0307409_100604985 3300031995 Bacteria 1084
409 Ga0307409_100881573 3300031995 Bacteria 907
410 Ga0307409_100912144 3300031995 Bacteria 893
411 Ga0307416_100000711 3300032002 Bacteria 17278
412 Ga0307416_100015982 3300032002 Bacteria 5201
413 Ga0307416_100018953 3300032002 Bacteria 4864
414 Ga0307416_100120113 3300032002 Bacteria 2339
415 Ga0307416_102722201 3300032002 Bacteria 591
416 Ga0307416_102836058 3300032002 Unclassified 580
417 Ga0307414_11138288 3300032004 Bacteria 721
418 Ga0307411_10091495 3300032005 Bacteria 2125
419 Ga0307415_100000296 3300032126 Bacteria 21625
420 Ga0307415_100010159 3300032126 Bacteria 5317
421 Ga0307415_100022248 3300032126 Bacteria 3908
422 Ga0307415_100098445 3300032126 Bacteria 2138
423 Ga0373952_0021088 3300035092 Bacteria 1373
424 Ga0373932_0099146 3300035112 Bacteria 946
425 Ga0373962_0210038 3300035242 Bacteria 662
426 Ga0373931_0333610 3300035691 Bacteria 945
427 Ga0373935_0481749 3300035692 Bacteria 899
428 Ga0373925_0109457 3300037068 Bacteria 2133
429 Ga0395899_0007215 3300037312 Bacteria 8603
430 Ga0395899_0007885 3300037312 Bacteria 8206
431 Ga0395899_0019593 3300037312 Bacteria 5136
432 Ga0395899_0027088 3300037312 Bacteria 4323
433 Ga0395899_0092061 3300037312 Bacteria 2196
434 Ga0395899_0159922 3300037312 Bacteria 1592
435 Ga0395899_0198119 3300037312 Bacteria 1402
436 Ga0395899_0198945 3300037312 Bacteria 1398
437 Ga0395899_0267711 3300037312 Bacteria 1166
438 Ga0395899_0415290 3300037312 Bacteria 888
439 Ga0395899_0521558 3300037312 Bacteria 768
440 Ga0395900_0000528 3300037418 Bacteria 53945
441 Ga0395900_0006608 3300037418 Bacteria 12067
442 Ga0395900_0040788 3300037418 Bacteria 4784
443 Ga0395900_0043397 3300037418 Bacteria 4635
444 Ga0395900_0054193 3300037418 Bacteria 4129
445 Ga0395900_0055681 3300037418 Bacteria 4072
446 Ga0395900_0072257 3300037418 Bacteria 3547
447 Ga0395900_0102187 3300037418 Bacteria 2945
448 Ga0395900_0108819 3300037418 Bacteria 2847
449 Ga0395900_0173743 3300037418 Bacteria 2192
450 Ga0395900_0180272 3300037418 Bacteria 2147
451 Ga0395900_0322053 3300037418 Bacteria 1526
452 Ga0395900_0344085 3300037418 Bacteria 1466
453 Ga0395900_0361124 3300037418 Bacteria 1424
454 Ga0395900_0442780 3300037418 Bacteria 1256
455 Ga0395900_0534864 3300037418 Bacteria 1118
456 Ga0395900_0577665 3300037418 Bacteria 1066
457 Ga0395900_0743353 3300037418 Bacteria 912
458 Ga0395900_1189620 3300037418 Bacteria 678
459 Ga0395900_1189870 3300037418 Bacteria 678
460 Ga0395900_1408700 3300037418 Unclassified 610
461 Ga0395898_0002139 3300037466 Bacteria 24346
462 Ga0395898_0012709 3300037466 Bacteria 8695
463 Ga0395898_0017551 3300037466 Bacteria 7305
464 Ga0395898_0020569 3300037466 Bacteria 6703
465 Ga0395898_0023768 3300037466 Bacteria 6188
466 Ga0395898_0033384 3300037466 Bacteria 5137
467 Ga0395898_0039856 3300037466 Bacteria 4647
468 Ga0395898_0067339 3300037466 Bacteria 3467
469 Ga0395898_0075798 3300037466 Bacteria 3248
470 Ga0395898_0086288 3300037466 Bacteria 3025
471 Ga0395898_0115094 3300037466 Bacteria 2577
472 Ga0395898_0158210 3300037466 Bacteria 2167
473 Ga0395898_0282451 3300037466 Bacteria 1583
474 Ga0395898_0344086 3300037466 Bacteria 1422
475 Ga0395898_0449326 3300037466 Bacteria 1227
476 Ga0395898_0768527 3300037466 Bacteria 904
477 Ga0395898_0840238 3300037466 Unclassified 858
478 Ga0395905_0000661 3300037471 Bacteria 45819
479 Ga0395905_0005716 3300037471 Bacteria 12642
480 Ga0395905_0009617 3300037471 Bacteria 9440
481 Ga0395905_0018357 3300037471 Bacteria 6639
482 Ga0395905_0031768 3300037471 Bacteria 4968
483 Ga0395905_0042861 3300037471 Bacteria 4246
484 Ga0395905_0079115 3300037471 Bacteria 3081
485 Ga0395905_0123399 3300037471 Bacteria 2435
486 Ga0395905_0141328 3300037471 Bacteria 2264
487 Ga0395905_0348794 3300037471 Bacteria 1372
488 Ga0395905_0366276 3300037471 Bacteria 1334
489 Ga0395905_0498040 3300037471 Bacteria 1118
490 Ga0395905_0511870 3300037471 Bacteria 1101
491 Ga0395905_0772131 3300037471 Bacteria 864
492 Ga0395905_0886791 3300037471 Bacteria 795
493 Ga0395905_1401165 3300037471 Unclassified 603
494 Ga0395905_1589282 3300037471 Unclassified 559
495 Ga0395901_0001057 3300038443 Bacteria 29607
496 Ga0395901_0003646 3300038443 Bacteria 15530
497 Ga0395901_0010037 3300038443 Bacteria 9601
498 Ga0395901_0010426 3300038443 Bacteria 9415
499 Ga0395901_0027883 3300038443 Bacteria 5806
500 Ga0395901_0048101 3300038443 Bacteria 4429
501 Ga0395901_0051842 3300038443 Bacteria 4265
502 Ga0395901_0069596 3300038443 Bacteria 3665
503 Ga0395901_0077799 3300038443 Bacteria 3462
504 Ga0395901_0091435 3300038443 Bacteria 3185
505 Ga0395901_0119598 3300038443 Bacteria 2768
506 Ga0395901_0151003 3300038443 Bacteria 2441
507 Ga0395901_0228306 3300038443 Bacteria 1944
508 Ga0395901_0253972 3300038443 Bacteria 1831
509 Ga0395901_0265813 3300038443 Bacteria 1785
510 Ga0395901_0406581 3300038443 Bacteria 1398
511 Ga0395901_0561778 3300038443 Bacteria 1155
512 Ga0395901_0636154 3300038443 Bacteria 1072
513 Ga0395901_0775643 3300038443 Bacteria 949
514 Ga0395901_1238691 3300038443 Unclassified 710
515 Ga0395901_1499770 3300038443 Bacteria 630
516 Ga0439438_009923 3300041405 Bacteria 3052
517 Ga0439447_012220 3300041407 Bacteria 2475
518 Ga0439453_0015199 3300041408 Bacteria 1329
519 Ga0439461_0002991 3300041410 Bacteria 2751
520 Ga0439466_0016371 3300041411 Bacteria 2680
521 Ga0439466_0095676 3300041411 Bacteria 929
522 Ga0451851_0629674 3300041507 Bacteria 554
523 Ga0439441_050794 3300042001 Bacteria 853
524 Ga0439448_0273065 3300042005 Bacteria 598
525 Ga0439450_104434 3300042008 Bacteria 721
526 Ga0439450_189859 3300042008 Bacteria 547
527 Ga0439451_007930 3300042009 Bacteria 2155
528 Ga0439454_002693 3300042011 Bacteria 1903
529 Ga0450920_025816 3300042122 Bacteria 1145
530 Ga0450907_057246 3300042146 Unclassified 672
531 Ga0439446_0175855 3300042156 Bacteria 714
532 Ga0439446_0248797 3300042156 Bacteria 612
533 Ga0450908_036736 3300042184 Bacteria 849
534 Ga0450908_068669 3300042184 Unclassified 628
535 Ga0439434_0002257 3300042435 Bacteria 5594
536 Ga0439435_0117045 3300042436 Bacteria 832
537 Ga0439464_0062743 3300042439 Bacteria 1090
538 Ga0450918_020396 3300042531 Bacteria 1158
539 Ga0466964_0509354 3300044706 Unclassified 647
540 Ga0466959_0136514 3300045049 Bacteria 1736
541 Ga0451576_0094753 3300045051 Bacteria 3105
542 Ga0466967_0037672 3300045976 Bacteria 4141
543 Ga0466967_0886640 3300045976 Bacteria 887
544 Ga0495617_108492 3300046452 Bacteria 899
545 Ga0495592_0348556 3300046454 Bacteria 950
546 Ga0495603_0196635 3300046455 Bacteria 1165
547 Ga0495629_0276818 3300046459 Bacteria 1152
548 Ga0495629_0654585 3300046459 Unclassified 700
549 Ga0495641_0075368 3300046461 Bacteria 1512
550 Ga0495641_0228901 3300046461 Bacteria 834
551 Ga0495641_0469964 3300046461 Bacteria 573
552 Ga0495580_0290624 3300046472 Bacteria 1114
553 Ga0495605_0031922 3300046474 Bacteria 2686
554 Ga0495584_0021737 3300046491 Bacteria 3258
555 Ga0495584_0141662 3300046491 Bacteria 1221
556 Ga0495584_0291524 3300046491 Unclassified 829
557 Ga0495584_0299467 3300046491 Bacteria 817
558 Ga0495585_0190406 3300046492 Bacteria 1050
559 Ga0495594_0084953 3300046499 Bacteria 1770
560 Ga0495596_0182289 3300046500 Bacteria 816
561 Ga0495596_0212563 3300046500 Bacteria 751
562 Ga0495607_0022098 3300046501 Bacteria 3999
563 Ga0495607_0149141 3300046501 Bacteria 1199
564 Ga0495618_0122205 3300046514 Bacteria 1668
565 Ga0495618_0369289 3300046514 Bacteria 882
566 Ga0495628_0626390 3300046516 Bacteria 766
567 Ga0495630_1092020 3300046517 Bacteria 605
568 Ga0495631_0076423 3300046518 Bacteria 1445
569 Ga0495632_0279859 3300046519 Bacteria 743
570 Ga0495637_0072469 3300046520 Bacteria 1387
571 Ga0495637_0091439 3300046520 Bacteria 1199
572 Ga0495644_0160770 3300046523 Bacteria 861
573 Ga0495644_0289793 3300046523 Bacteria 639
574 Ga0495663_0008460 3300046525 Bacteria 2850
575 Ga0495663_0075881 3300046525 Bacteria 1076
576 Ga0495663_0208677 3300046525 Bacteria 684
577 Ga0495666_0067277 3300046526 Bacteria 1707
578 Ga0495642_0042323 3300046528 Bacteria 1855
579 Ga0495642_0107583 3300046528 Bacteria 1190
580 Ga0495642_0277280 3300046528 Bacteria 734
581 Ga0495642_0330969 3300046528 Bacteria 669
582 Ga0495665_0092511 3300046531 Bacteria 1589
583 Ga0495640_0203225 3300046533 Bacteria 1255
584 Ga0495598_0005842 3300046537 Bacteria 2750
585 Ga0495598_0360113 3300046537 Bacteria 562
586 Ga0495609_0042648 3300046538 Bacteria 2038
587 Ga0495609_0102527 3300046538 Bacteria 1239
588 Ga0495609_0236774 3300046538 Unclassified 755
589 Ga0495597_0077576 3300046542 Bacteria 1424
590 Ga0495622_0310036 3300046557 Bacteria 687
591 Ga0495633_0090439 3300046558 Bacteria 1423
592 Ga0495633_0529944 3300046558 Unclassified 531
593 Ga0495667_0449538 3300046559 Bacteria 810
594 Ga0495656_0003173 3300046615 Bacteria 5534
595 Ga0495656_0121388 3300046615 Bacteria 1234
596 Ga0495656_0135081 3300046615 Bacteria 1177
597 Ga0495656_0360918 3300046615 Bacteria 754
598 Ga0495668_0046983 3300046616 Bacteria 2397
599 Ga0495634_0086870 3300046642 Bacteria 2036
600 Ga0495611_0181751 3300046648 Bacteria 983
601 Ga0495611_0312242 3300046648 Bacteria 724
602 Ga0495635_0346661 3300046663 Bacteria 991
603 Ga0495635_0469933 3300046663 Bacteria 830
604 Ga0495635_0512927 3300046663 Bacteria 788
605 Ga0495659_0021997 3300046664 Bacteria 2153
606 Ga0495659_0023062 3300046664 Bacteria 2111
607 Ga0495659_0149273 3300046664 Bacteria 938
608 Ga0495659_0203536 3300046664 Bacteria 813
609 Ga0495661_0033110 3300046665 Bacteria 3262
610 Ga0495588_0046383 3300046674 Bacteria 2229
611 Ga0495588_0702528 3300046674 Unclassified 529
612 Ga0495657_0686664 3300046675 Bacteria 589
613 Ga0495647_0121759 3300046681 Bacteria 1098
614 Ga0495647_0140307 3300046681 Bacteria 1030
615 Ga0495658_0202870 3300046683 Bacteria 1236
616 Ga0495658_0281875 3300046683 Bacteria 1049
617 Ga0495669_0062801 3300046684 Bacteria 1684
618 Ga0495624_0035274 3300046690 Bacteria 3230
619 Ga0495670_0021716 3300046691 Bacteria 3167
620 Ga0495670_0046037 3300046691 Bacteria 2179
621 Ga0495670_0104931 3300046691 Bacteria 1459
622 Ga0495589_0043884 3300046794 Bacteria 2225
623 Ga0495589_0201273 3300046794 Bacteria 940
624 Ga0495581_0004869 3300047315 Bacteria 7767
625 Ga0495581_0021948 3300047315 Bacteria 3700
626 Ga0495581_0204859 3300047315 Bacteria 1154
627 Ga0495636_0043928 3300047318 Bacteria 1860
628 Ga0495674_0071600 3300047319 Bacteria 2992
629 Ga0495676_0004151 3300047321 Bacteria 13213
630 Ga0495680_0081152 3300047322 Bacteria 2449
631 Ga0495683_0035790 3300047323 Bacteria 2523
632 Ga0495675_0607961 3300047444 Bacteria 619
633 Ga0495679_067463 3300047446 Bacteria 1036
634 Ga0495685_056886 3300047447 Bacteria 1322
635 Ga0495593_0492423 3300047673 Bacteria 614
636 Ga0495626_0341947 3300048091 Bacteria 585
637 Ga0496100_0288154 3300048903 Bacteria 1226
638 Ga0496100_0421881 3300048903 Bacteria 1019
639 Ga0496100_0572590 3300048903 Bacteria 875
640 Ga0496101_0005772 3300048904 Bacteria 7914
641 Ga0496101_0128409 3300048904 Bacteria 1923
642 Ga0496101_0141502 3300048904 Bacteria 1834
643 Ga0496101_0141761 3300048904 Bacteria 1832
644 Ga0496102_0001550 3300048905 Bacteria 20301
645 Ga0496102_0076483 3300048905 Bacteria 3079
646 Ga0496102_0114636 3300048905 Bacteria 2514
647 Ga0496102_0270115 3300048905 Bacteria 1603
648 Ga0496103_0000709 3300048906 Bacteria 24669
649 Ga0496103_0024392 3300048906 Bacteria 3651
650 Ga0496103_0041314 3300048906 Bacteria 2835
651 Ga0496103_0189100 3300048906 Bacteria 1324
652 Ga0496104_0000803 3300048907 Bacteria 27008
653 Ga0496104_0011491 3300048907 Bacteria 7933
654 Ga0496104_0067409 3300048907 Bacteria 3400
655 Ga0496104_0134388 3300048907 Bacteria 2376
656 Ga0496104_0357110 3300048907 Bacteria 1374
657 Ga0496104_0901404 3300048907 Bacteria 789
658 Ga0496105_0001672 3300048908 Bacteria 15803
659 Ga0496105_0010159 3300048908 Bacteria 7396
660 Ga0496105_0020745 3300048908 Bacteria 5312
661 Ga0496105_0172392 3300048908 Bacteria 1773
662 Ga0496105_0315132 3300048908 Bacteria 1255
663 Ga0496106_0010527 3300048909 Bacteria 6831
664 Ga0496106_0072159 3300048909 Bacteria 2640
665 Ga0496106_0341472 3300048909 Bacteria 1202
666 Ga0496106_0430180 3300048909 Bacteria 1061
667 Ga0496107_0002375 3300048910 Bacteria 12187
668 Ga0496107_0354901 3300048910 Bacteria 1091
669 Ga0496107_0659010 3300048910 Unclassified 771
670 Ga0496108_0008456 3300048911 Bacteria 8350
671 Ga0496108_0037234 3300048911 Bacteria 4051
672 Ga0496108_0107151 3300048911 Bacteria 2386
673 Ga0496108_0248562 3300048911 Bacteria 1547
674 Ga0496108_0910950 3300048911 Unclassified 754
675 Ga0496108_0936846 3300048911 Bacteria 742
676 Ga0496109_0000662 3300048912 Bacteria 28563
677 Ga0496109_0003962 3300048912 Bacteria 12362
678 Ga0496109_0007085 3300048912 Bacteria 9464
679 Ga0496109_0018429 3300048912 Bacteria 6133
680 Ga0496109_0025576 3300048912 Bacteria 5262
681 Ga0496109_0187327 3300048912 Bacteria 1944
682 Ga0496109_0995315 3300048912 Bacteria 776
683 Ga0496110_0000069 3300048913 Bacteria 51597
684 Ga0496110_0002879 3300048913 Bacteria 13005
685 Ga0496110_0003806 3300048913 Bacteria 11628
686 Ga0496110_0004602 3300048913 Bacteria 10717
687 Ga0496110_0014207 3300048913 Bacteria 6606
688 Ga0496110_0058040 3300048913 Bacteria 3408
689 Ga0496110_0555905 3300048913 Bacteria 1043
690 Ga0496110_0561886 3300048913 Bacteria 1037
691 Ga0496110_0704411 3300048913 Unclassified 911
692 Ga0496111_0001356 3300048914 Bacteria 13855
693 Ga0496111_0001848 3300048914 Bacteria 12482
694 Ga0496111_0005616 3300048914 Bacteria 8067
695 Ga0496111_0009977 3300048914 Bacteria 6352
696 Ga0496111_0010981 3300048914 Bacteria 6093
697 Ga0496111_0056769 3300048914 Bacteria 2833
698 Ga0496111_0076966 3300048914 Bacteria 2432
699 Ga0496111_0100563 3300048914 Bacteria 2124
700 Ga0496111_0215093 3300048914 Bacteria 1428
701 Ga0496112_0001443 3300048915 Bacteria 18248
702 Ga0496112_0074821 3300048915 Bacteria 3349
703 Ga0496112_0202690 3300048915 Bacteria 1943
704 Ga0496112_0281173 3300048915 Bacteria 1611
705 Ga0496112_0807110 3300048915 Bacteria 863
706 Ga0496112_0857857 3300048915 Bacteria 831
707 Ga0496112_1337582 3300048915 Bacteria 632
708 Ga0496113_0148359 3300048916 Bacteria 1849
709 Ga0496113_0236824 3300048916 Bacteria 1456
710 Ga0496114_0007482 3300048917 Bacteria 8636
711 Ga0496114_0012525 3300048917 Bacteria 6791
712 Ga0496114_0020054 3300048917 Bacteria 5423
713 Ga0496114_0370776 3300048917 Bacteria 1267
714 Ga0496114_1173216 3300048917 Bacteria 654
715 Ga0496115_0000825 3300048918 Bacteria 22720
716 Ga0496115_0071682 3300048918 Bacteria 2810
717 Ga0496115_0341877 3300048918 Bacteria 1221
718 Ga0496115_0861047 3300048918 Bacteria 701
719 Ga0496121_0835697 3300048924 Bacteria 537
720 Ga0501031_0009418 3300049568 Bacteria 6346
721 Ga0501031_0011087 3300049568 Bacteria 5875
722 Ga0501031_0115168 3300049568 Bacteria 1756
723 Ga0501031_0767091 3300049568 Bacteria 619
724 Ga0501032_0076899 3300049569 Bacteria 2222
725 Ga0501033_0114527 3300049570 Bacteria 1960
726 Ga0501033_0518041 3300049570 Bacteria 824
727 Ga0501033_0626506 3300049570 Bacteria 736
728 Ga0501036_0056709 3300049572 Bacteria 3319
729 Ga0501036_0173118 3300049572 Bacteria 1818
730 Ga0501036_0282143 3300049572 Bacteria 1390
731 Ga0501036_0759901 3300049572 Bacteria 799
732 Ga0501036_1423778 3300049572 Unclassified 562
733 Ga0501037_0224586 3300049573 Bacteria 1320
734 Ga0501038_0192372 3300049574 Bacteria 1641
735 Ga0501038_0371508 3300049574 Bacteria 1111
736 Ga0501039_0004144 3300049575 Bacteria 10909
737 Ga0501039_0039941 3300049575 Bacteria 3623
738 Ga0501039_0351550 3300049575 Bacteria 1158
739 Ga0501039_0678584 3300049575 Bacteria 806
740 Ga0501040_0020185 3300049576 Bacteria 4439
741 Ga0501040_0046535 3300049576 Bacteria 2961
742 Ga0501040_0231730 3300049576 Bacteria 1315
743 Ga0501041_0001903 3300049577 Bacteria 11701
744 Ga0501042_0001051 3300049578 Bacteria 15754
745 Ga0501042_0005040 3300049578 Bacteria 8467
746 Ga0501042_0006441 3300049578 Bacteria 7619
747 Ga0501042_0012515 3300049578 Bacteria 5750
748 Ga0501042_0030354 3300049578 Bacteria 3816
749 Ga0501043_0166228 3300049579 Bacteria 1723
750 Ga0501043_0171356 3300049579 Bacteria 1693
751 Ga0501043_0200743 3300049579 Bacteria 1548
752 Ga0501043_0423402 3300049579 Bacteria 1003
753 Ga0501046_0020910 3300049580 Bacteria 5404
754 Ga0501046_0040516 3300049580 Bacteria 3721
755 Ga0501046_1139531 3300049580 Bacteria 538
756 Ga0501046_1211013 3300049580 Bacteria 518
757 Ga0501048_0024758 3300049582 Bacteria 4378
758 Ga0501048_0027540 3300049582 Bacteria 4129
759 Ga0501048_0038723 3300049582 Bacteria 3421
760 Ga0501048_0398232 3300049582 Bacteria 984
761 Ga0501048_0565149 3300049582 Bacteria 816
762 Ga0501067_0006236 3300049583 Bacteria 6612
763 Ga0501068_0015242 3300049584 Bacteria 4410
764 Ga0501068_0036329 3300049584 Bacteria 2945
765 Ga0501068_0120314 3300049584 Bacteria 1637
766 Ga0501068_0210561 3300049584 Bacteria 1234
767 Ga0501068_0622562 3300049584 Bacteria 704
768 Ga0501069_0102500 3300049585 Bacteria 1625
769 Ga0501069_0701816 3300049585 Bacteria 610
770 Ga0501070_0353778 3300049586 Bacteria 1192
771 Ga0501071_0005719 3300049587 Bacteria 8020
772 Ga0501071_0071460 3300049587 Bacteria 2530
773 Ga0501071_0219109 3300049587 Bacteria 1432
774 Ga0501071_0242359 3300049587 Bacteria 1359
775 Ga0501071_0246051 3300049587 Bacteria 1349
776 Ga0501071_0307130 3300049587 Bacteria 1203
777 Ga0501071_0339917 3300049587 Bacteria 1141
778 Ga0501071_1014750 3300049587 Bacteria 641
779 Ga0501072_0039166 3300049588 Bacteria 3722
780 Ga0501072_0045774 3300049588 Bacteria 3441
781 Ga0501072_0047917 3300049588 Bacteria 3365
782 Ga0501074_0027588 3300049590 Bacteria 4117
783 Ga0501074_0048229 3300049590 Bacteria 3077
784 Ga0501074_0073793 3300049590 Bacteria 2450
785 Ga0501075_0000417 3300049591 Bacteria 24878
786 Ga0501075_0005234 3300049591 Bacteria 8869
787 Ga0501075_0031369 3300049591 Bacteria 3944
788 Ga0501075_0038898 3300049591 Bacteria 3557
789 Ga0501075_0298156 3300049591 Bacteria 1228
790 Ga0501076_0007615 3300049592 Bacteria 7884
791 Ga0501076_0012737 3300049592 Bacteria 6294
792 Ga0501076_0091125 3300049592 Bacteria 2452
793 Ga0501076_0217349 3300049592 Bacteria 1562
794 Ga0501076_0294486 3300049592 Bacteria 1330
795 Ga0501076_0317580 3300049592 Bacteria 1278
796 Ga0501076_0431188 3300049592 Bacteria 1085
797 Ga0501076_0687065 3300049592 Bacteria 845
798 Ga0501077_0012943 3300049593 Bacteria 5226
799 Ga0501077_0036344 3300049593 Bacteria 3137
800 Ga0501077_0104277 3300049593 Bacteria 1797
801 Ga0501077_0162591 3300049593 Bacteria 1418
802 Ga0501077_0300754 3300049593 Bacteria 1022
803 Ga0501208_160018 3300049655 Bacteria 513
804 Ga0501079_0006300 3300049741 Bacteria 8897
805 Ga0501079_0006761 3300049741 Bacteria 8625
806 Ga0501079_0319335 3300049741 Bacteria 1216
807 Ga0501079_0411613 3300049741 Bacteria 1061
808 Ga0501079_0677892 3300049741 Unclassified 811
809 Ga0501080_0057336 3300049742 Bacteria 3626
810 Ga0501080_0091287 3300049742 Bacteria 2829
811 Ga0501080_0123524 3300049742 Bacteria 2398
812 Ga0501080_0260584 3300049742 Bacteria 1580
813 Ga0501080_0808106 3300049742 Bacteria 822
814 Ga0501081_0003476 3300049743 Bacteria 10064
815 Ga0501081_0039204 3300049743 Bacteria 3241
816 Ga0501081_0050396 3300049743 Bacteria 2868
817 Ga0501081_0061639 3300049743 Bacteria 2601
818 Ga0501081_0189163 3300049743 Bacteria 1490
819 Ga0501083_0175986 3300049744 Bacteria 1398
820 Ga0501083_0603097 3300049744 Bacteria 714
821 Ga0501035_0108969 3300049822 Bacteria 2428
822 Ga0501035_0199402 3300049822 Bacteria 1717
823 Ga0501044_0227767 3300049823 Bacteria 1813
824 Ga0501045_0000641 3300049824 Bacteria 22097
825 Ga0501045_0014566 3300049824 Bacteria 5573
826 Ga0501045_0040011 3300049824 Bacteria 3411
827 Ga0501045_0183725 3300049824 Bacteria 1558
828 Ga0501045_0230074 3300049824 Bacteria 1380
829 Ga0501045_0243087 3300049824 Bacteria 1340
830 Ga0501045_0424145 3300049824 Bacteria 989
831 Ga0501045_1165259 3300049824 Unclassified 563
832 nmdc:mga05p37_13440_c1 3300050507 Bacteria 9810
833 nmdc:mga05p37_193701_c1 3300050507 Bacteria 2466
834 nmdc:mga05p37_366031_c1 3300050507 Bacteria 1693
835 nmdc:mga05p37_42536_c1 3300050507 Bacteria 5583
836 nmdc:mga05p37_662919_c1 3300050507 Bacteria 1166
837 nmdc:mga05p37_7656_c1 3300050507 Bacteria 12743
838 nmdc:mga09592_1046281_c1 3300050508 Unclassified 680
839 nmdc:mga09592_38915_c1 3300050508 Bacteria 3993
840 nmdc:mga06r32_159138_c1 3300050510 Bacteria 2240
841 nmdc:mga06r32_769532_c1 3300050510 Bacteria 925
842 nmdc:mga08y16_131094_c1 3300050511 Bacteria 1070
843 nmdc:mga08y16_166795_c1 3300050511 Bacteria 2288
844 nmdc:mga08y16_293013_c1 3300050511 Bacteria 1678
845 nmdc:mga08y16_664050_c1 3300050511 Bacteria 1045
846 nmdc:mga0n895_1119_c1 3300050512 Bacteria 19568
847 nmdc:mga0n895_113216_c1 3300050512 Bacteria 2730
848 nmdc:mga0n895_16096_c1 3300050512 Bacteria 6854
849 nmdc:mga0rr50_4220_c1 3300050513 Bacteria 6513
850 nmdc:mga0rr50_516849_c1 3300050513 Bacteria 1016
851 nmdc:mga0rr50_8094_c1 3300050513 Bacteria 6525
852 nmdc:mga08x19_438674_c1 3300050514 Bacteria 918
853 nmdc:mga08x19_59975_c1 3300050514 Bacteria 2464
854 nmdc:mga08x19_699536_c1 3300050514 Unclassified 719
855 nmdc:mga0a205_2266_c1 3300050515 Bacteria 16972
856 nmdc:mga0a205_42350_c1 3300050515 Bacteria 4388
857 Ga0495601_0272111 3300053077 Bacteria 1105
858 Ga0495601_0351090 3300053077 Bacteria 959
859 Ga0495619_0088783 3300053085 Bacteria 2091
860 Ga0495619_0468502 3300053085 Bacteria 868
861 Ga0501084_0003291 3300054114 Bacteria 13074
862 Ga0501084_0007290 3300054114 Bacteria 9113
863 Ga0501084_0078799 3300054114 Bacteria 2761
864 Ga0501084_0191850 3300054114 Bacteria 1724
865 Ga0501084_0230456 3300054114 Bacteria 1563
866 Ga0501084_0932146 3300054114 Bacteria 730
867 Ga0590071_048109 3300059421 Bacteria 1032
868 Ga0590075_017006 3300059424 Bacteria 1790
869 Ga0501082_0014301 3300060353 Bacteria 6831
870 Ga0501082_0051983 3300060353 Bacteria 3531
871 Ga0501082_0103270 3300060353 Bacteria 2465
872 Ga0501082_0106168 3300060353 Bacteria 2430
873 Ga0501082_0255075 3300060353 Bacteria 1526
874 Ga0501082_0389839 3300060353 Bacteria 1215
875 Ga0501082_0417339 3300060353 Bacteria 1172
876 Ga0530510_0010056 3300061734 Bacteria 6636
877 Ga0530510_0011529 3300061734 Bacteria 6203
878 Ga0530510_0012239 3300061734 Bacteria 6021
879 Ga0530510_0049750 3300061734 Bacteria 3027
880 Ga0530510_0107487 3300061734 Bacteria 2042
881 Ga0530510_0272436 3300061734 Bacteria 1263
882 Ga0530510_0363853 3300061734 Bacteria 1087
883 Ga0070694_100452401
884 JGI24744J21845_10001169
885 JGI24742J22300_10084959
886 Ga0070658_10058131
887 Ga0070683_100569378
888 Ga0070690_100031769
889 Ga0068869_100050871
890 Ga0070666_10175133
891 Ga0070680_100071045
892 Ga0070680_100854429
893 Ga0070682_100001046
894 Ga0068868_100058497
895 Ga0070689_100287309
896 Ga0070691_10090809
897 Ga0070691_10159504
898 Ga0070691_10570362
899 Ga0070687_100500620
900 Ga0070687_100677160
901 Ga0070692_10002003
902 Ga0070668_100012259
903 Ga0070668_100034924
904 Ga0070675_100202397
905 Ga0070675_100605871
906 Ga0070671_100072789
907 Ga0070671_100512946
908 Ga0070674_100024562
909 Ga0070674_100181585
910 Ga0070674_100359338
911 Ga0070674_100363118
912 Ga0070673_100803033
913 Ga0070673_101220581
914 Ga0070688_100201718
915 Ga0070688_101299645
916 Ga0070659_100136339
917 Ga0070659_100790410
918 Ga0070659_100930750
919 Ga0070667_100046836
920 Ga0070667_100499480
921 Ga0070709_10048366
922 Ga0070709_10298707
923 Ga0070714_100094702
924 Ga0070713_100002608
925 Ga0070713_100345956
926 Ga0070713_100524987
927 Ga0070710_10129351
928 Ga0070710_10808570
929 Ga0070701_10019274
930 Ga0070711_100005726
931 Ga0070711_100382950
932 Ga0070711_101034839
933 Ga0070705_101210946
934 Ga0070700_100005993
935 Ga0070700_100837370
936 Ga0070700_100853401
937 Ga0070700_100946160
938 Ga0070694_100377541
939 Ga0070708_100773722
940 Ga0070663_100533528
941 Ga0070678_100067067
942 Ga0070678_100216248
943 Ga0070678_100862099
944 Ga0070662_100002641
945 Ga0070662_100540940
946 Ga0070681_11444782
947 Ga0068867_100000290
948 Ga0068867_100123672
949 Ga0070685_10375194
950 Ga0070685_10587107
951 Ga0070706_100087854
952 Ga0070706_100101363
953 Ga0070706_100203140
954 Ga0070706_100218127
955 Ga0070706_101077316
956 Ga0070707_100001362
957 Ga0070707_100033547
958 Ga0070698_100008838
959 Ga0070698_100220818
960 Ga0070698_100253971
961 Ga0070698_100617921
962 Ga0070698_101239288
963 Ga0070698_101971946
964 Ga0070699_100008741
965 Ga0070699_101596644
966 Ga0070679_101358163
967 Ga0070679_101788134
968 Ga0070684_100069573
969 Ga0070684_100745322
970 Ga0070684_100860323
971 Ga0070684_100999743
972 Ga0070684_102049697
973 Ga0070697_100894348
974 Ga0070697_101465776
975 Ga0070672_100143591
976 Ga0070672_100332673
977 Ga0070672_100677723
978 Ga0070686_100009901
979 Ga0070686_100235823
980 Ga0070695_100054146
981 Ga0070695_100076816
982 Ga0070695_100652978
983 Ga0070696_100483196
984 Ga0070696_101003362
985 Ga0070693_100419747
986 Ga0070665_100394905
987 Ga0070704_100162689
988 Ga0070704_100244948
989 Ga0070704_100294518
990 Ga0068855_100073422
991 Ga0070664_100457987
992 Ga0070664_101113451
993 Ga0068857_100002943
994 Ga0068857_100125918
995 Ga0068854_101195780
996 Ga0068854_101295586
997 Ga0068856_100002162
998 Ga0068856_100575270
999 Ga0068856_100904107
1000 Ga0068856_101270323
1001 Ga0070702_100018760
1002 Ga0070702_101343143
1003 Ga0068852_100461231
1004 Ga0068864_100868382
1005 Ga0068864_100889562
1006 Ga0068864_101093505
1007 Ga0068866_10000154
1008 Ga0068866_10072391
1009 Ga0068861_100001783
1010 Ga0068861_100137079
1011 Ga0068861_101020390
1012 Ga0068851_10960056
1013 Ga0068858_100306160
1014 Ga0068858_100486134
1015 Ga0068858_101049780
1016 Ga0068860_100065963
1017 Ga0068860_100812165
1018 Ga0068862_100178671
1019 Ga0068862_101069525
1020 Ga0081455_10059969
1021 Ga0081455_10096923
1022 Ga0081538_10020315
1023 Ga0081538_10031392
1024 Ga0081538_10034449
1025 Ga0081538_10070154
1026 Ga0081539_10000397
1027 Ga0081539_10002620
1028 Ga0081539_10028254
1029 Ga0081539_10202314
1030 Ga0070717_10014641
1031 Ga0070717_10567166
1032 Ga0070717_10712779
1033 Ga0075432_10026251
1034 Ga0070715_10197078
1035 Ga0070715_10375126
1036 Ga0070716_100046618
1037 Ga0070716_100219372
1038 Ga0070716_100952342
1039 Ga0070712_100316251
1040 Ga0070712_100729723
1041 Ga0070712_101197639
1042 Ga0070712_101521670
1043 Ga0075367_10017297
1044 Ga0097621_100396606
1045 Ga0097621_101085331
1046 Ga0075428_100001324
1047 Ga0075428_100008062
1048 Ga0075428_100083469
1049 Ga0075428_100417806
1050 Ga0075428_101130303
1051 Ga0075428_101824861
1052 Ga0075430_100045380
1053 Ga0075430_100137242
1054 Ga0075431_100120826
1055 Ga0075431_100798585
1056 Ga0075431_100841653
1057 Ga0075433_10000356
1058 Ga0075433_10000542
1059 Ga0075434_100000720
1060 Ga0075434_100045583
1061 Ga0075434_101162702
1062 Ga0075429_100069824
1063 Ga0075429_100184757
1064 Ga0075429_100370988
1065 Ga0068865_100022070
1066 Ga0075436_100071815
1067 Ga0075435_100009468
1068 Ga0075435_100082891
1069 Ga0075435_100551722
1070 Ga0111539_10014838
1071 Ga0111539_10048781
1072 Ga0111539_11114693
1073 Ga0111539_11118107
1074 Ga0111539_11889615
1075 Ga0105245_10013922
1076 Ga0105245_10206647
1077 Ga0105245_10253651
1078 Ga0105245_10382387
1079 Ga0105245_10902183
1080 Ga0105245_11081667
1081 Ga0105247_10112585
1082 Ga0114129_10005223
1083 Ga0114129_10010248
1084 Ga0114129_10031268
1085 Ga0114129_10124310
1086 Ga0114129_10211121
1087 Ga0114129_10506460
1088 Ga0114129_10547632
1089 Ga0114129_10868343
1090 Ga0114129_11062286
1091 Ga0114129_11740373
1092 Ga0105243_10001079
1093 Ga0105243_10531728
1094 Ga0105243_11048200
1095 Ga0105241_10082186
1096 Ga0105242_10228307
1097 Ga0105242_10542404
1098 Ga0105242_10554889
1099 Ga0105242_10579868
1100 Ga0105248_10022344
1101 Ga0105248_10046659
1102 Ga0105248_10088431
1103 Ga0105237_10489697
1104 Ga0105237_10539633
1105 Ga0105238_10402643
1106 Ga0105238_10826399
1107 Ga0105249_10001703
1108 Ga0105249_10004222
1109 Ga0105249_10272228
1110 Ga0105239_10001224
1111 Ga0105239_10125740
1112 Ga0105239_10297845
1113 Ga0105239_10319303
1114 Ga0105239_10331948
1115 Ga0105239_11492029
1116 Ga0105246_10236035
1117 Ga0105246_10248227
1118 Ga0105246_11288065
1119 Ga0157374_10001561
1120 Ga0157374_10148299
1121 Ga0157374_10221004
1122 Ga0157374_10952169
1123 Ga0157378_10058383
1124 Ga0157378_11285259
1125 Ga0163162_10030158
1126 Ga0163162_10038088
1127 Ga0163162_11000464
1128 Ga0157375_10101153
1129 Ga0157375_10152574
1130 Ga0157375_10795756
1131 Ga0157380_10756534
1132 Ga0157380_10889099
1133 Ga0157380_11038071
1134 Ga0157377_10026003
1135 Ga0157377_10139034
1136 Ga0157377_10432024
1137 Ga0157377_10455493
1138 Ga0157379_10725708
1139 Ga0157376_10001860
1140 Ga0157376_10495619
1141 Ga0163161_11129526
1142 Ga0206356_11460515
1143 Ga0206350_11629545
1144 Ga0207692_10153677
1145 Ga0207642_10521606
1146 Ga0207688_10143335
1147 Ga0207688_10393723
1148 Ga0207685_10023542
1149 Ga0207699_10044876
1150 Ga0207645_10287216
1151 Ga0207643_10068435
1152 Ga0207684_10080784
1153 Ga0207684_10203672
1154 Ga0207684_11035769
1155 Ga0207654_10295011
1156 Ga0207707_10700090
1157 Ga0207693_10000499
1158 Ga0207693_10098918
1159 Ga0207693_10494436
1160 Ga0207663_10373938
1161 Ga0207663_10563945
1162 Ga0207660_10009541
1163 Ga0207662_10023652
1164 Ga0207662_10169147
1165 Ga0207662_10759592
1166 Ga0207657_10120254
1167 Ga0207657_10419425
1168 Ga0207649_10915149
1169 Ga0207652_10399526
1170 Ga0207652_11488045
1171 Ga0207646_10001072
1172 Ga0207646_10027364
1173 Ga0207694_10369284
1174 Ga0207659_10275556
1175 Ga0207659_10284400
1176 Ga0207659_10885338
1177 Ga0207687_10006813
1178 Ga0207687_10017022
1179 Ga0207687_10211398
1180 Ga0207687_10295114
1181 Ga0207687_10513194
1182 Ga0207687_10514204
1183 Ga0207700_10000001
1184 Ga0207664_10172970
1185 Ga0207664_10204532
1186 Ga0207690_10176212
1187 Ga0207690_10206542
1188 Ga0207690_10837944
1189 Ga0207706_10621447
1190 Ga0207686_10000672
1191 Ga0207686_10227251
1192 Ga0207686_10422472
1193 Ga0207709_10000781
1194 Ga0207709_10040500
1195 Ga0207709_10547931
1196 Ga0207709_11204638
1197 Ga0207670_11125750
1198 Ga0207669_10032949
1199 Ga0207669_10484736
1200 Ga0207669_11003620
1201 Ga0207669_11409524
1202 Ga0207704_10001419
1203 Ga0207704_10276825
1204 Ga0207665_10143886
1205 Ga0207665_10536848
1206 Ga0207665_10823486
1207 Ga0207691_10134120
1208 Ga0207691_10143645
1209 Ga0207691_10475537
1210 Ga0207711_11074070
1211 Ga0207661_10497390
1212 Ga0207661_10524948
1213 Ga0207661_11499098
1214 Ga0207679_10772938
1215 Ga0207667_10054593
1216 Ga0207651_10481858
1217 Ga0207651_12079615
1218 Ga0207712_10007048
1219 Ga0207712_10134333
1220 Ga0207712_10155390
1221 Ga0207668_10027466
1222 Ga0207668_10212937
1223 Ga0207640_10294431
1224 Ga0207658_10012020
1225 Ga0207658_11371830
1226 Ga0207677_10370358
1227 Ga0207703_10206384
1228 Ga0207639_10567265
1229 Ga0207639_11643715
1230 Ga0207678_10215470
1231 Ga0207708_10000434
1232 Ga0207708_10385805
1233 Ga0207708_10566968
1234 Ga0207708_10712953
1235 Ga0207708_10878221
1236 Ga0207702_10020710
1237 Ga0207702_10184461
1238 Ga0207648_10015109
1239 Ga0207648_10080125
1240 Ga0207648_10232035
1241 Ga0207676_10260379
1242 Ga0207676_10441944
1243 Ga0207674_10008735
1244 Ga0207674_10090219
1245 Ga0207674_11880173
1246 Ga0207675_100022938
1247 Ga0207675_100079099
1248 Ga0207675_100079403
1249 Ga0207683_10006588
1250 Ga0207683_10302178
1251 Ga0207698_10043854
1252 Ga0207428_10042636
1253 Ga0207428_10287647
1254 Ga0268266_10212127
1255 Ga0268264_10243069
1256 Ga0268264_10821288
1257 Ga0265319_1002809
1258 Ga0265318_10005078
1259 Ga0265322_10008197
1260 Ga0265338_10028546
1261 Ga0265324_10158984
1262 Ga0265330_10013638
1263 Ga0265332_10052464
1264 Ga0265320_10012238
1265 Ga0265340_10013801
1266 Ga0265339_10042433
1267 Ga0265327_10099616
1268 Ga0265316_10031600
1269 Ga0307408_100381213
1270 Ga0307408_101011790
1271 Ga0265342_10009711
1272 Ga0307405_10024196
1273 Ga0307405_10046658
1274 Ga0307405_10387117
1275 Ga0307413_10066967
1276 Ga0307413_10607809
1277 Ga0307410_10368565
1278 Ga0307410_10491496
1279 Ga0307406_10023139
1280 Ga0307406_10050675
1281 Ga0307406_10193560
1282 Ga0307407_10017709
1283 Ga0307412_10144709
1284 Ga0307412_10611604
1285 Ga0307412_11613105
1286 Ga0307409_100090234
1287 Ga0307409_100250650
1288 Ga0307409_100259291
1289 Ga0307409_100369474
1290 Ga0307409_100604985
1291 Ga0307409_100881573
1292 Ga0307409_100912144
1293 Ga0307416_100000711
1294 Ga0307416_100015982
1295 Ga0307416_100018953
1296 Ga0307416_100120113
1297 Ga0307416_102722201
1298 Ga0307416_102836058
1299 Ga0307414_11138288
1300 Ga0307411_10091495
1301 Ga0307415_100000296
1302 Ga0307415_100010159
1303 Ga0307415_100022248
1304 Ga0307415_100098445
1305 Ga0373952_0021088
1306 Ga0373932_0099146
1307 Ga0373962_0210038
1308 Ga0373931_0333610
1309 Ga0373935_0481749
1310 Ga0373925_0109457
1311 Ga0395899_0007215
1312 Ga0395899_0007885
1313 Ga0395899_0019593
1314 Ga0395899_0027088
1315 Ga0395899_0092061
1316 Ga0395899_0159922
1317 Ga0395899_0198119
1318 Ga0395899_0198945
1319 Ga0395899_0267711
1320 Ga0395899_0415290
1321 Ga0395899_0521558
1322 Ga0395900_0000528
1323 Ga0395900_0006608
1324 Ga0395900_0040788
1325 Ga0395900_0043397
1326 Ga0395900_0054193
1327 Ga0395900_0055681
1328 Ga0395900_0072257
1329 Ga0395900_0102187
1330 Ga0395900_0108819
1331 Ga0395900_0173743
1332 Ga0395900_0180272
1333 Ga0395900_0322053
1334 Ga0395900_0344085
1335 Ga0395900_0361124
1336 Ga0395900_0442780
1337 Ga0395900_0534864
1338 Ga0395900_0577665
1339 Ga0395900_0743353
1340 Ga0395900_1189620
1341 Ga0395900_1189870
1342 Ga0395900_1408700
1343 Ga0395898_0002139
1344 Ga0395898_0012709
1345 Ga0395898_0017551
1346 Ga0395898_0020569
1347 Ga0395898_0023768
1348 Ga0395898_0033384
1349 Ga0395898_0039856
1350 Ga0395898_0067339
1351 Ga0395898_0075798
1352 Ga0395898_0086288
1353 Ga0395898_0115094
1354 Ga0395898_0158210
1355 Ga0395898_0282451
1356 Ga0395898_0344086
1357 Ga0395898_0449326
1358 Ga0395898_0768527
1359 Ga0395898_0840238
1360 Ga0395905_0000661
1361 Ga0395905_0005716
1362 Ga0395905_0009617
1363 Ga0395905_0018357
1364 Ga0395905_0031768
1365 Ga0395905_0042861
1366 Ga0395905_0079115
1367 Ga0395905_0123399
1368 Ga0395905_0141328
1369 Ga0395905_0348794
1370 Ga0395905_0366276
1371 Ga0395905_0498040
1372 Ga0395905_0511870
1373 Ga0395905_0772131
1374 Ga0395905_0886791
1375 Ga0395905_1401165
1376 Ga0395905_1589282
1377 Ga0395901_0001057
1378 Ga0395901_0003646
1379 Ga0395901_0010037
1380 Ga0395901_0010426
1381 Ga0395901_0027883
1382 Ga0395901_0048101
1383 Ga0395901_0051842
1384 Ga0395901_0069596
1385 Ga0395901_0077799
1386 Ga0395901_0091435
1387 Ga0395901_0119598
1388 Ga0395901_0151003
1389 Ga0395901_0228306
1390 Ga0395901_0253972
1391 Ga0395901_0265813
1392 Ga0395901_0406581
1393 Ga0395901_0561778
1394 Ga0395901_0636154
1395 Ga0395901_0775643
1396 Ga0395901_1238691
1397 Ga0395901_1499770
1398 Ga0439438_009923
1399 Ga0439447_012220
1400 Ga0439453_0015199
1401 Ga0439461_0002991
1402 Ga0439466_0016371
1403 Ga0439466_0095676
1404 Ga0451851_0629674
1405 Ga0439441_050794
1406 Ga0439448_0273065
1407 Ga0439450_104434
1408 Ga0439450_189859
1409 Ga0439451_007930
1410 Ga0439454_002693
1411 Ga0450920_025816
1412 Ga0450907_057246
1413 Ga0439446_0175855
1414 Ga0439446_0248797
1415 Ga0450908_036736
1416 Ga0450908_068669
1417 Ga0439434_0002257
1418 Ga0439435_0117045
1419 Ga0439464_0062743
1420 Ga0450918_020396
1421 Ga0466964_0509354
1422 Ga0466959_0136514
1423 Ga0451576_0094753
1424 Ga0466967_0037672
1425 Ga0466967_0886640
1426 Ga0495617_108492
1427 Ga0495592_0348556
1428 Ga0495603_0196635
1429 Ga0495629_0276818
1430 Ga0495629_0654585
1431 Ga0495641_0075368
1432 Ga0495641_0228901
1433 Ga0495641_0469964
1434 Ga0495580_0290624
1435 Ga0495605_0031922
1436 Ga0495584_0021737
1437 Ga0495584_0141662
1438 Ga0495584_0291524
1439 Ga0495584_0299467
1440 Ga0495585_0190406
1441 Ga0495594_0084953
1442 Ga0495596_0182289
1443 Ga0495596_0212563
1444 Ga0495607_0022098
1445 Ga0495607_0149141
1446 Ga0495618_0122205
1447 Ga0495618_0369289
1448 Ga0495628_0626390
1449 Ga0495630_1092020
1450 Ga0495631_0076423
1451 Ga0495632_0279859
1452 Ga0495637_0072469
1453 Ga0495637_0091439
1454 Ga0495644_0160770
1455 Ga0495644_0289793
1456 Ga0495663_0008460
1457 Ga0495663_0075881
1458 Ga0495663_0208677
1459 Ga0495666_0067277
1460 Ga0495642_0042323
1461 Ga0495642_0107583
1462 Ga0495642_0277280
1463 Ga0495642_0330969
1464 Ga0495665_0092511
1465 Ga0495640_0203225
1466 Ga0495598_0005842
1467 Ga0495598_0360113
1468 Ga0495609_0042648
1469 Ga0495609_0102527
1470 Ga0495609_0236774
1471 Ga0495597_0077576
1472 Ga0495622_0310036
1473 Ga0495633_0090439
1474 Ga0495633_0529944
1475 Ga0495667_0449538
1476 Ga0495656_0003173
1477 Ga0495656_0121388
1478 Ga0495656_0135081
1479 Ga0495656_0360918
1480 Ga0495668_0046983
1481 Ga0495634_0086870
1482 Ga0495611_0181751
1483 Ga0495611_0312242
1484 Ga0495635_0346661
1485 Ga0495635_0469933
1486 Ga0495635_0512927
1487 Ga0495659_0021997
1488 Ga0495659_0023062
1489 Ga0495659_0149273
1490 Ga0495659_0203536
1491 Ga0495661_0033110
1492 Ga0495588_0046383
1493 Ga0495588_0702528
1494 Ga0495657_0686664
1495 Ga0495647_0121759
1496 Ga0495647_0140307
1497 Ga0495658_0202870
1498 Ga0495658_0281875
1499 Ga0495669_0062801
1500 Ga0495624_0035274
1501 Ga0495670_0021716
1502 Ga0495670_0046037
1503 Ga0495670_0104931
1504 Ga0495589_0043884
1505 Ga0495589_0201273
1506 Ga0495581_0004869
1507 Ga0495581_0021948
1508 Ga0495581_0204859
1509 Ga0495636_0043928
1510 Ga0495674_0071600
1511 Ga0495676_0004151
1512 Ga0495680_0081152
1513 Ga0495683_0035790
1514 Ga0495675_0607961
1515 Ga0495679_067463
1516 Ga0495685_056886
1517 Ga0495593_0492423
1518 Ga0495626_0341947
1519 Ga0496100_0288154
1520 Ga0496100_0421881
1521 Ga0496100_0572590
1522 Ga0496101_0005772
1523 Ga0496101_0128409
1524 Ga0496101_0141502
1525 Ga0496101_0141761
1526 Ga0496102_0001550
1527 Ga0496102_0076483
1528 Ga0496102_0114636
1529 Ga0496102_0270115
1530 Ga0496103_0000709
1531 Ga0496103_0024392
1532 Ga0496103_0041314
1533 Ga0496103_0189100
1534 Ga0496104_0000803
1535 Ga0496104_0011491
1536 Ga0496104_0067409
1537 Ga0496104_0134388
1538 Ga0496104_0357110
1539 Ga0496104_0901404
1540 Ga0496105_0001672
1541 Ga0496105_0010159
1542 Ga0496105_0020745
1543 Ga0496105_0172392
1544 Ga0496105_0315132
1545 Ga0496106_0010527
1546 Ga0496106_0072159
1547 Ga0496106_0341472
1548 Ga0496106_0430180
1549 Ga0496107_0002375
1550 Ga0496107_0354901
1551 Ga0496107_0659010
1552 Ga0496108_0008456
1553 Ga0496108_0037234
1554 Ga0496108_0107151
1555 Ga0496108_0248562
1556 Ga0496108_0910950
1557 Ga0496108_0936846
1558 Ga0496109_0000662
1559 Ga0496109_0003962
1560 Ga0496109_0007085
1561 Ga0496109_0018429
1562 Ga0496109_0025576
1563 Ga0496109_0187327
1564 Ga0496109_0995315
1565 Ga0496110_0000069
1566 Ga0496110_0002879
1567 Ga0496110_0003806
1568 Ga0496110_0004602
1569 Ga0496110_0014207
1570 Ga0496110_0058040
1571 Ga0496110_0555905
1572 Ga0496110_0561886
1573 Ga0496110_0704411
1574 Ga0496111_0001356
1575 Ga0496111_0001848
1576 Ga0496111_0005616
1577 Ga0496111_0009977
1578 Ga0496111_0010981
1579 Ga0496111_0056769
1580 Ga0496111_0076966
1581 Ga0496111_0100563
1582 Ga0496111_0215093
1583 Ga0496112_0001443
1584 Ga0496112_0074821
1585 Ga0496112_0202690
1586 Ga0496112_0281173
1587 Ga0496112_0807110
1588 Ga0496112_0857857
1589 Ga0496112_1337582
1590 Ga0496113_0148359
1591 Ga0496113_0236824
1592 Ga0496114_0007482
1593 Ga0496114_0012525
1594 Ga0496114_0020054
1595 Ga0496114_0370776
1596 Ga0496114_1173216
1597 Ga0496115_0000825
1598 Ga0496115_0071682
1599 Ga0496115_0341877
1600 Ga0496115_0861047
1601 Ga0496121_0835697
1602 Ga0501031_0009418
1603 Ga0501031_0011087
1604 Ga0501031_0115168
1605 Ga0501031_0767091
1606 Ga0501032_0076899
1607 Ga0501033_0114527
1608 Ga0501033_0518041
1609 Ga0501033_0626506
1610 Ga0501036_0056709
1611 Ga0501036_0173118
1612 Ga0501036_0282143
1613 Ga0501036_0759901
1614 Ga0501036_1423778
1615 Ga0501037_0224586
1616 Ga0501038_0192372
1617 Ga0501038_0371508
1618 Ga0501039_0004144
1619 Ga0501039_0039941
1620 Ga0501039_0351550
1621 Ga0501039_0678584
1622 Ga0501040_0020185
1623 Ga0501040_0046535
1624 Ga0501040_0231730
1625 Ga0501041_0001903
1626 Ga0501042_0001051
1627 Ga0501042_0005040
1628 Ga0501042_0006441
1629 Ga0501042_0012515
1630 Ga0501042_0030354
1631 Ga0501043_0166228
1632 Ga0501043_0171356
1633 Ga0501043_0200743
1634 Ga0501043_0423402
1635 Ga0501046_0020910
1636 Ga0501046_0040516
1637 Ga0501046_1139531
1638 Ga0501046_1211013
1639 Ga0501048_0024758
1640 Ga0501048_0027540
1641 Ga0501048_0038723
1642 Ga0501048_0398232
1643 Ga0501048_0565149
1644 Ga0501067_0006236
1645 Ga0501068_0015242
1646 Ga0501068_0036329
1647 Ga0501068_0120314
1648 Ga0501068_0210561
1649 Ga0501068_0622562
1650 Ga0501069_0102500
1651 Ga0501069_0701816
1652 Ga0501070_0353778
1653 Ga0501071_0005719
1654 Ga0501071_0071460
1655 Ga0501071_0219109
1656 Ga0501071_0242359
1657 Ga0501071_0246051
1658 Ga0501071_0307130
1659 Ga0501071_0339917
1660 Ga0501071_1014750
1661 Ga0501072_0039166
1662 Ga0501072_0045774
1663 Ga0501072_0047917
1664 Ga0501074_0027588
1665 Ga0501074_0048229
1666 Ga0501074_0073793
1667 Ga0501075_0000417
1668 Ga0501075_0005234
1669 Ga0501075_0031369
1670 Ga0501075_0038898
1671 Ga0501075_0298156
1672 Ga0501076_0007615
1673 Ga0501076_0012737
1674 Ga0501076_0091125
1675 Ga0501076_0217349
1676 Ga0501076_0294486
1677 Ga0501076_0317580
1678 Ga0501076_0431188
1679 Ga0501076_0687065
1680 Ga0501077_0012943
1681 Ga0501077_0036344
1682 Ga0501077_0104277
1683 Ga0501077_0162591
1684 Ga0501077_0300754
1685 Ga0501208_160018
1686 Ga0501079_0006300
1687 Ga0501079_0006761
1688 Ga0501079_0319335
1689 Ga0501079_0411613
1690 Ga0501079_0677892
1691 Ga0501080_0057336
1692 Ga0501080_0091287
1693 Ga0501080_0123524
1694 Ga0501080_0260584
1695 Ga0501080_0808106
1696 Ga0501081_0003476
1697 Ga0501081_0039204
1698 Ga0501081_0050396
1699 Ga0501081_0061639
1700 Ga0501081_0189163
1701 Ga0501083_0175986
1702 Ga0501083_0603097
1703 Ga0501035_0108969
1704 Ga0501035_0199402
1705 Ga0501044_0227767
1706 Ga0501045_0000641
1707 Ga0501045_0014566
1708 Ga0501045_0040011
1709 Ga0501045_0183725
1710 Ga0501045_0230074
1711 Ga0501045_0243087
1712 Ga0501045_0424145
1713 Ga0501045_1165259
1714 nmdc:mga05p37_13440_c1
1715 nmdc:mga05p37_193701_c1
1716 nmdc:mga05p37_366031_c1
1717 nmdc:mga05p37_42536_c1
1718 nmdc:mga05p37_662919_c1
1719 nmdc:mga05p37_7656_c1
1720 nmdc:mga09592_1046281_c1
1721 nmdc:mga09592_38915_c1
1722 nmdc:mga06r32_159138_c1
1723 nmdc:mga06r32_769532_c1
1724 nmdc:mga08y16_131094_c1
1725 nmdc:mga08y16_166795_c1
1726 nmdc:mga08y16_293013_c1
1727 nmdc:mga08y16_664050_c1
1728 nmdc:mga0n895_1119_c1
1729 nmdc:mga0n895_113216_c1
1730 nmdc:mga0n895_16096_c1
1731 nmdc:mga0rr50_4220_c1
1732 nmdc:mga0rr50_516849_c1
1733 nmdc:mga0rr50_8094_c1
1734 nmdc:mga08x19_438674_c1
1735 nmdc:mga08x19_59975_c1
1736 nmdc:mga08x19_699536_c1
1737 nmdc:mga0a205_2266_c1
1738 nmdc:mga0a205_42350_c1
1739 Ga0495601_0272111
1740 Ga0495601_0351090
1741 Ga0495619_0088783
1742 Ga0495619_0468502
1743 Ga0501084_0003291
1744 Ga0501084_0007290
1745 Ga0501084_0078799
1746 Ga0501084_0191850
1747 Ga0501084_0230456
1748 Ga0501084_0932146
1749 Ga0590071_048109
1750 Ga0590075_017006
1751 Ga0501082_0014301
1752 Ga0501082_0051983
1753 Ga0501082_0103270
1754 Ga0501082_0106168
1755 Ga0501082_0255075
1756 Ga0501082_0389839
1757 Ga0501082_0417339
1758 Ga0530510_0010056
1759 Ga0530510_0011529
1760 Ga0530510_0012239
1761 Ga0530510_0049750
1762 Ga0530510_0107487
1763 Ga0530510_0272436
1764 Ga0530510_0363853

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

30

174

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9i-assembly1.cif.gz_E mycobacterial respiratory complex i, semi-inserted quinone 0.8962 3 152
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8777 1 150
4uq8-assembly1.cif.gz_E electron cryo-microscopy of bovine complex i 0.8724 42 152
7ak6-assembly1.cif.gz_E cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.8704 5 155
6zjy-assembly1.cif.gz_2 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.868 6 154
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9512 69 150 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.951 70 154 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9294 69 150 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9278 70 154 3.40.30.10
2fug202 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8758 70 155 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C1DR85-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.9217 9 154 GO:0003954
GO:0046872
GO:0051537
AF-A0A838GK68-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.9164 9 154 GO:0003954
GO:0046872
GO:0051537
AF-A0A1Q2MAN0-F1-model_v4 NADP-reducing hydrogenase subunit HndA (EC 1.12.1.3) 0.9158 15 151 GO:0046872
GO:0050583
GO:0051537
AF-A0LRI5-F1-model_v4 NADH dehydrogenase subunit E (EC 1.6.5.3) 0.9117 4 154 GO:0003954
GO:0046872
GO:0051537
AF-A0A7V3FTB0-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9113 20 155 GO:0016491
GO:0046872
GO:0051537

Map