F484512
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 881 | 448 | 1762 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100070437|Ga0070713_1000704372 |
| Length | 254 |
| Sequence | MSDRYDCSDPEQRAAGLKAAVEAVHRGELIVLPTDTVYGIGAEAFSPAAITSLLAAKQRGRDMPPPVLVGTVRAATALVEELSDAGRDLIGEFWPGGLTLVCRAQRMLSWDLGDTRGTVAIRMPLHPVALDLLKETGPLAVSSANVSGMPAAATVDEAVDQLGDTVAVFLDDGPATGGVPSTIVDLTGVIPKLLRAGAIPVDELNAVSFVSTGPEPAEDAVSDAYPMAPGTGRPSAPGGDSAADHAPGERRESP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 110 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 111 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 116 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 117 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 134 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 136 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 137 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 140 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 141 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 142 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 143 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 144 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 145 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 146 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 147 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 148 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 149 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 150 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 151 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 152 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 153 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 154 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 155 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 156 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 157 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 158 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 159 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 160 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 161 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 162 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 163 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 164 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 169 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 170 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 171 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 172 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 319 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 322 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 324 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 326 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 330 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 331 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 332 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 336 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 339 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 340 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 341 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 342 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 343 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 344 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 345 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 346 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 347 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 348 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 349 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 350 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 351 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 352 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 353 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 354 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 355 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 356 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 357 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 358 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 359 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 360 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 361 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 362 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 363 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 364 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 365 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 366 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 367 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 368 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 369 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 370 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 371 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 372 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 373 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 374 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 375 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 376 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 377 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 378 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 379 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 380 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 381 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 382 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 383 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 384 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 385 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 386 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 387 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 388 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 389 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 390 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 391 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 392 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 393 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 394 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 395 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 396 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 397 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 398 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 399 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 400 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 401 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 402 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 403 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 404 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 405 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 406 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 407 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 408 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 409 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 410 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 411 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 412 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 413 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 414 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 415 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 416 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 417 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 418 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 419 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 420 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 421 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 422 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 423 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 424 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 425 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 426 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 427 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 428 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 429 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 430 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 431 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 432 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 433 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 434 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 435 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 436 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 437 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 438 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 439 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 440 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 441 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 442 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 443 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 444 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 445 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 446 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 447 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 448 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.49 |
| Metatranscriptomes | 1.02 |
| Isolates | 12.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.54 |
| Nodule | 0.91 |
| Rhizoplane | 4.09 |
| Rhizosphere | 79.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100070437 | 3300005436 | Bacteria | 2952 |
| 2 | JGI24738J21930_10006150 | 3300002075 | Bacteria | 2837 |
| 3 | Ga0006562J51391_1083535 | 3300003578 | Bacteria | 1850 |
| 4 | Ga0070658_10122840 | 3300005327 | Bacteria | 2159 |
| 5 | Ga0070683_100015389 | 3300005329 | Bacteria | 6719 |
| 6 | Ga0070690_100103532 | 3300005330 | Bacteria | 1890 |
| 7 | Ga0068869_100658675 | 3300005334 | Bacteria | 889 |
| 8 | Ga0068868_100037279 | 3300005338 | Bacteria | 3768 |
| 9 | Ga0070709_10020103 | 3300005434 | Bacteria | 3870 |
| 10 | Ga0070714_100294154 | 3300005435 | Bacteria | 1512 |
| 11 | Ga0070713_100156825 | 3300005436 | Bacteria | 2029 |
| 12 | Ga0070713_100249052 | 3300005436 | Bacteria | 1620 |
| 13 | Ga0070710_10004727 | 3300005437 | Bacteria | 6436 |
| 14 | Ga0070710_10072857 | 3300005437 | Bacteria | 1984 |
| 15 | Ga0070711_100024412 | 3300005439 | Bacteria | 3942 |
| 16 | Ga0070678_100241589 | 3300005456 | Bacteria | 1510 |
| 17 | Ga0070678_100297907 | 3300005456 | Bacteria | 1369 |
| 18 | Ga0070706_100158150 | 3300005467 | Bacteria | 2115 |
| 19 | Ga0070707_100029663 | 3300005468 | Bacteria | 5207 |
| 20 | Ga0070698_100140116 | 3300005471 | Bacteria | 2370 |
| 21 | Ga0070679_100422760 | 3300005530 | Bacteria | 1278 |
| 22 | Ga0070684_100164407 | 3300005535 | Bacteria | 2014 |
| 23 | Ga0070684_100246150 | 3300005535 | Bacteria | 1634 |
| 24 | Ga0070695_100158307 | 3300005545 | Bacteria | 1587 |
| 25 | Ga0070693_100055004 | 3300005547 | Bacteria | 2291 |
| 26 | Ga0070665_100000952 | 3300005548 | Bacteria | 36928 |
| 27 | Ga0070665_100134867 | 3300005548 | Bacteria | 2471 |
| 28 | Ga0070665_100218568 | 3300005548 | Bacteria | 1906 |
| 29 | Ga0068855_100271565 | 3300005563 | Bacteria | 1885 |
| 30 | Ga0068855_100396182 | 3300005563 | Bacteria | 1514 |
| 31 | Ga0068855_100726466 | 3300005563 | Bacteria | 1061 |
| 32 | Ga0070664_100074942 | 3300005564 | Bacteria | 2905 |
| 33 | Ga0068857_100485686 | 3300005577 | Bacteria | 1158 |
| 34 | Ga0068854_100379157 | 3300005578 | Bacteria | 1165 |
| 35 | Ga0068856_100036727 | 3300005614 | Bacteria | 4804 |
| 36 | Ga0068856_100043631 | 3300005614 | Bacteria | 4412 |
| 37 | Ga0068856_100072903 | 3300005614 | Bacteria | 3400 |
| 38 | Ga0068856_100164775 | 3300005614 | Bacteria | 2228 |
| 39 | Ga0068856_100710758 | 3300005614 | Bacteria | 1025 |
| 40 | Ga0068859_100012209 | 3300005617 | Bacteria | 8636 |
| 41 | Ga0068859_100068769 | 3300005617 | Bacteria | 3576 |
| 42 | Ga0068863_100001765 | 3300005841 | Bacteria | 21443 |
| 43 | Ga0068863_100003867 | 3300005841 | Bacteria | 14812 |
| 44 | Ga0068863_100291141 | 3300005841 | Bacteria | 1583 |
| 45 | Ga0068858_100001991 | 3300005842 | Bacteria | 20892 |
| 46 | Ga0068858_100011852 | 3300005842 | Bacteria | 8219 |
| 47 | Ga0068858_100079358 | 3300005842 | Bacteria | 3050 |
| 48 | Ga0068860_100000134 | 3300005843 | Bacteria | 120350 |
| 49 | Ga0068860_100471608 | 3300005843 | Bacteria | 1250 |
| 50 | Ga0081455_10009187 | 3300005937 | Bacteria | 10189 |
| 51 | Ga0081539_10014251 | 3300005985 | Bacteria | 5901 |
| 52 | Ga0081539_10024707 | 3300005985 | Bacteria | 3890 |
| 53 | Ga0081539_10077186 | 3300005985 | Bacteria | 1762 |
| 54 | Ga0070717_10000595 | 3300006028 | Bacteria | 23178 |
| 55 | Ga0070717_10011331 | 3300006028 | Bacteria | 6765 |
| 56 | Ga0075365_10190320 | 3300006038 | Bacteria | 1436 |
| 57 | Ga0075368_10044404 | 3300006042 | Bacteria | 1753 |
| 58 | Ga0075363_100129344 | 3300006048 | Bacteria | 1415 |
| 59 | Ga0070716_100000685 | 3300006173 | Bacteria | 14478 |
| 60 | Ga0070716_100037986 | 3300006173 | Bacteria | 2664 |
| 61 | Ga0070712_100001777 | 3300006175 | Bacteria | 13190 |
| 62 | Ga0070712_100047394 | 3300006175 | Bacteria | 2974 |
| 63 | Ga0075367_10000321 | 3300006178 | Bacteria | 16931 |
| 64 | Ga0097621_100007903 | 3300006237 | Bacteria | 7629 |
| 65 | Ga0097621_100488184 | 3300006237 | Bacteria | 1114 |
| 66 | Ga0075370_10056706 | 3300006353 | Bacteria | 2226 |
| 67 | Ga0075370_10189079 | 3300006353 | Bacteria | 1213 |
| 68 | Ga0075428_100038879 | 3300006844 | Bacteria | 5236 |
| 69 | Ga0075428_100337838 | 3300006844 | Bacteria | 1618 |
| 70 | Ga0075428_100362568 | 3300006844 | Bacteria | 1554 |
| 71 | Ga0075429_100043208 | 3300006880 | Bacteria | 3921 |
| 72 | Ga0097620_100001140 | 3300006931 | Bacteria | 27061 |
| 73 | Ga0097620_100012209 | 3300006931 | Bacteria | 8636 |
| 74 | Ga0097620_100068769 | 3300006931 | Bacteria | 3576 |
| 75 | Ga0099826_10064801 | 3300006948 | Bacteria | 2353 |
| 76 | Ga0075435_100186411 | 3300007076 | Bacteria | 1755 |
| 77 | Ga0105251_10026249 | 3300009011 | Bacteria | 2967 |
| 78 | Ga0105240_10025692 | 3300009093 | Bacteria | 7736 |
| 79 | Ga0105240_10284279 | 3300009093 | Bacteria | 1899 |
| 80 | Ga0111539_10468614 | 3300009094 | Bacteria | 1467 |
| 81 | Ga0105247_10009095 | 3300009101 | Bacteria | 6046 |
| 82 | Ga0114129_10490294 | 3300009147 | Bacteria | 1606 |
| 83 | Ga0105243_10303088 | 3300009148 | Bacteria | 1449 |
| 84 | Ga0105248_10027924 | 3300009177 | Bacteria | 6283 |
| 85 | Ga0105248_10413220 | 3300009177 | Bacteria | 1519 |
| 86 | Ga0105237_10006612 | 3300009545 | Bacteria | 12814 |
| 87 | Ga0105237_10171598 | 3300009545 | Bacteria | 2169 |
| 88 | Ga0105238_10315341 | 3300009551 | Bacteria | 1549 |
| 89 | Ga0105238_10384444 | 3300009551 | Bacteria | 1395 |
| 90 | Ga0105238_10473311 | 3300009551 | Bacteria | 1251 |
| 91 | Ga0105238_10818415 | 3300009551 | Bacteria | 947 |
| 92 | Ga0105249_10632700 | 3300009553 | Bacteria | 1127 |
| 93 | Ga0105239_10039506 | 3300010375 | Bacteria | 5170 |
| 94 | Ga0105239_10107516 | 3300010375 | Bacteria | 3090 |
| 95 | Ga0105239_10313227 | 3300010375 | Bacteria | 1769 |
| 96 | Ga0105239_10880005 | 3300010375 | Bacteria | 1028 |
| 97 | Ga0105239_10900560 | 3300010375 | Bacteria | 1015 |
| 98 | Ga0105239_11434532 | 3300010375 | Bacteria | 797 |
| 99 | Ga0105246_10004665 | 3300011119 | Bacteria | 8341 |
| 100 | Ga0105246_10039028 | 3300011119 | Bacteria | 3196 |
| 101 | Ga0157370_10094711 | 3300013104 | Bacteria | 2801 |
| 102 | Ga0157369_10075175 | 3300013105 | Bacteria | 3622 |
| 103 | Ga0157369_10501510 | 3300013105 | Bacteria | 1256 |
| 104 | Ga0157369_10637137 | 3300013105 | Bacteria | 1100 |
| 105 | Ga0157374_10017896 | 3300013296 | Bacteria | 6246 |
| 106 | Ga0157374_11180520 | 3300013296 | Bacteria | 786 |
| 107 | Ga0157372_10000057 | 3300013307 | Bacteria | 125915 |
| 108 | Ga0157372_10603793 | 3300013307 | Bacteria | 1279 |
| 109 | Ga0157375_10029877 | 3300013308 | Bacteria | 5131 |
| 110 | Ga0157375_10754745 | 3300013308 | Bacteria | 1124 |
| 111 | Ga0163163_10176788 | 3300014325 | Bacteria | 2181 |
| 112 | Ga0163163_10324377 | 3300014325 | Bacteria | 1594 |
| 113 | Ga0182008_10000936 | 3300014497 | Bacteria | 20326 |
| 114 | Ga0157379_10004934 | 3300014968 | Bacteria | 11448 |
| 115 | Ga0157379_10045416 | 3300014968 | Bacteria | 3920 |
| 116 | Ga0157376_10002413 | 3300014969 | Bacteria | 12626 |
| 117 | Ga0157376_10144211 | 3300014969 | Bacteria | 2140 |
| 118 | Ga0182006_1079114 | 3300015261 | Bacteria | 1203 |
| 119 | Ga0182007_10002331 | 3300015262 | Bacteria | 9530 |
| 120 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 121 | Ga0206356_10905932 | 3300020070 | Bacteria | 1109 |
| 122 | Ga0206354_10517852 | 3300020081 | Bacteria | 2397 |
| 123 | Ga0206353_10016682 | 3300020082 | Bacteria | 1512 |
| 124 | Ga0206353_10163452 | 3300020082 | Bacteria | 2762 |
| 125 | Ga0206353_11415672 | 3300020082 | Bacteria | 1595 |
| 126 | Ga0209758_1001875 | 3300025297 | Bacteria | 23033 |
| 127 | Ga0207426_1003290 | 3300025302 | Bacteria | 8998 |
| 128 | Ga0207426_1004031 | 3300025302 | Bacteria | 7441 |
| 129 | Ga0207426_1010105 | 3300025302 | Bacteria | 3688 |
| 130 | Ga0207713_1097771 | 3300025735 | Bacteria | 1019 |
| 131 | Ga0207692_10008220 | 3300025898 | Bacteria | 4314 |
| 132 | Ga0207692_10045647 | 3300025898 | Bacteria | 2193 |
| 133 | Ga0207680_10003719 | 3300025903 | Bacteria | 7172 |
| 134 | Ga0207647_10001930 | 3300025904 | Bacteria | 15848 |
| 135 | Ga0207647_10007232 | 3300025904 | Bacteria | 8038 |
| 136 | Ga0207647_10086674 | 3300025904 | Bacteria | 1871 |
| 137 | Ga0207699_10000107 | 3300025906 | Bacteria | 58818 |
| 138 | Ga0207699_10011658 | 3300025906 | Bacteria | 4447 |
| 139 | Ga0207684_10001220 | 3300025910 | Bacteria | 28611 |
| 140 | Ga0207707_10117296 | 3300025912 | Bacteria | 2327 |
| 141 | Ga0207707_10341150 | 3300025912 | Bacteria | 1292 |
| 142 | Ga0207695_10019805 | 3300025913 | Bacteria | 7733 |
| 143 | Ga0207695_10134074 | 3300025913 | Bacteria | 2431 |
| 144 | Ga0207695_10198876 | 3300025913 | Bacteria | 1919 |
| 145 | Ga0207695_10594454 | 3300025913 | Bacteria | 988 |
| 146 | Ga0207671_10020897 | 3300025914 | Bacteria | 4977 |
| 147 | Ga0207671_10484422 | 3300025914 | Bacteria | 986 |
| 148 | Ga0207693_10000536 | 3300025915 | Bacteria | 34408 |
| 149 | Ga0207646_10004644 | 3300025922 | Bacteria | 14825 |
| 150 | Ga0207694_10804716 | 3300025924 | Bacteria | 794 |
| 151 | Ga0207700_10001550 | 3300025928 | Bacteria | 13035 |
| 152 | Ga0207700_10311850 | 3300025928 | Bacteria | 1361 |
| 153 | Ga0207664_10000271 | 3300025929 | Bacteria | 39054 |
| 154 | Ga0207664_10116847 | 3300025929 | Bacteria | 2226 |
| 155 | Ga0207664_10163236 | 3300025929 | Bacteria | 1901 |
| 156 | Ga0207664_10264223 | 3300025929 | Bacteria | 1506 |
| 157 | Ga0207665_10001335 | 3300025939 | Bacteria | 16622 |
| 158 | Ga0207665_10063607 | 3300025939 | Bacteria | 2506 |
| 159 | Ga0207711_10401118 | 3300025941 | Bacteria | 1274 |
| 160 | Ga0207689_10543141 | 3300025942 | Bacteria | 976 |
| 161 | Ga0207661_10005614 | 3300025944 | Bacteria | 8844 |
| 162 | Ga0207667_10025531 | 3300025949 | Bacteria | 6466 |
| 163 | Ga0207667_10144321 | 3300025949 | Bacteria | 2451 |
| 164 | Ga0207667_10308756 | 3300025949 | Bacteria | 1616 |
| 165 | Ga0207667_10514622 | 3300025949 | Bacteria | 1213 |
| 166 | Ga0207639_10342146 | 3300026041 | Bacteria | 1334 |
| 167 | Ga0207702_10062077 | 3300026078 | Bacteria | 3190 |
| 168 | Ga0207641_10001501 | 3300026088 | Bacteria | 22834 |
| 169 | Ga0207641_10007737 | 3300026088 | Bacteria | 8934 |
| 170 | Ga0207676_10011596 | 3300026095 | Bacteria | 6303 |
| 171 | Ga0207674_10082650 | 3300026116 | Bacteria | 3212 |
| 172 | Ga0207674_10129165 | 3300026116 | Bacteria | 2491 |
| 173 | Ga0207674_10602076 | 3300026116 | Bacteria | 1061 |
| 174 | Ga0207683_10212255 | 3300026121 | Bacteria | 1762 |
| 175 | Ga0207698_10018662 | 3300026142 | Bacteria | 4733 |
| 176 | Ga0209371_1008444 | 3300027312 | Bacteria | 3425 |
| 177 | Ga0209813_10009566 | 3300027866 | Bacteria | 2484 |
| 178 | Ga0268266_10202843 | 3300028379 | Bacteria | 1816 |
| 179 | Ga0268266_10232871 | 3300028379 | Bacteria | 1697 |
| 180 | Ga0268264_10000206 | 3300028381 | Bacteria | 120365 |
| 181 | Ga0268264_10105054 | 3300028381 | Bacteria | 2463 |
| 182 | Ga0307517_10003529 | 3300028786 | Bacteria | 24302 |
| 183 | Ga0307517_10017905 | 3300028786 | Bacteria | 9197 |
| 184 | Ga0307515_10014631 | 3300028794 | Bacteria | 14524 |
| 185 | Ga0307515_10071404 | 3300028794 | Bacteria | 4705 |
| 186 | Ga0307515_10165910 | 3300028794 | Bacteria | 2226 |
| 187 | Ga0268256_1008377 | 3300030500 | Bacteria | 3547 |
| 188 | Ga0307511_10063515 | 3300030521 | Bacteria | 2787 |
| 189 | Ga0307511_10096062 | 3300030521 | Bacteria | 1976 |
| 190 | Ga0307511_10129441 | 3300030521 | Bacteria | 1526 |
| 191 | Ga0307511_10170509 | 3300030521 | Bacteria | 1197 |
| 192 | Ga0307512_10002661 | 3300030522 | Bacteria | 22042 |
| 193 | Ga0307512_10048282 | 3300030522 | Bacteria | 3448 |
| 194 | Ga0316180_1100308 | 3300030736 | Bacteria | 1844 |
| 195 | Ga0307513_10019853 | 3300031456 | Bacteria | 7986 |
| 196 | Ga0307513_10082297 | 3300031456 | Bacteria | 3314 |
| 197 | Ga0307509_10020652 | 3300031507 | Bacteria | 7469 |
| 198 | Ga0307509_10193266 | 3300031507 | Bacteria | 1883 |
| 199 | Ga0307508_10003293 | 3300031616 | Bacteria | 16460 |
| 200 | Ga0307508_10010996 | 3300031616 | Bacteria | 8272 |
| 201 | Ga0307508_10020346 | 3300031616 | Bacteria | 6026 |
| 202 | Ga0307508_10055728 | 3300031616 | Bacteria | 3501 |
| 203 | Ga0307514_10008300 | 3300031649 | Bacteria | 8863 |
| 204 | Ga0307514_10042177 | 3300031649 | Bacteria | 3590 |
| 205 | Ga0307516_10005886 | 3300031730 | Bacteria | 14510 |
| 206 | Ga0307516_10017480 | 3300031730 | Bacteria | 7476 |
| 207 | Ga0307516_10438656 | 3300031730 | Bacteria | 963 |
| 208 | Ga0307518_10137138 | 3300031838 | Bacteria | 1711 |
| 209 | Ga0307410_10076411 | 3300031852 | Bacteria | 2338 |
| 210 | Ga0307409_100283002 | 3300031995 | Bacteria | 1534 |
| 211 | Ga0307415_100884840 | 3300032126 | Bacteria | 822 |
| 212 | Ga0307507_10000001 | 3300033179 | Bacteria | 417520 |
| 213 | Ga0307510_10017495 | 3300033180 | Bacteria | 8449 |
| 214 | Ga0307510_10082704 | 3300033180 | Bacteria | 3104 |
| 215 | Ga0307510_10254210 | 3300033180 | Bacteria | 1243 |
| 216 | Ga0373953_0134157 | 3300035117 | Bacteria | 1057 |
| 217 | Ga0373954_0109280 | 3300035118 | Bacteria | 1337 |
| 218 | Ga0373924_0132784 | 3300035410 | Bacteria | 1083 |
| 219 | Ga0373927_0011575 | 3300035695 | Bacteria | 5877 |
| 220 | Ga0395900_0221583 | 3300037418 | Bacteria | 1906 |
| 221 | Ga0395900_0412783 | 3300037418 | Bacteria | 1312 |
| 222 | Ga0395900_0429440 | 3300037418 | Bacteria | 1281 |
| 223 | Ga0395898_0003850 | 3300037466 | Bacteria | 16607 |
| 224 | Ga0395898_0008215 | 3300037466 | Bacteria | 11037 |
| 225 | Ga0395905_0557629 | 3300037471 | Bacteria | 1047 |
| 226 | Ga0436364_0473068 | 3300037853 | Bacteria | 15750 |
| 227 | Ga0436364_1390040 | 3300037853 | Bacteria | 2729 |
| 228 | Ga0395901_0012207 | 3300038443 | Bacteria | 8719 |
| 229 | Ga0436365_1572934 | 3300039437 | Bacteria | 5241 |
| 230 | Ga0439436_0000487 | 3300041404 | Bacteria | 10315 |
| 231 | Ga0451800_0538965 | 3300041459 | Bacteria | 1022 |
| 232 | Ga0451833_1226686 | 3300041491 | Bacteria | 1178 |
| 233 | Ga0451837_0439067 | 3300041494 | Bacteria | 2758 |
| 234 | Ga0451845_0195701 | 3300041501 | Bacteria | 1896 |
| 235 | Ga0451853_0150950 | 3300041512 | Bacteria | 10492 |
| 236 | Ga0451853_0961486 | 3300041512 | Bacteria | 883 |
| 237 | Ga0451853_3409955 | 3300041512 | Bacteria | 956 |
| 238 | Ga0439433_0003227 | 3300041999 | Bacteria | 3497 |
| 239 | Ga0439433_0029225 | 3300041999 | Bacteria | 1257 |
| 240 | Ga0439448_0000693 | 3300042005 | Bacteria | 8050 |
| 241 | Ga0439449_0001943 | 3300042007 | Bacteria | 8126 |
| 242 | Ga0439449_0009393 | 3300042007 | Bacteria | 3707 |
| 243 | Ga0439450_005534 | 3300042008 | Bacteria | 2228 |
| 244 | Ga0439457_000419 | 3300042014 | Bacteria | 12192 |
| 245 | Ga0439462_0007223 | 3300042015 | Bacteria | 2779 |
| 246 | Ga0450890_024603 | 3300042127 | Bacteria | 832 |
| 247 | Ga0450894_001283 | 3300042131 | Bacteria | 3668 |
| 248 | Ga0450896_000320 | 3300042133 | Bacteria | 4575 |
| 249 | Ga0450898_000959 | 3300042134 | Bacteria | 3627 |
| 250 | Ga0450899_000327 | 3300042135 | Bacteria | 5222 |
| 251 | Ga0450902_004140 | 3300042137 | Bacteria | 2151 |
| 252 | Ga0450903_000144 | 3300042138 | Bacteria | 15642 |
| 253 | Ga0450906_018851 | 3300042145 | Bacteria | 1236 |
| 254 | Ga0450907_026909 | 3300042146 | Bacteria | 974 |
| 255 | Ga0439458_0001018 | 3300042157 | Bacteria | 7154 |
| 256 | Ga0450908_001391 | 3300042184 | Bacteria | 4693 |
| 257 | Ga0439435_0073583 | 3300042436 | Bacteria | 1015 |
| 258 | Ga0450901_002671 | 3300042533 | Bacteria | 1904 |
| 259 | Ga0466969_0032275 | 3300044656 | Bacteria | 2662 |
| 260 | Ga0466969_0045879 | 3300044656 | Bacteria | 2168 |
| 261 | Ga0466969_0074885 | 3300044656 | Bacteria | 1623 |
| 262 | Ga0466972_0005212 | 3300044658 | Bacteria | 6506 |
| 263 | Ga0466972_0007341 | 3300044658 | Bacteria | 5536 |
| 264 | Ga0466972_0018484 | 3300044658 | Bacteria | 3485 |
| 265 | Ga0466972_0046544 | 3300044658 | Bacteria | 2100 |
| 266 | Ga0466972_0051962 | 3300044658 | Bacteria | 1976 |
| 267 | Ga0466972_0055749 | 3300044658 | Bacteria | 1901 |
| 268 | Ga0466972_0085558 | 3300044658 | Bacteria | 1498 |
| 269 | Ga0466972_0243803 | 3300044658 | Bacteria | 840 |
| 270 | Ga0466965_0009157 | 3300044683 | Bacteria | 4598 |
| 271 | Ga0466965_0165401 | 3300044683 | Bacteria | 1161 |
| 272 | Ga0466966_0005431 | 3300044684 | Bacteria | 8378 |
| 273 | Ga0466966_0005731 | 3300044684 | Bacteria | 8174 |
| 274 | Ga0466966_0012088 | 3300044684 | Bacteria | 5719 |
| 275 | Ga0466966_0018664 | 3300044684 | Bacteria | 4571 |
| 276 | Ga0466966_0023865 | 3300044684 | Bacteria | 4002 |
| 277 | Ga0466966_0107843 | 3300044684 | Bacteria | 1718 |
| 278 | Ga0466966_0196376 | 3300044684 | Bacteria | 1222 |
| 279 | Ga0466961_0000308 | 3300044693 | Bacteria | 32406 |
| 280 | Ga0466961_0000436 | 3300044693 | Bacteria | 26623 |
| 281 | Ga0466961_0020527 | 3300044693 | Bacteria | 4252 |
| 282 | Ga0466961_0024472 | 3300044693 | Bacteria | 3884 |
| 283 | Ga0466961_0030043 | 3300044693 | Bacteria | 3492 |
| 284 | Ga0466961_0041049 | 3300044693 | Bacteria | 2966 |
| 285 | Ga0466961_0060951 | 3300044693 | Bacteria | 2398 |
| 286 | Ga0466961_0133823 | 3300044693 | Bacteria | 1553 |
| 287 | Ga0466961_0216799 | 3300044693 | Bacteria | 1180 |
| 288 | Ga0466961_0273176 | 3300044693 | Bacteria | 1035 |
| 289 | Ga0466961_0369290 | 3300044693 | Bacteria | 872 |
| 290 | Ga0466963_0001216 | 3300044694 | Bacteria | 13564 |
| 291 | Ga0466963_0004912 | 3300044694 | Bacteria | 7794 |
| 292 | Ga0466963_0006419 | 3300044694 | Bacteria | 6956 |
| 293 | Ga0466963_0074448 | 3300044694 | Bacteria | 2290 |
| 294 | Ga0466963_0102199 | 3300044694 | Bacteria | 1963 |
| 295 | Ga0466963_0256745 | 3300044694 | Bacteria | 1227 |
| 296 | Ga0466964_0002020 | 3300044706 | Bacteria | 7134 |
| 297 | Ga0466964_0004509 | 3300044706 | Bacteria | 5142 |
| 298 | Ga0466971_0002002 | 3300044719 | Bacteria | 8632 |
| 299 | Ga0466971_0004826 | 3300044719 | Bacteria | 5834 |
| 300 | Ga0466971_0004977 | 3300044719 | Bacteria | 5747 |
| 301 | Ga0466971_0031353 | 3300044719 | Bacteria | 2380 |
| 302 | Ga0466971_0032848 | 3300044719 | Bacteria | 2325 |
| 303 | Ga0466971_0090467 | 3300044719 | Bacteria | 1401 |
| 304 | Ga0466970_0003902 | 3300044765 | Bacteria | 7305 |
| 305 | Ga0466970_0013394 | 3300044765 | Bacteria | 4204 |
| 306 | Ga0466970_0052310 | 3300044765 | Bacteria | 2180 |
| 307 | Ga0466970_0052434 | 3300044765 | Bacteria | 2177 |
| 308 | Ga0466957_0000605 | 3300044842 | Bacteria | 18193 |
| 309 | Ga0466957_0006703 | 3300044842 | Bacteria | 6510 |
| 310 | Ga0466957_0037704 | 3300044842 | Bacteria | 2911 |
| 311 | Ga0466957_0056864 | 3300044842 | Bacteria | 2393 |
| 312 | Ga0466957_0073792 | 3300044842 | Bacteria | 2115 |
| 313 | Ga0466957_0091421 | 3300044842 | Bacteria | 1907 |
| 314 | Ga0466957_0181399 | 3300044842 | Bacteria | 1375 |
| 315 | Ga0466957_0185035 | 3300044842 | Bacteria | 1362 |
| 316 | Ga0466957_0500566 | 3300044842 | Bacteria | 842 |
| 317 | Ga0466960_0004007 | 3300044901 | Bacteria | 5727 |
| 318 | Ga0466960_0069559 | 3300044901 | Bacteria | 1749 |
| 319 | Ga0466960_0087787 | 3300044901 | Bacteria | 1580 |
| 320 | Ga0466959_0000486 | 3300045049 | Bacteria | 23165 |
| 321 | Ga0466959_0058546 | 3300045049 | Bacteria | 2806 |
| 322 | Ga0466959_0059733 | 3300045049 | Bacteria | 2776 |
| 323 | Ga0466959_0205077 | 3300045049 | Bacteria | 1372 |
| 324 | Ga0466959_0256671 | 3300045049 | Bacteria | 1204 |
| 325 | Ga0466959_0425301 | 3300045049 | Bacteria | 901 |
| 326 | Ga0466958_0000413 | 3300045836 | Bacteria | 17607 |
| 327 | Ga0466958_0000471 | 3300045836 | Bacteria | 16829 |
| 328 | Ga0466958_0002273 | 3300045836 | Bacteria | 9577 |
| 329 | Ga0466958_0054223 | 3300045836 | Bacteria | 2431 |
| 330 | Ga0466958_0149715 | 3300045836 | Bacteria | 1472 |
| 331 | Ga0466967_0002702 | 3300045976 | Bacteria | 11205 |
| 332 | Ga0466967_0003786 | 3300045976 | Bacteria | 9991 |
| 333 | Ga0466967_0004065 | 3300045976 | Bacteria | 9765 |
| 334 | Ga0466967_0005693 | 3300045976 | Bacteria | 8687 |
| 335 | Ga0466967_0008220 | 3300045976 | Bacteria | 7622 |
| 336 | Ga0466967_0012012 | 3300045976 | Bacteria | 6600 |
| 337 | Ga0466967_0014736 | 3300045976 | Bacteria | 6106 |
| 338 | Ga0466967_0014769 | 3300045976 | Bacteria | 6101 |
| 339 | Ga0466967_0027638 | 3300045976 | Bacteria | 4722 |
| 340 | Ga0466967_0074710 | 3300045976 | Bacteria | 3045 |
| 341 | Ga0466967_0383346 | 3300045976 | Bacteria | 1365 |
| 342 | Ga0466967_0421447 | 3300045976 | Bacteria | 1301 |
| 343 | Ga0466967_0862406 | 3300045976 | Bacteria | 900 |
| 344 | Ga0495617_022847 | 3300046452 | Bacteria | 2114 |
| 345 | Ga0495627_008225 | 3300046453 | Bacteria | 3924 |
| 346 | Ga0495592_0005201 | 3300046454 | Bacteria | 9592 |
| 347 | Ga0495592_0005293 | 3300046454 | Bacteria | 9510 |
| 348 | Ga0495592_0022578 | 3300046454 | Bacteria | 4786 |
| 349 | Ga0495592_0029620 | 3300046454 | Bacteria | 4145 |
| 350 | Ga0495592_0078035 | 3300046454 | Bacteria | 2399 |
| 351 | Ga0495603_0004525 | 3300046455 | Bacteria | 8299 |
| 352 | Ga0495603_0005904 | 3300046455 | Bacteria | 7318 |
| 353 | Ga0495603_0006034 | 3300046455 | Bacteria | 7243 |
| 354 | Ga0495603_0032749 | 3300046455 | Bacteria | 3126 |
| 355 | Ga0495603_0041571 | 3300046455 | Bacteria | 2748 |
| 356 | Ga0495603_0074808 | 3300046455 | Bacteria | 1988 |
| 357 | Ga0495603_0161811 | 3300046455 | Bacteria | 1298 |
| 358 | Ga0495629_0009563 | 3300046459 | Bacteria | 7084 |
| 359 | Ga0495629_0011333 | 3300046459 | Bacteria | 6476 |
| 360 | Ga0495629_0015350 | 3300046459 | Bacteria | 5501 |
| 361 | Ga0495629_0040389 | 3300046459 | Bacteria | 3281 |
| 362 | Ga0495629_0077207 | 3300046459 | Bacteria | 2325 |
| 363 | Ga0495629_0091371 | 3300046459 | Bacteria | 2124 |
| 364 | Ga0495629_0152763 | 3300046459 | Bacteria | 1604 |
| 365 | Ga0495638_0016183 | 3300046460 | Bacteria | 4999 |
| 366 | Ga0495638_0016255 | 3300046460 | Bacteria | 4986 |
| 367 | Ga0495638_0033786 | 3300046460 | Bacteria | 3269 |
| 368 | Ga0495638_0057055 | 3300046460 | Bacteria | 2423 |
| 369 | Ga0495641_0014947 | 3300046461 | Bacteria | 4177 |
| 370 | Ga0495641_0033864 | 3300046461 | Bacteria | 2421 |
| 371 | Ga0495641_0239562 | 3300046461 | Bacteria | 815 |
| 372 | Ga0495651_0001369 | 3300046462 | Bacteria | 18875 |
| 373 | Ga0495651_0009360 | 3300046462 | Bacteria | 7520 |
| 374 | Ga0495651_0037850 | 3300046462 | Bacteria | 3756 |
| 375 | Ga0495651_0059098 | 3300046462 | Bacteria | 2941 |
| 376 | Ga0495653_0004699 | 3300046463 | Bacteria | 11057 |
| 377 | Ga0495580_0010842 | 3300046472 | Bacteria | 7072 |
| 378 | Ga0495582_0011716 | 3300046473 | Bacteria | 4833 |
| 379 | Ga0495582_0095552 | 3300046473 | Bacteria | 1660 |
| 380 | Ga0495582_0112686 | 3300046473 | Bacteria | 1528 |
| 381 | Ga0495605_0001651 | 3300046474 | Bacteria | 14340 |
| 382 | Ga0495605_0049647 | 3300046474 | Bacteria | 2049 |
| 383 | Ga0495639_0072402 | 3300046475 | Bacteria | 1593 |
| 384 | Ga0495639_0140330 | 3300046475 | Bacteria | 1161 |
| 385 | Ga0495662_0000786 | 3300046476 | Bacteria | 15390 |
| 386 | Ga0495662_0006830 | 3300046476 | Bacteria | 5678 |
| 387 | Ga0495662_0028829 | 3300046476 | Bacteria | 2680 |
| 388 | Ga0495662_0146823 | 3300046476 | Bacteria | 1161 |
| 389 | Ga0495664_0007974 | 3300046477 | Bacteria | 5897 |
| 390 | Ga0495664_0012084 | 3300046477 | Bacteria | 4883 |
| 391 | Ga0495664_0111460 | 3300046477 | Bacteria | 1651 |
| 392 | Ga0495585_0003651 | 3300046492 | Bacteria | 10291 |
| 393 | Ga0495585_0017388 | 3300046492 | Bacteria | 4153 |
| 394 | Ga0495585_0018034 | 3300046492 | Bacteria | 4073 |
| 395 | Ga0495585_0194994 | 3300046492 | Bacteria | 1034 |
| 396 | Ga0495594_0002248 | 3300046499 | Bacteria | 10050 |
| 397 | Ga0495594_0012381 | 3300046499 | Bacteria | 4442 |
| 398 | Ga0495594_0014120 | 3300046499 | Bacteria | 4183 |
| 399 | Ga0495594_0127481 | 3300046499 | Bacteria | 1440 |
| 400 | Ga0495594_0182429 | 3300046499 | Bacteria | 1195 |
| 401 | Ga0495594_0214387 | 3300046499 | Bacteria | 1098 |
| 402 | Ga0495596_0022892 | 3300046500 | Bacteria | 2539 |
| 403 | Ga0495607_0008462 | 3300046501 | Bacteria | 7029 |
| 404 | Ga0495583_0019166 | 3300046506 | Bacteria | 3578 |
| 405 | Ga0495583_0084847 | 3300046506 | Bacteria | 1371 |
| 406 | Ga0495606_0009332 | 3300046507 | Bacteria | 8316 |
| 407 | Ga0495608_0008215 | 3300046511 | Bacteria | 7329 |
| 408 | Ga0495608_0015100 | 3300046511 | Bacteria | 5358 |
| 409 | Ga0495610_0039562 | 3300046512 | Bacteria | 2383 |
| 410 | Ga0495616_0036999 | 3300046513 | Bacteria | 2514 |
| 411 | Ga0495618_0040966 | 3300046514 | Bacteria | 2916 |
| 412 | Ga0495618_0049524 | 3300046514 | Bacteria | 2653 |
| 413 | Ga0495618_0165308 | 3300046514 | Bacteria | 1409 |
| 414 | Ga0495618_0370835 | 3300046514 | Bacteria | 879 |
| 415 | Ga0495628_0027925 | 3300046516 | Bacteria | 4588 |
| 416 | Ga0495628_0092283 | 3300046516 | Bacteria | 2342 |
| 417 | Ga0495628_0106918 | 3300046516 | Bacteria | 2154 |
| 418 | Ga0495628_0107360 | 3300046516 | Bacteria | 2149 |
| 419 | Ga0495630_0035964 | 3300046517 | Bacteria | 3702 |
| 420 | Ga0495630_0141154 | 3300046517 | Bacteria | 1831 |
| 421 | Ga0495630_0254905 | 3300046517 | Bacteria | 1340 |
| 422 | Ga0495631_0004578 | 3300046518 | Bacteria | 7339 |
| 423 | Ga0495631_0060497 | 3300046518 | Bacteria | 1643 |
| 424 | Ga0495637_0091835 | 3300046520 | Bacteria | 1196 |
| 425 | Ga0495643_0030389 | 3300046522 | Bacteria | 3016 |
| 426 | Ga0495644_0038437 | 3300046523 | Bacteria | 1805 |
| 427 | Ga0495648_0008379 | 3300046524 | Bacteria | 8145 |
| 428 | Ga0495648_0083010 | 3300046524 | Bacteria | 1817 |
| 429 | Ga0495666_0001826 | 3300046526 | Bacteria | 10518 |
| 430 | Ga0495652_0025149 | 3300046529 | Bacteria | 5271 |
| 431 | Ga0495652_0025949 | 3300046529 | Bacteria | 5177 |
| 432 | Ga0495652_0048785 | 3300046529 | Bacteria | 3626 |
| 433 | Ga0495652_0115064 | 3300046529 | Bacteria | 2156 |
| 434 | Ga0495654_0055990 | 3300046530 | Bacteria | 1907 |
| 435 | Ga0495665_0018410 | 3300046531 | Bacteria | 3753 |
| 436 | Ga0495665_0162497 | 3300046531 | Bacteria | 1164 |
| 437 | Ga0495640_0001855 | 3300046533 | Bacteria | 16801 |
| 438 | Ga0495640_0004646 | 3300046533 | Bacteria | 10957 |
| 439 | Ga0495640_0018882 | 3300046533 | Bacteria | 5100 |
| 440 | Ga0495640_0027452 | 3300046533 | Bacteria | 4106 |
| 441 | Ga0495586_0019663 | 3300046535 | Bacteria | 3596 |
| 442 | Ga0495586_0039858 | 3300046535 | Bacteria | 2526 |
| 443 | Ga0495586_0076019 | 3300046535 | Bacteria | 1839 |
| 444 | Ga0495587_0004186 | 3300046536 | Bacteria | 9551 |
| 445 | Ga0495587_0008083 | 3300046536 | Bacteria | 6783 |
| 446 | Ga0495587_0085054 | 3300046536 | Bacteria | 1831 |
| 447 | Ga0495609_0024697 | 3300046538 | Bacteria | 2755 |
| 448 | Ga0495597_0025855 | 3300046542 | Bacteria | 2700 |
| 449 | Ga0495645_0001626 | 3300046543 | Bacteria | 15212 |
| 450 | Ga0495645_0025182 | 3300046543 | Bacteria | 4317 |
| 451 | Ga0495645_0025719 | 3300046543 | Bacteria | 4274 |
| 452 | Ga0495645_0029619 | 3300046543 | Bacteria | 3982 |
| 453 | Ga0495622_0030352 | 3300046557 | Bacteria | 2526 |
| 454 | Ga0495622_0031737 | 3300046557 | Bacteria | 2468 |
| 455 | Ga0495622_0059453 | 3300046557 | Bacteria | 1769 |
| 456 | Ga0495622_0067046 | 3300046557 | Bacteria | 1658 |
| 457 | Ga0495633_0010933 | 3300046558 | Bacteria | 4930 |
| 458 | Ga0495633_0020156 | 3300046558 | Bacteria | 3358 |
| 459 | Ga0495667_0000718 | 3300046559 | Bacteria | 21245 |
| 460 | Ga0495667_0057139 | 3300046559 | Bacteria | 2565 |
| 461 | Ga0495656_0179536 | 3300046615 | Bacteria | 1040 |
| 462 | Ga0495656_0180577 | 3300046615 | Bacteria | 1037 |
| 463 | Ga0495668_0035251 | 3300046616 | Bacteria | 2804 |
| 464 | Ga0495634_0002467 | 3300046642 | Bacteria | 15369 |
| 465 | Ga0495634_0002771 | 3300046642 | Bacteria | 14392 |
| 466 | Ga0495634_0047625 | 3300046642 | Bacteria | 2887 |
| 467 | Ga0495634_0062670 | 3300046642 | Bacteria | 2468 |
| 468 | Ga0495611_0011589 | 3300046648 | Bacteria | 3739 |
| 469 | Ga0495611_0022220 | 3300046648 | Bacteria | 2744 |
| 470 | Ga0495611_0032094 | 3300046648 | Bacteria | 2314 |
| 471 | Ga0495611_0056732 | 3300046648 | Bacteria | 1774 |
| 472 | Ga0495625_0002557 | 3300046660 | Bacteria | 19548 |
| 473 | Ga0495625_0056140 | 3300046660 | Bacteria | 2804 |
| 474 | Ga0495625_0071203 | 3300046660 | Bacteria | 2440 |
| 475 | Ga0495625_0366745 | 3300046660 | Bacteria | 906 |
| 476 | Ga0495635_0001012 | 3300046663 | Bacteria | 18564 |
| 477 | Ga0495635_0004862 | 3300046663 | Bacteria | 9349 |
| 478 | Ga0495635_0054760 | 3300046663 | Bacteria | 2747 |
| 479 | Ga0495635_0115602 | 3300046663 | Bacteria | 1831 |
| 480 | Ga0495661_0065705 | 3300046665 | Bacteria | 2137 |
| 481 | Ga0495588_0003020 | 3300046674 | Bacteria | 7282 |
| 482 | Ga0495588_0003317 | 3300046674 | Bacteria | 6986 |
| 483 | Ga0495588_0003882 | 3300046674 | Bacteria | 6547 |
| 484 | Ga0495588_0018633 | 3300046674 | Bacteria | 3388 |
| 485 | Ga0495657_0000997 | 3300046675 | Bacteria | 24940 |
| 486 | Ga0495657_0002470 | 3300046675 | Bacteria | 15558 |
| 487 | Ga0495657_0008916 | 3300046675 | Bacteria | 7639 |
| 488 | Ga0495657_0019907 | 3300046675 | Bacteria | 4834 |
| 489 | Ga0495657_0051662 | 3300046675 | Bacteria | 2759 |
| 490 | Ga0495657_0133978 | 3300046675 | Bacteria | 1549 |
| 491 | Ga0495599_0002458 | 3300046678 | Bacteria | 10799 |
| 492 | Ga0495599_0015302 | 3300046678 | Bacteria | 4759 |
| 493 | Ga0495599_0327601 | 3300046678 | Bacteria | 921 |
| 494 | Ga0495599_0379357 | 3300046678 | Bacteria | 844 |
| 495 | Ga0495623_0008707 | 3300046679 | Bacteria | 6589 |
| 496 | Ga0495623_0033950 | 3300046679 | Bacteria | 3273 |
| 497 | Ga0495623_0094258 | 3300046679 | Bacteria | 1831 |
| 498 | Ga0495623_0100630 | 3300046679 | Bacteria | 1761 |
| 499 | Ga0495646_0005312 | 3300046680 | Bacteria | 8132 |
| 500 | Ga0495646_0041477 | 3300046680 | Bacteria | 2827 |
| 501 | Ga0495646_0098953 | 3300046680 | Bacteria | 1674 |
| 502 | Ga0495658_0101403 | 3300046683 | Bacteria | 1719 |
| 503 | Ga0495613_0000571 | 3300046689 | Bacteria | 30034 |
| 504 | Ga0495613_0002156 | 3300046689 | Bacteria | 14923 |
| 505 | Ga0495613_0009178 | 3300046689 | Bacteria | 7332 |
| 506 | Ga0495613_0010802 | 3300046689 | Bacteria | 6773 |
| 507 | Ga0495613_0028789 | 3300046689 | Bacteria | 4131 |
| 508 | Ga0495613_0339020 | 3300046689 | Bacteria | 1034 |
| 509 | Ga0495624_0070147 | 3300046690 | Bacteria | 2182 |
| 510 | Ga0495624_0127905 | 3300046690 | Bacteria | 1558 |
| 511 | Ga0495670_0006126 | 3300046691 | Bacteria | 5902 |
| 512 | Ga0495670_0119171 | 3300046691 | Bacteria | 1370 |
| 513 | Ga0495671_0015220 | 3300046692 | Bacteria | 4128 |
| 514 | Ga0495649_0018402 | 3300046694 | Bacteria | 3931 |
| 515 | Ga0495649_0041484 | 3300046694 | Bacteria | 2517 |
| 516 | Ga0495649_0063785 | 3300046694 | Bacteria | 1979 |
| 517 | Ga0495649_0199239 | 3300046694 | Bacteria | 1040 |
| 518 | Ga0495589_0005853 | 3300046794 | Bacteria | 6490 |
| 519 | Ga0495589_0036117 | 3300046794 | Bacteria | 2477 |
| 520 | Ga0495589_0056735 | 3300046794 | Bacteria | 1927 |
| 521 | Ga0495589_0099184 | 3300046794 | Bacteria | 1410 |
| 522 | Ga0495600_0017426 | 3300046809 | Bacteria | 4569 |
| 523 | Ga0495600_0038622 | 3300046809 | Bacteria | 3107 |
| 524 | Ga0495600_0068291 | 3300046809 | Bacteria | 2322 |
| 525 | Ga0495600_0082586 | 3300046809 | Bacteria | 2096 |
| 526 | Ga0495660_0041718 | 3300046810 | Bacteria | 2538 |
| 527 | Ga0495581_0024138 | 3300047315 | Bacteria | 3523 |
| 528 | Ga0495581_0039947 | 3300047315 | Bacteria | 2716 |
| 529 | Ga0495581_0078953 | 3300047315 | Bacteria | 1904 |
| 530 | Ga0495581_0146794 | 3300047315 | Bacteria | 1377 |
| 531 | Ga0495581_0259066 | 3300047315 | Bacteria | 1017 |
| 532 | Ga0495604_0000228 | 3300047317 | Bacteria | 50550 |
| 533 | Ga0495604_0000623 | 3300047317 | Bacteria | 30451 |
| 534 | Ga0495604_0006068 | 3300047317 | Bacteria | 9588 |
| 535 | Ga0495604_0023469 | 3300047317 | Bacteria | 4921 |
| 536 | Ga0495604_0083187 | 3300047317 | Bacteria | 2392 |
| 537 | Ga0495604_0307024 | 3300047317 | Bacteria | 1064 |
| 538 | Ga0495636_0005288 | 3300047318 | Bacteria | 5070 |
| 539 | Ga0495636_0007694 | 3300047318 | Bacteria | 4237 |
| 540 | Ga0495636_0275113 | 3300047318 | Bacteria | 783 |
| 541 | Ga0495674_0046303 | 3300047319 | Bacteria | 3860 |
| 542 | Ga0495674_0051988 | 3300047319 | Bacteria | 3609 |
| 543 | Ga0495674_0251861 | 3300047319 | Bacteria | 1453 |
| 544 | Ga0495672_0032638 | 3300047320 | Bacteria | 3236 |
| 545 | Ga0495676_0000806 | 3300047321 | Bacteria | 26177 |
| 546 | Ga0495676_0013591 | 3300047321 | Bacteria | 7309 |
| 547 | Ga0495676_0017631 | 3300047321 | Bacteria | 6308 |
| 548 | Ga0495676_0039744 | 3300047321 | Bacteria | 3891 |
| 549 | Ga0495676_0053708 | 3300047321 | Bacteria | 3208 |
| 550 | Ga0495676_0154327 | 3300047321 | Bacteria | 1630 |
| 551 | Ga0495680_0066575 | 3300047322 | Bacteria | 2756 |
| 552 | Ga0495680_0278978 | 3300047322 | Bacteria | 1178 |
| 553 | Ga0495683_0020551 | 3300047323 | Bacteria | 3404 |
| 554 | Ga0495687_004471 | 3300047443 | Bacteria | 9419 |
| 555 | Ga0495687_006861 | 3300047443 | Bacteria | 6863 |
| 556 | Ga0495687_029673 | 3300047443 | Bacteria | 2526 |
| 557 | Ga0495687_063310 | 3300047443 | Bacteria | 1514 |
| 558 | Ga0495687_109797 | 3300047443 | Bacteria | 1016 |
| 559 | Ga0495675_0003140 | 3300047444 | Bacteria | 9915 |
| 560 | Ga0495675_0030650 | 3300047444 | Bacteria | 3431 |
| 561 | Ga0495675_0055931 | 3300047444 | Bacteria | 2502 |
| 562 | Ga0495675_0087327 | 3300047444 | Bacteria | 1959 |
| 563 | Ga0495675_0130894 | 3300047444 | Bacteria | 1559 |
| 564 | Ga0495675_0304340 | 3300047444 | Bacteria | 946 |
| 565 | Ga0495675_0400388 | 3300047444 | Bacteria | 800 |
| 566 | Ga0495677_0019723 | 3300047445 | Bacteria | 2444 |
| 567 | Ga0495685_003118 | 3300047447 | Bacteria | 5257 |
| 568 | Ga0495685_008955 | 3300047447 | Bacteria | 3336 |
| 569 | Ga0495685_026991 | 3300047447 | Bacteria | 1975 |
| 570 | Ga0495685_045567 | 3300047447 | Bacteria | 1494 |
| 571 | Ga0495685_049972 | 3300047447 | Bacteria | 1419 |
| 572 | Ga0495685_056659 | 3300047447 | Bacteria | 1324 |
| 573 | Ga0495681_0000926 | 3300047470 | Bacteria | 22637 |
| 574 | Ga0495681_0006185 | 3300047470 | Bacteria | 7903 |
| 575 | Ga0495681_0015854 | 3300047470 | Bacteria | 4252 |
| 576 | Ga0495684_0032291 | 3300047471 | Bacteria | 4018 |
| 577 | Ga0495684_0036312 | 3300047471 | Bacteria | 3779 |
| 578 | Ga0495684_0116624 | 3300047471 | Bacteria | 2013 |
| 579 | Ga0495684_0137695 | 3300047471 | Bacteria | 1831 |
| 580 | Ga0495686_0023015 | 3300047472 | Bacteria | 4116 |
| 581 | Ga0495686_0076046 | 3300047472 | Bacteria | 2057 |
| 582 | Ga0495593_0006464 | 3300047673 | Bacteria | 6866 |
| 583 | Ga0495593_0084549 | 3300047673 | Bacteria | 1638 |
| 584 | Ga0495593_0115494 | 3300047673 | Bacteria | 1368 |
| 585 | Ga0495593_0324879 | 3300047673 | Bacteria | 769 |
| 586 | Ga0495602_0017544 | 3300048088 | Bacteria | 7173 |
| 587 | Ga0495602_0029092 | 3300048088 | Bacteria | 5273 |
| 588 | Ga0495602_0163235 | 3300048088 | Bacteria | 1737 |
| 589 | Ga0495614_0000863 | 3300048089 | Bacteria | 12821 |
| 590 | Ga0495614_0004450 | 3300048089 | Bacteria | 6319 |
| 591 | Ga0495614_0179294 | 3300048089 | Bacteria | 952 |
| 592 | Ga0495626_0076853 | 3300048091 | Bacteria | 1489 |
| 593 | Ga0496100_0595346 | 3300048903 | Bacteria | 858 |
| 594 | Ga0496101_0077830 | 3300048904 | Bacteria | 2445 |
| 595 | Ga0496101_0737831 | 3300048904 | Bacteria | 777 |
| 596 | Ga0496102_0000271 | 3300048905 | Bacteria | 66136 |
| 597 | Ga0496103_0000053 | 3300048906 | Bacteria | 148944 |
| 598 | Ga0496104_0015791 | 3300048907 | Bacteria | 6849 |
| 599 | Ga0496104_0116361 | 3300048907 | Bacteria | 2566 |
| 600 | Ga0496104_0620512 | 3300048907 | Bacteria | 991 |
| 601 | Ga0496105_0015581 | 3300048908 | Bacteria | 6062 |
| 602 | Ga0496105_0201008 | 3300048908 | Bacteria | 1627 |
| 603 | Ga0496105_0305427 | 3300048908 | Bacteria | 1278 |
| 604 | Ga0496106_0097771 | 3300048909 | Bacteria | 2273 |
| 605 | Ga0496107_0535906 | 3300048910 | Bacteria | 868 |
| 606 | Ga0496108_0005347 | 3300048911 | Bacteria | 10381 |
| 607 | Ga0496108_0403846 | 3300048911 | Bacteria | 1193 |
| 608 | Ga0496109_0007959 | 3300048912 | Bacteria | 8985 |
| 609 | Ga0496109_0019488 | 3300048912 | Bacteria | 5986 |
| 610 | Ga0496109_0063102 | 3300048912 | Bacteria | 3389 |
| 611 | Ga0496109_0136167 | 3300048912 | Bacteria | 2295 |
| 612 | Ga0496109_0247288 | 3300048912 | Bacteria | 1679 |
| 613 | Ga0496110_0009284 | 3300048913 | Bacteria | 7955 |
| 614 | Ga0496110_0009728 | 3300048913 | Bacteria | 7786 |
| 615 | Ga0496110_0030734 | 3300048913 | Bacteria | 4631 |
| 616 | Ga0496111_0003445 | 3300048914 | Bacteria | 9784 |
| 617 | Ga0496111_0014144 | 3300048914 | Bacteria | 5445 |
| 618 | Ga0496111_0302906 | 3300048914 | Bacteria | 1185 |
| 619 | Ga0496113_0046779 | 3300048916 | Bacteria | 3213 |
| 620 | Ga0496113_0101086 | 3300048916 | Bacteria | 2235 |
| 621 | Ga0496113_0281851 | 3300048916 | Bacteria | 1329 |
| 622 | Ga0496113_0317800 | 3300048916 | Bacteria | 1248 |
| 623 | Ga0496114_0113812 | 3300048917 | Bacteria | 2320 |
| 624 | Ga0496114_0120424 | 3300048917 | Bacteria | 2257 |
| 625 | Ga0496114_0209958 | 3300048917 | Bacteria | 1707 |
| 626 | Ga0496114_0743215 | 3300048917 | Bacteria | 858 |
| 627 | Ga0496116_0000381 | 3300048919 | Bacteria | 65986 |
| 628 | Ga0496117_0014152 | 3300048920 | Bacteria | 6896 |
| 629 | Ga0496117_0017269 | 3300048920 | Bacteria | 6035 |
| 630 | Ga0496118_0005975 | 3300048921 | Bacteria | 13580 |
| 631 | Ga0496118_0051474 | 3300048921 | Bacteria | 3150 |
| 632 | Ga0496118_0153736 | 3300048921 | Bacteria | 1435 |
| 633 | Ga0496119_0000595 | 3300048922 | Bacteria | 48961 |
| 634 | Ga0496119_0007576 | 3300048922 | Bacteria | 9741 |
| 635 | Ga0496120_0027873 | 3300048923 | Bacteria | 3468 |
| 636 | Ga0496120_0130766 | 3300048923 | Bacteria | 1286 |
| 637 | Ga0496121_0040474 | 3300048924 | Bacteria | 4087 |
| 638 | Ga0496125_0259265 | 3300048928 | Bacteria | 1091 |
| 639 | Ga0496126_0000026 | 3300048929 | Bacteria | 422310 |
| 640 | Ga0496126_0000267 | 3300048929 | Bacteria | 110994 |
| 641 | Ga0501306_006817 | 3300049127 | Bacteria | 1352 |
| 642 | Ga0501305_033356 | 3300049161 | Bacteria | 812 |
| 643 | Ga0495678_034012 | 3300049459 | Bacteria | 2100 |
| 644 | Ga0495682_0008824 | 3300049460 | Bacteria | 3961 |
| 645 | Ga0501323_004602 | 3300049539 | Bacteria | 1469 |
| 646 | Ga0501031_0054211 | 3300049568 | Bacteria | 2613 |
| 647 | Ga0501031_0104289 | 3300049568 | Bacteria | 1850 |
| 648 | Ga0501031_0243746 | 3300049568 | Bacteria | 1168 |
| 649 | Ga0501032_0012305 | 3300049569 | Bacteria | 6119 |
| 650 | Ga0501032_0018382 | 3300049569 | Bacteria | 4898 |
| 651 | Ga0501032_0020658 | 3300049569 | Bacteria | 4584 |
| 652 | Ga0501032_0038291 | 3300049569 | Bacteria | 3267 |
| 653 | Ga0501032_0079136 | 3300049569 | Bacteria | 2188 |
| 654 | Ga0501033_0005722 | 3300049570 | Bacteria | 9802 |
| 655 | Ga0501033_0007958 | 3300049570 | Bacteria | 8210 |
| 656 | Ga0501033_0042600 | 3300049570 | Bacteria | 3384 |
| 657 | Ga0501033_0121926 | 3300049570 | Bacteria | 1891 |
| 658 | Ga0501033_0643821 | 3300049570 | Bacteria | 724 |
| 659 | Ga0501034_0005286 | 3300049571 | Bacteria | 14162 |
| 660 | Ga0501034_0025568 | 3300049571 | Bacteria | 6012 |
| 661 | Ga0501034_0031253 | 3300049571 | Bacteria | 5409 |
| 662 | Ga0501034_0071846 | 3300049571 | Bacteria | 3469 |
| 663 | Ga0501034_0275006 | 3300049571 | Bacteria | 1624 |
| 664 | Ga0501036_0038877 | 3300049572 | Bacteria | 4028 |
| 665 | Ga0501036_0043216 | 3300049572 | Bacteria | 3815 |
| 666 | Ga0501036_0108952 | 3300049572 | Bacteria | 2341 |
| 667 | Ga0501036_0635286 | 3300049572 | Bacteria | 884 |
| 668 | Ga0501037_0009081 | 3300049573 | Bacteria | 7286 |
| 669 | Ga0501037_0010921 | 3300049573 | Bacteria | 6674 |
| 670 | Ga0501037_0207626 | 3300049573 | Bacteria | 1382 |
| 671 | Ga0501037_0433498 | 3300049573 | Bacteria | 898 |
| 672 | Ga0501038_0006047 | 3300049574 | Bacteria | 11201 |
| 673 | Ga0501038_0031409 | 3300049574 | Bacteria | 4694 |
| 674 | Ga0501038_0065689 | 3300049574 | Bacteria | 3090 |
| 675 | Ga0501038_0101103 | 3300049574 | Bacteria | 2400 |
| 676 | Ga0501039_0023008 | 3300049575 | Bacteria | 4779 |
| 677 | Ga0501039_0371137 | 3300049575 | Bacteria | 1124 |
| 678 | Ga0501039_0674007 | 3300049575 | Bacteria | 809 |
| 679 | Ga0501042_0035445 | 3300049578 | Bacteria | 3540 |
| 680 | Ga0501043_0016631 | 3300049579 | Bacteria | 5766 |
| 681 | Ga0501043_0040506 | 3300049579 | Bacteria | 3661 |
| 682 | Ga0501043_0077110 | 3300049579 | Bacteria | 2618 |
| 683 | Ga0501043_0080789 | 3300049579 | Bacteria | 2554 |
| 684 | Ga0501043_0084845 | 3300049579 | Bacteria | 2489 |
| 685 | Ga0501043_0144530 | 3300049579 | Bacteria | 1862 |
| 686 | Ga0501043_0533764 | 3300049579 | Bacteria | 873 |
| 687 | Ga0501046_0082052 | 3300049580 | Bacteria | 2490 |
| 688 | Ga0501046_0116545 | 3300049580 | Bacteria | 2036 |
| 689 | Ga0501047_0002231 | 3300049581 | Bacteria | 18539 |
| 690 | Ga0501047_0032944 | 3300049581 | Bacteria | 5003 |
| 691 | Ga0501047_0064211 | 3300049581 | Bacteria | 3541 |
| 692 | Ga0501047_0100159 | 3300049581 | Bacteria | 2777 |
| 693 | Ga0501047_0285291 | 3300049581 | Bacteria | 1495 |
| 694 | Ga0501048_0000015 | 3300049582 | Bacteria | 74579 |
| 695 | Ga0501048_0034229 | 3300049582 | Bacteria | 3667 |
| 696 | Ga0501048_0107878 | 3300049582 | Bacteria | 1966 |
| 697 | Ga0501069_0179891 | 3300049585 | Bacteria | 1222 |
| 698 | Ga0501070_0000119 | 3300049586 | Bacteria | 70355 |
| 699 | Ga0501070_0007859 | 3300049586 | Bacteria | 9039 |
| 700 | Ga0501070_0103169 | 3300049586 | Bacteria | 2359 |
| 701 | Ga0501070_0194771 | 3300049586 | Bacteria | 1665 |
| 702 | Ga0501070_0225475 | 3300049586 | Bacteria | 1536 |
| 703 | Ga0501074_0001283 | 3300049590 | Bacteria | 16635 |
| 704 | Ga0501235_007096 | 3300049669 | Bacteria | 2441 |
| 705 | Ga0501080_0051038 | 3300049742 | Bacteria | 3848 |
| 706 | Ga0501080_0277015 | 3300049742 | Bacteria | 1526 |
| 707 | Ga0501081_0142780 | 3300049743 | Bacteria | 1716 |
| 708 | Ga0501282_009400 | 3300049778 | Bacteria | 1048 |
| 709 | Ga0501035_0008845 | 3300049822 | Bacteria | 9369 |
| 710 | Ga0501035_0011307 | 3300049822 | Bacteria | 8272 |
| 711 | Ga0501035_0030917 | 3300049822 | Bacteria | 4877 |
| 712 | Ga0501035_0037873 | 3300049822 | Bacteria | 4365 |
| 713 | Ga0501035_0067653 | 3300049822 | Bacteria | 3169 |
| 714 | Ga0501035_0206701 | 3300049822 | Bacteria | 1681 |
| 715 | Ga0501035_0403220 | 3300049822 | Bacteria | 1137 |
| 716 | Ga0501044_0008387 | 3300049823 | Bacteria | 11334 |
| 717 | Ga0501044_0033811 | 3300049823 | Bacteria | 5368 |
| 718 | Ga0501044_0044230 | 3300049823 | Bacteria | 4622 |
| 719 | Ga0501044_0057780 | 3300049823 | Bacteria | 3980 |
| 720 | Ga0501044_0075268 | 3300049823 | Bacteria | 3427 |
| 721 | Ga0501044_0113043 | 3300049823 | Bacteria | 2722 |
| 722 | Ga0501044_0139006 | 3300049823 | Bacteria | 2418 |
| 723 | Ga0501044_0189338 | 3300049823 | Bacteria | 2021 |
| 724 | Ga0501045_0054702 | 3300049824 | Bacteria | 2918 |
| 725 | nmdc:mga0yw44_66789_c1 | 3300050492 | Bacteria | 2220 |
| 726 | nmdc:mga06z11_47066_c1 | 3300050494 | Bacteria | 2189 |
| 727 | nmdc:mga07m45_22239_c1 | 3300050496 | Bacteria | 3460 |
| 728 | nmdc:mga06r32_656370_c1 | 3300050510 | Bacteria | 1017 |
| 729 | nmdc:mga0rr50_68983_c1 | 3300050513 | Bacteria | 2689 |
| 730 | Ga0495601_0084931 | 3300053077 | Bacteria | 2033 |
| 731 | Ga0495601_0132559 | 3300053077 | Bacteria | 1623 |
| 732 | Ga0495612_0007933 | 3300053078 | Bacteria | 4326 |
| 733 | Ga0495655_0006720 | 3300053083 | Bacteria | 2105 |
| 734 | Ga0495619_0007102 | 3300053085 | Bacteria | 7089 |
| 735 | Ga0495619_0135417 | 3300053085 | Bacteria | 1694 |
| 736 | Ga0495619_0192878 | 3300053085 | Bacteria | 1410 |
| 737 | Ga0495619_0249085 | 3300053085 | Bacteria | 1231 |
| 738 | Ga0500578_0091501 | 3300053086 | Bacteria | 1930 |
| 739 | Ga0500644_0006014 | 3300053088 | Bacteria | 3090 |
| 740 | Ga0500646_0036781 | 3300053090 | Bacteria | 1365 |
| 741 | Ga0500583_0015141 | 3300053092 | Bacteria | 3042 |
| 742 | Ga0500566_0076944 | 3300053094 | Bacteria | 1864 |
| 743 | Ga0500566_0186909 | 3300053094 | Bacteria | 1058 |
| 744 | Ga0500640_022270 | 3300053095 | Bacteria | 2737 |
| 745 | Ga0500654_027345 | 3300053099 | Bacteria | 3512 |
| 746 | Ga0500557_072891 | 3300053105 | Bacteria | 1128 |
| 747 | Ga0500560_004617 | 3300053107 | Bacteria | 2951 |
| 748 | Ga0500560_032901 | 3300053107 | Bacteria | 1580 |
| 749 | Ga0500628_062866 | 3300053129 | Bacteria | 911 |
| 750 | Ga0500652_006516 | 3300053131 | Bacteria | 3763 |
| 751 | Ga0500658_0011376 | 3300053134 | Bacteria | 3278 |
| 752 | Ga0500561_0001101 | 3300053137 | Bacteria | 4360 |
| 753 | Ga0500573_0046840 | 3300053140 | Bacteria | 2491 |
| 754 | Ga0500573_0074450 | 3300053140 | Bacteria | 1934 |
| 755 | Ga0500573_0088475 | 3300053140 | Bacteria | 1752 |
| 756 | Ga0500573_0190980 | 3300053140 | Bacteria | 1094 |
| 757 | Ga0500579_109010 | 3300053143 | Bacteria | 1403 |
| 758 | Ga0500600_0005395 | 3300053149 | Bacteria | 7555 |
| 759 | Ga0500603_013347 | 3300053150 | Bacteria | 1904 |
| 760 | Ga0500616_0001175 | 3300053153 | Bacteria | 26640 |
| 761 | Ga0500624_001424 | 3300053157 | Bacteria | 3902 |
| 762 | Ga0500656_001862 | 3300053732 | Bacteria | 1860 |
| 763 | Ga0500565_016808 | 3300053734 | Bacteria | 835 |
| 764 | Ga0501084_0479455 | 3300054114 | Bacteria | 1051 |
| 765 | Ga0466962_0000418 | 3300061719 | Bacteria | 18353 |
| 766 | Ga0466962_0000646 | 3300061719 | Bacteria | 15546 |
| 767 | Ga0466962_0035017 | 3300061719 | Bacteria | 2404 |
| 768 | Ga0466962_0042207 | 3300061719 | Bacteria | 2183 |
| 769 | Ga0466962_0053116 | 3300061719 | Bacteria | 1936 |
| 770 | Ga0466962_0141757 | 3300061719 | Bacteria | 1164 |
| 771 | Ga0466962_0212123 | 3300061719 | Bacteria | 947 |
| 772 | 2517760535 | 2517572101 | Bacteria | 6884336 |
| 773 | 2547408417 | 2547132111 | Bacteria | 8013147 |
| 774 | 2554256247 | 2554235005 | Bacteria | 6457341 |
| 775 | 2585296591 | 2582581312 | Bacteria | 7308206 |
| 776 | 2585309032 | 2582581313 | Bacteria | 10042643 |
| 777 | 2585319222 | 2582581314 | Bacteria | 11452267 |
| 778 | 2616697276 | 2616644814 | Bacteria | 11555299 |
| 779 | 2616899933 | 2616644941 | Bacteria | 8510691 |
| 780 | 2643763999 | 2643221548 | Bacteria | 8053412 |
| 781 | 2643902283 | 2643221578 | Bacteria | 9213798 |
| 782 | 2643943887 | 2643221587 | Bacteria | 7586415 |
| 783 | 2644265829 | 2643221647 | Bacteria | 10741251 |
| 784 | 2644386874 | 2643221670 | Bacteria | 6497041 |
| 785 | 2644403853 | 2643221673 | Bacteria | 9196637 |
| 786 | 2644434624 | 2643221677 | Bacteria | 7584031 |
| 787 | 2644440031 | 2643221678 | Bacteria | 9540101 |
| 788 | 2644461568 | 2643221682 | Bacteria | 6743283 |
| 789 | 2644632644 | 2643221714 | Bacteria | 9015452 |
| 790 | 2671838936 | 2671180195 | Bacteria | 9757215 |
| 791 | 2676494797 | 2675903060 | Bacteria | 10051191 |
| 792 | 2731908656 | 2731639228 | Bacteria | 4187555 |
| 793 | 2768643042 | 2767802112 | Bacteria | 6465194 |
| 794 | 2774857092 | 2773857922 | Bacteria | 9757215 |
| 795 | 2784590389 | 2784132148 | Bacteria | 8627943 |
| 796 | 2785341226 | 2784746763 | Bacteria | 9783172 |
| 797 | 2785371478 | 2784746768 | Bacteria | 10036182 |
| 798 | 2786672637 | 2786546132 | Bacteria | 10419719 |
| 799 | 2793977061 | 2791355406 | Bacteria | 11364898 |
| 800 | 2804847881 | 2802429296 | Bacteria | 7227771 |
| 801 | 2808844009 | 2808606359 | Bacteria | 9866990 |
| 802 | 2808913600 | 2808606375 | Bacteria | 9466072 |
| 803 | 2809234063 | 2808606448 | Bacteria | 8656184 |
| 804 | 2811844433 | 2808606982 | Bacteria | 7791042 |
| 805 | 2812355967 | 2811994879 | Bacteria | 9313447 |
| 806 | 2812478776 | 2811994917 | Bacteria | 7761064 |
| 807 | 2819694652 | 2818991463 | Bacteria | 7948711 |
| 808 | 2819740651 | 2818991472 | Bacteria | 10089953 |
| 809 | 2852641000 | 2852635781 | Bacteria | 8251373 |
| 810 | 2856743441 | 2856741275 | Bacteria | 8096094 |
| 811 | 2862186389 | 2862178590 | Bacteria | 8583590 |
| 812 | 2862284771 | 2862281513 | Bacteria | 9621493 |
| 813 | 2862291081 | 2862290372 | Bacteria | 7471434 |
| 814 | 2862388107 | 2862382967 | Bacteria | 10317375 |
| 815 | 2862512700 | 2862507626 | Bacteria | 9425308 |
| 816 | 2862577531 | 2862574272 | Bacteria | 10567477 |
| 817 | 2862706418 | 2862705112 | Bacteria | 6563286 |
| 818 | 2863408588 | 2863404153 | Bacteria | 9672205 |
| 819 | 2867349196 | 2867346516 | Bacteria | 7608576 |
| 820 | 2867373848 | 2867369537 | Bacteria | 6501581 |
| 821 | 2867430547 | 2867428634 | Bacteria | 9590268 |
| 822 | 2867481131 | 2867475112 | Bacteria | 6909112 |
| 823 | 2873154077 | 2873151551 | Bacteria | 8625867 |
| 824 | 2875396673 | 2875391855 | Bacteria | 7600475 |
| 825 | 2877679125 | 2877676314 | Bacteria | 9512378 |
| 826 | 2884695593 | 2884693830 | Bacteria | 11273186 |
| 827 | 2891404506 | 2891395885 | Bacteria | 9251614 |
| 828 | 2891565749 | 2891562705 | Bacteria | 8039471 |
| 829 | 2895438670 | 2895427314 | Bacteria | 13147766 |
| 830 | 2895445700 | 2895442618 | Bacteria | 11027144 |
| 831 | 2912717637 | 2912715099 | Bacteria | 9460473 |
| 832 | 2912762726 | 2912757875 | Bacteria | 7940295 |
| 833 | 2918506483 | 2918501144 | Bacteria | 8668083 |
| 834 | 2919471714 | 2919468124 | Bacteria | 9133025 |
| 835 | 2946047882 | 2946045630 | Bacteria | 8527308 |
| 836 | 2946069820 | 2946064051 | Bacteria | 8957905 |
| 837 | 2946077741 | 2946072368 | Bacteria | 8999607 |
| 838 | 2947226980 | 2947224130 | Bacteria | 9938529 |
| 839 | 2954005449 | 2954002825 | Bacteria | 9173742 |
| 840 | 2954384029 | 2954380949 | Bacteria | 10050426 |
| 841 | 2954678929 | 2954673503 | Bacteria | 9685905 |
| 842 | 2954685222 | 2954682443 | Bacteria | 9862841 |
| 843 | 2954694828 | 2954691527 | Bacteria | 10720516 |
| 844 | 2954710030 | 2954701450 | Bacteria | 10834262 |
| 845 | 2954714340 | 2954711539 | Bacteria | 10867210 |
| 846 | 2954724289 | 2954721474 | Bacteria | 10456478 |
| 847 | 2954737550 | 2954731030 | Bacteria | 10243860 |
| 848 | 2954743186 | 2954740390 | Bacteria | 10229294 |
| 849 | 2954756384 | 2954749733 | Bacteria | 10366972 |
| 850 | 2954762144 | 2954759201 | Bacteria | 9358192 |
| 851 | 2966600884 | 2966598605 | Bacteria | 7676064 |
| 852 | 2990046202 | 2990044586 | Bacteria | 6603797 |
| 853 | 2990062920 | 2990059506 | Bacteria | 9321252 |
| 854 | 2990092821 | 2990088156 | Bacteria | 6657676 |
| 855 | 2997452842 | 2997451912 | Bacteria | 8492419 |
| 856 | 2997602847 | 2997600082 | Bacteria | 9896405 |
| 857 | 3006322571 | 3006321560 | Bacteria | 8247479 |
| 858 | 3006393569 | 3006393351 | Bacteria | 6615579 |
| 859 | 3006429914 | 3006425503 | Bacteria | 6491253 |
| 860 | 3006500098 | 3006493962 | Bacteria | 8825450 |
| 861 | 8002789563 | 8002784119 | Bacteria | 9788632 |
| 862 | 8008491508 | 8008485437 | Bacteria | 7198341 |
| 863 | 8008562763 | 8008558824 | Bacteria | 10610750 |
| 864 | 8008577190 | 8008574985 | Bacteria | 7815457 |
| 865 | 8023627168 | 8023623736 | Bacteria | 8593882 |
| 866 | 8025413934 | 8025413630 | Bacteria | 7014048 |
| 867 | 8025483924 | 8025478263 | Bacteria | 8209203 |
| 868 | 8025524564 | 8025524527 | Bacteria | 7197316 |
| 869 | 8025531339 | 8025530807 | Bacteria | 8495698 |
| 870 | 8033686982 | 8033684223 | Bacteria | 6906479 |
| 871 | 8047896126 | 8047893842 | Bacteria | 11723082 |
| 872 | 8048132288 | 8048127548 | Bacteria | 11053136 |
| 873 | 8048362808 | 8048356638 | Bacteria | 11044339 |
| 874 | 8048373152 | 8048369669 | Bacteria | 11666822 |
| 875 | 8048382085 | 8048379754 | Bacteria | 11877923 |
| 876 | 8048411948 | 8048406513 | Bacteria | 8936924 |
| 877 | 8054163328 | 8054160619 | Bacteria | 7783213 |
| 878 | 8056453186 | 8056447290 | Bacteria | 7680491 |
| 879 | 8056668089 | 8056667051 | Bacteria | 6953971 |
| 880 | 8056832177 | 8056829672 | Bacteria | 9045328 |
| 881 | 8057569227 | 8057568493 | Bacteria | 7221719 |
| 882 | Ga0070713_100070437 | |||
| 883 | JGI24738J21930_10006150 | |||
| 884 | Ga0006562J51391_1083535 | |||
| 885 | Ga0070658_10122840 | |||
| 886 | Ga0070683_100015389 | |||
| 887 | Ga0070690_100103532 | |||
| 888 | Ga0068869_100658675 | |||
| 889 | Ga0068868_100037279 | |||
| 890 | Ga0070709_10020103 | |||
| 891 | Ga0070714_100294154 | |||
| 892 | Ga0070713_100156825 | |||
| 893 | Ga0070713_100249052 | |||
| 894 | Ga0070710_10004727 | |||
| 895 | Ga0070710_10072857 | |||
| 896 | Ga0070711_100024412 | |||
| 897 | Ga0070678_100241589 | |||
| 898 | Ga0070678_100297907 | |||
| 899 | Ga0070706_100158150 | |||
| 900 | Ga0070707_100029663 | |||
| 901 | Ga0070698_100140116 | |||
| 902 | Ga0070679_100422760 | |||
| 903 | Ga0070684_100164407 | |||
| 904 | Ga0070684_100246150 | |||
| 905 | Ga0070695_100158307 | |||
| 906 | Ga0070693_100055004 | |||
| 907 | Ga0070665_100000952 | |||
| 908 | Ga0070665_100134867 | |||
| 909 | Ga0070665_100218568 | |||
| 910 | Ga0068855_100271565 | |||
| 911 | Ga0068855_100396182 | |||
| 912 | Ga0068855_100726466 | |||
| 913 | Ga0070664_100074942 | |||
| 914 | Ga0068857_100485686 | |||
| 915 | Ga0068854_100379157 | |||
| 916 | Ga0068856_100036727 | |||
| 917 | Ga0068856_100043631 | |||
| 918 | Ga0068856_100072903 | |||
| 919 | Ga0068856_100164775 | |||
| 920 | Ga0068856_100710758 | |||
| 921 | Ga0068859_100012209 | |||
| 922 | Ga0068859_100068769 | |||
| 923 | Ga0068863_100001765 | |||
| 924 | Ga0068863_100003867 | |||
| 925 | Ga0068863_100291141 | |||
| 926 | Ga0068858_100001991 | |||
| 927 | Ga0068858_100011852 | |||
| 928 | Ga0068858_100079358 | |||
| 929 | Ga0068860_100000134 | |||
| 930 | Ga0068860_100471608 | |||
| 931 | Ga0081455_10009187 | |||
| 932 | Ga0081539_10014251 | |||
| 933 | Ga0081539_10024707 | |||
| 934 | Ga0081539_10077186 | |||
| 935 | Ga0070717_10000595 | |||
| 936 | Ga0070717_10011331 | |||
| 937 | Ga0075365_10190320 | |||
| 938 | Ga0075368_10044404 | |||
| 939 | Ga0075363_100129344 | |||
| 940 | Ga0070716_100000685 | |||
| 941 | Ga0070716_100037986 | |||
| 942 | Ga0070712_100001777 | |||
| 943 | Ga0070712_100047394 | |||
| 944 | Ga0075367_10000321 | |||
| 945 | Ga0097621_100007903 | |||
| 946 | Ga0097621_100488184 | |||
| 947 | Ga0075370_10056706 | |||
| 948 | Ga0075370_10189079 | |||
| 949 | Ga0075428_100038879 | |||
| 950 | Ga0075428_100337838 | |||
| 951 | Ga0075428_100362568 | |||
| 952 | Ga0075429_100043208 | |||
| 953 | Ga0097620_100001140 | |||
| 954 | Ga0097620_100012209 | |||
| 955 | Ga0097620_100068769 | |||
| 956 | Ga0099826_10064801 | |||
| 957 | Ga0075435_100186411 | |||
| 958 | Ga0105251_10026249 | |||
| 959 | Ga0105240_10025692 | |||
| 960 | Ga0105240_10284279 | |||
| 961 | Ga0111539_10468614 | |||
| 962 | Ga0105247_10009095 | |||
| 963 | Ga0114129_10490294 | |||
| 964 | Ga0105243_10303088 | |||
| 965 | Ga0105248_10027924 | |||
| 966 | Ga0105248_10413220 | |||
| 967 | Ga0105237_10006612 | |||
| 968 | Ga0105237_10171598 | |||
| 969 | Ga0105238_10315341 | |||
| 970 | Ga0105238_10384444 | |||
| 971 | Ga0105238_10473311 | |||
| 972 | Ga0105238_10818415 | |||
| 973 | Ga0105249_10632700 | |||
| 974 | Ga0105239_10039506 | |||
| 975 | Ga0105239_10107516 | |||
| 976 | Ga0105239_10313227 | |||
| 977 | Ga0105239_10880005 | |||
| 978 | Ga0105239_10900560 | |||
| 979 | Ga0105239_11434532 | |||
| 980 | Ga0105246_10004665 | |||
| 981 | Ga0105246_10039028 | |||
| 982 | Ga0157370_10094711 | |||
| 983 | Ga0157369_10075175 | |||
| 984 | Ga0157369_10501510 | |||
| 985 | Ga0157369_10637137 | |||
| 986 | Ga0157374_10017896 | |||
| 987 | Ga0157374_11180520 | |||
| 988 | Ga0157372_10000057 | |||
| 989 | Ga0157372_10603793 | |||
| 990 | Ga0157375_10029877 | |||
| 991 | Ga0157375_10754745 | |||
| 992 | Ga0163163_10176788 | |||
| 993 | Ga0163163_10324377 | |||
| 994 | Ga0182008_10000936 | |||
| 995 | Ga0157379_10004934 | |||
| 996 | Ga0157379_10045416 | |||
| 997 | Ga0157376_10002413 | |||
| 998 | Ga0157376_10144211 | |||
| 999 | Ga0182006_1079114 | |||
| 1000 | Ga0182007_10002331 | |||
| 1001 | Ga0183367_1002 | |||
| 1002 | Ga0206356_10905932 | |||
| 1003 | Ga0206354_10517852 | |||
| 1004 | Ga0206353_10016682 | |||
| 1005 | Ga0206353_10163452 | |||
| 1006 | Ga0206353_11415672 | |||
| 1007 | Ga0209758_1001875 | |||
| 1008 | Ga0207426_1003290 | |||
| 1009 | Ga0207426_1004031 | |||
| 1010 | Ga0207426_1010105 | |||
| 1011 | Ga0207713_1097771 | |||
| 1012 | Ga0207692_10008220 | |||
| 1013 | Ga0207692_10045647 | |||
| 1014 | Ga0207680_10003719 | |||
| 1015 | Ga0207647_10001930 | |||
| 1016 | Ga0207647_10007232 | |||
| 1017 | Ga0207647_10086674 | |||
| 1018 | Ga0207699_10000107 | |||
| 1019 | Ga0207699_10011658 | |||
| 1020 | Ga0207684_10001220 | |||
| 1021 | Ga0207707_10117296 | |||
| 1022 | Ga0207707_10341150 | |||
| 1023 | Ga0207695_10019805 | |||
| 1024 | Ga0207695_10134074 | |||
| 1025 | Ga0207695_10198876 | |||
| 1026 | Ga0207695_10594454 | |||
| 1027 | Ga0207671_10020897 | |||
| 1028 | Ga0207671_10484422 | |||
| 1029 | Ga0207693_10000536 | |||
| 1030 | Ga0207646_10004644 | |||
| 1031 | Ga0207694_10804716 | |||
| 1032 | Ga0207700_10001550 | |||
| 1033 | Ga0207700_10311850 | |||
| 1034 | Ga0207664_10000271 | |||
| 1035 | Ga0207664_10116847 | |||
| 1036 | Ga0207664_10163236 | |||
| 1037 | Ga0207664_10264223 | |||
| 1038 | Ga0207665_10001335 | |||
| 1039 | Ga0207665_10063607 | |||
| 1040 | Ga0207711_10401118 | |||
| 1041 | Ga0207689_10543141 | |||
| 1042 | Ga0207661_10005614 | |||
| 1043 | Ga0207667_10025531 | |||
| 1044 | Ga0207667_10144321 | |||
| 1045 | Ga0207667_10308756 | |||
| 1046 | Ga0207667_10514622 | |||
| 1047 | Ga0207639_10342146 | |||
| 1048 | Ga0207702_10062077 | |||
| 1049 | Ga0207641_10001501 | |||
| 1050 | Ga0207641_10007737 | |||
| 1051 | Ga0207676_10011596 | |||
| 1052 | Ga0207674_10082650 | |||
| 1053 | Ga0207674_10129165 | |||
| 1054 | Ga0207674_10602076 | |||
| 1055 | Ga0207683_10212255 | |||
| 1056 | Ga0207698_10018662 | |||
| 1057 | Ga0209371_1008444 | |||
| 1058 | Ga0209813_10009566 | |||
| 1059 | Ga0268266_10202843 | |||
| 1060 | Ga0268266_10232871 | |||
| 1061 | Ga0268264_10000206 | |||
| 1062 | Ga0268264_10105054 | |||
| 1063 | Ga0307517_10003529 | |||
| 1064 | Ga0307517_10017905 | |||
| 1065 | Ga0307515_10014631 | |||
| 1066 | Ga0307515_10071404 | |||
| 1067 | Ga0307515_10165910 | |||
| 1068 | Ga0268256_1008377 | |||
| 1069 | Ga0307511_10063515 | |||
| 1070 | Ga0307511_10096062 | |||
| 1071 | Ga0307511_10129441 | |||
| 1072 | Ga0307511_10170509 | |||
| 1073 | Ga0307512_10002661 | |||
| 1074 | Ga0307512_10048282 | |||
| 1075 | Ga0316180_1100308 | |||
| 1076 | Ga0307513_10019853 | |||
| 1077 | Ga0307513_10082297 | |||
| 1078 | Ga0307509_10020652 | |||
| 1079 | Ga0307509_10193266 | |||
| 1080 | Ga0307508_10003293 | |||
| 1081 | Ga0307508_10010996 | |||
| 1082 | Ga0307508_10020346 | |||
| 1083 | Ga0307508_10055728 | |||
| 1084 | Ga0307514_10008300 | |||
| 1085 | Ga0307514_10042177 | |||
| 1086 | Ga0307516_10005886 | |||
| 1087 | Ga0307516_10017480 | |||
| 1088 | Ga0307516_10438656 | |||
| 1089 | Ga0307518_10137138 | |||
| 1090 | Ga0307410_10076411 | |||
| 1091 | Ga0307409_100283002 | |||
| 1092 | Ga0307415_100884840 | |||
| 1093 | Ga0307507_10000001 | |||
| 1094 | Ga0307510_10017495 | |||
| 1095 | Ga0307510_10082704 | |||
| 1096 | Ga0307510_10254210 | |||
| 1097 | Ga0373953_0134157 | |||
| 1098 | Ga0373954_0109280 | |||
| 1099 | Ga0373924_0132784 | |||
| 1100 | Ga0373927_0011575 | |||
| 1101 | Ga0395900_0221583 | |||
| 1102 | Ga0395900_0412783 | |||
| 1103 | Ga0395900_0429440 | |||
| 1104 | Ga0395898_0003850 | |||
| 1105 | Ga0395898_0008215 | |||
| 1106 | Ga0395905_0557629 | |||
| 1107 | Ga0436364_0473068 | |||
| 1108 | Ga0436364_1390040 | |||
| 1109 | Ga0395901_0012207 | |||
| 1110 | Ga0436365_1572934 | |||
| 1111 | Ga0439436_0000487 | |||
| 1112 | Ga0451800_0538965 | |||
| 1113 | Ga0451833_1226686 | |||
| 1114 | Ga0451837_0439067 | |||
| 1115 | Ga0451845_0195701 | |||
| 1116 | Ga0451853_0150950 | |||
| 1117 | Ga0451853_0961486 | |||
| 1118 | Ga0451853_3409955 | |||
| 1119 | Ga0439433_0003227 | |||
| 1120 | Ga0439433_0029225 | |||
| 1121 | Ga0439448_0000693 | |||
| 1122 | Ga0439449_0001943 | |||
| 1123 | Ga0439449_0009393 | |||
| 1124 | Ga0439450_005534 | |||
| 1125 | Ga0439457_000419 | |||
| 1126 | Ga0439462_0007223 | |||
| 1127 | Ga0450890_024603 | |||
| 1128 | Ga0450894_001283 | |||
| 1129 | Ga0450896_000320 | |||
| 1130 | Ga0450898_000959 | |||
| 1131 | Ga0450899_000327 | |||
| 1132 | Ga0450902_004140 | |||
| 1133 | Ga0450903_000144 | |||
| 1134 | Ga0450906_018851 | |||
| 1135 | Ga0450907_026909 | |||
| 1136 | Ga0439458_0001018 | |||
| 1137 | Ga0450908_001391 | |||
| 1138 | Ga0439435_0073583 | |||
| 1139 | Ga0450901_002671 | |||
| 1140 | Ga0466969_0032275 | |||
| 1141 | Ga0466969_0045879 | |||
| 1142 | Ga0466969_0074885 | |||
| 1143 | Ga0466972_0005212 | |||
| 1144 | Ga0466972_0007341 | |||
| 1145 | Ga0466972_0018484 | |||
| 1146 | Ga0466972_0046544 | |||
| 1147 | Ga0466972_0051962 | |||
| 1148 | Ga0466972_0055749 | |||
| 1149 | Ga0466972_0085558 | |||
| 1150 | Ga0466972_0243803 | |||
| 1151 | Ga0466965_0009157 | |||
| 1152 | Ga0466965_0165401 | |||
| 1153 | Ga0466966_0005431 | |||
| 1154 | Ga0466966_0005731 | |||
| 1155 | Ga0466966_0012088 | |||
| 1156 | Ga0466966_0018664 | |||
| 1157 | Ga0466966_0023865 | |||
| 1158 | Ga0466966_0107843 | |||
| 1159 | Ga0466966_0196376 | |||
| 1160 | Ga0466961_0000308 | |||
| 1161 | Ga0466961_0000436 | |||
| 1162 | Ga0466961_0020527 | |||
| 1163 | Ga0466961_0024472 | |||
| 1164 | Ga0466961_0030043 | |||
| 1165 | Ga0466961_0041049 | |||
| 1166 | Ga0466961_0060951 | |||
| 1167 | Ga0466961_0133823 | |||
| 1168 | Ga0466961_0216799 | |||
| 1169 | Ga0466961_0273176 | |||
| 1170 | Ga0466961_0369290 | |||
| 1171 | Ga0466963_0001216 | |||
| 1172 | Ga0466963_0004912 | |||
| 1173 | Ga0466963_0006419 | |||
| 1174 | Ga0466963_0074448 | |||
| 1175 | Ga0466963_0102199 | |||
| 1176 | Ga0466963_0256745 | |||
| 1177 | Ga0466964_0002020 | |||
| 1178 | Ga0466964_0004509 | |||
| 1179 | Ga0466971_0002002 | |||
| 1180 | Ga0466971_0004826 | |||
| 1181 | Ga0466971_0004977 | |||
| 1182 | Ga0466971_0031353 | |||
| 1183 | Ga0466971_0032848 | |||
| 1184 | Ga0466971_0090467 | |||
| 1185 | Ga0466970_0003902 | |||
| 1186 | Ga0466970_0013394 | |||
| 1187 | Ga0466970_0052310 | |||
| 1188 | Ga0466970_0052434 | |||
| 1189 | Ga0466957_0000605 | |||
| 1190 | Ga0466957_0006703 | |||
| 1191 | Ga0466957_0037704 | |||
| 1192 | Ga0466957_0056864 | |||
| 1193 | Ga0466957_0073792 | |||
| 1194 | Ga0466957_0091421 | |||
| 1195 | Ga0466957_0181399 | |||
| 1196 | Ga0466957_0185035 | |||
| 1197 | Ga0466957_0500566 | |||
| 1198 | Ga0466960_0004007 | |||
| 1199 | Ga0466960_0069559 | |||
| 1200 | Ga0466960_0087787 | |||
| 1201 | Ga0466959_0000486 | |||
| 1202 | Ga0466959_0058546 | |||
| 1203 | Ga0466959_0059733 | |||
| 1204 | Ga0466959_0205077 | |||
| 1205 | Ga0466959_0256671 | |||
| 1206 | Ga0466959_0425301 | |||
| 1207 | Ga0466958_0000413 | |||
| 1208 | Ga0466958_0000471 | |||
| 1209 | Ga0466958_0002273 | |||
| 1210 | Ga0466958_0054223 | |||
| 1211 | Ga0466958_0149715 | |||
| 1212 | Ga0466967_0002702 | |||
| 1213 | Ga0466967_0003786 | |||
| 1214 | Ga0466967_0004065 | |||
| 1215 | Ga0466967_0005693 | |||
| 1216 | Ga0466967_0008220 | |||
| 1217 | Ga0466967_0012012 | |||
| 1218 | Ga0466967_0014736 | |||
| 1219 | Ga0466967_0014769 | |||
| 1220 | Ga0466967_0027638 | |||
| 1221 | Ga0466967_0074710 | |||
| 1222 | Ga0466967_0383346 | |||
| 1223 | Ga0466967_0421447 | |||
| 1224 | Ga0466967_0862406 | |||
| 1225 | Ga0495617_022847 | |||
| 1226 | Ga0495627_008225 | |||
| 1227 | Ga0495592_0005201 | |||
| 1228 | Ga0495592_0005293 | |||
| 1229 | Ga0495592_0022578 | |||
| 1230 | Ga0495592_0029620 | |||
| 1231 | Ga0495592_0078035 | |||
| 1232 | Ga0495603_0004525 | |||
| 1233 | Ga0495603_0005904 | |||
| 1234 | Ga0495603_0006034 | |||
| 1235 | Ga0495603_0032749 | |||
| 1236 | Ga0495603_0041571 | |||
| 1237 | Ga0495603_0074808 | |||
| 1238 | Ga0495603_0161811 | |||
| 1239 | Ga0495629_0009563 | |||
| 1240 | Ga0495629_0011333 | |||
| 1241 | Ga0495629_0015350 | |||
| 1242 | Ga0495629_0040389 | |||
| 1243 | Ga0495629_0077207 | |||
| 1244 | Ga0495629_0091371 | |||
| 1245 | Ga0495629_0152763 | |||
| 1246 | Ga0495638_0016183 | |||
| 1247 | Ga0495638_0016255 | |||
| 1248 | Ga0495638_0033786 | |||
| 1249 | Ga0495638_0057055 | |||
| 1250 | Ga0495641_0014947 | |||
| 1251 | Ga0495641_0033864 | |||
| 1252 | Ga0495641_0239562 | |||
| 1253 | Ga0495651_0001369 | |||
| 1254 | Ga0495651_0009360 | |||
| 1255 | Ga0495651_0037850 | |||
| 1256 | Ga0495651_0059098 | |||
| 1257 | Ga0495653_0004699 | |||
| 1258 | Ga0495580_0010842 | |||
| 1259 | Ga0495582_0011716 | |||
| 1260 | Ga0495582_0095552 | |||
| 1261 | Ga0495582_0112686 | |||
| 1262 | Ga0495605_0001651 | |||
| 1263 | Ga0495605_0049647 | |||
| 1264 | Ga0495639_0072402 | |||
| 1265 | Ga0495639_0140330 | |||
| 1266 | Ga0495662_0000786 | |||
| 1267 | Ga0495662_0006830 | |||
| 1268 | Ga0495662_0028829 | |||
| 1269 | Ga0495662_0146823 | |||
| 1270 | Ga0495664_0007974 | |||
| 1271 | Ga0495664_0012084 | |||
| 1272 | Ga0495664_0111460 | |||
| 1273 | Ga0495585_0003651 | |||
| 1274 | Ga0495585_0017388 | |||
| 1275 | Ga0495585_0018034 | |||
| 1276 | Ga0495585_0194994 | |||
| 1277 | Ga0495594_0002248 | |||
| 1278 | Ga0495594_0012381 | |||
| 1279 | Ga0495594_0014120 | |||
| 1280 | Ga0495594_0127481 | |||
| 1281 | Ga0495594_0182429 | |||
| 1282 | Ga0495594_0214387 | |||
| 1283 | Ga0495596_0022892 | |||
| 1284 | Ga0495607_0008462 | |||
| 1285 | Ga0495583_0019166 | |||
| 1286 | Ga0495583_0084847 | |||
| 1287 | Ga0495606_0009332 | |||
| 1288 | Ga0495608_0008215 | |||
| 1289 | Ga0495608_0015100 | |||
| 1290 | Ga0495610_0039562 | |||
| 1291 | Ga0495616_0036999 | |||
| 1292 | Ga0495618_0040966 | |||
| 1293 | Ga0495618_0049524 | |||
| 1294 | Ga0495618_0165308 | |||
| 1295 | Ga0495618_0370835 | |||
| 1296 | Ga0495628_0027925 | |||
| 1297 | Ga0495628_0092283 | |||
| 1298 | Ga0495628_0106918 | |||
| 1299 | Ga0495628_0107360 | |||
| 1300 | Ga0495630_0035964 | |||
| 1301 | Ga0495630_0141154 | |||
| 1302 | Ga0495630_0254905 | |||
| 1303 | Ga0495631_0004578 | |||
| 1304 | Ga0495631_0060497 | |||
| 1305 | Ga0495637_0091835 | |||
| 1306 | Ga0495643_0030389 | |||
| 1307 | Ga0495644_0038437 | |||
| 1308 | Ga0495648_0008379 | |||
| 1309 | Ga0495648_0083010 | |||
| 1310 | Ga0495666_0001826 | |||
| 1311 | Ga0495652_0025149 | |||
| 1312 | Ga0495652_0025949 | |||
| 1313 | Ga0495652_0048785 | |||
| 1314 | Ga0495652_0115064 | |||
| 1315 | Ga0495654_0055990 | |||
| 1316 | Ga0495665_0018410 | |||
| 1317 | Ga0495665_0162497 | |||
| 1318 | Ga0495640_0001855 | |||
| 1319 | Ga0495640_0004646 | |||
| 1320 | Ga0495640_0018882 | |||
| 1321 | Ga0495640_0027452 | |||
| 1322 | Ga0495586_0019663 | |||
| 1323 | Ga0495586_0039858 | |||
| 1324 | Ga0495586_0076019 | |||
| 1325 | Ga0495587_0004186 | |||
| 1326 | Ga0495587_0008083 | |||
| 1327 | Ga0495587_0085054 | |||
| 1328 | Ga0495609_0024697 | |||
| 1329 | Ga0495597_0025855 | |||
| 1330 | Ga0495645_0001626 | |||
| 1331 | Ga0495645_0025182 | |||
| 1332 | Ga0495645_0025719 | |||
| 1333 | Ga0495645_0029619 | |||
| 1334 | Ga0495622_0030352 | |||
| 1335 | Ga0495622_0031737 | |||
| 1336 | Ga0495622_0059453 | |||
| 1337 | Ga0495622_0067046 | |||
| 1338 | Ga0495633_0010933 | |||
| 1339 | Ga0495633_0020156 | |||
| 1340 | Ga0495667_0000718 | |||
| 1341 | Ga0495667_0057139 | |||
| 1342 | Ga0495656_0179536 | |||
| 1343 | Ga0495656_0180577 | |||
| 1344 | Ga0495668_0035251 | |||
| 1345 | Ga0495634_0002467 | |||
| 1346 | Ga0495634_0002771 | |||
| 1347 | Ga0495634_0047625 | |||
| 1348 | Ga0495634_0062670 | |||
| 1349 | Ga0495611_0011589 | |||
| 1350 | Ga0495611_0022220 | |||
| 1351 | Ga0495611_0032094 | |||
| 1352 | Ga0495611_0056732 | |||
| 1353 | Ga0495625_0002557 | |||
| 1354 | Ga0495625_0056140 | |||
| 1355 | Ga0495625_0071203 | |||
| 1356 | Ga0495625_0366745 | |||
| 1357 | Ga0495635_0001012 | |||
| 1358 | Ga0495635_0004862 | |||
| 1359 | Ga0495635_0054760 | |||
| 1360 | Ga0495635_0115602 | |||
| 1361 | Ga0495661_0065705 | |||
| 1362 | Ga0495588_0003020 | |||
| 1363 | Ga0495588_0003317 | |||
| 1364 | Ga0495588_0003882 | |||
| 1365 | Ga0495588_0018633 | |||
| 1366 | Ga0495657_0000997 | |||
| 1367 | Ga0495657_0002470 | |||
| 1368 | Ga0495657_0008916 | |||
| 1369 | Ga0495657_0019907 | |||
| 1370 | Ga0495657_0051662 | |||
| 1371 | Ga0495657_0133978 | |||
| 1372 | Ga0495599_0002458 | |||
| 1373 | Ga0495599_0015302 | |||
| 1374 | Ga0495599_0327601 | |||
| 1375 | Ga0495599_0379357 | |||
| 1376 | Ga0495623_0008707 | |||
| 1377 | Ga0495623_0033950 | |||
| 1378 | Ga0495623_0094258 | |||
| 1379 | Ga0495623_0100630 | |||
| 1380 | Ga0495646_0005312 | |||
| 1381 | Ga0495646_0041477 | |||
| 1382 | Ga0495646_0098953 | |||
| 1383 | Ga0495658_0101403 | |||
| 1384 | Ga0495613_0000571 | |||
| 1385 | Ga0495613_0002156 | |||
| 1386 | Ga0495613_0009178 | |||
| 1387 | Ga0495613_0010802 | |||
| 1388 | Ga0495613_0028789 | |||
| 1389 | Ga0495613_0339020 | |||
| 1390 | Ga0495624_0070147 | |||
| 1391 | Ga0495624_0127905 | |||
| 1392 | Ga0495670_0006126 | |||
| 1393 | Ga0495670_0119171 | |||
| 1394 | Ga0495671_0015220 | |||
| 1395 | Ga0495649_0018402 | |||
| 1396 | Ga0495649_0041484 | |||
| 1397 | Ga0495649_0063785 | |||
| 1398 | Ga0495649_0199239 | |||
| 1399 | Ga0495589_0005853 | |||
| 1400 | Ga0495589_0036117 | |||
| 1401 | Ga0495589_0056735 | |||
| 1402 | Ga0495589_0099184 | |||
| 1403 | Ga0495600_0017426 | |||
| 1404 | Ga0495600_0038622 | |||
| 1405 | Ga0495600_0068291 | |||
| 1406 | Ga0495600_0082586 | |||
| 1407 | Ga0495660_0041718 | |||
| 1408 | Ga0495581_0024138 | |||
| 1409 | Ga0495581_0039947 | |||
| 1410 | Ga0495581_0078953 | |||
| 1411 | Ga0495581_0146794 | |||
| 1412 | Ga0495581_0259066 | |||
| 1413 | Ga0495604_0000228 | |||
| 1414 | Ga0495604_0000623 | |||
| 1415 | Ga0495604_0006068 | |||
| 1416 | Ga0495604_0023469 | |||
| 1417 | Ga0495604_0083187 | |||
| 1418 | Ga0495604_0307024 | |||
| 1419 | Ga0495636_0005288 | |||
| 1420 | Ga0495636_0007694 | |||
| 1421 | Ga0495636_0275113 | |||
| 1422 | Ga0495674_0046303 | |||
| 1423 | Ga0495674_0051988 | |||
| 1424 | Ga0495674_0251861 | |||
| 1425 | Ga0495672_0032638 | |||
| 1426 | Ga0495676_0000806 | |||
| 1427 | Ga0495676_0013591 | |||
| 1428 | Ga0495676_0017631 | |||
| 1429 | Ga0495676_0039744 | |||
| 1430 | Ga0495676_0053708 | |||
| 1431 | Ga0495676_0154327 | |||
| 1432 | Ga0495680_0066575 | |||
| 1433 | Ga0495680_0278978 | |||
| 1434 | Ga0495683_0020551 | |||
| 1435 | Ga0495687_004471 | |||
| 1436 | Ga0495687_006861 | |||
| 1437 | Ga0495687_029673 | |||
| 1438 | Ga0495687_063310 | |||
| 1439 | Ga0495687_109797 | |||
| 1440 | Ga0495675_0003140 | |||
| 1441 | Ga0495675_0030650 | |||
| 1442 | Ga0495675_0055931 | |||
| 1443 | Ga0495675_0087327 | |||
| 1444 | Ga0495675_0130894 | |||
| 1445 | Ga0495675_0304340 | |||
| 1446 | Ga0495675_0400388 | |||
| 1447 | Ga0495677_0019723 | |||
| 1448 | Ga0495685_003118 | |||
| 1449 | Ga0495685_008955 | |||
| 1450 | Ga0495685_026991 | |||
| 1451 | Ga0495685_045567 | |||
| 1452 | Ga0495685_049972 | |||
| 1453 | Ga0495685_056659 | |||
| 1454 | Ga0495681_0000926 | |||
| 1455 | Ga0495681_0006185 | |||
| 1456 | Ga0495681_0015854 | |||
| 1457 | Ga0495684_0032291 | |||
| 1458 | Ga0495684_0036312 | |||
| 1459 | Ga0495684_0116624 | |||
| 1460 | Ga0495684_0137695 | |||
| 1461 | Ga0495686_0023015 | |||
| 1462 | Ga0495686_0076046 | |||
| 1463 | Ga0495593_0006464 | |||
| 1464 | Ga0495593_0084549 | |||
| 1465 | Ga0495593_0115494 | |||
| 1466 | Ga0495593_0324879 | |||
| 1467 | Ga0495602_0017544 | |||
| 1468 | Ga0495602_0029092 | |||
| 1469 | Ga0495602_0163235 | |||
| 1470 | Ga0495614_0000863 | |||
| 1471 | Ga0495614_0004450 | |||
| 1472 | Ga0495614_0179294 | |||
| 1473 | Ga0495626_0076853 | |||
| 1474 | Ga0496100_0595346 | |||
| 1475 | Ga0496101_0077830 | |||
| 1476 | Ga0496101_0737831 | |||
| 1477 | Ga0496102_0000271 | |||
| 1478 | Ga0496103_0000053 | |||
| 1479 | Ga0496104_0015791 | |||
| 1480 | Ga0496104_0116361 | |||
| 1481 | Ga0496104_0620512 | |||
| 1482 | Ga0496105_0015581 | |||
| 1483 | Ga0496105_0201008 | |||
| 1484 | Ga0496105_0305427 | |||
| 1485 | Ga0496106_0097771 | |||
| 1486 | Ga0496107_0535906 | |||
| 1487 | Ga0496108_0005347 | |||
| 1488 | Ga0496108_0403846 | |||
| 1489 | Ga0496109_0007959 | |||
| 1490 | Ga0496109_0019488 | |||
| 1491 | Ga0496109_0063102 | |||
| 1492 | Ga0496109_0136167 | |||
| 1493 | Ga0496109_0247288 | |||
| 1494 | Ga0496110_0009284 | |||
| 1495 | Ga0496110_0009728 | |||
| 1496 | Ga0496110_0030734 | |||
| 1497 | Ga0496111_0003445 | |||
| 1498 | Ga0496111_0014144 | |||
| 1499 | Ga0496111_0302906 | |||
| 1500 | Ga0496113_0046779 | |||
| 1501 | Ga0496113_0101086 | |||
| 1502 | Ga0496113_0281851 | |||
| 1503 | Ga0496113_0317800 | |||
| 1504 | Ga0496114_0113812 | |||
| 1505 | Ga0496114_0120424 | |||
| 1506 | Ga0496114_0209958 | |||
| 1507 | Ga0496114_0743215 | |||
| 1508 | Ga0496116_0000381 | |||
| 1509 | Ga0496117_0014152 | |||
| 1510 | Ga0496117_0017269 | |||
| 1511 | Ga0496118_0005975 | |||
| 1512 | Ga0496118_0051474 | |||
| 1513 | Ga0496118_0153736 | |||
| 1514 | Ga0496119_0000595 | |||
| 1515 | Ga0496119_0007576 | |||
| 1516 | Ga0496120_0027873 | |||
| 1517 | Ga0496120_0130766 | |||
| 1518 | Ga0496121_0040474 | |||
| 1519 | Ga0496125_0259265 | |||
| 1520 | Ga0496126_0000026 | |||
| 1521 | Ga0496126_0000267 | |||
| 1522 | Ga0501306_006817 | |||
| 1523 | Ga0501305_033356 | |||
| 1524 | Ga0495678_034012 | |||
| 1525 | Ga0495682_0008824 | |||
| 1526 | Ga0501323_004602 | |||
| 1527 | Ga0501031_0054211 | |||
| 1528 | Ga0501031_0104289 | |||
| 1529 | Ga0501031_0243746 | |||
| 1530 | Ga0501032_0012305 | |||
| 1531 | Ga0501032_0018382 | |||
| 1532 | Ga0501032_0020658 | |||
| 1533 | Ga0501032_0038291 | |||
| 1534 | Ga0501032_0079136 | |||
| 1535 | Ga0501033_0005722 | |||
| 1536 | Ga0501033_0007958 | |||
| 1537 | Ga0501033_0042600 | |||
| 1538 | Ga0501033_0121926 | |||
| 1539 | Ga0501033_0643821 | |||
| 1540 | Ga0501034_0005286 | |||
| 1541 | Ga0501034_0025568 | |||
| 1542 | Ga0501034_0031253 | |||
| 1543 | Ga0501034_0071846 | |||
| 1544 | Ga0501034_0275006 | |||
| 1545 | Ga0501036_0038877 | |||
| 1546 | Ga0501036_0043216 | |||
| 1547 | Ga0501036_0108952 | |||
| 1548 | Ga0501036_0635286 | |||
| 1549 | Ga0501037_0009081 | |||
| 1550 | Ga0501037_0010921 | |||
| 1551 | Ga0501037_0207626 | |||
| 1552 | Ga0501037_0433498 | |||
| 1553 | Ga0501038_0006047 | |||
| 1554 | Ga0501038_0031409 | |||
| 1555 | Ga0501038_0065689 | |||
| 1556 | Ga0501038_0101103 | |||
| 1557 | Ga0501039_0023008 | |||
| 1558 | Ga0501039_0371137 | |||
| 1559 | Ga0501039_0674007 | |||
| 1560 | Ga0501042_0035445 | |||
| 1561 | Ga0501043_0016631 | |||
| 1562 | Ga0501043_0040506 | |||
| 1563 | Ga0501043_0077110 | |||
| 1564 | Ga0501043_0080789 | |||
| 1565 | Ga0501043_0084845 | |||
| 1566 | Ga0501043_0144530 | |||
| 1567 | Ga0501043_0533764 | |||
| 1568 | Ga0501046_0082052 | |||
| 1569 | Ga0501046_0116545 | |||
| 1570 | Ga0501047_0002231 | |||
| 1571 | Ga0501047_0032944 | |||
| 1572 | Ga0501047_0064211 | |||
| 1573 | Ga0501047_0100159 | |||
| 1574 | Ga0501047_0285291 | |||
| 1575 | Ga0501048_0000015 | |||
| 1576 | Ga0501048_0034229 | |||
| 1577 | Ga0501048_0107878 | |||
| 1578 | Ga0501069_0179891 | |||
| 1579 | Ga0501070_0000119 | |||
| 1580 | Ga0501070_0007859 | |||
| 1581 | Ga0501070_0103169 | |||
| 1582 | Ga0501070_0194771 | |||
| 1583 | Ga0501070_0225475 | |||
| 1584 | Ga0501074_0001283 | |||
| 1585 | Ga0501235_007096 | |||
| 1586 | Ga0501080_0051038 | |||
| 1587 | Ga0501080_0277015 | |||
| 1588 | Ga0501081_0142780 | |||
| 1589 | Ga0501282_009400 | |||
| 1590 | Ga0501035_0008845 | |||
| 1591 | Ga0501035_0011307 | |||
| 1592 | Ga0501035_0030917 | |||
| 1593 | Ga0501035_0037873 | |||
| 1594 | Ga0501035_0067653 | |||
| 1595 | Ga0501035_0206701 | |||
| 1596 | Ga0501035_0403220 | |||
| 1597 | Ga0501044_0008387 | |||
| 1598 | Ga0501044_0033811 | |||
| 1599 | Ga0501044_0044230 | |||
| 1600 | Ga0501044_0057780 | |||
| 1601 | Ga0501044_0075268 | |||
| 1602 | Ga0501044_0113043 | |||
| 1603 | Ga0501044_0139006 | |||
| 1604 | Ga0501044_0189338 | |||
| 1605 | Ga0501045_0054702 | |||
| 1606 | nmdc:mga0yw44_66789_c1 | |||
| 1607 | nmdc:mga06z11_47066_c1 | |||
| 1608 | nmdc:mga07m45_22239_c1 | |||
| 1609 | nmdc:mga06r32_656370_c1 | |||
| 1610 | nmdc:mga0rr50_68983_c1 | |||
| 1611 | Ga0495601_0084931 | |||
| 1612 | Ga0495601_0132559 | |||
| 1613 | Ga0495612_0007933 | |||
| 1614 | Ga0495655_0006720 | |||
| 1615 | Ga0495619_0007102 | |||
| 1616 | Ga0495619_0135417 | |||
| 1617 | Ga0495619_0192878 | |||
| 1618 | Ga0495619_0249085 | |||
| 1619 | Ga0500578_0091501 | |||
| 1620 | Ga0500644_0006014 | |||
| 1621 | Ga0500646_0036781 | |||
| 1622 | Ga0500583_0015141 | |||
| 1623 | Ga0500566_0076944 | |||
| 1624 | Ga0500566_0186909 | |||
| 1625 | Ga0500640_022270 | |||
| 1626 | Ga0500654_027345 | |||
| 1627 | Ga0500557_072891 | |||
| 1628 | Ga0500560_004617 | |||
| 1629 | Ga0500560_032901 | |||
| 1630 | Ga0500628_062866 | |||
| 1631 | Ga0500652_006516 | |||
| 1632 | Ga0500658_0011376 | |||
| 1633 | Ga0500561_0001101 | |||
| 1634 | Ga0500573_0046840 | |||
| 1635 | Ga0500573_0074450 | |||
| 1636 | Ga0500573_0088475 | |||
| 1637 | Ga0500573_0190980 | |||
| 1638 | Ga0500579_109010 | |||
| 1639 | Ga0500600_0005395 | |||
| 1640 | Ga0500603_013347 | |||
| 1641 | Ga0500616_0001175 | |||
| 1642 | Ga0500624_001424 | |||
| 1643 | Ga0500656_001862 | |||
| 1644 | Ga0500565_016808 | |||
| 1645 | Ga0501084_0479455 | |||
| 1646 | Ga0466962_0000418 | |||
| 1647 | Ga0466962_0000646 | |||
| 1648 | Ga0466962_0035017 | |||
| 1649 | Ga0466962_0042207 | |||
| 1650 | Ga0466962_0053116 | |||
| 1651 | Ga0466962_0141757 | |||
| 1652 | Ga0466962_0212123 | |||
| 1653 | 2517760535 | |||
| 1654 | 2547408417 | |||
| 1655 | 2554256247 | |||
| 1656 | 2585296591 | |||
| 1657 | 2585309032 | |||
| 1658 | 2585319222 | |||
| 1659 | 2616697276 | |||
| 1660 | 2616899933 | |||
| 1661 | 2643763999 | |||
| 1662 | 2643902283 | |||
| 1663 | 2643943887 | |||
| 1664 | 2644265829 | |||
| 1665 | 2644386874 | |||
| 1666 | 2644403853 | |||
| 1667 | 2644434624 | |||
| 1668 | 2644440031 | |||
| 1669 | 2644461568 | |||
| 1670 | 2644632644 | |||
| 1671 | 2671838936 | |||
| 1672 | 2676494797 | |||
| 1673 | 2731908656 | |||
| 1674 | 2768643042 | |||
| 1675 | 2774857092 | |||
| 1676 | 2784590389 | |||
| 1677 | 2785341226 | |||
| 1678 | 2785371478 | |||
| 1679 | 2786672637 | |||
| 1680 | 2793977061 | |||
| 1681 | 2804847881 | |||
| 1682 | 2808844009 | |||
| 1683 | 2808913600 | |||
| 1684 | 2809234063 | |||
| 1685 | 2811844433 | |||
| 1686 | 2812355967 | |||
| 1687 | 2812478776 | |||
| 1688 | 2819694652 | |||
| 1689 | 2819740651 | |||
| 1690 | 2852641000 | |||
| 1691 | 2856743441 | |||
| 1692 | 2862186389 | |||
| 1693 | 2862284771 | |||
| 1694 | 2862291081 | |||
| 1695 | 2862388107 | |||
| 1696 | 2862512700 | |||
| 1697 | 2862577531 | |||
| 1698 | 2862706418 | |||
| 1699 | 2863408588 | |||
| 1700 | 2867349196 | |||
| 1701 | 2867373848 | |||
| 1702 | 2867430547 | |||
| 1703 | 2867481131 | |||
| 1704 | 2873154077 | |||
| 1705 | 2875396673 | |||
| 1706 | 2877679125 | |||
| 1707 | 2884695593 | |||
| 1708 | 2891404506 | |||
| 1709 | 2891565749 | |||
| 1710 | 2895438670 | |||
| 1711 | 2895445700 | |||
| 1712 | 2912717637 | |||
| 1713 | 2912762726 | |||
| 1714 | 2918506483 | |||
| 1715 | 2919471714 | |||
| 1716 | 2946047882 | |||
| 1717 | 2946069820 | |||
| 1718 | 2946077741 | |||
| 1719 | 2947226980 | |||
| 1720 | 2954005449 | |||
| 1721 | 2954384029 | |||
| 1722 | 2954678929 | |||
| 1723 | 2954685222 | |||
| 1724 | 2954694828 | |||
| 1725 | 2954710030 | |||
| 1726 | 2954714340 | |||
| 1727 | 2954724289 | |||
| 1728 | 2954737550 | |||
| 1729 | 2954743186 | |||
| 1730 | 2954756384 | |||
| 1731 | 2954762144 | |||
| 1732 | 2966600884 | |||
| 1733 | 2990046202 | |||
| 1734 | 2990062920 | |||
| 1735 | 2990092821 | |||
| 1736 | 2997452842 | |||
| 1737 | 2997602847 | |||
| 1738 | 3006322571 | |||
| 1739 | 3006393569 | |||
| 1740 | 3006429914 | |||
| 1741 | 3006500098 | |||
| 1742 | 8002789563 | |||
| 1743 | 8008491508 | |||
| 1744 | 8008562763 | |||
| 1745 | 8008577190 | |||
| 1746 | 8023627168 | |||
| 1747 | 8025413934 | |||
| 1748 | 8025483924 | |||
| 1749 | 8025524564 | |||
| 1750 | 8025531339 | |||
| 1751 | 8033686982 | |||
| 1752 | 8047896126 | |||
| 1753 | 8048132288 | |||
| 1754 | 8048362808 | |||
| 1755 | 8048373152 | |||
| 1756 | 8048382085 | |||
| 1757 | 8048411948 | |||
| 1758 | 8054163328 | |||
| 1759 | 8056453186 | |||
| 1760 | 8056668089 | |||
| 1761 | 8056832177 | |||
| 1762 | 8057569227 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.9516 | 4 | 214 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.9495 | 1 | 214 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.9476 | 1 | 214 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.941 | 1 | 214 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.9391 | 1 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9896 | 2 | 209 | 3.90.870.10 |
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9756 | 2 | 209 | 3.90.870.10 |
| af_Q60369_7_206_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9397 | 9 | 204 | 3.90.870.10 |
| af_Q2FWE2_20_236_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9327 | 2 | 214 | 3.90.870.10 |
| af_Q2FWE2_20_236_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9203 | 2 | 214 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q9K1X7-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9947 | 1 | 208 |
GO:0000049
GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A543HVT9-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9945 | 1 | 208 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A2P8CYD7-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9944 | 1 | 215 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A223SAX3-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9936 | 1 | 215 |
GO:0000049
GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A2Y9A7H3-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9932 | 4 | 214 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |