F484481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 880 | 301 | 1760 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10007262|Ga0081539_1000726212 |
| Length | 132 |
| Sequence | VLETDGGSRGNPGPAAIGYVLAAADGTVLAAHGEAIGVAGANVAEYRALLAGLEQASRMDLKRVDARCDARVVVEQVTGAREPANPRLAGLCRAVRDVAQRIGTVELTWVPAEANGRAHALVAQALAPGMHQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 158 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 159 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 163 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 164 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 167 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.45 |
| Nodule | 0 |
| Rhizoplane | 8.52 |
| Rhizosphere | 90.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081539_10007262 | 3300005985 | Bacteria | 10178 |
| 2 | JGI25407J50210_10025906 | 3300003373 | Bacteria | 1520 |
| 3 | JGI25407J50210_10171524 | 3300003373 | Bacteria | 534 |
| 4 | Ga0070658_10006819 | 3300005327 | Bacteria | 9235 |
| 5 | Ga0070658_10023888 | 3300005327 | Bacteria | 4904 |
| 6 | Ga0070658_10035144 | 3300005327 | Bacteria | 4035 |
| 7 | Ga0070683_100009167 | 3300005329 | Bacteria | 8447 |
| 8 | Ga0070683_100029926 | 3300005329 | Bacteria | 4937 |
| 9 | Ga0070683_100224787 | 3300005329 | Bacteria | 1784 |
| 10 | Ga0070683_100271041 | 3300005329 | Bacteria | 1615 |
| 11 | Ga0070683_101017644 | 3300005329 | Bacteria | 795 |
| 12 | Ga0070680_100026507 | 3300005336 | Bacteria | 4637 |
| 13 | Ga0070680_100230664 | 3300005336 | Bacteria | 1564 |
| 14 | Ga0070680_100392362 | 3300005336 | Bacteria | 1183 |
| 15 | Ga0070680_100768907 | 3300005336 | Bacteria | 829 |
| 16 | Ga0070682_100323808 | 3300005337 | Bacteria | 1139 |
| 17 | Ga0068868_100600917 | 3300005338 | Bacteria | 975 |
| 18 | Ga0070660_100011544 | 3300005339 | Bacteria | 6286 |
| 19 | Ga0070660_100014170 | 3300005339 | Bacteria | 5740 |
| 20 | Ga0070660_100734502 | 3300005339 | Bacteria | 829 |
| 21 | Ga0070660_101036501 | 3300005339 | Bacteria | 694 |
| 22 | Ga0070691_10028261 | 3300005341 | Bacteria | 2619 |
| 23 | Ga0070691_10651425 | 3300005341 | Bacteria | 627 |
| 24 | Ga0070661_100027180 | 3300005344 | Bacteria | 4118 |
| 25 | Ga0070661_101500299 | 3300005344 | Bacteria | 569 |
| 26 | Ga0070668_100265072 | 3300005347 | Bacteria | 1430 |
| 27 | Ga0070675_100768792 | 3300005354 | Bacteria | 879 |
| 28 | Ga0070671_100072585 | 3300005355 | Bacteria | 2874 |
| 29 | Ga0070671_100308440 | 3300005355 | Bacteria | 1348 |
| 30 | Ga0070674_100071521 | 3300005356 | Unclassified | 2454 |
| 31 | Ga0070673_101840670 | 3300005364 | Bacteria | 574 |
| 32 | Ga0070688_100743269 | 3300005365 | Bacteria | 763 |
| 33 | Ga0070659_100310994 | 3300005366 | Bacteria | 1316 |
| 34 | Ga0070659_101460372 | 3300005366 | Bacteria | 609 |
| 35 | Ga0070709_10011736 | 3300005434 | Bacteria | 4892 |
| 36 | Ga0070709_10014329 | 3300005434 | Bacteria | 4482 |
| 37 | Ga0070714_100310252 | 3300005435 | Bacteria | 1473 |
| 38 | Ga0070714_100441966 | 3300005435 | Bacteria | 1234 |
| 39 | Ga0070714_100605311 | 3300005435 | Bacteria | 1052 |
| 40 | Ga0070714_100761190 | 3300005435 | Bacteria | 937 |
| 41 | Ga0070714_101478049 | 3300005435 | Bacteria | 664 |
| 42 | Ga0070714_101752908 | 3300005435 | Bacteria | 606 |
| 43 | Ga0070713_100001898 | 3300005436 | Bacteria | 13463 |
| 44 | Ga0070713_100183075 | 3300005436 | Bacteria | 1884 |
| 45 | Ga0070713_101863309 | 3300005436 | Bacteria | 584 |
| 46 | Ga0070710_10003777 | 3300005437 | Bacteria | 7164 |
| 47 | Ga0070710_10004714 | 3300005437 | Bacteria | 6449 |
| 48 | Ga0070710_10909947 | 3300005437 | Bacteria | 636 |
| 49 | Ga0070711_100036621 | 3300005439 | Bacteria | 3287 |
| 50 | Ga0070711_100081722 | 3300005439 | Bacteria | 2304 |
| 51 | Ga0070711_100436779 | 3300005439 | Bacteria | 1069 |
| 52 | Ga0070711_101792625 | 3300005439 | Bacteria | 538 |
| 53 | Ga0070705_100588960 | 3300005440 | Bacteria | 859 |
| 54 | Ga0070705_100592249 | 3300005440 | Bacteria | 856 |
| 55 | Ga0070708_101197453 | 3300005445 | Bacteria | 711 |
| 56 | Ga0070678_100414645 | 3300005456 | Bacteria | 1173 |
| 57 | Ga0070678_100531623 | 3300005456 | Bacteria | 1042 |
| 58 | Ga0070681_10025398 | 3300005458 | Bacteria | 5959 |
| 59 | Ga0070681_10047166 | 3300005458 | Bacteria | 4307 |
| 60 | Ga0070681_10068399 | 3300005458 | Bacteria | 3518 |
| 61 | Ga0070681_10125740 | 3300005458 | Bacteria | 2497 |
| 62 | Ga0070681_11312189 | 3300005458 | Bacteria | 647 |
| 63 | Ga0070681_11616731 | 3300005458 | Bacteria | 573 |
| 64 | Ga0068867_100238754 | 3300005459 | Bacteria | 1473 |
| 65 | Ga0070707_100000819 | 3300005468 | Bacteria | 30825 |
| 66 | Ga0070707_100190504 | 3300005468 | Bacteria | 2000 |
| 67 | Ga0070707_100638159 | 3300005468 | Bacteria | 1028 |
| 68 | Ga0070698_100007710 | 3300005471 | Bacteria | 11642 |
| 69 | Ga0070698_100400551 | 3300005471 | Bacteria | 1306 |
| 70 | Ga0070698_100453882 | 3300005471 | Bacteria | 1217 |
| 71 | Ga0070699_101098545 | 3300005518 | Bacteria | 729 |
| 72 | Ga0070679_100058919 | 3300005530 | Bacteria | 3827 |
| 73 | Ga0070679_100075673 | 3300005530 | Bacteria | 3356 |
| 74 | Ga0070679_100093878 | 3300005530 | Bacteria | 2987 |
| 75 | Ga0070679_100112544 | 3300005530 | Bacteria | 2708 |
| 76 | Ga0070679_100341505 | 3300005530 | Bacteria | 1445 |
| 77 | Ga0070679_100408937 | 3300005530 | Bacteria | 1303 |
| 78 | Ga0070679_100474295 | 3300005530 | Bacteria | 1195 |
| 79 | Ga0070679_101012943 | 3300005530 | Bacteria | 775 |
| 80 | Ga0070684_100002789 | 3300005535 | Bacteria | 12943 |
| 81 | Ga0070684_100003984 | 3300005535 | Bacteria | 11188 |
| 82 | Ga0070684_100010471 | 3300005535 | Bacteria | 7348 |
| 83 | Ga0070684_100679126 | 3300005535 | Bacteria | 959 |
| 84 | Ga0070684_101150517 | 3300005535 | Bacteria | 730 |
| 85 | Ga0070684_101677181 | 3300005535 | Bacteria | 600 |
| 86 | Ga0070684_101682910 | 3300005535 | Bacteria | 599 |
| 87 | Ga0070686_100552854 | 3300005544 | Bacteria | 901 |
| 88 | Ga0070695_100000009 | 3300005545 | Bacteria | 87710 |
| 89 | Ga0070695_100403916 | 3300005545 | Bacteria | 1036 |
| 90 | Ga0070693_100185962 | 3300005547 | Bacteria | 1341 |
| 91 | Ga0070693_100189090 | 3300005547 | Bacteria | 1331 |
| 92 | Ga0070704_100037956 | 3300005549 | Bacteria | 3295 |
| 93 | Ga0070704_100756452 | 3300005549 | Bacteria | 865 |
| 94 | Ga0070704_101136161 | 3300005549 | Bacteria | 711 |
| 95 | Ga0068855_100050260 | 3300005563 | Bacteria | 4914 |
| 96 | Ga0068855_100218300 | 3300005563 | Bacteria | 2140 |
| 97 | Ga0068855_101506345 | 3300005563 | Bacteria | 690 |
| 98 | Ga0068855_101646893 | 3300005563 | Bacteria | 656 |
| 99 | Ga0070664_100197096 | 3300005564 | Bacteria | 1795 |
| 100 | Ga0068857_100019684 | 3300005577 | Bacteria | 5929 |
| 101 | Ga0068857_100087165 | 3300005577 | Bacteria | 2792 |
| 102 | Ga0068857_100096390 | 3300005577 | Bacteria | 2651 |
| 103 | Ga0068857_101567747 | 3300005577 | Bacteria | 643 |
| 104 | Ga0068856_100030722 | 3300005614 | Bacteria | 5252 |
| 105 | Ga0068856_100130493 | 3300005614 | Bacteria | 2518 |
| 106 | Ga0068856_100218195 | 3300005614 | Bacteria | 1922 |
| 107 | Ga0068856_100233065 | 3300005614 | Bacteria | 1856 |
| 108 | Ga0068852_100367398 | 3300005616 | Bacteria | 1409 |
| 109 | Ga0068852_100670591 | 3300005616 | Bacteria | 1046 |
| 110 | Ga0068859_100805153 | 3300005617 | Bacteria | 1027 |
| 111 | Ga0068861_101066669 | 3300005719 | Bacteria | 775 |
| 112 | Ga0068870_10191947 | 3300005840 | Bacteria | 1233 |
| 113 | Ga0068863_100109515 | 3300005841 | Bacteria | 2630 |
| 114 | Ga0068863_100921552 | 3300005841 | Bacteria | 875 |
| 115 | Ga0068858_100431743 | 3300005842 | Bacteria | 1268 |
| 116 | Ga0068858_100515829 | 3300005842 | Bacteria | 1156 |
| 117 | Ga0068862_100805324 | 3300005844 | Bacteria | 918 |
| 118 | Ga0081455_10020306 | 3300005937 | Bacteria | 6261 |
| 119 | Ga0081455_10051277 | 3300005937 | Bacteria | 3540 |
| 120 | Ga0081455_10094671 | 3300005937 | Bacteria | 2412 |
| 121 | Ga0081455_10656903 | 3300005937 | Bacteria | 674 |
| 122 | Ga0081538_10000184 | 3300005981 | Bacteria | 68601 |
| 123 | Ga0081538_10000747 | 3300005981 | Bacteria | 35453 |
| 124 | Ga0081538_10002355 | 3300005981 | Bacteria | 18586 |
| 125 | Ga0081538_10003921 | 3300005981 | Bacteria | 13876 |
| 126 | Ga0081538_10007045 | 3300005981 | Bacteria | 9778 |
| 127 | Ga0081538_10111858 | 3300005981 | Bacteria | 1338 |
| 128 | Ga0081539_10002546 | 3300005985 | Bacteria | 25327 |
| 129 | Ga0070717_10011983 | 3300006028 | Bacteria | 6600 |
| 130 | Ga0070717_10016859 | 3300006028 | Bacteria | 5671 |
| 131 | Ga0070717_10068575 | 3300006028 | Bacteria | 2952 |
| 132 | Ga0070717_11048646 | 3300006028 | Bacteria | 743 |
| 133 | Ga0075364_10032208 | 3300006051 | Bacteria | 3369 |
| 134 | Ga0075432_10256179 | 3300006058 | Bacteria | 712 |
| 135 | Ga0070715_10001428 | 3300006163 | Bacteria | 6916 |
| 136 | Ga0070716_100042776 | 3300006173 | Bacteria | 2530 |
| 137 | Ga0070716_100080960 | 3300006173 | Bacteria | 1938 |
| 138 | Ga0070712_100142738 | 3300006175 | Bacteria | 1830 |
| 139 | Ga0070712_100917833 | 3300006175 | Bacteria | 755 |
| 140 | Ga0070712_101159745 | 3300006175 | Bacteria | 672 |
| 141 | Ga0070712_101209127 | 3300006175 | Bacteria | 657 |
| 142 | Ga0070712_101426090 | 3300006175 | Bacteria | 604 |
| 143 | Ga0075367_10750049 | 3300006178 | Bacteria | 621 |
| 144 | Ga0075428_101865935 | 3300006844 | Bacteria | 625 |
| 145 | Ga0075430_100115037 | 3300006846 | Bacteria | 2241 |
| 146 | Ga0075430_100126820 | 3300006846 | Bacteria | 2127 |
| 147 | Ga0075430_100142852 | 3300006846 | Bacteria | 1993 |
| 148 | Ga0075431_100159176 | 3300006847 | Bacteria | 2322 |
| 149 | Ga0075431_100514808 | 3300006847 | Bacteria | 1186 |
| 150 | Ga0075434_100006605 | 3300006871 | Bacteria | 10642 |
| 151 | Ga0075434_100220697 | 3300006871 | Bacteria | 1915 |
| 152 | Ga0075429_100035831 | 3300006880 | Bacteria | 4315 |
| 153 | Ga0075429_100083291 | 3300006880 | Bacteria | 2788 |
| 154 | Ga0075429_100600729 | 3300006880 | Bacteria | 964 |
| 155 | Ga0075429_101567725 | 3300006880 | Bacteria | 573 |
| 156 | Ga0068865_101441673 | 3300006881 | Bacteria | 616 |
| 157 | Ga0075436_100008175 | 3300006914 | Bacteria | 7160 |
| 158 | Ga0097620_100805208 | 3300006931 | Bacteria | 1027 |
| 159 | Ga0105250_10309036 | 3300009092 | Bacteria | 685 |
| 160 | Ga0105240_10026690 | 3300009093 | Bacteria | 7577 |
| 161 | Ga0105240_10069913 | 3300009093 | Bacteria | 4345 |
| 162 | Ga0105240_10116638 | 3300009093 | Bacteria | 3221 |
| 163 | Ga0105240_11457818 | 3300009093 | Bacteria | 718 |
| 164 | Ga0111539_10024633 | 3300009094 | Bacteria | 7381 |
| 165 | Ga0111539_10292969 | 3300009094 | Bacteria | 1894 |
| 166 | Ga0111539_10321659 | 3300009094 | Bacteria | 1800 |
| 167 | Ga0111539_10842433 | 3300009094 | Bacteria | 1067 |
| 168 | Ga0105245_10076725 | 3300009098 | Bacteria | 3045 |
| 169 | Ga0105245_10107661 | 3300009098 | Bacteria | 2588 |
| 170 | Ga0105245_10122893 | 3300009098 | Bacteria | 2427 |
| 171 | Ga0105245_10172064 | 3300009098 | Bacteria | 2063 |
| 172 | Ga0105245_10246373 | 3300009098 | Bacteria | 1735 |
| 173 | Ga0105245_10612015 | 3300009098 | Bacteria | 1117 |
| 174 | Ga0105245_11072596 | 3300009098 | Unclassified | 851 |
| 175 | Ga0105245_11266565 | 3300009098 | Bacteria | 786 |
| 176 | Ga0105247_10336543 | 3300009101 | Bacteria | 1057 |
| 177 | Ga0105247_11189376 | 3300009101 | Bacteria | 606 |
| 178 | Ga0114129_10034292 | 3300009147 | Bacteria | 7168 |
| 179 | Ga0114129_10205785 | 3300009147 | Bacteria | 2663 |
| 180 | Ga0114129_10452095 | 3300009147 | Bacteria | 1684 |
| 181 | Ga0114129_10964063 | 3300009147 | Bacteria | 1076 |
| 182 | Ga0114129_11177497 | 3300009147 | Bacteria | 956 |
| 183 | Ga0105243_10188544 | 3300009148 | Bacteria | 1799 |
| 184 | Ga0105243_10820727 | 3300009148 | Bacteria | 918 |
| 185 | Ga0105243_11379359 | 3300009148 | Bacteria | 725 |
| 186 | Ga0105242_10295051 | 3300009176 | Bacteria | 1478 |
| 187 | Ga0105242_10470310 | 3300009176 | Bacteria | 1189 |
| 188 | Ga0105248_10102389 | 3300009177 | Bacteria | 3227 |
| 189 | Ga0105248_10377289 | 3300009177 | Bacteria | 1596 |
| 190 | Ga0105248_10918848 | 3300009177 | Bacteria | 988 |
| 191 | Ga0105248_11279507 | 3300009177 | Bacteria | 829 |
| 192 | Ga0105248_13342220 | 3300009177 | Bacteria | 510 |
| 193 | Ga0105237_10028651 | 3300009545 | Bacteria | 5670 |
| 194 | Ga0105237_10947543 | 3300009545 | Bacteria | 868 |
| 195 | Ga0105237_11138383 | 3300009545 | Bacteria | 787 |
| 196 | Ga0105237_11540882 | 3300009545 | Bacteria | 671 |
| 197 | Ga0105238_10060481 | 3300009551 | Bacteria | 3792 |
| 198 | Ga0105238_11529742 | 3300009551 | Bacteria | 696 |
| 199 | Ga0105238_12539930 | 3300009551 | Bacteria | 548 |
| 200 | Ga0105249_10667262 | 3300009553 | Bacteria | 1098 |
| 201 | Ga0105249_12689451 | 3300009553 | Bacteria | 570 |
| 202 | Ga0105239_10207157 | 3300010375 | Bacteria | 2197 |
| 203 | Ga0105246_10736852 | 3300011119 | Bacteria | 868 |
| 204 | Ga0157370_10009301 | 3300013104 | Bacteria | 10522 |
| 205 | Ga0157370_10874560 | 3300013104 | Bacteria | 816 |
| 206 | Ga0157369_10077611 | 3300013105 | Bacteria | 3560 |
| 207 | Ga0157369_10139208 | 3300013105 | Bacteria | 2569 |
| 208 | Ga0157369_10233255 | 3300013105 | Bacteria | 1924 |
| 209 | Ga0157369_10518379 | 3300013105 | Bacteria | 1233 |
| 210 | Ga0157369_11761259 | 3300013105 | Bacteria | 629 |
| 211 | Ga0157374_10181649 | 3300013296 | Bacteria | 2055 |
| 212 | Ga0157374_11748577 | 3300013296 | Bacteria | 647 |
| 213 | Ga0163162_10181667 | 3300013306 | Bacteria | 2230 |
| 214 | Ga0163162_10428208 | 3300013306 | Bacteria | 1455 |
| 215 | Ga0163162_11815736 | 3300013306 | Bacteria | 697 |
| 216 | Ga0157372_10080638 | 3300013307 | Bacteria | 3683 |
| 217 | Ga0157372_10230787 | 3300013307 | Bacteria | 2146 |
| 218 | Ga0157372_10288236 | 3300013307 | Bacteria | 1909 |
| 219 | Ga0157372_12700909 | 3300013307 | Bacteria | 570 |
| 220 | Ga0157375_10147472 | 3300013308 | Bacteria | 2485 |
| 221 | Ga0157375_11521021 | 3300013308 | Bacteria | 790 |
| 222 | Ga0163163_10799460 | 3300014325 | Bacteria | 1007 |
| 223 | Ga0182008_10004028 | 3300014497 | Bacteria | 8673 |
| 224 | Ga0182008_10107544 | 3300014497 | Bacteria | 1381 |
| 225 | Ga0182008_10210060 | 3300014497 | Bacteria | 993 |
| 226 | Ga0182008_10350340 | 3300014497 | Bacteria | 783 |
| 227 | Ga0157376_10011746 | 3300014969 | Bacteria | 6467 |
| 228 | Ga0182006_1089958 | 3300015261 | Bacteria | 1106 |
| 229 | Ga0182007_10012283 | 3300015262 | Bacteria | 3298 |
| 230 | Ga0182007_10087275 | 3300015262 | Bacteria | 1026 |
| 231 | Ga0206356_10039275 | 3300020070 | Bacteria | 1507 |
| 232 | Ga0206356_11094341 | 3300020070 | Bacteria | 1134 |
| 233 | Ga0206353_11654778 | 3300020082 | Bacteria | 4392 |
| 234 | Ga0207692_10006002 | 3300025898 | Bacteria | 4910 |
| 235 | Ga0207692_10148245 | 3300025898 | Bacteria | 1341 |
| 236 | Ga0207710_10649691 | 3300025900 | Bacteria | 552 |
| 237 | Ga0207688_10260366 | 3300025901 | Bacteria | 1052 |
| 238 | Ga0207685_10055183 | 3300025905 | Bacteria | 1550 |
| 239 | Ga0207699_10320994 | 3300025906 | Bacteria | 1086 |
| 240 | Ga0207699_10846834 | 3300025906 | Bacteria | 673 |
| 241 | Ga0207643_10014388 | 3300025908 | Bacteria | 4296 |
| 242 | Ga0207705_10649966 | 3300025909 | Bacteria | 820 |
| 243 | Ga0207684_11020441 | 3300025910 | Bacteria | 691 |
| 244 | Ga0207707_10085050 | 3300025912 | Bacteria | 2763 |
| 245 | Ga0207707_10182036 | 3300025912 | Bacteria | 1834 |
| 246 | Ga0207707_10277293 | 3300025912 | Bacteria | 1452 |
| 247 | Ga0207707_10620505 | 3300025912 | Bacteria | 913 |
| 248 | Ga0207695_10099689 | 3300025913 | Bacteria | 2902 |
| 249 | Ga0207695_10706590 | 3300025913 | Bacteria | 889 |
| 250 | Ga0207695_10921362 | 3300025913 | Bacteria | 753 |
| 251 | Ga0207671_10404850 | 3300025914 | Bacteria | 1085 |
| 252 | Ga0207671_11142717 | 3300025914 | Bacteria | 611 |
| 253 | Ga0207671_11212355 | 3300025914 | Bacteria | 590 |
| 254 | Ga0207671_11357287 | 3300025914 | Bacteria | 552 |
| 255 | Ga0207693_10008691 | 3300025915 | Bacteria | 8307 |
| 256 | Ga0207693_10020559 | 3300025915 | Bacteria | 5249 |
| 257 | Ga0207693_10023372 | 3300025915 | Bacteria | 4909 |
| 258 | Ga0207693_10199756 | 3300025915 | Bacteria | 1573 |
| 259 | Ga0207693_10501356 | 3300025915 | Bacteria | 948 |
| 260 | Ga0207693_10913296 | 3300025915 | Bacteria | 673 |
| 261 | Ga0207693_11345695 | 3300025915 | Bacteria | 532 |
| 262 | Ga0207663_10018096 | 3300025916 | Bacteria | 3940 |
| 263 | Ga0207663_10019046 | 3300025916 | Bacteria | 3858 |
| 264 | Ga0207663_10874705 | 3300025916 | Bacteria | 718 |
| 265 | Ga0207660_10013739 | 3300025917 | Bacteria | 5312 |
| 266 | Ga0207660_10047498 | 3300025917 | Bacteria | 3035 |
| 267 | Ga0207660_11497786 | 3300025917 | Bacteria | 545 |
| 268 | Ga0207657_10009493 | 3300025919 | Bacteria | 9773 |
| 269 | Ga0207657_10010764 | 3300025919 | Bacteria | 9105 |
| 270 | Ga0207649_10578928 | 3300025920 | Bacteria | 862 |
| 271 | Ga0207649_11072630 | 3300025920 | Bacteria | 635 |
| 272 | Ga0207652_10121275 | 3300025921 | Bacteria | 2326 |
| 273 | Ga0207652_10126062 | 3300025921 | Bacteria | 2281 |
| 274 | Ga0207652_10146163 | 3300025921 | Bacteria | 2116 |
| 275 | Ga0207652_10623834 | 3300025921 | Bacteria | 965 |
| 276 | Ga0207652_10774094 | 3300025921 | Bacteria | 853 |
| 277 | Ga0207646_10003137 | 3300025922 | Bacteria | 18943 |
| 278 | Ga0207646_11412286 | 3300025922 | Bacteria | 605 |
| 279 | Ga0207659_11255334 | 3300025926 | Bacteria | 636 |
| 280 | Ga0207659_11918662 | 3300025926 | Bacteria | 502 |
| 281 | Ga0207687_10251171 | 3300025927 | Bacteria | 1406 |
| 282 | Ga0207687_10751348 | 3300025927 | Bacteria | 830 |
| 283 | Ga0207687_11172726 | 3300025927 | Bacteria | 660 |
| 284 | Ga0207687_11741949 | 3300025927 | Bacteria | 534 |
| 285 | Ga0207700_10056430 | 3300025928 | Bacteria | 2956 |
| 286 | Ga0207700_10168108 | 3300025928 | Bacteria | 1827 |
| 287 | Ga0207700_11648148 | 3300025928 | Bacteria | 567 |
| 288 | Ga0207664_10008513 | 3300025929 | Bacteria | 7162 |
| 289 | Ga0207664_10011230 | 3300025929 | Bacteria | 6352 |
| 290 | Ga0207664_10111773 | 3300025929 | Bacteria | 2273 |
| 291 | Ga0207664_10254735 | 3300025929 | Bacteria | 1533 |
| 292 | Ga0207664_10294149 | 3300025929 | Bacteria | 1427 |
| 293 | Ga0207664_10367334 | 3300025929 | Bacteria | 1276 |
| 294 | Ga0207644_11131312 | 3300025931 | Bacteria | 658 |
| 295 | Ga0207690_11105923 | 3300025932 | Bacteria | 661 |
| 296 | Ga0207706_10056281 | 3300025933 | Bacteria | 3468 |
| 297 | Ga0207686_10098448 | 3300025934 | Bacteria | 1947 |
| 298 | Ga0207686_10411914 | 3300025934 | Bacteria | 1032 |
| 299 | Ga0207709_11270091 | 3300025935 | Bacteria | 608 |
| 300 | Ga0207669_10284081 | 3300025937 | Bacteria | 1250 |
| 301 | Ga0207665_10002129 | 3300025939 | Bacteria | 13398 |
| 302 | Ga0207711_10178680 | 3300025941 | Bacteria | 1929 |
| 303 | Ga0207661_10024653 | 3300025944 | Bacteria | 4561 |
| 304 | Ga0207661_10564157 | 3300025944 | Bacteria | 1043 |
| 305 | Ga0207661_10579051 | 3300025944 | Bacteria | 1029 |
| 306 | Ga0207661_10696826 | 3300025944 | Bacteria | 934 |
| 307 | Ga0207661_12014090 | 3300025944 | Bacteria | 523 |
| 308 | Ga0207679_10095255 | 3300025945 | Bacteria | 2313 |
| 309 | Ga0207679_10131590 | 3300025945 | Bacteria | 2008 |
| 310 | Ga0207667_10993833 | 3300025949 | Bacteria | 827 |
| 311 | Ga0207667_11152418 | 3300025949 | Bacteria | 757 |
| 312 | Ga0207667_12171805 | 3300025949 | Bacteria | 513 |
| 313 | Ga0207712_10357492 | 3300025961 | Bacteria | 1216 |
| 314 | Ga0207677_11199468 | 3300026023 | Bacteria | 695 |
| 315 | Ga0207703_10843580 | 3300026035 | Bacteria | 876 |
| 316 | Ga0207702_10050786 | 3300026078 | Bacteria | 3501 |
| 317 | Ga0207702_10113566 | 3300026078 | Bacteria | 2412 |
| 318 | Ga0207702_10138719 | 3300026078 | Bacteria | 2197 |
| 319 | Ga0207702_10685498 | 3300026078 | Bacteria | 1009 |
| 320 | Ga0207641_10088835 | 3300026088 | Bacteria | 2700 |
| 321 | Ga0207648_10420659 | 3300026089 | Bacteria | 1213 |
| 322 | Ga0207674_10002484 | 3300026116 | Bacteria | 23238 |
| 323 | Ga0207674_10028403 | 3300026116 | Bacteria | 5905 |
| 324 | Ga0207674_10155333 | 3300026116 | Bacteria | 2243 |
| 325 | Ga0207674_10430949 | 3300026116 | Bacteria | 1274 |
| 326 | Ga0207674_11525931 | 3300026116 | Bacteria | 637 |
| 327 | Ga0207675_100849544 | 3300026118 | Bacteria | 928 |
| 328 | Ga0207683_10316104 | 3300026121 | Bacteria | 1430 |
| 329 | Ga0207698_11509898 | 3300026142 | Bacteria | 687 |
| 330 | Ga0207428_10105547 | 3300027907 | Bacteria | 2173 |
| 331 | Ga0268265_10915959 | 3300028380 | Bacteria | 862 |
| 332 | Ga0265319_1232339 | 3300028563 | Bacteria | 563 |
| 333 | Ga0265336_10009011 | 3300028666 | Bacteria | 3468 |
| 334 | Ga0265338_10002905 | 3300028800 | Bacteria | 24920 |
| 335 | Ga0307413_10227287 | 3300031824 | Bacteria | 1368 |
| 336 | Ga0307413_12061062 | 3300031824 | Bacteria | 515 |
| 337 | Ga0307407_10239896 | 3300031903 | Bacteria | 1236 |
| 338 | Ga0307407_11400709 | 3300031903 | Bacteria | 551 |
| 339 | Ga0307412_11689563 | 3300031911 | Bacteria | 580 |
| 340 | Ga0307409_100066010 | 3300031995 | Bacteria | 2851 |
| 341 | Ga0307409_100391265 | 3300031995 | Bacteria | 1325 |
| 342 | Ga0307416_100056460 | 3300032002 | Bacteria | 3169 |
| 343 | Ga0307416_101505978 | 3300032002 | Bacteria | 778 |
| 344 | Ga0307415_100037113 | 3300032126 | Bacteria | 3200 |
| 345 | Ga0373936_0112682 | 3300035113 | Bacteria | 1156 |
| 346 | Ga0373931_0102191 | 3300035691 | Bacteria | 1614 |
| 347 | Ga0373935_0240375 | 3300035692 | Bacteria | 1264 |
| 348 | Ga0373935_0355061 | 3300035692 | Bacteria | 1046 |
| 349 | Ga0373947_0302527 | 3300035725 | Bacteria | 1067 |
| 350 | Ga0373937_0520878 | 3300036401 | Bacteria | 1130 |
| 351 | Ga0395899_0002411 | 3300037312 | Bacteria | 15193 |
| 352 | Ga0395899_0031639 | 3300037312 | Bacteria | 3976 |
| 353 | Ga0395899_0058497 | 3300037312 | Bacteria | 2842 |
| 354 | Ga0395899_0321583 | 3300037312 | Bacteria | 1042 |
| 355 | Ga0395899_0347559 | 3300037312 | Bacteria | 993 |
| 356 | Ga0395899_0381515 | 3300037312 | Bacteria | 937 |
| 357 | Ga0395900_0015039 | 3300037418 | Bacteria | 7888 |
| 358 | Ga0395900_0016859 | 3300037418 | Bacteria | 7454 |
| 359 | Ga0395900_0026672 | 3300037418 | Bacteria | 5915 |
| 360 | Ga0395900_0046334 | 3300037418 | Bacteria | 4476 |
| 361 | Ga0395900_0098676 | 3300037418 | Bacteria | 3001 |
| 362 | Ga0395900_0116389 | 3300037418 | Bacteria | 2743 |
| 363 | Ga0395900_0145888 | 3300037418 | Bacteria | 2420 |
| 364 | Ga0395900_0198342 | 3300037418 | Bacteria | 2032 |
| 365 | Ga0395900_0391565 | 3300037418 | Bacteria | 1355 |
| 366 | Ga0395900_0392546 | 3300037418 | Bacteria | 1353 |
| 367 | Ga0395900_0602320 | 3300037418 | Bacteria | 1039 |
| 368 | Ga0395900_1027484 | 3300037418 | Bacteria | 743 |
| 369 | Ga0395900_1562722 | 3300037418 | Bacteria | 571 |
| 370 | Ga0395900_1633065 | 3300037418 | Bacteria | 556 |
| 371 | Ga0395898_0005964 | 3300037466 | Bacteria | 13081 |
| 372 | Ga0395898_0010490 | 3300037466 | Bacteria | 9686 |
| 373 | Ga0395898_0020626 | 3300037466 | Bacteria | 6694 |
| 374 | Ga0395898_0035987 | 3300037466 | Bacteria | 4920 |
| 375 | Ga0395898_0042077 | 3300037466 | Bacteria | 4509 |
| 376 | Ga0395898_0251346 | 3300037466 | Bacteria | 1686 |
| 377 | Ga0395898_0295587 | 3300037466 | Bacteria | 1545 |
| 378 | Ga0395898_0526726 | 3300037466 | Bacteria | 1123 |
| 379 | Ga0395898_0563497 | 3300037466 | Bacteria | 1081 |
| 380 | Ga0395898_0796234 | 3300037466 | Bacteria | 885 |
| 381 | Ga0395898_0976856 | 3300037466 | Bacteria | 783 |
| 382 | Ga0395898_1074671 | 3300037466 | Bacteria | 739 |
| 383 | Ga0395905_0021372 | 3300037471 | Bacteria | 6120 |
| 384 | Ga0395905_0033208 | 3300037471 | Bacteria | 4848 |
| 385 | Ga0395905_0195787 | 3300037471 | Bacteria | 1895 |
| 386 | Ga0395905_0275419 | 3300037471 | Bacteria | 1568 |
| 387 | Ga0395905_0278542 | 3300037471 | Bacteria | 1558 |
| 388 | Ga0395905_0398685 | 3300037471 | Bacteria | 1271 |
| 389 | Ga0395905_0426983 | 3300037471 | Bacteria | 1222 |
| 390 | Ga0395905_0515519 | 3300037471 | Bacteria | 1096 |
| 391 | Ga0395905_1104211 | 3300037471 | Bacteria | 696 |
| 392 | Ga0395905_1158925 | 3300037471 | Bacteria | 676 |
| 393 | Ga0395905_1248993 | 3300037471 | Bacteria | 646 |
| 394 | Ga0395901_0001730 | 3300038443 | Bacteria | 22543 |
| 395 | Ga0395901_0004281 | 3300038443 | Bacteria | 14399 |
| 396 | Ga0395901_0010470 | 3300038443 | Bacteria | 9393 |
| 397 | Ga0395901_0015802 | 3300038443 | Bacteria | 7691 |
| 398 | Ga0395901_0070123 | 3300038443 | Bacteria | 3651 |
| 399 | Ga0395901_0127794 | 3300038443 | Bacteria | 2671 |
| 400 | Ga0395901_0291942 | 3300038443 | Bacteria | 1692 |
| 401 | Ga0395901_0293960 | 3300038443 | Bacteria | 1685 |
| 402 | Ga0395901_0361120 | 3300038443 | Bacteria | 1497 |
| 403 | Ga0395901_0366132 | 3300038443 | Bacteria | 1485 |
| 404 | Ga0395901_0439071 | 3300038443 | Bacteria | 1336 |
| 405 | Ga0395901_0788115 | 3300038443 | Bacteria | 940 |
| 406 | Ga0395901_1064239 | 3300038443 | Bacteria | 781 |
| 407 | Ga0395901_1910902 | 3300038443 | Bacteria | 541 |
| 408 | Ga0436363_0438143 | 3300039450 | Bacteria | 805 |
| 409 | Ga0436363_1655099 | 3300039450 | Bacteria | 957 |
| 410 | Ga0439438_059950 | 3300041405 | Bacteria | 954 |
| 411 | Ga0439461_0198355 | 3300041410 | Bacteria | 538 |
| 412 | Ga0451791_1724365 | 3300041451 | Bacteria | 738 |
| 413 | Ga0451845_0704111 | 3300041501 | Bacteria | 522 |
| 414 | Ga0451853_2233860 | 3300041512 | Bacteria | 1007 |
| 415 | Ga0439445_0117000 | 3300042004 | Bacteria | 763 |
| 416 | Ga0439449_0330317 | 3300042007 | Bacteria | 576 |
| 417 | Ga0439464_0171767 | 3300042439 | Bacteria | 684 |
| 418 | Ga0439460_0313418 | 3300042461 | Bacteria | 550 |
| 419 | Ga0450918_034132 | 3300042531 | Bacteria | 903 |
| 420 | Ga0466969_0077276 | 3300044656 | Bacteria | 1593 |
| 421 | Ga0466969_0098555 | 3300044656 | Bacteria | 1378 |
| 422 | Ga0466972_0024827 | 3300044658 | Bacteria | 2975 |
| 423 | Ga0466965_0063247 | 3300044683 | Bacteria | 1852 |
| 424 | Ga0466965_0115741 | 3300044683 | Bacteria | 1381 |
| 425 | Ga0466965_0795297 | 3300044683 | Bacteria | 547 |
| 426 | Ga0466966_0008968 | 3300044684 | Bacteria | 6628 |
| 427 | Ga0466966_0049950 | 3300044684 | Bacteria | 2662 |
| 428 | Ga0466961_0003397 | 3300044693 | Bacteria | 9935 |
| 429 | Ga0466961_0132303 | 3300044693 | Bacteria | 1563 |
| 430 | Ga0466961_0207291 | 3300044693 | Bacteria | 1211 |
| 431 | Ga0466963_0005916 | 3300044694 | Bacteria | 7201 |
| 432 | Ga0466963_0007929 | 3300044694 | Bacteria | 6359 |
| 433 | Ga0466963_0021952 | 3300044694 | Bacteria | 4035 |
| 434 | Ga0466963_0060709 | 3300044694 | Bacteria | 2525 |
| 435 | Ga0466963_0063407 | 3300044694 | Bacteria | 2473 |
| 436 | Ga0466963_0120699 | 3300044694 | Bacteria | 1803 |
| 437 | Ga0466963_0139871 | 3300044694 | Bacteria | 1676 |
| 438 | Ga0466963_0264239 | 3300044694 | Bacteria | 1208 |
| 439 | Ga0466963_0724772 | 3300044694 | Bacteria | 701 |
| 440 | Ga0466964_0005301 | 3300044706 | Bacteria | 4785 |
| 441 | Ga0466964_0012711 | 3300044706 | Bacteria | 3187 |
| 442 | Ga0466964_0019735 | 3300044706 | Bacteria | 2592 |
| 443 | Ga0466964_0066236 | 3300044706 | Bacteria | 1515 |
| 444 | Ga0466964_0081695 | 3300044706 | Bacteria | 1388 |
| 445 | Ga0466964_0115124 | 3300044706 | Bacteria | 1204 |
| 446 | Ga0466964_0439356 | 3300044706 | Bacteria | 690 |
| 447 | Ga0466964_0445748 | 3300044706 | Bacteria | 685 |
| 448 | Ga0466964_0808823 | 3300044706 | Bacteria | 530 |
| 449 | Ga0466971_0001034 | 3300044719 | Bacteria | 11524 |
| 450 | Ga0466971_0013313 | 3300044719 | Bacteria | 3612 |
| 451 | Ga0466971_0076211 | 3300044719 | Bacteria | 1526 |
| 452 | Ga0466971_0121251 | 3300044719 | Bacteria | 1210 |
| 453 | Ga0466968_0003414 | 3300044735 | Bacteria | 5873 |
| 454 | Ga0466968_0010182 | 3300044735 | Bacteria | 3638 |
| 455 | Ga0466968_0047138 | 3300044735 | Bacteria | 1832 |
| 456 | Ga0466968_0141050 | 3300044735 | Bacteria | 1102 |
| 457 | Ga0466968_0182082 | 3300044735 | Bacteria | 977 |
| 458 | Ga0466968_0254272 | 3300044735 | Bacteria | 835 |
| 459 | Ga0466970_0160019 | 3300044765 | Bacteria | 1245 |
| 460 | Ga0466957_0002287 | 3300044842 | Bacteria | 10260 |
| 461 | Ga0466957_0036114 | 3300044842 | Bacteria | 2969 |
| 462 | Ga0466957_0091545 | 3300044842 | Bacteria | 1906 |
| 463 | Ga0466957_0094593 | 3300044842 | Bacteria | 1876 |
| 464 | Ga0466957_0169697 | 3300044842 | Bacteria | 1421 |
| 465 | Ga0466957_0301668 | 3300044842 | Bacteria | 1076 |
| 466 | Ga0466960_0014345 | 3300044901 | Bacteria | 3390 |
| 467 | Ga0466960_0031867 | 3300044901 | Bacteria | 2435 |
| 468 | Ga0466960_0757507 | 3300044901 | Bacteria | 586 |
| 469 | Ga0466959_0001467 | 3300045049 | Bacteria | 14453 |
| 470 | Ga0466959_0002306 | 3300045049 | Bacteria | 12175 |
| 471 | Ga0466959_0674705 | 3300045049 | Bacteria | 693 |
| 472 | Ga0466958_0036288 | 3300045836 | Bacteria | 2950 |
| 473 | Ga0466958_0038426 | 3300045836 | Bacteria | 2872 |
| 474 | Ga0466958_0047613 | 3300045836 | Bacteria | 2588 |
| 475 | Ga0466958_0052618 | 3300045836 | Bacteria | 2468 |
| 476 | Ga0466958_0158614 | 3300045836 | Bacteria | 1428 |
| 477 | Ga0466958_0257172 | 3300045836 | Bacteria | 1117 |
| 478 | Ga0466967_0000602 | 3300045976 | Bacteria | 17865 |
| 479 | Ga0466967_0001349 | 3300045976 | Bacteria | 14097 |
| 480 | Ga0466967_0032464 | 3300045976 | Bacteria | 4409 |
| 481 | Ga0466967_0039396 | 3300045976 | Bacteria | 4062 |
| 482 | Ga0466967_0055383 | 3300045976 | Bacteria | 3493 |
| 483 | Ga0466967_0083108 | 3300045976 | Bacteria | 2895 |
| 484 | Ga0466967_0086927 | 3300045976 | Bacteria | 2833 |
| 485 | Ga0466967_0098577 | 3300045976 | Bacteria | 2668 |
| 486 | Ga0466967_0101712 | 3300045976 | Bacteria | 2627 |
| 487 | Ga0466967_0110092 | 3300045976 | Bacteria | 2529 |
| 488 | Ga0466967_0122553 | 3300045976 | Bacteria | 2404 |
| 489 | Ga0466967_0162735 | 3300045976 | Bacteria | 2095 |
| 490 | Ga0466967_0473308 | 3300045976 | Bacteria | 1226 |
| 491 | Ga0466967_0769062 | 3300045976 | Bacteria | 955 |
| 492 | Ga0466967_1163475 | 3300045976 | Bacteria | 768 |
| 493 | Ga0466967_2401569 | 3300045976 | Bacteria | 522 |
| 494 | Ga0495592_0077201 | 3300046454 | Bacteria | 2415 |
| 495 | Ga0495592_0237019 | 3300046454 | Bacteria | 1212 |
| 496 | Ga0495592_0383032 | 3300046454 | Bacteria | 894 |
| 497 | Ga0495603_0148007 | 3300046455 | Bacteria | 1365 |
| 498 | Ga0495629_0095764 | 3300046459 | Bacteria | 2071 |
| 499 | Ga0495629_0099393 | 3300046459 | Bacteria | 2030 |
| 500 | Ga0495641_0009111 | 3300046461 | Bacteria | 5943 |
| 501 | Ga0495641_0032020 | 3300046461 | Bacteria | 2507 |
| 502 | Ga0495641_0065957 | 3300046461 | Bacteria | 1629 |
| 503 | Ga0495641_0191704 | 3300046461 | Bacteria | 916 |
| 504 | Ga0495641_0227778 | 3300046461 | Bacteria | 836 |
| 505 | Ga0495641_0243097 | 3300046461 | Bacteria | 809 |
| 506 | Ga0495651_0107736 | 3300046462 | Bacteria | 2064 |
| 507 | Ga0495651_0325319 | 3300046462 | Bacteria | 1023 |
| 508 | Ga0495651_0635580 | 3300046462 | Bacteria | 670 |
| 509 | Ga0495651_0803713 | 3300046462 | Bacteria | 580 |
| 510 | Ga0495653_0033712 | 3300046463 | Bacteria | 4054 |
| 511 | Ga0495653_0034462 | 3300046463 | Bacteria | 4005 |
| 512 | Ga0495653_0099046 | 3300046463 | Bacteria | 2116 |
| 513 | Ga0495653_0181593 | 3300046463 | Bacteria | 1443 |
| 514 | Ga0495653_0389363 | 3300046463 | Bacteria | 888 |
| 515 | Ga0495653_0410521 | 3300046463 | Bacteria | 859 |
| 516 | Ga0495580_0732371 | 3300046472 | Bacteria | 645 |
| 517 | Ga0495582_0092313 | 3300046473 | Bacteria | 1689 |
| 518 | Ga0495605_0260286 | 3300046474 | Bacteria | 741 |
| 519 | Ga0495664_0049809 | 3300046477 | Bacteria | 2487 |
| 520 | Ga0495664_0185437 | 3300046477 | Bacteria | 1261 |
| 521 | Ga0495664_0450768 | 3300046477 | Bacteria | 770 |
| 522 | Ga0495585_0051106 | 3300046492 | Bacteria | 2291 |
| 523 | Ga0495596_0157621 | 3300046500 | Bacteria | 882 |
| 524 | Ga0495607_0049949 | 3300046501 | Bacteria | 2437 |
| 525 | Ga0495607_0077240 | 3300046501 | Bacteria | 1840 |
| 526 | Ga0495608_0035123 | 3300046511 | Bacteria | 3383 |
| 527 | Ga0495608_0097069 | 3300046511 | Bacteria | 1903 |
| 528 | Ga0495608_0227286 | 3300046511 | Bacteria | 1169 |
| 529 | Ga0495608_0279069 | 3300046511 | Bacteria | 1037 |
| 530 | Ga0495608_0890426 | 3300046511 | Bacteria | 521 |
| 531 | Ga0495618_0142277 | 3300046514 | Bacteria | 1534 |
| 532 | Ga0495618_0187967 | 3300046514 | Bacteria | 1311 |
| 533 | Ga0495618_0229465 | 3300046514 | Bacteria | 1169 |
| 534 | Ga0495618_0296129 | 3300046514 | Bacteria | 1006 |
| 535 | Ga0495618_0388755 | 3300046514 | Bacteria | 855 |
| 536 | Ga0495628_0139628 | 3300046516 | Bacteria | 1849 |
| 537 | Ga0495628_0209349 | 3300046516 | Bacteria | 1467 |
| 538 | Ga0495628_1153956 | 3300046516 | Bacteria | 527 |
| 539 | Ga0495630_0113983 | 3300046517 | Bacteria | 2048 |
| 540 | Ga0495630_0244684 | 3300046517 | Bacteria | 1370 |
| 541 | Ga0495630_0928068 | 3300046517 | Bacteria | 663 |
| 542 | Ga0495630_1134091 | 3300046517 | Bacteria | 592 |
| 543 | Ga0495637_0096930 | 3300046520 | Bacteria | 1157 |
| 544 | Ga0495644_0019710 | 3300046523 | Bacteria | 2575 |
| 545 | Ga0495642_0232982 | 3300046528 | Bacteria | 804 |
| 546 | Ga0495652_0024347 | 3300046529 | Bacteria | 5359 |
| 547 | Ga0495652_0209574 | 3300046529 | Bacteria | 1472 |
| 548 | Ga0495640_0181423 | 3300046533 | Bacteria | 1341 |
| 549 | Ga0495640_0374373 | 3300046533 | Bacteria | 877 |
| 550 | Ga0495586_0002329 | 3300046535 | Bacteria | 10328 |
| 551 | Ga0495587_0037387 | 3300046536 | Bacteria | 2915 |
| 552 | Ga0495645_0131891 | 3300046543 | Bacteria | 1750 |
| 553 | Ga0495645_0183865 | 3300046543 | Bacteria | 1429 |
| 554 | Ga0495645_0229756 | 3300046543 | Bacteria | 1243 |
| 555 | Ga0495667_0054984 | 3300046559 | Bacteria | 2618 |
| 556 | Ga0495667_0327229 | 3300046559 | Bacteria | 969 |
| 557 | Ga0495667_0561778 | 3300046559 | Bacteria | 712 |
| 558 | Ga0495656_0001684 | 3300046615 | Bacteria | 7232 |
| 559 | Ga0495656_0130155 | 3300046615 | Bacteria | 1197 |
| 560 | Ga0495656_0415058 | 3300046615 | Bacteria | 706 |
| 561 | Ga0495634_0310045 | 3300046642 | Bacteria | 952 |
| 562 | Ga0495634_0376038 | 3300046642 | Bacteria | 847 |
| 563 | Ga0495634_0400167 | 3300046642 | Bacteria | 816 |
| 564 | Ga0495634_0477608 | 3300046642 | Bacteria | 733 |
| 565 | Ga0495611_0025198 | 3300046648 | Bacteria | 2591 |
| 566 | Ga0495635_0018122 | 3300046663 | Bacteria | 4917 |
| 567 | Ga0495635_0299988 | 3300046663 | Bacteria | 1077 |
| 568 | Ga0495661_0298603 | 3300046665 | Unclassified | 807 |
| 569 | Ga0495657_0015450 | 3300046675 | Bacteria | 5587 |
| 570 | Ga0495657_0059425 | 3300046675 | Bacteria | 2536 |
| 571 | Ga0495657_0127289 | 3300046675 | Bacteria | 1599 |
| 572 | Ga0495599_0028273 | 3300046678 | Bacteria | 3514 |
| 573 | Ga0495623_0098893 | 3300046679 | Bacteria | 1780 |
| 574 | Ga0495646_0025801 | 3300046680 | Bacteria | 3695 |
| 575 | Ga0495658_0080923 | 3300046683 | Bacteria | 1906 |
| 576 | Ga0495669_0308932 | 3300046684 | Bacteria | 763 |
| 577 | Ga0495613_0311274 | 3300046689 | Bacteria | 1088 |
| 578 | Ga0495613_0797052 | 3300046689 | Bacteria | 617 |
| 579 | Ga0495624_0008048 | 3300046690 | Bacteria | 7384 |
| 580 | Ga0495624_0075064 | 3300046690 | Bacteria | 2100 |
| 581 | Ga0495624_0440241 | 3300046690 | Bacteria | 781 |
| 582 | Ga0495670_0333881 | 3300046691 | Bacteria | 815 |
| 583 | Ga0495589_0034291 | 3300046794 | Bacteria | 2549 |
| 584 | Ga0495589_0497054 | 3300046794 | Bacteria | 557 |
| 585 | Ga0495600_0027831 | 3300046809 | Bacteria | 3655 |
| 586 | Ga0495600_0149672 | 3300046809 | Bacteria | 1512 |
| 587 | Ga0495600_0460786 | 3300046809 | Bacteria | 785 |
| 588 | Ga0495581_0637502 | 3300047315 | Bacteria | 616 |
| 589 | Ga0495604_0197669 | 3300047317 | Bacteria | 1397 |
| 590 | Ga0495604_0536353 | 3300047317 | Bacteria | 756 |
| 591 | Ga0495636_0147460 | 3300047318 | Bacteria | 1054 |
| 592 | Ga0495636_0455277 | 3300047318 | Bacteria | 615 |
| 593 | Ga0495674_0024505 | 3300047319 | Bacteria | 5543 |
| 594 | Ga0495674_0059113 | 3300047319 | Bacteria | 3349 |
| 595 | Ga0495674_0141769 | 3300047319 | Bacteria | 2020 |
| 596 | Ga0495674_0320248 | 3300047319 | Bacteria | 1263 |
| 597 | Ga0495674_0424085 | 3300047319 | Bacteria | 1071 |
| 598 | Ga0495674_0425528 | 3300047319 | Bacteria | 1069 |
| 599 | Ga0495674_0512956 | 3300047319 | Bacteria | 958 |
| 600 | Ga0495676_0356906 | 3300047321 | Bacteria | 976 |
| 601 | Ga0495676_0549670 | 3300047321 | Bacteria | 755 |
| 602 | Ga0495676_0707868 | 3300047321 | Bacteria | 651 |
| 603 | Ga0495676_1041327 | 3300047321 | Bacteria | 521 |
| 604 | Ga0495680_0025389 | 3300047322 | Bacteria | 4905 |
| 605 | Ga0495680_0245197 | 3300047322 | Bacteria | 1271 |
| 606 | Ga0495680_0302145 | 3300047322 | Bacteria | 1123 |
| 607 | Ga0495680_0491831 | 3300047322 | Bacteria | 834 |
| 608 | Ga0495680_0655774 | 3300047322 | Bacteria | 697 |
| 609 | Ga0495680_0804026 | 3300047322 | Bacteria | 614 |
| 610 | Ga0495679_121713 | 3300047446 | Bacteria | 713 |
| 611 | Ga0495684_0010240 | 3300047471 | Bacteria | 7251 |
| 612 | Ga0495684_0898895 | 3300047471 | Bacteria | 570 |
| 613 | Ga0495602_0052083 | 3300048088 | Bacteria | 3639 |
| 614 | Ga0495602_1118832 | 3300048088 | Bacteria | 516 |
| 615 | Ga0496100_0229182 | 3300048903 | Bacteria | 1366 |
| 616 | Ga0496100_0391344 | 3300048903 | Bacteria | 1057 |
| 617 | Ga0496100_0877506 | 3300048903 | Bacteria | 704 |
| 618 | Ga0496101_0014002 | 3300048904 | Bacteria | 5386 |
| 619 | Ga0496101_0046419 | 3300048904 | Bacteria | 3115 |
| 620 | Ga0496101_0172860 | 3300048904 | Bacteria | 1661 |
| 621 | Ga0496101_0804188 | 3300048904 | Bacteria | 741 |
| 622 | Ga0496101_1116828 | 3300048904 | Bacteria | 619 |
| 623 | Ga0496101_1522938 | 3300048904 | Bacteria | 520 |
| 624 | Ga0496102_0048673 | 3300048905 | Bacteria | 3854 |
| 625 | Ga0496102_0088932 | 3300048905 | Bacteria | 2856 |
| 626 | Ga0496103_0091335 | 3300048906 | Bacteria | 1921 |
| 627 | Ga0496103_0110790 | 3300048906 | Bacteria | 1744 |
| 628 | Ga0496103_0257853 | 3300048906 | Bacteria | 1122 |
| 629 | Ga0496103_0577177 | 3300048906 | Bacteria | 717 |
| 630 | Ga0496104_0002284 | 3300048907 | Bacteria | 16535 |
| 631 | Ga0496104_0007845 | 3300048907 | Bacteria | 9460 |
| 632 | Ga0496104_0046059 | 3300048907 | Bacteria | 4104 |
| 633 | Ga0496104_0138664 | 3300048907 | Bacteria | 2337 |
| 634 | Ga0496104_0148959 | 3300048907 | Bacteria | 2247 |
| 635 | Ga0496104_0308234 | 3300048907 | Bacteria | 1496 |
| 636 | Ga0496104_0961117 | 3300048907 | Bacteria | 759 |
| 637 | Ga0496105_0004123 | 3300048908 | Bacteria | 10893 |
| 638 | Ga0496105_0008437 | 3300048908 | Bacteria | 8008 |
| 639 | Ga0496105_0015296 | 3300048908 | Bacteria | 6111 |
| 640 | Ga0496105_0034045 | 3300048908 | Bacteria | 4188 |
| 641 | Ga0496105_0044517 | 3300048908 | Bacteria | 3661 |
| 642 | Ga0496106_0383796 | 3300048909 | Bacteria | 1129 |
| 643 | Ga0496106_0440479 | 3300048909 | Bacteria | 1047 |
| 644 | Ga0496106_0827978 | 3300048909 | Bacteria | 733 |
| 645 | Ga0496106_0890427 | 3300048909 | Bacteria | 703 |
| 646 | Ga0496107_0021170 | 3300048910 | Bacteria | 4597 |
| 647 | Ga0496107_0026969 | 3300048910 | Bacteria | 4077 |
| 648 | Ga0496108_0020386 | 3300048911 | Bacteria | 5450 |
| 649 | Ga0496108_0048468 | 3300048911 | Bacteria | 3552 |
| 650 | Ga0496108_0052069 | 3300048911 | Bacteria | 3430 |
| 651 | Ga0496108_0059540 | 3300048911 | Bacteria | 3211 |
| 652 | Ga0496108_0520407 | 3300048911 | Bacteria | 1038 |
| 653 | Ga0496108_1002355 | 3300048911 | Bacteria | 713 |
| 654 | Ga0496108_1066078 | 3300048911 | Bacteria | 688 |
| 655 | Ga0496109_0003748 | 3300048912 | Bacteria | 12703 |
| 656 | Ga0496109_0010639 | 3300048912 | Bacteria | 7868 |
| 657 | Ga0496109_0056298 | 3300048912 | Bacteria | 3588 |
| 658 | Ga0496109_0079705 | 3300048912 | Bacteria | 3017 |
| 659 | Ga0496109_0085715 | 3300048912 | Bacteria | 2908 |
| 660 | Ga0496109_0303329 | 3300048912 | Bacteria | 1506 |
| 661 | Ga0496109_0452968 | 3300048912 | Bacteria | 1212 |
| 662 | Ga0496109_1990466 | 3300048912 | Bacteria | 513 |
| 663 | Ga0496110_0007489 | 3300048913 | Bacteria | 8722 |
| 664 | Ga0496110_0134108 | 3300048913 | Bacteria | 2237 |
| 665 | Ga0496110_0275284 | 3300048913 | Bacteria | 1533 |
| 666 | Ga0496110_1270509 | 3300048913 | Bacteria | 645 |
| 667 | Ga0496111_0003137 | 3300048914 | Bacteria | 10169 |
| 668 | Ga0496111_0007042 | 3300048914 | Bacteria | 7347 |
| 669 | Ga0496111_0366270 | 3300048914 | Bacteria | 1066 |
| 670 | Ga0496111_0382810 | 3300048914 | Bacteria | 1040 |
| 671 | Ga0496111_0411727 | 3300048914 | Bacteria | 999 |
| 672 | Ga0496111_0677007 | 3300048914 | Bacteria | 751 |
| 673 | Ga0496111_0890766 | 3300048914 | Bacteria | 641 |
| 674 | Ga0496112_0002474 | 3300048915 | Bacteria | 14909 |
| 675 | Ga0496112_0342251 | 3300048915 | Bacteria | 1439 |
| 676 | Ga0496113_0004105 | 3300048916 | Bacteria | 8875 |
| 677 | Ga0496113_0161857 | 3300048916 | Bacteria | 1769 |
| 678 | Ga0496113_0466128 | 3300048916 | Bacteria | 1015 |
| 679 | Ga0496113_0809187 | 3300048916 | Bacteria | 744 |
| 680 | Ga0496114_0037319 | 3300048917 | Bacteria | 4018 |
| 681 | Ga0496114_0045517 | 3300048917 | Bacteria | 3646 |
| 682 | Ga0496114_0068075 | 3300048917 | Bacteria | 2988 |
| 683 | Ga0496114_0252648 | 3300048917 | Bacteria | 1551 |
| 684 | Ga0496114_1043679 | 3300048917 | Bacteria | 701 |
| 685 | Ga0496115_0117621 | 3300048918 | Bacteria | 2186 |
| 686 | Ga0496115_0141011 | 3300048918 | Bacteria | 1988 |
| 687 | Ga0496115_0155518 | 3300048918 | Bacteria | 1889 |
| 688 | Ga0496115_1197847 | 3300048918 | Bacteria | 571 |
| 689 | Ga0501031_0000423 | 3300049568 | Bacteria | 24274 |
| 690 | Ga0501031_0528448 | 3300049568 | Bacteria | 760 |
| 691 | Ga0501031_0911377 | 3300049568 | Bacteria | 562 |
| 692 | Ga0501032_0002185 | 3300049569 | Bacteria | 15389 |
| 693 | Ga0501032_0136528 | 3300049569 | Bacteria | 1616 |
| 694 | Ga0501033_0004428 | 3300049570 | Bacteria | 11238 |
| 695 | Ga0501033_0019459 | 3300049570 | Bacteria | 5135 |
| 696 | Ga0501033_0150382 | 3300049570 | Bacteria | 1680 |
| 697 | Ga0501034_0036109 | 3300049571 | Bacteria | 5010 |
| 698 | Ga0501036_0001079 | 3300049572 | Bacteria | 20681 |
| 699 | Ga0501036_0049827 | 3300049572 | Bacteria | 3547 |
| 700 | Ga0501036_0133549 | 3300049572 | Bacteria | 2094 |
| 701 | Ga0501036_0936060 | 3300049572 | Bacteria | 710 |
| 702 | Ga0501037_0000071 | 3300049573 | Bacteria | 94548 |
| 703 | Ga0501037_0002387 | 3300049573 | Bacteria | 13558 |
| 704 | Ga0501038_0000282 | 3300049574 | Bacteria | 43214 |
| 705 | Ga0501038_0007028 | 3300049574 | Bacteria | 10397 |
| 706 | Ga0501038_0450746 | 3300049574 | Bacteria | 989 |
| 707 | Ga0501038_0688485 | 3300049574 | Bacteria | 767 |
| 708 | Ga0501039_0001238 | 3300049575 | Bacteria | 18696 |
| 709 | Ga0501039_0014170 | 3300049575 | Bacteria | 6104 |
| 710 | Ga0501039_0083543 | 3300049575 | Bacteria | 2487 |
| 711 | Ga0501039_0341164 | 3300049575 | Bacteria | 1177 |
| 712 | Ga0501039_0982386 | 3300049575 | Bacteria | 656 |
| 713 | Ga0501040_0025089 | 3300049576 | Bacteria | 4005 |
| 714 | Ga0501040_0031551 | 3300049576 | Bacteria | 3582 |
| 715 | Ga0501040_0075251 | 3300049576 | Bacteria | 2333 |
| 716 | Ga0501040_0125804 | 3300049576 | Bacteria | 1800 |
| 717 | Ga0501040_0615933 | 3300049576 | Bacteria | 784 |
| 718 | Ga0501041_0002075 | 3300049577 | Bacteria | 11284 |
| 719 | Ga0501041_0007528 | 3300049577 | Bacteria | 6392 |
| 720 | Ga0501041_0018197 | 3300049577 | Bacteria | 4185 |
| 721 | Ga0501041_0034437 | 3300049577 | Bacteria | 3066 |
| 722 | Ga0501041_0234508 | 3300049577 | Bacteria | 1152 |
| 723 | Ga0501041_0443998 | 3300049577 | Bacteria | 823 |
| 724 | Ga0501041_0668056 | 3300049577 | Bacteria | 664 |
| 725 | Ga0501042_0006730 | 3300049578 | Bacteria | 7492 |
| 726 | Ga0501042_0025268 | 3300049578 | Bacteria | 4170 |
| 727 | Ga0501042_0046434 | 3300049578 | Bacteria | 3096 |
| 728 | Ga0501042_0344587 | 3300049578 | Bacteria | 1077 |
| 729 | Ga0501043_0001377 | 3300049579 | Bacteria | 21286 |
| 730 | Ga0501043_0004913 | 3300049579 | Bacteria | 10808 |
| 731 | Ga0501043_0365987 | 3300049579 | Bacteria | 1094 |
| 732 | Ga0501046_0000812 | 3300049580 | Bacteria | 30391 |
| 733 | Ga0501046_0051117 | 3300049580 | Bacteria | 3263 |
| 734 | Ga0501046_0935066 | 3300049580 | Bacteria | 604 |
| 735 | Ga0501047_0943470 | 3300049581 | Bacteria | 676 |
| 736 | Ga0501047_1212991 | 3300049581 | Unclassified | 568 |
| 737 | Ga0501048_0003425 | 3300049582 | Bacteria | 12048 |
| 738 | Ga0501048_0059562 | 3300049582 | Bacteria | 2706 |
| 739 | Ga0501048_0064591 | 3300049582 | Bacteria | 2588 |
| 740 | Ga0501048_0274177 | 3300049582 | Bacteria | 1199 |
| 741 | Ga0501048_0620134 | 3300049582 | Bacteria | 776 |
| 742 | Ga0501067_0227473 | 3300049583 | Bacteria | 1038 |
| 743 | Ga0501067_0245688 | 3300049583 | Bacteria | 996 |
| 744 | Ga0501068_0000165 | 3300049584 | Bacteria | 30724 |
| 745 | Ga0501068_0001860 | 3300049584 | Bacteria | 11209 |
| 746 | Ga0501069_0000359 | 3300049585 | Bacteria | 20470 |
| 747 | Ga0501069_0010689 | 3300049585 | Bacteria | 4865 |
| 748 | Ga0501069_0221462 | 3300049585 | Bacteria | 1100 |
| 749 | Ga0501069_0262565 | 3300049585 | Bacteria | 1008 |
| 750 | Ga0501070_0006865 | 3300049586 | Bacteria | 9687 |
| 751 | Ga0501070_0007343 | 3300049586 | Bacteria | 9358 |
| 752 | Ga0501070_0439205 | 3300049586 | Bacteria | 1053 |
| 753 | Ga0501070_0837541 | 3300049586 | Bacteria | 720 |
| 754 | Ga0501071_0002486 | 3300049587 | Bacteria | 11203 |
| 755 | Ga0501071_0006169 | 3300049587 | Bacteria | 7772 |
| 756 | Ga0501071_0062693 | 3300049587 | Bacteria | 2694 |
| 757 | Ga0501071_0082827 | 3300049587 | Bacteria | 2350 |
| 758 | Ga0501071_0187402 | 3300049587 | Bacteria | 1551 |
| 759 | Ga0501071_0311465 | 3300049587 | Bacteria | 1194 |
| 760 | Ga0501071_0396485 | 3300049587 | Bacteria | 1053 |
| 761 | Ga0501072_0000494 | 3300049588 | Bacteria | 28340 |
| 762 | Ga0501072_0037578 | 3300049588 | Bacteria | 3798 |
| 763 | Ga0501072_0134747 | 3300049588 | Bacteria | 1969 |
| 764 | Ga0501072_0349184 | 3300049588 | Bacteria | 1174 |
| 765 | Ga0501073_0001985 | 3300049589 | Bacteria | 15256 |
| 766 | Ga0501074_0006393 | 3300049590 | Bacteria | 8505 |
| 767 | Ga0501074_0018894 | 3300049590 | Bacteria | 5005 |
| 768 | Ga0501075_0000105 | 3300049591 | Bacteria | 39518 |
| 769 | Ga0501075_0011622 | 3300049591 | Bacteria | 6234 |
| 770 | Ga0501075_0025617 | 3300049591 | Bacteria | 4333 |
| 771 | Ga0501075_0088741 | 3300049591 | Bacteria | 2344 |
| 772 | Ga0501075_0247481 | 3300049591 | Bacteria | 1359 |
| 773 | Ga0501075_0265391 | 3300049591 | Bacteria | 1308 |
| 774 | Ga0501075_1235974 | 3300049591 | Bacteria | 566 |
| 775 | Ga0501076_0070460 | 3300049592 | Bacteria | 2795 |
| 776 | Ga0501076_0198124 | 3300049592 | Bacteria | 1639 |
| 777 | Ga0501076_0495893 | 3300049592 | Bacteria | 1006 |
| 778 | Ga0501076_0685033 | 3300049592 | Bacteria | 846 |
| 779 | Ga0501076_0973769 | 3300049592 | Bacteria | 699 |
| 780 | Ga0501076_1560945 | 3300049592 | Bacteria | 542 |
| 781 | Ga0501076_1784505 | 3300049592 | Bacteria | 504 |
| 782 | Ga0501077_0000128 | 3300049593 | Bacteria | 41409 |
| 783 | Ga0501077_0241843 | 3300049593 | Bacteria | 1147 |
| 784 | Ga0501077_0311612 | 3300049593 | Bacteria | 1003 |
| 785 | Ga0501209_296356 | 3300049656 | Bacteria | 509 |
| 786 | Ga0501079_0050948 | 3300049741 | Bacteria | 3195 |
| 787 | Ga0501079_0067187 | 3300049741 | Bacteria | 2766 |
| 788 | Ga0501079_0087521 | 3300049741 | Bacteria | 2411 |
| 789 | Ga0501079_0348203 | 3300049741 | Bacteria | 1161 |
| 790 | Ga0501079_0775869 | 3300049741 | Bacteria | 755 |
| 791 | Ga0501080_0013924 | 3300049742 | Bacteria | 7403 |
| 792 | Ga0501080_0018014 | 3300049742 | Bacteria | 6539 |
| 793 | Ga0501080_0326723 | 3300049742 | Bacteria | 1388 |
| 794 | Ga0501080_0636533 | 3300049742 | Bacteria | 944 |
| 795 | Ga0501081_0003084 | 3300049743 | Bacteria | 10581 |
| 796 | Ga0501081_0032217 | 3300049743 | Bacteria | 3555 |
| 797 | Ga0501081_0037395 | 3300049743 | Bacteria | 3311 |
| 798 | Ga0501081_0047880 | 3300049743 | Bacteria | 2941 |
| 799 | Ga0501081_0071197 | 3300049743 | Bacteria | 2424 |
| 800 | Ga0501081_0583888 | 3300049743 | Bacteria | 836 |
| 801 | Ga0501081_0634363 | 3300049743 | Bacteria | 800 |
| 802 | Ga0501083_0000352 | 3300049744 | Bacteria | 29038 |
| 803 | Ga0501035_0000978 | 3300049822 | Bacteria | 30240 |
| 804 | Ga0501035_0005703 | 3300049822 | Bacteria | 11746 |
| 805 | Ga0501044_0002766 | 3300049823 | Bacteria | 19969 |
| 806 | Ga0501044_0023380 | 3300049823 | Bacteria | 6573 |
| 807 | Ga0501045_0009549 | 3300049824 | Bacteria | 6787 |
| 808 | Ga0501045_0013003 | 3300049824 | Bacteria | 5867 |
| 809 | Ga0501045_0013979 | 3300049824 | Bacteria | 5681 |
| 810 | Ga0501045_0029991 | 3300049824 | Bacteria | 3934 |
| 811 | Ga0501045_0296478 | 3300049824 | Bacteria | 1203 |
| 812 | Ga0501045_0401695 | 3300049824 | Bacteria | 1020 |
| 813 | Ga0501045_0489380 | 3300049824 | Bacteria | 914 |
| 814 | Ga0501045_0769471 | 3300049824 | Bacteria | 709 |
| 815 | nmdc:mga03683_103721_c1 | 3300050489 | Bacteria | 1252 |
| 816 | nmdc:mga00v17_51181_c1 | 3300050491 | Bacteria | 2511 |
| 817 | nmdc:mga05p37_103565_c1 | 3300050507 | Bacteria | 3503 |
| 818 | nmdc:mga05p37_1277886_c1 | 3300050507 | Bacteria | 750 |
| 819 | nmdc:mga05p37_42344_c1 | 3300050507 | Bacteria | 5595 |
| 820 | nmdc:mga05p37_95385_c2 | 3300050507 | Bacteria | 1727 |
| 821 | nmdc:mga05p37_985944_c1 | 3300050507 | Bacteria | 897 |
| 822 | nmdc:mga09592_1586943_c1 | 3300050508 | Bacteria | 530 |
| 823 | nmdc:mga09592_15894_c1 | 3300050508 | Bacteria | 6150 |
| 824 | nmdc:mga09592_192471_c1 | 3300050508 | Bacteria | 1765 |
| 825 | nmdc:mga09592_71908_c1 | 3300050508 | Bacteria | 2937 |
| 826 | nmdc:mga0qj67_32355_c1 | 3300050509 | Bacteria | 4078 |
| 827 | nmdc:mga0qj67_446629_c1 | 3300050509 | Bacteria | 1042 |
| 828 | nmdc:mga0qj67_581736_c1 | 3300050509 | Bacteria | 897 |
| 829 | nmdc:mga06r32_1600101_c1 | 3300050510 | Bacteria | 590 |
| 830 | nmdc:mga06r32_241545_c1 | 3300050510 | Bacteria | 1794 |
| 831 | nmdc:mga06r32_584775_c1 | 3300050510 | Bacteria | 1088 |
| 832 | nmdc:mga06r32_84192_c1 | 3300050510 | Bacteria | 3099 |
| 833 | nmdc:mga08y16_72940_c1 | 3300050511 | Bacteria | 3578 |
| 834 | nmdc:mga0n895_157150_c1 | 3300050512 | Bacteria | 2305 |
| 835 | nmdc:mga0n895_15818_c1 | 3300050512 | Bacteria | 6898 |
| 836 | nmdc:mga0n895_746116_c1 | 3300050512 | Bacteria | 972 |
| 837 | nmdc:mga0rr50_15135_c1 | 3300050513 | Bacteria | 5085 |
| 838 | nmdc:mga0rr50_1743113_c1 | 3300050513 | Unclassified | 525 |
| 839 | nmdc:mga0rr50_251020_c1 | 3300050513 | Bacteria | 1469 |
| 840 | nmdc:mga08x19_52751_c1 | 3300050514 | Bacteria | 2616 |
| 841 | nmdc:mga0a205_97257_c1 | 3300050515 | Bacteria | 2843 |
| 842 | Ga0495601_0175044 | 3300053077 | Bacteria | 1403 |
| 843 | Ga0495601_0181190 | 3300053077 | Bacteria | 1377 |
| 844 | Ga0495601_0526455 | 3300053077 | Bacteria | 761 |
| 845 | Ga0495601_0707466 | 3300053077 | Bacteria | 642 |
| 846 | Ga0495612_0018627 | 3300053078 | Bacteria | 2780 |
| 847 | Ga0495612_0114812 | 3300053078 | Bacteria | 1155 |
| 848 | Ga0495612_0479819 | 3300053078 | Bacteria | 569 |
| 849 | Ga0495595_0005713 | 3300053084 | Bacteria | 5038 |
| 850 | Ga0495595_0061965 | 3300053084 | Bacteria | 1753 |
| 851 | Ga0495595_0095061 | 3300053084 | Bacteria | 1433 |
| 852 | Ga0495595_0132982 | 3300053084 | Bacteria | 1217 |
| 853 | Ga0495595_0481083 | 3300053084 | Bacteria | 632 |
| 854 | Ga0495619_0007503 | 3300053085 | Bacteria | 6907 |
| 855 | Ga0495619_0268066 | 3300053085 | Bacteria | 1183 |
| 856 | Ga0495619_0472507 | 3300053085 | Bacteria | 863 |
| 857 | Ga0495619_0832103 | 3300053085 | Bacteria | 623 |
| 858 | Ga0495619_0840192 | 3300053085 | Bacteria | 620 |
| 859 | Ga0495619_0914927 | 3300053085 | Bacteria | 589 |
| 860 | Ga0501084_0001813 | 3300054114 | Bacteria | 17044 |
| 861 | Ga0501084_0036271 | 3300054114 | Bacteria | 4119 |
| 862 | Ga0501084_0061892 | 3300054114 | Bacteria | 3134 |
| 863 | Ga0501084_0082209 | 3300054114 | Bacteria | 2702 |
| 864 | Ga0501084_0097848 | 3300054114 | Bacteria | 2463 |
| 865 | Ga0501084_0109045 | 3300054114 | Bacteria | 2326 |
| 866 | Ga0501084_0348953 | 3300054114 | Bacteria | 1250 |
| 867 | Ga0501084_0863214 | 3300054114 | Bacteria | 761 |
| 868 | Ga0501082_0002186 | 3300060353 | Bacteria | 17124 |
| 869 | Ga0501082_0099402 | 3300060353 | Bacteria | 2515 |
| 870 | Ga0501082_0099595 | 3300060353 | Bacteria | 2513 |
| 871 | Ga0501082_0339571 | 3300060353 | Bacteria | 1309 |
| 872 | Ga0501082_0496709 | 3300060353 | Bacteria | 1066 |
| 873 | Ga0466962_0031346 | 3300061719 | Bacteria | 2546 |
| 874 | Ga0466962_0033694 | 3300061719 | Bacteria | 2451 |
| 875 | Ga0466962_0045698 | 3300061719 | Bacteria | 2093 |
| 876 | Ga0466962_0095605 | 3300061719 | Bacteria | 1424 |
| 877 | Ga0530510_0000191 | 3300061734 | Bacteria | 37694 |
| 878 | Ga0530510_0034632 | 3300061734 | Bacteria | 3639 |
| 879 | Ga0530510_0035758 | 3300061734 | Bacteria | 3580 |
| 880 | Ga0530510_0087189 | 3300061734 | Bacteria | 2275 |
| 881 | Ga0081539_10007262 | |||
| 882 | JGI25407J50210_10025906 | |||
| 883 | JGI25407J50210_10171524 | |||
| 884 | Ga0070658_10006819 | |||
| 885 | Ga0070658_10023888 | |||
| 886 | Ga0070658_10035144 | |||
| 887 | Ga0070683_100009167 | |||
| 888 | Ga0070683_100029926 | |||
| 889 | Ga0070683_100224787 | |||
| 890 | Ga0070683_100271041 | |||
| 891 | Ga0070683_101017644 | |||
| 892 | Ga0070680_100026507 | |||
| 893 | Ga0070680_100230664 | |||
| 894 | Ga0070680_100392362 | |||
| 895 | Ga0070680_100768907 | |||
| 896 | Ga0070682_100323808 | |||
| 897 | Ga0068868_100600917 | |||
| 898 | Ga0070660_100011544 | |||
| 899 | Ga0070660_100014170 | |||
| 900 | Ga0070660_100734502 | |||
| 901 | Ga0070660_101036501 | |||
| 902 | Ga0070691_10028261 | |||
| 903 | Ga0070691_10651425 | |||
| 904 | Ga0070661_100027180 | |||
| 905 | Ga0070661_101500299 | |||
| 906 | Ga0070668_100265072 | |||
| 907 | Ga0070675_100768792 | |||
| 908 | Ga0070671_100072585 | |||
| 909 | Ga0070671_100308440 | |||
| 910 | Ga0070674_100071521 | |||
| 911 | Ga0070673_101840670 | |||
| 912 | Ga0070688_100743269 | |||
| 913 | Ga0070659_100310994 | |||
| 914 | Ga0070659_101460372 | |||
| 915 | Ga0070709_10011736 | |||
| 916 | Ga0070709_10014329 | |||
| 917 | Ga0070714_100310252 | |||
| 918 | Ga0070714_100441966 | |||
| 919 | Ga0070714_100605311 | |||
| 920 | Ga0070714_100761190 | |||
| 921 | Ga0070714_101478049 | |||
| 922 | Ga0070714_101752908 | |||
| 923 | Ga0070713_100001898 | |||
| 924 | Ga0070713_100183075 | |||
| 925 | Ga0070713_101863309 | |||
| 926 | Ga0070710_10003777 | |||
| 927 | Ga0070710_10004714 | |||
| 928 | Ga0070710_10909947 | |||
| 929 | Ga0070711_100036621 | |||
| 930 | Ga0070711_100081722 | |||
| 931 | Ga0070711_100436779 | |||
| 932 | Ga0070711_101792625 | |||
| 933 | Ga0070705_100588960 | |||
| 934 | Ga0070705_100592249 | |||
| 935 | Ga0070708_101197453 | |||
| 936 | Ga0070678_100414645 | |||
| 937 | Ga0070678_100531623 | |||
| 938 | Ga0070681_10025398 | |||
| 939 | Ga0070681_10047166 | |||
| 940 | Ga0070681_10068399 | |||
| 941 | Ga0070681_10125740 | |||
| 942 | Ga0070681_11312189 | |||
| 943 | Ga0070681_11616731 | |||
| 944 | Ga0068867_100238754 | |||
| 945 | Ga0070707_100000819 | |||
| 946 | Ga0070707_100190504 | |||
| 947 | Ga0070707_100638159 | |||
| 948 | Ga0070698_100007710 | |||
| 949 | Ga0070698_100400551 | |||
| 950 | Ga0070698_100453882 | |||
| 951 | Ga0070699_101098545 | |||
| 952 | Ga0070679_100058919 | |||
| 953 | Ga0070679_100075673 | |||
| 954 | Ga0070679_100093878 | |||
| 955 | Ga0070679_100112544 | |||
| 956 | Ga0070679_100341505 | |||
| 957 | Ga0070679_100408937 | |||
| 958 | Ga0070679_100474295 | |||
| 959 | Ga0070679_101012943 | |||
| 960 | Ga0070684_100002789 | |||
| 961 | Ga0070684_100003984 | |||
| 962 | Ga0070684_100010471 | |||
| 963 | Ga0070684_100679126 | |||
| 964 | Ga0070684_101150517 | |||
| 965 | Ga0070684_101677181 | |||
| 966 | Ga0070684_101682910 | |||
| 967 | Ga0070686_100552854 | |||
| 968 | Ga0070695_100000009 | |||
| 969 | Ga0070695_100403916 | |||
| 970 | Ga0070693_100185962 | |||
| 971 | Ga0070693_100189090 | |||
| 972 | Ga0070704_100037956 | |||
| 973 | Ga0070704_100756452 | |||
| 974 | Ga0070704_101136161 | |||
| 975 | Ga0068855_100050260 | |||
| 976 | Ga0068855_100218300 | |||
| 977 | Ga0068855_101506345 | |||
| 978 | Ga0068855_101646893 | |||
| 979 | Ga0070664_100197096 | |||
| 980 | Ga0068857_100019684 | |||
| 981 | Ga0068857_100087165 | |||
| 982 | Ga0068857_100096390 | |||
| 983 | Ga0068857_101567747 | |||
| 984 | Ga0068856_100030722 | |||
| 985 | Ga0068856_100130493 | |||
| 986 | Ga0068856_100218195 | |||
| 987 | Ga0068856_100233065 | |||
| 988 | Ga0068852_100367398 | |||
| 989 | Ga0068852_100670591 | |||
| 990 | Ga0068859_100805153 | |||
| 991 | Ga0068861_101066669 | |||
| 992 | Ga0068870_10191947 | |||
| 993 | Ga0068863_100109515 | |||
| 994 | Ga0068863_100921552 | |||
| 995 | Ga0068858_100431743 | |||
| 996 | Ga0068858_100515829 | |||
| 997 | Ga0068862_100805324 | |||
| 998 | Ga0081455_10020306 | |||
| 999 | Ga0081455_10051277 | |||
| 1000 | Ga0081455_10094671 | |||
| 1001 | Ga0081455_10656903 | |||
| 1002 | Ga0081538_10000184 | |||
| 1003 | Ga0081538_10000747 | |||
| 1004 | Ga0081538_10002355 | |||
| 1005 | Ga0081538_10003921 | |||
| 1006 | Ga0081538_10007045 | |||
| 1007 | Ga0081538_10111858 | |||
| 1008 | Ga0081539_10002546 | |||
| 1009 | Ga0070717_10011983 | |||
| 1010 | Ga0070717_10016859 | |||
| 1011 | Ga0070717_10068575 | |||
| 1012 | Ga0070717_11048646 | |||
| 1013 | Ga0075364_10032208 | |||
| 1014 | Ga0075432_10256179 | |||
| 1015 | Ga0070715_10001428 | |||
| 1016 | Ga0070716_100042776 | |||
| 1017 | Ga0070716_100080960 | |||
| 1018 | Ga0070712_100142738 | |||
| 1019 | Ga0070712_100917833 | |||
| 1020 | Ga0070712_101159745 | |||
| 1021 | Ga0070712_101209127 | |||
| 1022 | Ga0070712_101426090 | |||
| 1023 | Ga0075367_10750049 | |||
| 1024 | Ga0075428_101865935 | |||
| 1025 | Ga0075430_100115037 | |||
| 1026 | Ga0075430_100126820 | |||
| 1027 | Ga0075430_100142852 | |||
| 1028 | Ga0075431_100159176 | |||
| 1029 | Ga0075431_100514808 | |||
| 1030 | Ga0075434_100006605 | |||
| 1031 | Ga0075434_100220697 | |||
| 1032 | Ga0075429_100035831 | |||
| 1033 | Ga0075429_100083291 | |||
| 1034 | Ga0075429_100600729 | |||
| 1035 | Ga0075429_101567725 | |||
| 1036 | Ga0068865_101441673 | |||
| 1037 | Ga0075436_100008175 | |||
| 1038 | Ga0097620_100805208 | |||
| 1039 | Ga0105250_10309036 | |||
| 1040 | Ga0105240_10026690 | |||
| 1041 | Ga0105240_10069913 | |||
| 1042 | Ga0105240_10116638 | |||
| 1043 | Ga0105240_11457818 | |||
| 1044 | Ga0111539_10024633 | |||
| 1045 | Ga0111539_10292969 | |||
| 1046 | Ga0111539_10321659 | |||
| 1047 | Ga0111539_10842433 | |||
| 1048 | Ga0105245_10076725 | |||
| 1049 | Ga0105245_10107661 | |||
| 1050 | Ga0105245_10122893 | |||
| 1051 | Ga0105245_10172064 | |||
| 1052 | Ga0105245_10246373 | |||
| 1053 | Ga0105245_10612015 | |||
| 1054 | Ga0105245_11072596 | |||
| 1055 | Ga0105245_11266565 | |||
| 1056 | Ga0105247_10336543 | |||
| 1057 | Ga0105247_11189376 | |||
| 1058 | Ga0114129_10034292 | |||
| 1059 | Ga0114129_10205785 | |||
| 1060 | Ga0114129_10452095 | |||
| 1061 | Ga0114129_10964063 | |||
| 1062 | Ga0114129_11177497 | |||
| 1063 | Ga0105243_10188544 | |||
| 1064 | Ga0105243_10820727 | |||
| 1065 | Ga0105243_11379359 | |||
| 1066 | Ga0105242_10295051 | |||
| 1067 | Ga0105242_10470310 | |||
| 1068 | Ga0105248_10102389 | |||
| 1069 | Ga0105248_10377289 | |||
| 1070 | Ga0105248_10918848 | |||
| 1071 | Ga0105248_11279507 | |||
| 1072 | Ga0105248_13342220 | |||
| 1073 | Ga0105237_10028651 | |||
| 1074 | Ga0105237_10947543 | |||
| 1075 | Ga0105237_11138383 | |||
| 1076 | Ga0105237_11540882 | |||
| 1077 | Ga0105238_10060481 | |||
| 1078 | Ga0105238_11529742 | |||
| 1079 | Ga0105238_12539930 | |||
| 1080 | Ga0105249_10667262 | |||
| 1081 | Ga0105249_12689451 | |||
| 1082 | Ga0105239_10207157 | |||
| 1083 | Ga0105246_10736852 | |||
| 1084 | Ga0157370_10009301 | |||
| 1085 | Ga0157370_10874560 | |||
| 1086 | Ga0157369_10077611 | |||
| 1087 | Ga0157369_10139208 | |||
| 1088 | Ga0157369_10233255 | |||
| 1089 | Ga0157369_10518379 | |||
| 1090 | Ga0157369_11761259 | |||
| 1091 | Ga0157374_10181649 | |||
| 1092 | Ga0157374_11748577 | |||
| 1093 | Ga0163162_10181667 | |||
| 1094 | Ga0163162_10428208 | |||
| 1095 | Ga0163162_11815736 | |||
| 1096 | Ga0157372_10080638 | |||
| 1097 | Ga0157372_10230787 | |||
| 1098 | Ga0157372_10288236 | |||
| 1099 | Ga0157372_12700909 | |||
| 1100 | Ga0157375_10147472 | |||
| 1101 | Ga0157375_11521021 | |||
| 1102 | Ga0163163_10799460 | |||
| 1103 | Ga0182008_10004028 | |||
| 1104 | Ga0182008_10107544 | |||
| 1105 | Ga0182008_10210060 | |||
| 1106 | Ga0182008_10350340 | |||
| 1107 | Ga0157376_10011746 | |||
| 1108 | Ga0182006_1089958 | |||
| 1109 | Ga0182007_10012283 | |||
| 1110 | Ga0182007_10087275 | |||
| 1111 | Ga0206356_10039275 | |||
| 1112 | Ga0206356_11094341 | |||
| 1113 | Ga0206353_11654778 | |||
| 1114 | Ga0207692_10006002 | |||
| 1115 | Ga0207692_10148245 | |||
| 1116 | Ga0207710_10649691 | |||
| 1117 | Ga0207688_10260366 | |||
| 1118 | Ga0207685_10055183 | |||
| 1119 | Ga0207699_10320994 | |||
| 1120 | Ga0207699_10846834 | |||
| 1121 | Ga0207643_10014388 | |||
| 1122 | Ga0207705_10649966 | |||
| 1123 | Ga0207684_11020441 | |||
| 1124 | Ga0207707_10085050 | |||
| 1125 | Ga0207707_10182036 | |||
| 1126 | Ga0207707_10277293 | |||
| 1127 | Ga0207707_10620505 | |||
| 1128 | Ga0207695_10099689 | |||
| 1129 | Ga0207695_10706590 | |||
| 1130 | Ga0207695_10921362 | |||
| 1131 | Ga0207671_10404850 | |||
| 1132 | Ga0207671_11142717 | |||
| 1133 | Ga0207671_11212355 | |||
| 1134 | Ga0207671_11357287 | |||
| 1135 | Ga0207693_10008691 | |||
| 1136 | Ga0207693_10020559 | |||
| 1137 | Ga0207693_10023372 | |||
| 1138 | Ga0207693_10199756 | |||
| 1139 | Ga0207693_10501356 | |||
| 1140 | Ga0207693_10913296 | |||
| 1141 | Ga0207693_11345695 | |||
| 1142 | Ga0207663_10018096 | |||
| 1143 | Ga0207663_10019046 | |||
| 1144 | Ga0207663_10874705 | |||
| 1145 | Ga0207660_10013739 | |||
| 1146 | Ga0207660_10047498 | |||
| 1147 | Ga0207660_11497786 | |||
| 1148 | Ga0207657_10009493 | |||
| 1149 | Ga0207657_10010764 | |||
| 1150 | Ga0207649_10578928 | |||
| 1151 | Ga0207649_11072630 | |||
| 1152 | Ga0207652_10121275 | |||
| 1153 | Ga0207652_10126062 | |||
| 1154 | Ga0207652_10146163 | |||
| 1155 | Ga0207652_10623834 | |||
| 1156 | Ga0207652_10774094 | |||
| 1157 | Ga0207646_10003137 | |||
| 1158 | Ga0207646_11412286 | |||
| 1159 | Ga0207659_11255334 | |||
| 1160 | Ga0207659_11918662 | |||
| 1161 | Ga0207687_10251171 | |||
| 1162 | Ga0207687_10751348 | |||
| 1163 | Ga0207687_11172726 | |||
| 1164 | Ga0207687_11741949 | |||
| 1165 | Ga0207700_10056430 | |||
| 1166 | Ga0207700_10168108 | |||
| 1167 | Ga0207700_11648148 | |||
| 1168 | Ga0207664_10008513 | |||
| 1169 | Ga0207664_10011230 | |||
| 1170 | Ga0207664_10111773 | |||
| 1171 | Ga0207664_10254735 | |||
| 1172 | Ga0207664_10294149 | |||
| 1173 | Ga0207664_10367334 | |||
| 1174 | Ga0207644_11131312 | |||
| 1175 | Ga0207690_11105923 | |||
| 1176 | Ga0207706_10056281 | |||
| 1177 | Ga0207686_10098448 | |||
| 1178 | Ga0207686_10411914 | |||
| 1179 | Ga0207709_11270091 | |||
| 1180 | Ga0207669_10284081 | |||
| 1181 | Ga0207665_10002129 | |||
| 1182 | Ga0207711_10178680 | |||
| 1183 | Ga0207661_10024653 | |||
| 1184 | Ga0207661_10564157 | |||
| 1185 | Ga0207661_10579051 | |||
| 1186 | Ga0207661_10696826 | |||
| 1187 | Ga0207661_12014090 | |||
| 1188 | Ga0207679_10095255 | |||
| 1189 | Ga0207679_10131590 | |||
| 1190 | Ga0207667_10993833 | |||
| 1191 | Ga0207667_11152418 | |||
| 1192 | Ga0207667_12171805 | |||
| 1193 | Ga0207712_10357492 | |||
| 1194 | Ga0207677_11199468 | |||
| 1195 | Ga0207703_10843580 | |||
| 1196 | Ga0207702_10050786 | |||
| 1197 | Ga0207702_10113566 | |||
| 1198 | Ga0207702_10138719 | |||
| 1199 | Ga0207702_10685498 | |||
| 1200 | Ga0207641_10088835 | |||
| 1201 | Ga0207648_10420659 | |||
| 1202 | Ga0207674_10002484 | |||
| 1203 | Ga0207674_10028403 | |||
| 1204 | Ga0207674_10155333 | |||
| 1205 | Ga0207674_10430949 | |||
| 1206 | Ga0207674_11525931 | |||
| 1207 | Ga0207675_100849544 | |||
| 1208 | Ga0207683_10316104 | |||
| 1209 | Ga0207698_11509898 | |||
| 1210 | Ga0207428_10105547 | |||
| 1211 | Ga0268265_10915959 | |||
| 1212 | Ga0265319_1232339 | |||
| 1213 | Ga0265336_10009011 | |||
| 1214 | Ga0265338_10002905 | |||
| 1215 | Ga0307413_10227287 | |||
| 1216 | Ga0307413_12061062 | |||
| 1217 | Ga0307407_10239896 | |||
| 1218 | Ga0307407_11400709 | |||
| 1219 | Ga0307412_11689563 | |||
| 1220 | Ga0307409_100066010 | |||
| 1221 | Ga0307409_100391265 | |||
| 1222 | Ga0307416_100056460 | |||
| 1223 | Ga0307416_101505978 | |||
| 1224 | Ga0307415_100037113 | |||
| 1225 | Ga0373936_0112682 | |||
| 1226 | Ga0373931_0102191 | |||
| 1227 | Ga0373935_0240375 | |||
| 1228 | Ga0373935_0355061 | |||
| 1229 | Ga0373947_0302527 | |||
| 1230 | Ga0373937_0520878 | |||
| 1231 | Ga0395899_0002411 | |||
| 1232 | Ga0395899_0031639 | |||
| 1233 | Ga0395899_0058497 | |||
| 1234 | Ga0395899_0321583 | |||
| 1235 | Ga0395899_0347559 | |||
| 1236 | Ga0395899_0381515 | |||
| 1237 | Ga0395900_0015039 | |||
| 1238 | Ga0395900_0016859 | |||
| 1239 | Ga0395900_0026672 | |||
| 1240 | Ga0395900_0046334 | |||
| 1241 | Ga0395900_0098676 | |||
| 1242 | Ga0395900_0116389 | |||
| 1243 | Ga0395900_0145888 | |||
| 1244 | Ga0395900_0198342 | |||
| 1245 | Ga0395900_0391565 | |||
| 1246 | Ga0395900_0392546 | |||
| 1247 | Ga0395900_0602320 | |||
| 1248 | Ga0395900_1027484 | |||
| 1249 | Ga0395900_1562722 | |||
| 1250 | Ga0395900_1633065 | |||
| 1251 | Ga0395898_0005964 | |||
| 1252 | Ga0395898_0010490 | |||
| 1253 | Ga0395898_0020626 | |||
| 1254 | Ga0395898_0035987 | |||
| 1255 | Ga0395898_0042077 | |||
| 1256 | Ga0395898_0251346 | |||
| 1257 | Ga0395898_0295587 | |||
| 1258 | Ga0395898_0526726 | |||
| 1259 | Ga0395898_0563497 | |||
| 1260 | Ga0395898_0796234 | |||
| 1261 | Ga0395898_0976856 | |||
| 1262 | Ga0395898_1074671 | |||
| 1263 | Ga0395905_0021372 | |||
| 1264 | Ga0395905_0033208 | |||
| 1265 | Ga0395905_0195787 | |||
| 1266 | Ga0395905_0275419 | |||
| 1267 | Ga0395905_0278542 | |||
| 1268 | Ga0395905_0398685 | |||
| 1269 | Ga0395905_0426983 | |||
| 1270 | Ga0395905_0515519 | |||
| 1271 | Ga0395905_1104211 | |||
| 1272 | Ga0395905_1158925 | |||
| 1273 | Ga0395905_1248993 | |||
| 1274 | Ga0395901_0001730 | |||
| 1275 | Ga0395901_0004281 | |||
| 1276 | Ga0395901_0010470 | |||
| 1277 | Ga0395901_0015802 | |||
| 1278 | Ga0395901_0070123 | |||
| 1279 | Ga0395901_0127794 | |||
| 1280 | Ga0395901_0291942 | |||
| 1281 | Ga0395901_0293960 | |||
| 1282 | Ga0395901_0361120 | |||
| 1283 | Ga0395901_0366132 | |||
| 1284 | Ga0395901_0439071 | |||
| 1285 | Ga0395901_0788115 | |||
| 1286 | Ga0395901_1064239 | |||
| 1287 | Ga0395901_1910902 | |||
| 1288 | Ga0436363_0438143 | |||
| 1289 | Ga0436363_1655099 | |||
| 1290 | Ga0439438_059950 | |||
| 1291 | Ga0439461_0198355 | |||
| 1292 | Ga0451791_1724365 | |||
| 1293 | Ga0451845_0704111 | |||
| 1294 | Ga0451853_2233860 | |||
| 1295 | Ga0439445_0117000 | |||
| 1296 | Ga0439449_0330317 | |||
| 1297 | Ga0439464_0171767 | |||
| 1298 | Ga0439460_0313418 | |||
| 1299 | Ga0450918_034132 | |||
| 1300 | Ga0466969_0077276 | |||
| 1301 | Ga0466969_0098555 | |||
| 1302 | Ga0466972_0024827 | |||
| 1303 | Ga0466965_0063247 | |||
| 1304 | Ga0466965_0115741 | |||
| 1305 | Ga0466965_0795297 | |||
| 1306 | Ga0466966_0008968 | |||
| 1307 | Ga0466966_0049950 | |||
| 1308 | Ga0466961_0003397 | |||
| 1309 | Ga0466961_0132303 | |||
| 1310 | Ga0466961_0207291 | |||
| 1311 | Ga0466963_0005916 | |||
| 1312 | Ga0466963_0007929 | |||
| 1313 | Ga0466963_0021952 | |||
| 1314 | Ga0466963_0060709 | |||
| 1315 | Ga0466963_0063407 | |||
| 1316 | Ga0466963_0120699 | |||
| 1317 | Ga0466963_0139871 | |||
| 1318 | Ga0466963_0264239 | |||
| 1319 | Ga0466963_0724772 | |||
| 1320 | Ga0466964_0005301 | |||
| 1321 | Ga0466964_0012711 | |||
| 1322 | Ga0466964_0019735 | |||
| 1323 | Ga0466964_0066236 | |||
| 1324 | Ga0466964_0081695 | |||
| 1325 | Ga0466964_0115124 | |||
| 1326 | Ga0466964_0439356 | |||
| 1327 | Ga0466964_0445748 | |||
| 1328 | Ga0466964_0808823 | |||
| 1329 | Ga0466971_0001034 | |||
| 1330 | Ga0466971_0013313 | |||
| 1331 | Ga0466971_0076211 | |||
| 1332 | Ga0466971_0121251 | |||
| 1333 | Ga0466968_0003414 | |||
| 1334 | Ga0466968_0010182 | |||
| 1335 | Ga0466968_0047138 | |||
| 1336 | Ga0466968_0141050 | |||
| 1337 | Ga0466968_0182082 | |||
| 1338 | Ga0466968_0254272 | |||
| 1339 | Ga0466970_0160019 | |||
| 1340 | Ga0466957_0002287 | |||
| 1341 | Ga0466957_0036114 | |||
| 1342 | Ga0466957_0091545 | |||
| 1343 | Ga0466957_0094593 | |||
| 1344 | Ga0466957_0169697 | |||
| 1345 | Ga0466957_0301668 | |||
| 1346 | Ga0466960_0014345 | |||
| 1347 | Ga0466960_0031867 | |||
| 1348 | Ga0466960_0757507 | |||
| 1349 | Ga0466959_0001467 | |||
| 1350 | Ga0466959_0002306 | |||
| 1351 | Ga0466959_0674705 | |||
| 1352 | Ga0466958_0036288 | |||
| 1353 | Ga0466958_0038426 | |||
| 1354 | Ga0466958_0047613 | |||
| 1355 | Ga0466958_0052618 | |||
| 1356 | Ga0466958_0158614 | |||
| 1357 | Ga0466958_0257172 | |||
| 1358 | Ga0466967_0000602 | |||
| 1359 | Ga0466967_0001349 | |||
| 1360 | Ga0466967_0032464 | |||
| 1361 | Ga0466967_0039396 | |||
| 1362 | Ga0466967_0055383 | |||
| 1363 | Ga0466967_0083108 | |||
| 1364 | Ga0466967_0086927 | |||
| 1365 | Ga0466967_0098577 | |||
| 1366 | Ga0466967_0101712 | |||
| 1367 | Ga0466967_0110092 | |||
| 1368 | Ga0466967_0122553 | |||
| 1369 | Ga0466967_0162735 | |||
| 1370 | Ga0466967_0473308 | |||
| 1371 | Ga0466967_0769062 | |||
| 1372 | Ga0466967_1163475 | |||
| 1373 | Ga0466967_2401569 | |||
| 1374 | Ga0495592_0077201 | |||
| 1375 | Ga0495592_0237019 | |||
| 1376 | Ga0495592_0383032 | |||
| 1377 | Ga0495603_0148007 | |||
| 1378 | Ga0495629_0095764 | |||
| 1379 | Ga0495629_0099393 | |||
| 1380 | Ga0495641_0009111 | |||
| 1381 | Ga0495641_0032020 | |||
| 1382 | Ga0495641_0065957 | |||
| 1383 | Ga0495641_0191704 | |||
| 1384 | Ga0495641_0227778 | |||
| 1385 | Ga0495641_0243097 | |||
| 1386 | Ga0495651_0107736 | |||
| 1387 | Ga0495651_0325319 | |||
| 1388 | Ga0495651_0635580 | |||
| 1389 | Ga0495651_0803713 | |||
| 1390 | Ga0495653_0033712 | |||
| 1391 | Ga0495653_0034462 | |||
| 1392 | Ga0495653_0099046 | |||
| 1393 | Ga0495653_0181593 | |||
| 1394 | Ga0495653_0389363 | |||
| 1395 | Ga0495653_0410521 | |||
| 1396 | Ga0495580_0732371 | |||
| 1397 | Ga0495582_0092313 | |||
| 1398 | Ga0495605_0260286 | |||
| 1399 | Ga0495664_0049809 | |||
| 1400 | Ga0495664_0185437 | |||
| 1401 | Ga0495664_0450768 | |||
| 1402 | Ga0495585_0051106 | |||
| 1403 | Ga0495596_0157621 | |||
| 1404 | Ga0495607_0049949 | |||
| 1405 | Ga0495607_0077240 | |||
| 1406 | Ga0495608_0035123 | |||
| 1407 | Ga0495608_0097069 | |||
| 1408 | Ga0495608_0227286 | |||
| 1409 | Ga0495608_0279069 | |||
| 1410 | Ga0495608_0890426 | |||
| 1411 | Ga0495618_0142277 | |||
| 1412 | Ga0495618_0187967 | |||
| 1413 | Ga0495618_0229465 | |||
| 1414 | Ga0495618_0296129 | |||
| 1415 | Ga0495618_0388755 | |||
| 1416 | Ga0495628_0139628 | |||
| 1417 | Ga0495628_0209349 | |||
| 1418 | Ga0495628_1153956 | |||
| 1419 | Ga0495630_0113983 | |||
| 1420 | Ga0495630_0244684 | |||
| 1421 | Ga0495630_0928068 | |||
| 1422 | Ga0495630_1134091 | |||
| 1423 | Ga0495637_0096930 | |||
| 1424 | Ga0495644_0019710 | |||
| 1425 | Ga0495642_0232982 | |||
| 1426 | Ga0495652_0024347 | |||
| 1427 | Ga0495652_0209574 | |||
| 1428 | Ga0495640_0181423 | |||
| 1429 | Ga0495640_0374373 | |||
| 1430 | Ga0495586_0002329 | |||
| 1431 | Ga0495587_0037387 | |||
| 1432 | Ga0495645_0131891 | |||
| 1433 | Ga0495645_0183865 | |||
| 1434 | Ga0495645_0229756 | |||
| 1435 | Ga0495667_0054984 | |||
| 1436 | Ga0495667_0327229 | |||
| 1437 | Ga0495667_0561778 | |||
| 1438 | Ga0495656_0001684 | |||
| 1439 | Ga0495656_0130155 | |||
| 1440 | Ga0495656_0415058 | |||
| 1441 | Ga0495634_0310045 | |||
| 1442 | Ga0495634_0376038 | |||
| 1443 | Ga0495634_0400167 | |||
| 1444 | Ga0495634_0477608 | |||
| 1445 | Ga0495611_0025198 | |||
| 1446 | Ga0495635_0018122 | |||
| 1447 | Ga0495635_0299988 | |||
| 1448 | Ga0495661_0298603 | |||
| 1449 | Ga0495657_0015450 | |||
| 1450 | Ga0495657_0059425 | |||
| 1451 | Ga0495657_0127289 | |||
| 1452 | Ga0495599_0028273 | |||
| 1453 | Ga0495623_0098893 | |||
| 1454 | Ga0495646_0025801 | |||
| 1455 | Ga0495658_0080923 | |||
| 1456 | Ga0495669_0308932 | |||
| 1457 | Ga0495613_0311274 | |||
| 1458 | Ga0495613_0797052 | |||
| 1459 | Ga0495624_0008048 | |||
| 1460 | Ga0495624_0075064 | |||
| 1461 | Ga0495624_0440241 | |||
| 1462 | Ga0495670_0333881 | |||
| 1463 | Ga0495589_0034291 | |||
| 1464 | Ga0495589_0497054 | |||
| 1465 | Ga0495600_0027831 | |||
| 1466 | Ga0495600_0149672 | |||
| 1467 | Ga0495600_0460786 | |||
| 1468 | Ga0495581_0637502 | |||
| 1469 | Ga0495604_0197669 | |||
| 1470 | Ga0495604_0536353 | |||
| 1471 | Ga0495636_0147460 | |||
| 1472 | Ga0495636_0455277 | |||
| 1473 | Ga0495674_0024505 | |||
| 1474 | Ga0495674_0059113 | |||
| 1475 | Ga0495674_0141769 | |||
| 1476 | Ga0495674_0320248 | |||
| 1477 | Ga0495674_0424085 | |||
| 1478 | Ga0495674_0425528 | |||
| 1479 | Ga0495674_0512956 | |||
| 1480 | Ga0495676_0356906 | |||
| 1481 | Ga0495676_0549670 | |||
| 1482 | Ga0495676_0707868 | |||
| 1483 | Ga0495676_1041327 | |||
| 1484 | Ga0495680_0025389 | |||
| 1485 | Ga0495680_0245197 | |||
| 1486 | Ga0495680_0302145 | |||
| 1487 | Ga0495680_0491831 | |||
| 1488 | Ga0495680_0655774 | |||
| 1489 | Ga0495680_0804026 | |||
| 1490 | Ga0495679_121713 | |||
| 1491 | Ga0495684_0010240 | |||
| 1492 | Ga0495684_0898895 | |||
| 1493 | Ga0495602_0052083 | |||
| 1494 | Ga0495602_1118832 | |||
| 1495 | Ga0496100_0229182 | |||
| 1496 | Ga0496100_0391344 | |||
| 1497 | Ga0496100_0877506 | |||
| 1498 | Ga0496101_0014002 | |||
| 1499 | Ga0496101_0046419 | |||
| 1500 | Ga0496101_0172860 | |||
| 1501 | Ga0496101_0804188 | |||
| 1502 | Ga0496101_1116828 | |||
| 1503 | Ga0496101_1522938 | |||
| 1504 | Ga0496102_0048673 | |||
| 1505 | Ga0496102_0088932 | |||
| 1506 | Ga0496103_0091335 | |||
| 1507 | Ga0496103_0110790 | |||
| 1508 | Ga0496103_0257853 | |||
| 1509 | Ga0496103_0577177 | |||
| 1510 | Ga0496104_0002284 | |||
| 1511 | Ga0496104_0007845 | |||
| 1512 | Ga0496104_0046059 | |||
| 1513 | Ga0496104_0138664 | |||
| 1514 | Ga0496104_0148959 | |||
| 1515 | Ga0496104_0308234 | |||
| 1516 | Ga0496104_0961117 | |||
| 1517 | Ga0496105_0004123 | |||
| 1518 | Ga0496105_0008437 | |||
| 1519 | Ga0496105_0015296 | |||
| 1520 | Ga0496105_0034045 | |||
| 1521 | Ga0496105_0044517 | |||
| 1522 | Ga0496106_0383796 | |||
| 1523 | Ga0496106_0440479 | |||
| 1524 | Ga0496106_0827978 | |||
| 1525 | Ga0496106_0890427 | |||
| 1526 | Ga0496107_0021170 | |||
| 1527 | Ga0496107_0026969 | |||
| 1528 | Ga0496108_0020386 | |||
| 1529 | Ga0496108_0048468 | |||
| 1530 | Ga0496108_0052069 | |||
| 1531 | Ga0496108_0059540 | |||
| 1532 | Ga0496108_0520407 | |||
| 1533 | Ga0496108_1002355 | |||
| 1534 | Ga0496108_1066078 | |||
| 1535 | Ga0496109_0003748 | |||
| 1536 | Ga0496109_0010639 | |||
| 1537 | Ga0496109_0056298 | |||
| 1538 | Ga0496109_0079705 | |||
| 1539 | Ga0496109_0085715 | |||
| 1540 | Ga0496109_0303329 | |||
| 1541 | Ga0496109_0452968 | |||
| 1542 | Ga0496109_1990466 | |||
| 1543 | Ga0496110_0007489 | |||
| 1544 | Ga0496110_0134108 | |||
| 1545 | Ga0496110_0275284 | |||
| 1546 | Ga0496110_1270509 | |||
| 1547 | Ga0496111_0003137 | |||
| 1548 | Ga0496111_0007042 | |||
| 1549 | Ga0496111_0366270 | |||
| 1550 | Ga0496111_0382810 | |||
| 1551 | Ga0496111_0411727 | |||
| 1552 | Ga0496111_0677007 | |||
| 1553 | Ga0496111_0890766 | |||
| 1554 | Ga0496112_0002474 | |||
| 1555 | Ga0496112_0342251 | |||
| 1556 | Ga0496113_0004105 | |||
| 1557 | Ga0496113_0161857 | |||
| 1558 | Ga0496113_0466128 | |||
| 1559 | Ga0496113_0809187 | |||
| 1560 | Ga0496114_0037319 | |||
| 1561 | Ga0496114_0045517 | |||
| 1562 | Ga0496114_0068075 | |||
| 1563 | Ga0496114_0252648 | |||
| 1564 | Ga0496114_1043679 | |||
| 1565 | Ga0496115_0117621 | |||
| 1566 | Ga0496115_0141011 | |||
| 1567 | Ga0496115_0155518 | |||
| 1568 | Ga0496115_1197847 | |||
| 1569 | Ga0501031_0000423 | |||
| 1570 | Ga0501031_0528448 | |||
| 1571 | Ga0501031_0911377 | |||
| 1572 | Ga0501032_0002185 | |||
| 1573 | Ga0501032_0136528 | |||
| 1574 | Ga0501033_0004428 | |||
| 1575 | Ga0501033_0019459 | |||
| 1576 | Ga0501033_0150382 | |||
| 1577 | Ga0501034_0036109 | |||
| 1578 | Ga0501036_0001079 | |||
| 1579 | Ga0501036_0049827 | |||
| 1580 | Ga0501036_0133549 | |||
| 1581 | Ga0501036_0936060 | |||
| 1582 | Ga0501037_0000071 | |||
| 1583 | Ga0501037_0002387 | |||
| 1584 | Ga0501038_0000282 | |||
| 1585 | Ga0501038_0007028 | |||
| 1586 | Ga0501038_0450746 | |||
| 1587 | Ga0501038_0688485 | |||
| 1588 | Ga0501039_0001238 | |||
| 1589 | Ga0501039_0014170 | |||
| 1590 | Ga0501039_0083543 | |||
| 1591 | Ga0501039_0341164 | |||
| 1592 | Ga0501039_0982386 | |||
| 1593 | Ga0501040_0025089 | |||
| 1594 | Ga0501040_0031551 | |||
| 1595 | Ga0501040_0075251 | |||
| 1596 | Ga0501040_0125804 | |||
| 1597 | Ga0501040_0615933 | |||
| 1598 | Ga0501041_0002075 | |||
| 1599 | Ga0501041_0007528 | |||
| 1600 | Ga0501041_0018197 | |||
| 1601 | Ga0501041_0034437 | |||
| 1602 | Ga0501041_0234508 | |||
| 1603 | Ga0501041_0443998 | |||
| 1604 | Ga0501041_0668056 | |||
| 1605 | Ga0501042_0006730 | |||
| 1606 | Ga0501042_0025268 | |||
| 1607 | Ga0501042_0046434 | |||
| 1608 | Ga0501042_0344587 | |||
| 1609 | Ga0501043_0001377 | |||
| 1610 | Ga0501043_0004913 | |||
| 1611 | Ga0501043_0365987 | |||
| 1612 | Ga0501046_0000812 | |||
| 1613 | Ga0501046_0051117 | |||
| 1614 | Ga0501046_0935066 | |||
| 1615 | Ga0501047_0943470 | |||
| 1616 | Ga0501047_1212991 | |||
| 1617 | Ga0501048_0003425 | |||
| 1618 | Ga0501048_0059562 | |||
| 1619 | Ga0501048_0064591 | |||
| 1620 | Ga0501048_0274177 | |||
| 1621 | Ga0501048_0620134 | |||
| 1622 | Ga0501067_0227473 | |||
| 1623 | Ga0501067_0245688 | |||
| 1624 | Ga0501068_0000165 | |||
| 1625 | Ga0501068_0001860 | |||
| 1626 | Ga0501069_0000359 | |||
| 1627 | Ga0501069_0010689 | |||
| 1628 | Ga0501069_0221462 | |||
| 1629 | Ga0501069_0262565 | |||
| 1630 | Ga0501070_0006865 | |||
| 1631 | Ga0501070_0007343 | |||
| 1632 | Ga0501070_0439205 | |||
| 1633 | Ga0501070_0837541 | |||
| 1634 | Ga0501071_0002486 | |||
| 1635 | Ga0501071_0006169 | |||
| 1636 | Ga0501071_0062693 | |||
| 1637 | Ga0501071_0082827 | |||
| 1638 | Ga0501071_0187402 | |||
| 1639 | Ga0501071_0311465 | |||
| 1640 | Ga0501071_0396485 | |||
| 1641 | Ga0501072_0000494 | |||
| 1642 | Ga0501072_0037578 | |||
| 1643 | Ga0501072_0134747 | |||
| 1644 | Ga0501072_0349184 | |||
| 1645 | Ga0501073_0001985 | |||
| 1646 | Ga0501074_0006393 | |||
| 1647 | Ga0501074_0018894 | |||
| 1648 | Ga0501075_0000105 | |||
| 1649 | Ga0501075_0011622 | |||
| 1650 | Ga0501075_0025617 | |||
| 1651 | Ga0501075_0088741 | |||
| 1652 | Ga0501075_0247481 | |||
| 1653 | Ga0501075_0265391 | |||
| 1654 | Ga0501075_1235974 | |||
| 1655 | Ga0501076_0070460 | |||
| 1656 | Ga0501076_0198124 | |||
| 1657 | Ga0501076_0495893 | |||
| 1658 | Ga0501076_0685033 | |||
| 1659 | Ga0501076_0973769 | |||
| 1660 | Ga0501076_1560945 | |||
| 1661 | Ga0501076_1784505 | |||
| 1662 | Ga0501077_0000128 | |||
| 1663 | Ga0501077_0241843 | |||
| 1664 | Ga0501077_0311612 | |||
| 1665 | Ga0501209_296356 | |||
| 1666 | Ga0501079_0050948 | |||
| 1667 | Ga0501079_0067187 | |||
| 1668 | Ga0501079_0087521 | |||
| 1669 | Ga0501079_0348203 | |||
| 1670 | Ga0501079_0775869 | |||
| 1671 | Ga0501080_0013924 | |||
| 1672 | Ga0501080_0018014 | |||
| 1673 | Ga0501080_0326723 | |||
| 1674 | Ga0501080_0636533 | |||
| 1675 | Ga0501081_0003084 | |||
| 1676 | Ga0501081_0032217 | |||
| 1677 | Ga0501081_0037395 | |||
| 1678 | Ga0501081_0047880 | |||
| 1679 | Ga0501081_0071197 | |||
| 1680 | Ga0501081_0583888 | |||
| 1681 | Ga0501081_0634363 | |||
| 1682 | Ga0501083_0000352 | |||
| 1683 | Ga0501035_0000978 | |||
| 1684 | Ga0501035_0005703 | |||
| 1685 | Ga0501044_0002766 | |||
| 1686 | Ga0501044_0023380 | |||
| 1687 | Ga0501045_0009549 | |||
| 1688 | Ga0501045_0013003 | |||
| 1689 | Ga0501045_0013979 | |||
| 1690 | Ga0501045_0029991 | |||
| 1691 | Ga0501045_0296478 | |||
| 1692 | Ga0501045_0401695 | |||
| 1693 | Ga0501045_0489380 | |||
| 1694 | Ga0501045_0769471 | |||
| 1695 | nmdc:mga03683_103721_c1 | |||
| 1696 | nmdc:mga00v17_51181_c1 | |||
| 1697 | nmdc:mga05p37_103565_c1 | |||
| 1698 | nmdc:mga05p37_1277886_c1 | |||
| 1699 | nmdc:mga05p37_42344_c1 | |||
| 1700 | nmdc:mga05p37_95385_c2 | |||
| 1701 | nmdc:mga05p37_985944_c1 | |||
| 1702 | nmdc:mga09592_1586943_c1 | |||
| 1703 | nmdc:mga09592_15894_c1 | |||
| 1704 | nmdc:mga09592_192471_c1 | |||
| 1705 | nmdc:mga09592_71908_c1 | |||
| 1706 | nmdc:mga0qj67_32355_c1 | |||
| 1707 | nmdc:mga0qj67_446629_c1 | |||
| 1708 | nmdc:mga0qj67_581736_c1 | |||
| 1709 | nmdc:mga06r32_1600101_c1 | |||
| 1710 | nmdc:mga06r32_241545_c1 | |||
| 1711 | nmdc:mga06r32_584775_c1 | |||
| 1712 | nmdc:mga06r32_84192_c1 | |||
| 1713 | nmdc:mga08y16_72940_c1 | |||
| 1714 | nmdc:mga0n895_157150_c1 | |||
| 1715 | nmdc:mga0n895_15818_c1 | |||
| 1716 | nmdc:mga0n895_746116_c1 | |||
| 1717 | nmdc:mga0rr50_15135_c1 | |||
| 1718 | nmdc:mga0rr50_1743113_c1 | |||
| 1719 | nmdc:mga0rr50_251020_c1 | |||
| 1720 | nmdc:mga08x19_52751_c1 | |||
| 1721 | nmdc:mga0a205_97257_c1 | |||
| 1722 | Ga0495601_0175044 | |||
| 1723 | Ga0495601_0181190 | |||
| 1724 | Ga0495601_0526455 | |||
| 1725 | Ga0495601_0707466 | |||
| 1726 | Ga0495612_0018627 | |||
| 1727 | Ga0495612_0114812 | |||
| 1728 | Ga0495612_0479819 | |||
| 1729 | Ga0495595_0005713 | |||
| 1730 | Ga0495595_0061965 | |||
| 1731 | Ga0495595_0095061 | |||
| 1732 | Ga0495595_0132982 | |||
| 1733 | Ga0495595_0481083 | |||
| 1734 | Ga0495619_0007503 | |||
| 1735 | Ga0495619_0268066 | |||
| 1736 | Ga0495619_0472507 | |||
| 1737 | Ga0495619_0832103 | |||
| 1738 | Ga0495619_0840192 | |||
| 1739 | Ga0495619_0914927 | |||
| 1740 | Ga0501084_0001813 | |||
| 1741 | Ga0501084_0036271 | |||
| 1742 | Ga0501084_0061892 | |||
| 1743 | Ga0501084_0082209 | |||
| 1744 | Ga0501084_0097848 | |||
| 1745 | Ga0501084_0109045 | |||
| 1746 | Ga0501084_0348953 | |||
| 1747 | Ga0501084_0863214 | |||
| 1748 | Ga0501082_0002186 | |||
| 1749 | Ga0501082_0099402 | |||
| 1750 | Ga0501082_0099595 | |||
| 1751 | Ga0501082_0339571 | |||
| 1752 | Ga0501082_0496709 | |||
| 1753 | Ga0466962_0031346 | |||
| 1754 | Ga0466962_0033694 | |||
| 1755 | Ga0466962_0045698 | |||
| 1756 | Ga0466962_0095605 | |||
| 1757 | Ga0530510_0000191 | |||
| 1758 | Ga0530510_0034632 | |||
| 1759 | Ga0530510_0035758 | |||
| 1760 | Ga0530510_0087189 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9884 | 1 | 130 |
| 3hst-assembly2.cif.gz_B | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9865 | 1 | 131 |
| 3hst-assembly4.cif.gz_D | n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein | 0.9735 | 1 | 130 |
| 4e19-assembly2.cif.gz_B | crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 | 0.9685 | 1 | 131 |
| 4h8k-assembly1.cif.gz_B | crystal structure of lc11-rnase h1 in complex with rna/dna hybrid | 0.958 | 3 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9884 | 1 | 130 | 3.30.420.10 |
| 4e19A00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9832 | 2 | 131 | 3.30.420.10 |
| 3hstD00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9735 | 1 | 130 | 3.30.420.10 |
| af_A0A0R0FBC1_213_345_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9697 | 3 | 130 | 3.30.420.10 |
| 3u3gA00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9574 | 2 | 131 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0V5Y7-F1-model_v4 | RNase H type-1 domain-containing protein | 0.9936 | 3 | 84 |
GO:0003676
GO:0004523 |
| AF-A0A538U4U4-F1-model_v4 | Ribonuclease HI family protein | 0.9895 | 3 | 114 |
GO:0003676
GO:0004523 |
| AF-A0A518LQG6-F1-model_v4 | 14.7 kDa ribonuclease H-like protein | 0.9894 | 1 | 131 |
GO:0003676
GO:0004523 |
| AF-A0A0F0CJ98-F1-model_v4 | Ribonuclease HI | 0.9885 | 2 | 131 |
GO:0003676
GO:0004523 |
| AF-A0A523TY04-F1-model_v4 | Ribonuclease HI family protein | 0.9881 | 2 | 131 |
GO:0003676
GO:0004523 |