F484481

General Info

Members Datasets Scaffolds Average Seq Length
880 301 1760 134

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10007262|Ga0081539_1000726212
Length 132
Sequence VLETDGGSRGNPGPAAIGYVLAAADGTVLAAHGEAIGVAGANVAEYRALLAGLEQASRMDLKRVDARCDARVVVEQVTGAREPANPRLAGLCRAVRDVAQRIGTVELTWVPAEANGRAHALVAQALAPGMHQ

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 8.52
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10007262 3300005985 Bacteria 10178
2 JGI25407J50210_10025906 3300003373 Bacteria 1520
3 JGI25407J50210_10171524 3300003373 Bacteria 534
4 Ga0070658_10006819 3300005327 Bacteria 9235
5 Ga0070658_10023888 3300005327 Bacteria 4904
6 Ga0070658_10035144 3300005327 Bacteria 4035
7 Ga0070683_100009167 3300005329 Bacteria 8447
8 Ga0070683_100029926 3300005329 Bacteria 4937
9 Ga0070683_100224787 3300005329 Bacteria 1784
10 Ga0070683_100271041 3300005329 Bacteria 1615
11 Ga0070683_101017644 3300005329 Bacteria 795
12 Ga0070680_100026507 3300005336 Bacteria 4637
13 Ga0070680_100230664 3300005336 Bacteria 1564
14 Ga0070680_100392362 3300005336 Bacteria 1183
15 Ga0070680_100768907 3300005336 Bacteria 829
16 Ga0070682_100323808 3300005337 Bacteria 1139
17 Ga0068868_100600917 3300005338 Bacteria 975
18 Ga0070660_100011544 3300005339 Bacteria 6286
19 Ga0070660_100014170 3300005339 Bacteria 5740
20 Ga0070660_100734502 3300005339 Bacteria 829
21 Ga0070660_101036501 3300005339 Bacteria 694
22 Ga0070691_10028261 3300005341 Bacteria 2619
23 Ga0070691_10651425 3300005341 Bacteria 627
24 Ga0070661_100027180 3300005344 Bacteria 4118
25 Ga0070661_101500299 3300005344 Bacteria 569
26 Ga0070668_100265072 3300005347 Bacteria 1430
27 Ga0070675_100768792 3300005354 Bacteria 879
28 Ga0070671_100072585 3300005355 Bacteria 2874
29 Ga0070671_100308440 3300005355 Bacteria 1348
30 Ga0070674_100071521 3300005356 Unclassified 2454
31 Ga0070673_101840670 3300005364 Bacteria 574
32 Ga0070688_100743269 3300005365 Bacteria 763
33 Ga0070659_100310994 3300005366 Bacteria 1316
34 Ga0070659_101460372 3300005366 Bacteria 609
35 Ga0070709_10011736 3300005434 Bacteria 4892
36 Ga0070709_10014329 3300005434 Bacteria 4482
37 Ga0070714_100310252 3300005435 Bacteria 1473
38 Ga0070714_100441966 3300005435 Bacteria 1234
39 Ga0070714_100605311 3300005435 Bacteria 1052
40 Ga0070714_100761190 3300005435 Bacteria 937
41 Ga0070714_101478049 3300005435 Bacteria 664
42 Ga0070714_101752908 3300005435 Bacteria 606
43 Ga0070713_100001898 3300005436 Bacteria 13463
44 Ga0070713_100183075 3300005436 Bacteria 1884
45 Ga0070713_101863309 3300005436 Bacteria 584
46 Ga0070710_10003777 3300005437 Bacteria 7164
47 Ga0070710_10004714 3300005437 Bacteria 6449
48 Ga0070710_10909947 3300005437 Bacteria 636
49 Ga0070711_100036621 3300005439 Bacteria 3287
50 Ga0070711_100081722 3300005439 Bacteria 2304
51 Ga0070711_100436779 3300005439 Bacteria 1069
52 Ga0070711_101792625 3300005439 Bacteria 538
53 Ga0070705_100588960 3300005440 Bacteria 859
54 Ga0070705_100592249 3300005440 Bacteria 856
55 Ga0070708_101197453 3300005445 Bacteria 711
56 Ga0070678_100414645 3300005456 Bacteria 1173
57 Ga0070678_100531623 3300005456 Bacteria 1042
58 Ga0070681_10025398 3300005458 Bacteria 5959
59 Ga0070681_10047166 3300005458 Bacteria 4307
60 Ga0070681_10068399 3300005458 Bacteria 3518
61 Ga0070681_10125740 3300005458 Bacteria 2497
62 Ga0070681_11312189 3300005458 Bacteria 647
63 Ga0070681_11616731 3300005458 Bacteria 573
64 Ga0068867_100238754 3300005459 Bacteria 1473
65 Ga0070707_100000819 3300005468 Bacteria 30825
66 Ga0070707_100190504 3300005468 Bacteria 2000
67 Ga0070707_100638159 3300005468 Bacteria 1028
68 Ga0070698_100007710 3300005471 Bacteria 11642
69 Ga0070698_100400551 3300005471 Bacteria 1306
70 Ga0070698_100453882 3300005471 Bacteria 1217
71 Ga0070699_101098545 3300005518 Bacteria 729
72 Ga0070679_100058919 3300005530 Bacteria 3827
73 Ga0070679_100075673 3300005530 Bacteria 3356
74 Ga0070679_100093878 3300005530 Bacteria 2987
75 Ga0070679_100112544 3300005530 Bacteria 2708
76 Ga0070679_100341505 3300005530 Bacteria 1445
77 Ga0070679_100408937 3300005530 Bacteria 1303
78 Ga0070679_100474295 3300005530 Bacteria 1195
79 Ga0070679_101012943 3300005530 Bacteria 775
80 Ga0070684_100002789 3300005535 Bacteria 12943
81 Ga0070684_100003984 3300005535 Bacteria 11188
82 Ga0070684_100010471 3300005535 Bacteria 7348
83 Ga0070684_100679126 3300005535 Bacteria 959
84 Ga0070684_101150517 3300005535 Bacteria 730
85 Ga0070684_101677181 3300005535 Bacteria 600
86 Ga0070684_101682910 3300005535 Bacteria 599
87 Ga0070686_100552854 3300005544 Bacteria 901
88 Ga0070695_100000009 3300005545 Bacteria 87710
89 Ga0070695_100403916 3300005545 Bacteria 1036
90 Ga0070693_100185962 3300005547 Bacteria 1341
91 Ga0070693_100189090 3300005547 Bacteria 1331
92 Ga0070704_100037956 3300005549 Bacteria 3295
93 Ga0070704_100756452 3300005549 Bacteria 865
94 Ga0070704_101136161 3300005549 Bacteria 711
95 Ga0068855_100050260 3300005563 Bacteria 4914
96 Ga0068855_100218300 3300005563 Bacteria 2140
97 Ga0068855_101506345 3300005563 Bacteria 690
98 Ga0068855_101646893 3300005563 Bacteria 656
99 Ga0070664_100197096 3300005564 Bacteria 1795
100 Ga0068857_100019684 3300005577 Bacteria 5929
101 Ga0068857_100087165 3300005577 Bacteria 2792
102 Ga0068857_100096390 3300005577 Bacteria 2651
103 Ga0068857_101567747 3300005577 Bacteria 643
104 Ga0068856_100030722 3300005614 Bacteria 5252
105 Ga0068856_100130493 3300005614 Bacteria 2518
106 Ga0068856_100218195 3300005614 Bacteria 1922
107 Ga0068856_100233065 3300005614 Bacteria 1856
108 Ga0068852_100367398 3300005616 Bacteria 1409
109 Ga0068852_100670591 3300005616 Bacteria 1046
110 Ga0068859_100805153 3300005617 Bacteria 1027
111 Ga0068861_101066669 3300005719 Bacteria 775
112 Ga0068870_10191947 3300005840 Bacteria 1233
113 Ga0068863_100109515 3300005841 Bacteria 2630
114 Ga0068863_100921552 3300005841 Bacteria 875
115 Ga0068858_100431743 3300005842 Bacteria 1268
116 Ga0068858_100515829 3300005842 Bacteria 1156
117 Ga0068862_100805324 3300005844 Bacteria 918
118 Ga0081455_10020306 3300005937 Bacteria 6261
119 Ga0081455_10051277 3300005937 Bacteria 3540
120 Ga0081455_10094671 3300005937 Bacteria 2412
121 Ga0081455_10656903 3300005937 Bacteria 674
122 Ga0081538_10000184 3300005981 Bacteria 68601
123 Ga0081538_10000747 3300005981 Bacteria 35453
124 Ga0081538_10002355 3300005981 Bacteria 18586
125 Ga0081538_10003921 3300005981 Bacteria 13876
126 Ga0081538_10007045 3300005981 Bacteria 9778
127 Ga0081538_10111858 3300005981 Bacteria 1338
128 Ga0081539_10002546 3300005985 Bacteria 25327
129 Ga0070717_10011983 3300006028 Bacteria 6600
130 Ga0070717_10016859 3300006028 Bacteria 5671
131 Ga0070717_10068575 3300006028 Bacteria 2952
132 Ga0070717_11048646 3300006028 Bacteria 743
133 Ga0075364_10032208 3300006051 Bacteria 3369
134 Ga0075432_10256179 3300006058 Bacteria 712
135 Ga0070715_10001428 3300006163 Bacteria 6916
136 Ga0070716_100042776 3300006173 Bacteria 2530
137 Ga0070716_100080960 3300006173 Bacteria 1938
138 Ga0070712_100142738 3300006175 Bacteria 1830
139 Ga0070712_100917833 3300006175 Bacteria 755
140 Ga0070712_101159745 3300006175 Bacteria 672
141 Ga0070712_101209127 3300006175 Bacteria 657
142 Ga0070712_101426090 3300006175 Bacteria 604
143 Ga0075367_10750049 3300006178 Bacteria 621
144 Ga0075428_101865935 3300006844 Bacteria 625
145 Ga0075430_100115037 3300006846 Bacteria 2241
146 Ga0075430_100126820 3300006846 Bacteria 2127
147 Ga0075430_100142852 3300006846 Bacteria 1993
148 Ga0075431_100159176 3300006847 Bacteria 2322
149 Ga0075431_100514808 3300006847 Bacteria 1186
150 Ga0075434_100006605 3300006871 Bacteria 10642
151 Ga0075434_100220697 3300006871 Bacteria 1915
152 Ga0075429_100035831 3300006880 Bacteria 4315
153 Ga0075429_100083291 3300006880 Bacteria 2788
154 Ga0075429_100600729 3300006880 Bacteria 964
155 Ga0075429_101567725 3300006880 Bacteria 573
156 Ga0068865_101441673 3300006881 Bacteria 616
157 Ga0075436_100008175 3300006914 Bacteria 7160
158 Ga0097620_100805208 3300006931 Bacteria 1027
159 Ga0105250_10309036 3300009092 Bacteria 685
160 Ga0105240_10026690 3300009093 Bacteria 7577
161 Ga0105240_10069913 3300009093 Bacteria 4345
162 Ga0105240_10116638 3300009093 Bacteria 3221
163 Ga0105240_11457818 3300009093 Bacteria 718
164 Ga0111539_10024633 3300009094 Bacteria 7381
165 Ga0111539_10292969 3300009094 Bacteria 1894
166 Ga0111539_10321659 3300009094 Bacteria 1800
167 Ga0111539_10842433 3300009094 Bacteria 1067
168 Ga0105245_10076725 3300009098 Bacteria 3045
169 Ga0105245_10107661 3300009098 Bacteria 2588
170 Ga0105245_10122893 3300009098 Bacteria 2427
171 Ga0105245_10172064 3300009098 Bacteria 2063
172 Ga0105245_10246373 3300009098 Bacteria 1735
173 Ga0105245_10612015 3300009098 Bacteria 1117
174 Ga0105245_11072596 3300009098 Unclassified 851
175 Ga0105245_11266565 3300009098 Bacteria 786
176 Ga0105247_10336543 3300009101 Bacteria 1057
177 Ga0105247_11189376 3300009101 Bacteria 606
178 Ga0114129_10034292 3300009147 Bacteria 7168
179 Ga0114129_10205785 3300009147 Bacteria 2663
180 Ga0114129_10452095 3300009147 Bacteria 1684
181 Ga0114129_10964063 3300009147 Bacteria 1076
182 Ga0114129_11177497 3300009147 Bacteria 956
183 Ga0105243_10188544 3300009148 Bacteria 1799
184 Ga0105243_10820727 3300009148 Bacteria 918
185 Ga0105243_11379359 3300009148 Bacteria 725
186 Ga0105242_10295051 3300009176 Bacteria 1478
187 Ga0105242_10470310 3300009176 Bacteria 1189
188 Ga0105248_10102389 3300009177 Bacteria 3227
189 Ga0105248_10377289 3300009177 Bacteria 1596
190 Ga0105248_10918848 3300009177 Bacteria 988
191 Ga0105248_11279507 3300009177 Bacteria 829
192 Ga0105248_13342220 3300009177 Bacteria 510
193 Ga0105237_10028651 3300009545 Bacteria 5670
194 Ga0105237_10947543 3300009545 Bacteria 868
195 Ga0105237_11138383 3300009545 Bacteria 787
196 Ga0105237_11540882 3300009545 Bacteria 671
197 Ga0105238_10060481 3300009551 Bacteria 3792
198 Ga0105238_11529742 3300009551 Bacteria 696
199 Ga0105238_12539930 3300009551 Bacteria 548
200 Ga0105249_10667262 3300009553 Bacteria 1098
201 Ga0105249_12689451 3300009553 Bacteria 570
202 Ga0105239_10207157 3300010375 Bacteria 2197
203 Ga0105246_10736852 3300011119 Bacteria 868
204 Ga0157370_10009301 3300013104 Bacteria 10522
205 Ga0157370_10874560 3300013104 Bacteria 816
206 Ga0157369_10077611 3300013105 Bacteria 3560
207 Ga0157369_10139208 3300013105 Bacteria 2569
208 Ga0157369_10233255 3300013105 Bacteria 1924
209 Ga0157369_10518379 3300013105 Bacteria 1233
210 Ga0157369_11761259 3300013105 Bacteria 629
211 Ga0157374_10181649 3300013296 Bacteria 2055
212 Ga0157374_11748577 3300013296 Bacteria 647
213 Ga0163162_10181667 3300013306 Bacteria 2230
214 Ga0163162_10428208 3300013306 Bacteria 1455
215 Ga0163162_11815736 3300013306 Bacteria 697
216 Ga0157372_10080638 3300013307 Bacteria 3683
217 Ga0157372_10230787 3300013307 Bacteria 2146
218 Ga0157372_10288236 3300013307 Bacteria 1909
219 Ga0157372_12700909 3300013307 Bacteria 570
220 Ga0157375_10147472 3300013308 Bacteria 2485
221 Ga0157375_11521021 3300013308 Bacteria 790
222 Ga0163163_10799460 3300014325 Bacteria 1007
223 Ga0182008_10004028 3300014497 Bacteria 8673
224 Ga0182008_10107544 3300014497 Bacteria 1381
225 Ga0182008_10210060 3300014497 Bacteria 993
226 Ga0182008_10350340 3300014497 Bacteria 783
227 Ga0157376_10011746 3300014969 Bacteria 6467
228 Ga0182006_1089958 3300015261 Bacteria 1106
229 Ga0182007_10012283 3300015262 Bacteria 3298
230 Ga0182007_10087275 3300015262 Bacteria 1026
231 Ga0206356_10039275 3300020070 Bacteria 1507
232 Ga0206356_11094341 3300020070 Bacteria 1134
233 Ga0206353_11654778 3300020082 Bacteria 4392
234 Ga0207692_10006002 3300025898 Bacteria 4910
235 Ga0207692_10148245 3300025898 Bacteria 1341
236 Ga0207710_10649691 3300025900 Bacteria 552
237 Ga0207688_10260366 3300025901 Bacteria 1052
238 Ga0207685_10055183 3300025905 Bacteria 1550
239 Ga0207699_10320994 3300025906 Bacteria 1086
240 Ga0207699_10846834 3300025906 Bacteria 673
241 Ga0207643_10014388 3300025908 Bacteria 4296
242 Ga0207705_10649966 3300025909 Bacteria 820
243 Ga0207684_11020441 3300025910 Bacteria 691
244 Ga0207707_10085050 3300025912 Bacteria 2763
245 Ga0207707_10182036 3300025912 Bacteria 1834
246 Ga0207707_10277293 3300025912 Bacteria 1452
247 Ga0207707_10620505 3300025912 Bacteria 913
248 Ga0207695_10099689 3300025913 Bacteria 2902
249 Ga0207695_10706590 3300025913 Bacteria 889
250 Ga0207695_10921362 3300025913 Bacteria 753
251 Ga0207671_10404850 3300025914 Bacteria 1085
252 Ga0207671_11142717 3300025914 Bacteria 611
253 Ga0207671_11212355 3300025914 Bacteria 590
254 Ga0207671_11357287 3300025914 Bacteria 552
255 Ga0207693_10008691 3300025915 Bacteria 8307
256 Ga0207693_10020559 3300025915 Bacteria 5249
257 Ga0207693_10023372 3300025915 Bacteria 4909
258 Ga0207693_10199756 3300025915 Bacteria 1573
259 Ga0207693_10501356 3300025915 Bacteria 948
260 Ga0207693_10913296 3300025915 Bacteria 673
261 Ga0207693_11345695 3300025915 Bacteria 532
262 Ga0207663_10018096 3300025916 Bacteria 3940
263 Ga0207663_10019046 3300025916 Bacteria 3858
264 Ga0207663_10874705 3300025916 Bacteria 718
265 Ga0207660_10013739 3300025917 Bacteria 5312
266 Ga0207660_10047498 3300025917 Bacteria 3035
267 Ga0207660_11497786 3300025917 Bacteria 545
268 Ga0207657_10009493 3300025919 Bacteria 9773
269 Ga0207657_10010764 3300025919 Bacteria 9105
270 Ga0207649_10578928 3300025920 Bacteria 862
271 Ga0207649_11072630 3300025920 Bacteria 635
272 Ga0207652_10121275 3300025921 Bacteria 2326
273 Ga0207652_10126062 3300025921 Bacteria 2281
274 Ga0207652_10146163 3300025921 Bacteria 2116
275 Ga0207652_10623834 3300025921 Bacteria 965
276 Ga0207652_10774094 3300025921 Bacteria 853
277 Ga0207646_10003137 3300025922 Bacteria 18943
278 Ga0207646_11412286 3300025922 Bacteria 605
279 Ga0207659_11255334 3300025926 Bacteria 636
280 Ga0207659_11918662 3300025926 Bacteria 502
281 Ga0207687_10251171 3300025927 Bacteria 1406
282 Ga0207687_10751348 3300025927 Bacteria 830
283 Ga0207687_11172726 3300025927 Bacteria 660
284 Ga0207687_11741949 3300025927 Bacteria 534
285 Ga0207700_10056430 3300025928 Bacteria 2956
286 Ga0207700_10168108 3300025928 Bacteria 1827
287 Ga0207700_11648148 3300025928 Bacteria 567
288 Ga0207664_10008513 3300025929 Bacteria 7162
289 Ga0207664_10011230 3300025929 Bacteria 6352
290 Ga0207664_10111773 3300025929 Bacteria 2273
291 Ga0207664_10254735 3300025929 Bacteria 1533
292 Ga0207664_10294149 3300025929 Bacteria 1427
293 Ga0207664_10367334 3300025929 Bacteria 1276
294 Ga0207644_11131312 3300025931 Bacteria 658
295 Ga0207690_11105923 3300025932 Bacteria 661
296 Ga0207706_10056281 3300025933 Bacteria 3468
297 Ga0207686_10098448 3300025934 Bacteria 1947
298 Ga0207686_10411914 3300025934 Bacteria 1032
299 Ga0207709_11270091 3300025935 Bacteria 608
300 Ga0207669_10284081 3300025937 Bacteria 1250
301 Ga0207665_10002129 3300025939 Bacteria 13398
302 Ga0207711_10178680 3300025941 Bacteria 1929
303 Ga0207661_10024653 3300025944 Bacteria 4561
304 Ga0207661_10564157 3300025944 Bacteria 1043
305 Ga0207661_10579051 3300025944 Bacteria 1029
306 Ga0207661_10696826 3300025944 Bacteria 934
307 Ga0207661_12014090 3300025944 Bacteria 523
308 Ga0207679_10095255 3300025945 Bacteria 2313
309 Ga0207679_10131590 3300025945 Bacteria 2008
310 Ga0207667_10993833 3300025949 Bacteria 827
311 Ga0207667_11152418 3300025949 Bacteria 757
312 Ga0207667_12171805 3300025949 Bacteria 513
313 Ga0207712_10357492 3300025961 Bacteria 1216
314 Ga0207677_11199468 3300026023 Bacteria 695
315 Ga0207703_10843580 3300026035 Bacteria 876
316 Ga0207702_10050786 3300026078 Bacteria 3501
317 Ga0207702_10113566 3300026078 Bacteria 2412
318 Ga0207702_10138719 3300026078 Bacteria 2197
319 Ga0207702_10685498 3300026078 Bacteria 1009
320 Ga0207641_10088835 3300026088 Bacteria 2700
321 Ga0207648_10420659 3300026089 Bacteria 1213
322 Ga0207674_10002484 3300026116 Bacteria 23238
323 Ga0207674_10028403 3300026116 Bacteria 5905
324 Ga0207674_10155333 3300026116 Bacteria 2243
325 Ga0207674_10430949 3300026116 Bacteria 1274
326 Ga0207674_11525931 3300026116 Bacteria 637
327 Ga0207675_100849544 3300026118 Bacteria 928
328 Ga0207683_10316104 3300026121 Bacteria 1430
329 Ga0207698_11509898 3300026142 Bacteria 687
330 Ga0207428_10105547 3300027907 Bacteria 2173
331 Ga0268265_10915959 3300028380 Bacteria 862
332 Ga0265319_1232339 3300028563 Bacteria 563
333 Ga0265336_10009011 3300028666 Bacteria 3468
334 Ga0265338_10002905 3300028800 Bacteria 24920
335 Ga0307413_10227287 3300031824 Bacteria 1368
336 Ga0307413_12061062 3300031824 Bacteria 515
337 Ga0307407_10239896 3300031903 Bacteria 1236
338 Ga0307407_11400709 3300031903 Bacteria 551
339 Ga0307412_11689563 3300031911 Bacteria 580
340 Ga0307409_100066010 3300031995 Bacteria 2851
341 Ga0307409_100391265 3300031995 Bacteria 1325
342 Ga0307416_100056460 3300032002 Bacteria 3169
343 Ga0307416_101505978 3300032002 Bacteria 778
344 Ga0307415_100037113 3300032126 Bacteria 3200
345 Ga0373936_0112682 3300035113 Bacteria 1156
346 Ga0373931_0102191 3300035691 Bacteria 1614
347 Ga0373935_0240375 3300035692 Bacteria 1264
348 Ga0373935_0355061 3300035692 Bacteria 1046
349 Ga0373947_0302527 3300035725 Bacteria 1067
350 Ga0373937_0520878 3300036401 Bacteria 1130
351 Ga0395899_0002411 3300037312 Bacteria 15193
352 Ga0395899_0031639 3300037312 Bacteria 3976
353 Ga0395899_0058497 3300037312 Bacteria 2842
354 Ga0395899_0321583 3300037312 Bacteria 1042
355 Ga0395899_0347559 3300037312 Bacteria 993
356 Ga0395899_0381515 3300037312 Bacteria 937
357 Ga0395900_0015039 3300037418 Bacteria 7888
358 Ga0395900_0016859 3300037418 Bacteria 7454
359 Ga0395900_0026672 3300037418 Bacteria 5915
360 Ga0395900_0046334 3300037418 Bacteria 4476
361 Ga0395900_0098676 3300037418 Bacteria 3001
362 Ga0395900_0116389 3300037418 Bacteria 2743
363 Ga0395900_0145888 3300037418 Bacteria 2420
364 Ga0395900_0198342 3300037418 Bacteria 2032
365 Ga0395900_0391565 3300037418 Bacteria 1355
366 Ga0395900_0392546 3300037418 Bacteria 1353
367 Ga0395900_0602320 3300037418 Bacteria 1039
368 Ga0395900_1027484 3300037418 Bacteria 743
369 Ga0395900_1562722 3300037418 Bacteria 571
370 Ga0395900_1633065 3300037418 Bacteria 556
371 Ga0395898_0005964 3300037466 Bacteria 13081
372 Ga0395898_0010490 3300037466 Bacteria 9686
373 Ga0395898_0020626 3300037466 Bacteria 6694
374 Ga0395898_0035987 3300037466 Bacteria 4920
375 Ga0395898_0042077 3300037466 Bacteria 4509
376 Ga0395898_0251346 3300037466 Bacteria 1686
377 Ga0395898_0295587 3300037466 Bacteria 1545
378 Ga0395898_0526726 3300037466 Bacteria 1123
379 Ga0395898_0563497 3300037466 Bacteria 1081
380 Ga0395898_0796234 3300037466 Bacteria 885
381 Ga0395898_0976856 3300037466 Bacteria 783
382 Ga0395898_1074671 3300037466 Bacteria 739
383 Ga0395905_0021372 3300037471 Bacteria 6120
384 Ga0395905_0033208 3300037471 Bacteria 4848
385 Ga0395905_0195787 3300037471 Bacteria 1895
386 Ga0395905_0275419 3300037471 Bacteria 1568
387 Ga0395905_0278542 3300037471 Bacteria 1558
388 Ga0395905_0398685 3300037471 Bacteria 1271
389 Ga0395905_0426983 3300037471 Bacteria 1222
390 Ga0395905_0515519 3300037471 Bacteria 1096
391 Ga0395905_1104211 3300037471 Bacteria 696
392 Ga0395905_1158925 3300037471 Bacteria 676
393 Ga0395905_1248993 3300037471 Bacteria 646
394 Ga0395901_0001730 3300038443 Bacteria 22543
395 Ga0395901_0004281 3300038443 Bacteria 14399
396 Ga0395901_0010470 3300038443 Bacteria 9393
397 Ga0395901_0015802 3300038443 Bacteria 7691
398 Ga0395901_0070123 3300038443 Bacteria 3651
399 Ga0395901_0127794 3300038443 Bacteria 2671
400 Ga0395901_0291942 3300038443 Bacteria 1692
401 Ga0395901_0293960 3300038443 Bacteria 1685
402 Ga0395901_0361120 3300038443 Bacteria 1497
403 Ga0395901_0366132 3300038443 Bacteria 1485
404 Ga0395901_0439071 3300038443 Bacteria 1336
405 Ga0395901_0788115 3300038443 Bacteria 940
406 Ga0395901_1064239 3300038443 Bacteria 781
407 Ga0395901_1910902 3300038443 Bacteria 541
408 Ga0436363_0438143 3300039450 Bacteria 805
409 Ga0436363_1655099 3300039450 Bacteria 957
410 Ga0439438_059950 3300041405 Bacteria 954
411 Ga0439461_0198355 3300041410 Bacteria 538
412 Ga0451791_1724365 3300041451 Bacteria 738
413 Ga0451845_0704111 3300041501 Bacteria 522
414 Ga0451853_2233860 3300041512 Bacteria 1007
415 Ga0439445_0117000 3300042004 Bacteria 763
416 Ga0439449_0330317 3300042007 Bacteria 576
417 Ga0439464_0171767 3300042439 Bacteria 684
418 Ga0439460_0313418 3300042461 Bacteria 550
419 Ga0450918_034132 3300042531 Bacteria 903
420 Ga0466969_0077276 3300044656 Bacteria 1593
421 Ga0466969_0098555 3300044656 Bacteria 1378
422 Ga0466972_0024827 3300044658 Bacteria 2975
423 Ga0466965_0063247 3300044683 Bacteria 1852
424 Ga0466965_0115741 3300044683 Bacteria 1381
425 Ga0466965_0795297 3300044683 Bacteria 547
426 Ga0466966_0008968 3300044684 Bacteria 6628
427 Ga0466966_0049950 3300044684 Bacteria 2662
428 Ga0466961_0003397 3300044693 Bacteria 9935
429 Ga0466961_0132303 3300044693 Bacteria 1563
430 Ga0466961_0207291 3300044693 Bacteria 1211
431 Ga0466963_0005916 3300044694 Bacteria 7201
432 Ga0466963_0007929 3300044694 Bacteria 6359
433 Ga0466963_0021952 3300044694 Bacteria 4035
434 Ga0466963_0060709 3300044694 Bacteria 2525
435 Ga0466963_0063407 3300044694 Bacteria 2473
436 Ga0466963_0120699 3300044694 Bacteria 1803
437 Ga0466963_0139871 3300044694 Bacteria 1676
438 Ga0466963_0264239 3300044694 Bacteria 1208
439 Ga0466963_0724772 3300044694 Bacteria 701
440 Ga0466964_0005301 3300044706 Bacteria 4785
441 Ga0466964_0012711 3300044706 Bacteria 3187
442 Ga0466964_0019735 3300044706 Bacteria 2592
443 Ga0466964_0066236 3300044706 Bacteria 1515
444 Ga0466964_0081695 3300044706 Bacteria 1388
445 Ga0466964_0115124 3300044706 Bacteria 1204
446 Ga0466964_0439356 3300044706 Bacteria 690
447 Ga0466964_0445748 3300044706 Bacteria 685
448 Ga0466964_0808823 3300044706 Bacteria 530
449 Ga0466971_0001034 3300044719 Bacteria 11524
450 Ga0466971_0013313 3300044719 Bacteria 3612
451 Ga0466971_0076211 3300044719 Bacteria 1526
452 Ga0466971_0121251 3300044719 Bacteria 1210
453 Ga0466968_0003414 3300044735 Bacteria 5873
454 Ga0466968_0010182 3300044735 Bacteria 3638
455 Ga0466968_0047138 3300044735 Bacteria 1832
456 Ga0466968_0141050 3300044735 Bacteria 1102
457 Ga0466968_0182082 3300044735 Bacteria 977
458 Ga0466968_0254272 3300044735 Bacteria 835
459 Ga0466970_0160019 3300044765 Bacteria 1245
460 Ga0466957_0002287 3300044842 Bacteria 10260
461 Ga0466957_0036114 3300044842 Bacteria 2969
462 Ga0466957_0091545 3300044842 Bacteria 1906
463 Ga0466957_0094593 3300044842 Bacteria 1876
464 Ga0466957_0169697 3300044842 Bacteria 1421
465 Ga0466957_0301668 3300044842 Bacteria 1076
466 Ga0466960_0014345 3300044901 Bacteria 3390
467 Ga0466960_0031867 3300044901 Bacteria 2435
468 Ga0466960_0757507 3300044901 Bacteria 586
469 Ga0466959_0001467 3300045049 Bacteria 14453
470 Ga0466959_0002306 3300045049 Bacteria 12175
471 Ga0466959_0674705 3300045049 Bacteria 693
472 Ga0466958_0036288 3300045836 Bacteria 2950
473 Ga0466958_0038426 3300045836 Bacteria 2872
474 Ga0466958_0047613 3300045836 Bacteria 2588
475 Ga0466958_0052618 3300045836 Bacteria 2468
476 Ga0466958_0158614 3300045836 Bacteria 1428
477 Ga0466958_0257172 3300045836 Bacteria 1117
478 Ga0466967_0000602 3300045976 Bacteria 17865
479 Ga0466967_0001349 3300045976 Bacteria 14097
480 Ga0466967_0032464 3300045976 Bacteria 4409
481 Ga0466967_0039396 3300045976 Bacteria 4062
482 Ga0466967_0055383 3300045976 Bacteria 3493
483 Ga0466967_0083108 3300045976 Bacteria 2895
484 Ga0466967_0086927 3300045976 Bacteria 2833
485 Ga0466967_0098577 3300045976 Bacteria 2668
486 Ga0466967_0101712 3300045976 Bacteria 2627
487 Ga0466967_0110092 3300045976 Bacteria 2529
488 Ga0466967_0122553 3300045976 Bacteria 2404
489 Ga0466967_0162735 3300045976 Bacteria 2095
490 Ga0466967_0473308 3300045976 Bacteria 1226
491 Ga0466967_0769062 3300045976 Bacteria 955
492 Ga0466967_1163475 3300045976 Bacteria 768
493 Ga0466967_2401569 3300045976 Bacteria 522
494 Ga0495592_0077201 3300046454 Bacteria 2415
495 Ga0495592_0237019 3300046454 Bacteria 1212
496 Ga0495592_0383032 3300046454 Bacteria 894
497 Ga0495603_0148007 3300046455 Bacteria 1365
498 Ga0495629_0095764 3300046459 Bacteria 2071
499 Ga0495629_0099393 3300046459 Bacteria 2030
500 Ga0495641_0009111 3300046461 Bacteria 5943
501 Ga0495641_0032020 3300046461 Bacteria 2507
502 Ga0495641_0065957 3300046461 Bacteria 1629
503 Ga0495641_0191704 3300046461 Bacteria 916
504 Ga0495641_0227778 3300046461 Bacteria 836
505 Ga0495641_0243097 3300046461 Bacteria 809
506 Ga0495651_0107736 3300046462 Bacteria 2064
507 Ga0495651_0325319 3300046462 Bacteria 1023
508 Ga0495651_0635580 3300046462 Bacteria 670
509 Ga0495651_0803713 3300046462 Bacteria 580
510 Ga0495653_0033712 3300046463 Bacteria 4054
511 Ga0495653_0034462 3300046463 Bacteria 4005
512 Ga0495653_0099046 3300046463 Bacteria 2116
513 Ga0495653_0181593 3300046463 Bacteria 1443
514 Ga0495653_0389363 3300046463 Bacteria 888
515 Ga0495653_0410521 3300046463 Bacteria 859
516 Ga0495580_0732371 3300046472 Bacteria 645
517 Ga0495582_0092313 3300046473 Bacteria 1689
518 Ga0495605_0260286 3300046474 Bacteria 741
519 Ga0495664_0049809 3300046477 Bacteria 2487
520 Ga0495664_0185437 3300046477 Bacteria 1261
521 Ga0495664_0450768 3300046477 Bacteria 770
522 Ga0495585_0051106 3300046492 Bacteria 2291
523 Ga0495596_0157621 3300046500 Bacteria 882
524 Ga0495607_0049949 3300046501 Bacteria 2437
525 Ga0495607_0077240 3300046501 Bacteria 1840
526 Ga0495608_0035123 3300046511 Bacteria 3383
527 Ga0495608_0097069 3300046511 Bacteria 1903
528 Ga0495608_0227286 3300046511 Bacteria 1169
529 Ga0495608_0279069 3300046511 Bacteria 1037
530 Ga0495608_0890426 3300046511 Bacteria 521
531 Ga0495618_0142277 3300046514 Bacteria 1534
532 Ga0495618_0187967 3300046514 Bacteria 1311
533 Ga0495618_0229465 3300046514 Bacteria 1169
534 Ga0495618_0296129 3300046514 Bacteria 1006
535 Ga0495618_0388755 3300046514 Bacteria 855
536 Ga0495628_0139628 3300046516 Bacteria 1849
537 Ga0495628_0209349 3300046516 Bacteria 1467
538 Ga0495628_1153956 3300046516 Bacteria 527
539 Ga0495630_0113983 3300046517 Bacteria 2048
540 Ga0495630_0244684 3300046517 Bacteria 1370
541 Ga0495630_0928068 3300046517 Bacteria 663
542 Ga0495630_1134091 3300046517 Bacteria 592
543 Ga0495637_0096930 3300046520 Bacteria 1157
544 Ga0495644_0019710 3300046523 Bacteria 2575
545 Ga0495642_0232982 3300046528 Bacteria 804
546 Ga0495652_0024347 3300046529 Bacteria 5359
547 Ga0495652_0209574 3300046529 Bacteria 1472
548 Ga0495640_0181423 3300046533 Bacteria 1341
549 Ga0495640_0374373 3300046533 Bacteria 877
550 Ga0495586_0002329 3300046535 Bacteria 10328
551 Ga0495587_0037387 3300046536 Bacteria 2915
552 Ga0495645_0131891 3300046543 Bacteria 1750
553 Ga0495645_0183865 3300046543 Bacteria 1429
554 Ga0495645_0229756 3300046543 Bacteria 1243
555 Ga0495667_0054984 3300046559 Bacteria 2618
556 Ga0495667_0327229 3300046559 Bacteria 969
557 Ga0495667_0561778 3300046559 Bacteria 712
558 Ga0495656_0001684 3300046615 Bacteria 7232
559 Ga0495656_0130155 3300046615 Bacteria 1197
560 Ga0495656_0415058 3300046615 Bacteria 706
561 Ga0495634_0310045 3300046642 Bacteria 952
562 Ga0495634_0376038 3300046642 Bacteria 847
563 Ga0495634_0400167 3300046642 Bacteria 816
564 Ga0495634_0477608 3300046642 Bacteria 733
565 Ga0495611_0025198 3300046648 Bacteria 2591
566 Ga0495635_0018122 3300046663 Bacteria 4917
567 Ga0495635_0299988 3300046663 Bacteria 1077
568 Ga0495661_0298603 3300046665 Unclassified 807
569 Ga0495657_0015450 3300046675 Bacteria 5587
570 Ga0495657_0059425 3300046675 Bacteria 2536
571 Ga0495657_0127289 3300046675 Bacteria 1599
572 Ga0495599_0028273 3300046678 Bacteria 3514
573 Ga0495623_0098893 3300046679 Bacteria 1780
574 Ga0495646_0025801 3300046680 Bacteria 3695
575 Ga0495658_0080923 3300046683 Bacteria 1906
576 Ga0495669_0308932 3300046684 Bacteria 763
577 Ga0495613_0311274 3300046689 Bacteria 1088
578 Ga0495613_0797052 3300046689 Bacteria 617
579 Ga0495624_0008048 3300046690 Bacteria 7384
580 Ga0495624_0075064 3300046690 Bacteria 2100
581 Ga0495624_0440241 3300046690 Bacteria 781
582 Ga0495670_0333881 3300046691 Bacteria 815
583 Ga0495589_0034291 3300046794 Bacteria 2549
584 Ga0495589_0497054 3300046794 Bacteria 557
585 Ga0495600_0027831 3300046809 Bacteria 3655
586 Ga0495600_0149672 3300046809 Bacteria 1512
587 Ga0495600_0460786 3300046809 Bacteria 785
588 Ga0495581_0637502 3300047315 Bacteria 616
589 Ga0495604_0197669 3300047317 Bacteria 1397
590 Ga0495604_0536353 3300047317 Bacteria 756
591 Ga0495636_0147460 3300047318 Bacteria 1054
592 Ga0495636_0455277 3300047318 Bacteria 615
593 Ga0495674_0024505 3300047319 Bacteria 5543
594 Ga0495674_0059113 3300047319 Bacteria 3349
595 Ga0495674_0141769 3300047319 Bacteria 2020
596 Ga0495674_0320248 3300047319 Bacteria 1263
597 Ga0495674_0424085 3300047319 Bacteria 1071
598 Ga0495674_0425528 3300047319 Bacteria 1069
599 Ga0495674_0512956 3300047319 Bacteria 958
600 Ga0495676_0356906 3300047321 Bacteria 976
601 Ga0495676_0549670 3300047321 Bacteria 755
602 Ga0495676_0707868 3300047321 Bacteria 651
603 Ga0495676_1041327 3300047321 Bacteria 521
604 Ga0495680_0025389 3300047322 Bacteria 4905
605 Ga0495680_0245197 3300047322 Bacteria 1271
606 Ga0495680_0302145 3300047322 Bacteria 1123
607 Ga0495680_0491831 3300047322 Bacteria 834
608 Ga0495680_0655774 3300047322 Bacteria 697
609 Ga0495680_0804026 3300047322 Bacteria 614
610 Ga0495679_121713 3300047446 Bacteria 713
611 Ga0495684_0010240 3300047471 Bacteria 7251
612 Ga0495684_0898895 3300047471 Bacteria 570
613 Ga0495602_0052083 3300048088 Bacteria 3639
614 Ga0495602_1118832 3300048088 Bacteria 516
615 Ga0496100_0229182 3300048903 Bacteria 1366
616 Ga0496100_0391344 3300048903 Bacteria 1057
617 Ga0496100_0877506 3300048903 Bacteria 704
618 Ga0496101_0014002 3300048904 Bacteria 5386
619 Ga0496101_0046419 3300048904 Bacteria 3115
620 Ga0496101_0172860 3300048904 Bacteria 1661
621 Ga0496101_0804188 3300048904 Bacteria 741
622 Ga0496101_1116828 3300048904 Bacteria 619
623 Ga0496101_1522938 3300048904 Bacteria 520
624 Ga0496102_0048673 3300048905 Bacteria 3854
625 Ga0496102_0088932 3300048905 Bacteria 2856
626 Ga0496103_0091335 3300048906 Bacteria 1921
627 Ga0496103_0110790 3300048906 Bacteria 1744
628 Ga0496103_0257853 3300048906 Bacteria 1122
629 Ga0496103_0577177 3300048906 Bacteria 717
630 Ga0496104_0002284 3300048907 Bacteria 16535
631 Ga0496104_0007845 3300048907 Bacteria 9460
632 Ga0496104_0046059 3300048907 Bacteria 4104
633 Ga0496104_0138664 3300048907 Bacteria 2337
634 Ga0496104_0148959 3300048907 Bacteria 2247
635 Ga0496104_0308234 3300048907 Bacteria 1496
636 Ga0496104_0961117 3300048907 Bacteria 759
637 Ga0496105_0004123 3300048908 Bacteria 10893
638 Ga0496105_0008437 3300048908 Bacteria 8008
639 Ga0496105_0015296 3300048908 Bacteria 6111
640 Ga0496105_0034045 3300048908 Bacteria 4188
641 Ga0496105_0044517 3300048908 Bacteria 3661
642 Ga0496106_0383796 3300048909 Bacteria 1129
643 Ga0496106_0440479 3300048909 Bacteria 1047
644 Ga0496106_0827978 3300048909 Bacteria 733
645 Ga0496106_0890427 3300048909 Bacteria 703
646 Ga0496107_0021170 3300048910 Bacteria 4597
647 Ga0496107_0026969 3300048910 Bacteria 4077
648 Ga0496108_0020386 3300048911 Bacteria 5450
649 Ga0496108_0048468 3300048911 Bacteria 3552
650 Ga0496108_0052069 3300048911 Bacteria 3430
651 Ga0496108_0059540 3300048911 Bacteria 3211
652 Ga0496108_0520407 3300048911 Bacteria 1038
653 Ga0496108_1002355 3300048911 Bacteria 713
654 Ga0496108_1066078 3300048911 Bacteria 688
655 Ga0496109_0003748 3300048912 Bacteria 12703
656 Ga0496109_0010639 3300048912 Bacteria 7868
657 Ga0496109_0056298 3300048912 Bacteria 3588
658 Ga0496109_0079705 3300048912 Bacteria 3017
659 Ga0496109_0085715 3300048912 Bacteria 2908
660 Ga0496109_0303329 3300048912 Bacteria 1506
661 Ga0496109_0452968 3300048912 Bacteria 1212
662 Ga0496109_1990466 3300048912 Bacteria 513
663 Ga0496110_0007489 3300048913 Bacteria 8722
664 Ga0496110_0134108 3300048913 Bacteria 2237
665 Ga0496110_0275284 3300048913 Bacteria 1533
666 Ga0496110_1270509 3300048913 Bacteria 645
667 Ga0496111_0003137 3300048914 Bacteria 10169
668 Ga0496111_0007042 3300048914 Bacteria 7347
669 Ga0496111_0366270 3300048914 Bacteria 1066
670 Ga0496111_0382810 3300048914 Bacteria 1040
671 Ga0496111_0411727 3300048914 Bacteria 999
672 Ga0496111_0677007 3300048914 Bacteria 751
673 Ga0496111_0890766 3300048914 Bacteria 641
674 Ga0496112_0002474 3300048915 Bacteria 14909
675 Ga0496112_0342251 3300048915 Bacteria 1439
676 Ga0496113_0004105 3300048916 Bacteria 8875
677 Ga0496113_0161857 3300048916 Bacteria 1769
678 Ga0496113_0466128 3300048916 Bacteria 1015
679 Ga0496113_0809187 3300048916 Bacteria 744
680 Ga0496114_0037319 3300048917 Bacteria 4018
681 Ga0496114_0045517 3300048917 Bacteria 3646
682 Ga0496114_0068075 3300048917 Bacteria 2988
683 Ga0496114_0252648 3300048917 Bacteria 1551
684 Ga0496114_1043679 3300048917 Bacteria 701
685 Ga0496115_0117621 3300048918 Bacteria 2186
686 Ga0496115_0141011 3300048918 Bacteria 1988
687 Ga0496115_0155518 3300048918 Bacteria 1889
688 Ga0496115_1197847 3300048918 Bacteria 571
689 Ga0501031_0000423 3300049568 Bacteria 24274
690 Ga0501031_0528448 3300049568 Bacteria 760
691 Ga0501031_0911377 3300049568 Bacteria 562
692 Ga0501032_0002185 3300049569 Bacteria 15389
693 Ga0501032_0136528 3300049569 Bacteria 1616
694 Ga0501033_0004428 3300049570 Bacteria 11238
695 Ga0501033_0019459 3300049570 Bacteria 5135
696 Ga0501033_0150382 3300049570 Bacteria 1680
697 Ga0501034_0036109 3300049571 Bacteria 5010
698 Ga0501036_0001079 3300049572 Bacteria 20681
699 Ga0501036_0049827 3300049572 Bacteria 3547
700 Ga0501036_0133549 3300049572 Bacteria 2094
701 Ga0501036_0936060 3300049572 Bacteria 710
702 Ga0501037_0000071 3300049573 Bacteria 94548
703 Ga0501037_0002387 3300049573 Bacteria 13558
704 Ga0501038_0000282 3300049574 Bacteria 43214
705 Ga0501038_0007028 3300049574 Bacteria 10397
706 Ga0501038_0450746 3300049574 Bacteria 989
707 Ga0501038_0688485 3300049574 Bacteria 767
708 Ga0501039_0001238 3300049575 Bacteria 18696
709 Ga0501039_0014170 3300049575 Bacteria 6104
710 Ga0501039_0083543 3300049575 Bacteria 2487
711 Ga0501039_0341164 3300049575 Bacteria 1177
712 Ga0501039_0982386 3300049575 Bacteria 656
713 Ga0501040_0025089 3300049576 Bacteria 4005
714 Ga0501040_0031551 3300049576 Bacteria 3582
715 Ga0501040_0075251 3300049576 Bacteria 2333
716 Ga0501040_0125804 3300049576 Bacteria 1800
717 Ga0501040_0615933 3300049576 Bacteria 784
718 Ga0501041_0002075 3300049577 Bacteria 11284
719 Ga0501041_0007528 3300049577 Bacteria 6392
720 Ga0501041_0018197 3300049577 Bacteria 4185
721 Ga0501041_0034437 3300049577 Bacteria 3066
722 Ga0501041_0234508 3300049577 Bacteria 1152
723 Ga0501041_0443998 3300049577 Bacteria 823
724 Ga0501041_0668056 3300049577 Bacteria 664
725 Ga0501042_0006730 3300049578 Bacteria 7492
726 Ga0501042_0025268 3300049578 Bacteria 4170
727 Ga0501042_0046434 3300049578 Bacteria 3096
728 Ga0501042_0344587 3300049578 Bacteria 1077
729 Ga0501043_0001377 3300049579 Bacteria 21286
730 Ga0501043_0004913 3300049579 Bacteria 10808
731 Ga0501043_0365987 3300049579 Bacteria 1094
732 Ga0501046_0000812 3300049580 Bacteria 30391
733 Ga0501046_0051117 3300049580 Bacteria 3263
734 Ga0501046_0935066 3300049580 Bacteria 604
735 Ga0501047_0943470 3300049581 Bacteria 676
736 Ga0501047_1212991 3300049581 Unclassified 568
737 Ga0501048_0003425 3300049582 Bacteria 12048
738 Ga0501048_0059562 3300049582 Bacteria 2706
739 Ga0501048_0064591 3300049582 Bacteria 2588
740 Ga0501048_0274177 3300049582 Bacteria 1199
741 Ga0501048_0620134 3300049582 Bacteria 776
742 Ga0501067_0227473 3300049583 Bacteria 1038
743 Ga0501067_0245688 3300049583 Bacteria 996
744 Ga0501068_0000165 3300049584 Bacteria 30724
745 Ga0501068_0001860 3300049584 Bacteria 11209
746 Ga0501069_0000359 3300049585 Bacteria 20470
747 Ga0501069_0010689 3300049585 Bacteria 4865
748 Ga0501069_0221462 3300049585 Bacteria 1100
749 Ga0501069_0262565 3300049585 Bacteria 1008
750 Ga0501070_0006865 3300049586 Bacteria 9687
751 Ga0501070_0007343 3300049586 Bacteria 9358
752 Ga0501070_0439205 3300049586 Bacteria 1053
753 Ga0501070_0837541 3300049586 Bacteria 720
754 Ga0501071_0002486 3300049587 Bacteria 11203
755 Ga0501071_0006169 3300049587 Bacteria 7772
756 Ga0501071_0062693 3300049587 Bacteria 2694
757 Ga0501071_0082827 3300049587 Bacteria 2350
758 Ga0501071_0187402 3300049587 Bacteria 1551
759 Ga0501071_0311465 3300049587 Bacteria 1194
760 Ga0501071_0396485 3300049587 Bacteria 1053
761 Ga0501072_0000494 3300049588 Bacteria 28340
762 Ga0501072_0037578 3300049588 Bacteria 3798
763 Ga0501072_0134747 3300049588 Bacteria 1969
764 Ga0501072_0349184 3300049588 Bacteria 1174
765 Ga0501073_0001985 3300049589 Bacteria 15256
766 Ga0501074_0006393 3300049590 Bacteria 8505
767 Ga0501074_0018894 3300049590 Bacteria 5005
768 Ga0501075_0000105 3300049591 Bacteria 39518
769 Ga0501075_0011622 3300049591 Bacteria 6234
770 Ga0501075_0025617 3300049591 Bacteria 4333
771 Ga0501075_0088741 3300049591 Bacteria 2344
772 Ga0501075_0247481 3300049591 Bacteria 1359
773 Ga0501075_0265391 3300049591 Bacteria 1308
774 Ga0501075_1235974 3300049591 Bacteria 566
775 Ga0501076_0070460 3300049592 Bacteria 2795
776 Ga0501076_0198124 3300049592 Bacteria 1639
777 Ga0501076_0495893 3300049592 Bacteria 1006
778 Ga0501076_0685033 3300049592 Bacteria 846
779 Ga0501076_0973769 3300049592 Bacteria 699
780 Ga0501076_1560945 3300049592 Bacteria 542
781 Ga0501076_1784505 3300049592 Bacteria 504
782 Ga0501077_0000128 3300049593 Bacteria 41409
783 Ga0501077_0241843 3300049593 Bacteria 1147
784 Ga0501077_0311612 3300049593 Bacteria 1003
785 Ga0501209_296356 3300049656 Bacteria 509
786 Ga0501079_0050948 3300049741 Bacteria 3195
787 Ga0501079_0067187 3300049741 Bacteria 2766
788 Ga0501079_0087521 3300049741 Bacteria 2411
789 Ga0501079_0348203 3300049741 Bacteria 1161
790 Ga0501079_0775869 3300049741 Bacteria 755
791 Ga0501080_0013924 3300049742 Bacteria 7403
792 Ga0501080_0018014 3300049742 Bacteria 6539
793 Ga0501080_0326723 3300049742 Bacteria 1388
794 Ga0501080_0636533 3300049742 Bacteria 944
795 Ga0501081_0003084 3300049743 Bacteria 10581
796 Ga0501081_0032217 3300049743 Bacteria 3555
797 Ga0501081_0037395 3300049743 Bacteria 3311
798 Ga0501081_0047880 3300049743 Bacteria 2941
799 Ga0501081_0071197 3300049743 Bacteria 2424
800 Ga0501081_0583888 3300049743 Bacteria 836
801 Ga0501081_0634363 3300049743 Bacteria 800
802 Ga0501083_0000352 3300049744 Bacteria 29038
803 Ga0501035_0000978 3300049822 Bacteria 30240
804 Ga0501035_0005703 3300049822 Bacteria 11746
805 Ga0501044_0002766 3300049823 Bacteria 19969
806 Ga0501044_0023380 3300049823 Bacteria 6573
807 Ga0501045_0009549 3300049824 Bacteria 6787
808 Ga0501045_0013003 3300049824 Bacteria 5867
809 Ga0501045_0013979 3300049824 Bacteria 5681
810 Ga0501045_0029991 3300049824 Bacteria 3934
811 Ga0501045_0296478 3300049824 Bacteria 1203
812 Ga0501045_0401695 3300049824 Bacteria 1020
813 Ga0501045_0489380 3300049824 Bacteria 914
814 Ga0501045_0769471 3300049824 Bacteria 709
815 nmdc:mga03683_103721_c1 3300050489 Bacteria 1252
816 nmdc:mga00v17_51181_c1 3300050491 Bacteria 2511
817 nmdc:mga05p37_103565_c1 3300050507 Bacteria 3503
818 nmdc:mga05p37_1277886_c1 3300050507 Bacteria 750
819 nmdc:mga05p37_42344_c1 3300050507 Bacteria 5595
820 nmdc:mga05p37_95385_c2 3300050507 Bacteria 1727
821 nmdc:mga05p37_985944_c1 3300050507 Bacteria 897
822 nmdc:mga09592_1586943_c1 3300050508 Bacteria 530
823 nmdc:mga09592_15894_c1 3300050508 Bacteria 6150
824 nmdc:mga09592_192471_c1 3300050508 Bacteria 1765
825 nmdc:mga09592_71908_c1 3300050508 Bacteria 2937
826 nmdc:mga0qj67_32355_c1 3300050509 Bacteria 4078
827 nmdc:mga0qj67_446629_c1 3300050509 Bacteria 1042
828 nmdc:mga0qj67_581736_c1 3300050509 Bacteria 897
829 nmdc:mga06r32_1600101_c1 3300050510 Bacteria 590
830 nmdc:mga06r32_241545_c1 3300050510 Bacteria 1794
831 nmdc:mga06r32_584775_c1 3300050510 Bacteria 1088
832 nmdc:mga06r32_84192_c1 3300050510 Bacteria 3099
833 nmdc:mga08y16_72940_c1 3300050511 Bacteria 3578
834 nmdc:mga0n895_157150_c1 3300050512 Bacteria 2305
835 nmdc:mga0n895_15818_c1 3300050512 Bacteria 6898
836 nmdc:mga0n895_746116_c1 3300050512 Bacteria 972
837 nmdc:mga0rr50_15135_c1 3300050513 Bacteria 5085
838 nmdc:mga0rr50_1743113_c1 3300050513 Unclassified 525
839 nmdc:mga0rr50_251020_c1 3300050513 Bacteria 1469
840 nmdc:mga08x19_52751_c1 3300050514 Bacteria 2616
841 nmdc:mga0a205_97257_c1 3300050515 Bacteria 2843
842 Ga0495601_0175044 3300053077 Bacteria 1403
843 Ga0495601_0181190 3300053077 Bacteria 1377
844 Ga0495601_0526455 3300053077 Bacteria 761
845 Ga0495601_0707466 3300053077 Bacteria 642
846 Ga0495612_0018627 3300053078 Bacteria 2780
847 Ga0495612_0114812 3300053078 Bacteria 1155
848 Ga0495612_0479819 3300053078 Bacteria 569
849 Ga0495595_0005713 3300053084 Bacteria 5038
850 Ga0495595_0061965 3300053084 Bacteria 1753
851 Ga0495595_0095061 3300053084 Bacteria 1433
852 Ga0495595_0132982 3300053084 Bacteria 1217
853 Ga0495595_0481083 3300053084 Bacteria 632
854 Ga0495619_0007503 3300053085 Bacteria 6907
855 Ga0495619_0268066 3300053085 Bacteria 1183
856 Ga0495619_0472507 3300053085 Bacteria 863
857 Ga0495619_0832103 3300053085 Bacteria 623
858 Ga0495619_0840192 3300053085 Bacteria 620
859 Ga0495619_0914927 3300053085 Bacteria 589
860 Ga0501084_0001813 3300054114 Bacteria 17044
861 Ga0501084_0036271 3300054114 Bacteria 4119
862 Ga0501084_0061892 3300054114 Bacteria 3134
863 Ga0501084_0082209 3300054114 Bacteria 2702
864 Ga0501084_0097848 3300054114 Bacteria 2463
865 Ga0501084_0109045 3300054114 Bacteria 2326
866 Ga0501084_0348953 3300054114 Bacteria 1250
867 Ga0501084_0863214 3300054114 Bacteria 761
868 Ga0501082_0002186 3300060353 Bacteria 17124
869 Ga0501082_0099402 3300060353 Bacteria 2515
870 Ga0501082_0099595 3300060353 Bacteria 2513
871 Ga0501082_0339571 3300060353 Bacteria 1309
872 Ga0501082_0496709 3300060353 Bacteria 1066
873 Ga0466962_0031346 3300061719 Bacteria 2546
874 Ga0466962_0033694 3300061719 Bacteria 2451
875 Ga0466962_0045698 3300061719 Bacteria 2093
876 Ga0466962_0095605 3300061719 Bacteria 1424
877 Ga0530510_0000191 3300061734 Bacteria 37694
878 Ga0530510_0034632 3300061734 Bacteria 3639
879 Ga0530510_0035758 3300061734 Bacteria 3580
880 Ga0530510_0087189 3300061734 Bacteria 2275
881 Ga0081539_10007262
882 JGI25407J50210_10025906
883 JGI25407J50210_10171524
884 Ga0070658_10006819
885 Ga0070658_10023888
886 Ga0070658_10035144
887 Ga0070683_100009167
888 Ga0070683_100029926
889 Ga0070683_100224787
890 Ga0070683_100271041
891 Ga0070683_101017644
892 Ga0070680_100026507
893 Ga0070680_100230664
894 Ga0070680_100392362
895 Ga0070680_100768907
896 Ga0070682_100323808
897 Ga0068868_100600917
898 Ga0070660_100011544
899 Ga0070660_100014170
900 Ga0070660_100734502
901 Ga0070660_101036501
902 Ga0070691_10028261
903 Ga0070691_10651425
904 Ga0070661_100027180
905 Ga0070661_101500299
906 Ga0070668_100265072
907 Ga0070675_100768792
908 Ga0070671_100072585
909 Ga0070671_100308440
910 Ga0070674_100071521
911 Ga0070673_101840670
912 Ga0070688_100743269
913 Ga0070659_100310994
914 Ga0070659_101460372
915 Ga0070709_10011736
916 Ga0070709_10014329
917 Ga0070714_100310252
918 Ga0070714_100441966
919 Ga0070714_100605311
920 Ga0070714_100761190
921 Ga0070714_101478049
922 Ga0070714_101752908
923 Ga0070713_100001898
924 Ga0070713_100183075
925 Ga0070713_101863309
926 Ga0070710_10003777
927 Ga0070710_10004714
928 Ga0070710_10909947
929 Ga0070711_100036621
930 Ga0070711_100081722
931 Ga0070711_100436779
932 Ga0070711_101792625
933 Ga0070705_100588960
934 Ga0070705_100592249
935 Ga0070708_101197453
936 Ga0070678_100414645
937 Ga0070678_100531623
938 Ga0070681_10025398
939 Ga0070681_10047166
940 Ga0070681_10068399
941 Ga0070681_10125740
942 Ga0070681_11312189
943 Ga0070681_11616731
944 Ga0068867_100238754
945 Ga0070707_100000819
946 Ga0070707_100190504
947 Ga0070707_100638159
948 Ga0070698_100007710
949 Ga0070698_100400551
950 Ga0070698_100453882
951 Ga0070699_101098545
952 Ga0070679_100058919
953 Ga0070679_100075673
954 Ga0070679_100093878
955 Ga0070679_100112544
956 Ga0070679_100341505
957 Ga0070679_100408937
958 Ga0070679_100474295
959 Ga0070679_101012943
960 Ga0070684_100002789
961 Ga0070684_100003984
962 Ga0070684_100010471
963 Ga0070684_100679126
964 Ga0070684_101150517
965 Ga0070684_101677181
966 Ga0070684_101682910
967 Ga0070686_100552854
968 Ga0070695_100000009
969 Ga0070695_100403916
970 Ga0070693_100185962
971 Ga0070693_100189090
972 Ga0070704_100037956
973 Ga0070704_100756452
974 Ga0070704_101136161
975 Ga0068855_100050260
976 Ga0068855_100218300
977 Ga0068855_101506345
978 Ga0068855_101646893
979 Ga0070664_100197096
980 Ga0068857_100019684
981 Ga0068857_100087165
982 Ga0068857_100096390
983 Ga0068857_101567747
984 Ga0068856_100030722
985 Ga0068856_100130493
986 Ga0068856_100218195
987 Ga0068856_100233065
988 Ga0068852_100367398
989 Ga0068852_100670591
990 Ga0068859_100805153
991 Ga0068861_101066669
992 Ga0068870_10191947
993 Ga0068863_100109515
994 Ga0068863_100921552
995 Ga0068858_100431743
996 Ga0068858_100515829
997 Ga0068862_100805324
998 Ga0081455_10020306
999 Ga0081455_10051277
1000 Ga0081455_10094671
1001 Ga0081455_10656903
1002 Ga0081538_10000184
1003 Ga0081538_10000747
1004 Ga0081538_10002355
1005 Ga0081538_10003921
1006 Ga0081538_10007045
1007 Ga0081538_10111858
1008 Ga0081539_10002546
1009 Ga0070717_10011983
1010 Ga0070717_10016859
1011 Ga0070717_10068575
1012 Ga0070717_11048646
1013 Ga0075364_10032208
1014 Ga0075432_10256179
1015 Ga0070715_10001428
1016 Ga0070716_100042776
1017 Ga0070716_100080960
1018 Ga0070712_100142738
1019 Ga0070712_100917833
1020 Ga0070712_101159745
1021 Ga0070712_101209127
1022 Ga0070712_101426090
1023 Ga0075367_10750049
1024 Ga0075428_101865935
1025 Ga0075430_100115037
1026 Ga0075430_100126820
1027 Ga0075430_100142852
1028 Ga0075431_100159176
1029 Ga0075431_100514808
1030 Ga0075434_100006605
1031 Ga0075434_100220697
1032 Ga0075429_100035831
1033 Ga0075429_100083291
1034 Ga0075429_100600729
1035 Ga0075429_101567725
1036 Ga0068865_101441673
1037 Ga0075436_100008175
1038 Ga0097620_100805208
1039 Ga0105250_10309036
1040 Ga0105240_10026690
1041 Ga0105240_10069913
1042 Ga0105240_10116638
1043 Ga0105240_11457818
1044 Ga0111539_10024633
1045 Ga0111539_10292969
1046 Ga0111539_10321659
1047 Ga0111539_10842433
1048 Ga0105245_10076725
1049 Ga0105245_10107661
1050 Ga0105245_10122893
1051 Ga0105245_10172064
1052 Ga0105245_10246373
1053 Ga0105245_10612015
1054 Ga0105245_11072596
1055 Ga0105245_11266565
1056 Ga0105247_10336543
1057 Ga0105247_11189376
1058 Ga0114129_10034292
1059 Ga0114129_10205785
1060 Ga0114129_10452095
1061 Ga0114129_10964063
1062 Ga0114129_11177497
1063 Ga0105243_10188544
1064 Ga0105243_10820727
1065 Ga0105243_11379359
1066 Ga0105242_10295051
1067 Ga0105242_10470310
1068 Ga0105248_10102389
1069 Ga0105248_10377289
1070 Ga0105248_10918848
1071 Ga0105248_11279507
1072 Ga0105248_13342220
1073 Ga0105237_10028651
1074 Ga0105237_10947543
1075 Ga0105237_11138383
1076 Ga0105237_11540882
1077 Ga0105238_10060481
1078 Ga0105238_11529742
1079 Ga0105238_12539930
1080 Ga0105249_10667262
1081 Ga0105249_12689451
1082 Ga0105239_10207157
1083 Ga0105246_10736852
1084 Ga0157370_10009301
1085 Ga0157370_10874560
1086 Ga0157369_10077611
1087 Ga0157369_10139208
1088 Ga0157369_10233255
1089 Ga0157369_10518379
1090 Ga0157369_11761259
1091 Ga0157374_10181649
1092 Ga0157374_11748577
1093 Ga0163162_10181667
1094 Ga0163162_10428208
1095 Ga0163162_11815736
1096 Ga0157372_10080638
1097 Ga0157372_10230787
1098 Ga0157372_10288236
1099 Ga0157372_12700909
1100 Ga0157375_10147472
1101 Ga0157375_11521021
1102 Ga0163163_10799460
1103 Ga0182008_10004028
1104 Ga0182008_10107544
1105 Ga0182008_10210060
1106 Ga0182008_10350340
1107 Ga0157376_10011746
1108 Ga0182006_1089958
1109 Ga0182007_10012283
1110 Ga0182007_10087275
1111 Ga0206356_10039275
1112 Ga0206356_11094341
1113 Ga0206353_11654778
1114 Ga0207692_10006002
1115 Ga0207692_10148245
1116 Ga0207710_10649691
1117 Ga0207688_10260366
1118 Ga0207685_10055183
1119 Ga0207699_10320994
1120 Ga0207699_10846834
1121 Ga0207643_10014388
1122 Ga0207705_10649966
1123 Ga0207684_11020441
1124 Ga0207707_10085050
1125 Ga0207707_10182036
1126 Ga0207707_10277293
1127 Ga0207707_10620505
1128 Ga0207695_10099689
1129 Ga0207695_10706590
1130 Ga0207695_10921362
1131 Ga0207671_10404850
1132 Ga0207671_11142717
1133 Ga0207671_11212355
1134 Ga0207671_11357287
1135 Ga0207693_10008691
1136 Ga0207693_10020559
1137 Ga0207693_10023372
1138 Ga0207693_10199756
1139 Ga0207693_10501356
1140 Ga0207693_10913296
1141 Ga0207693_11345695
1142 Ga0207663_10018096
1143 Ga0207663_10019046
1144 Ga0207663_10874705
1145 Ga0207660_10013739
1146 Ga0207660_10047498
1147 Ga0207660_11497786
1148 Ga0207657_10009493
1149 Ga0207657_10010764
1150 Ga0207649_10578928
1151 Ga0207649_11072630
1152 Ga0207652_10121275
1153 Ga0207652_10126062
1154 Ga0207652_10146163
1155 Ga0207652_10623834
1156 Ga0207652_10774094
1157 Ga0207646_10003137
1158 Ga0207646_11412286
1159 Ga0207659_11255334
1160 Ga0207659_11918662
1161 Ga0207687_10251171
1162 Ga0207687_10751348
1163 Ga0207687_11172726
1164 Ga0207687_11741949
1165 Ga0207700_10056430
1166 Ga0207700_10168108
1167 Ga0207700_11648148
1168 Ga0207664_10008513
1169 Ga0207664_10011230
1170 Ga0207664_10111773
1171 Ga0207664_10254735
1172 Ga0207664_10294149
1173 Ga0207664_10367334
1174 Ga0207644_11131312
1175 Ga0207690_11105923
1176 Ga0207706_10056281
1177 Ga0207686_10098448
1178 Ga0207686_10411914
1179 Ga0207709_11270091
1180 Ga0207669_10284081
1181 Ga0207665_10002129
1182 Ga0207711_10178680
1183 Ga0207661_10024653
1184 Ga0207661_10564157
1185 Ga0207661_10579051
1186 Ga0207661_10696826
1187 Ga0207661_12014090
1188 Ga0207679_10095255
1189 Ga0207679_10131590
1190 Ga0207667_10993833
1191 Ga0207667_11152418
1192 Ga0207667_12171805
1193 Ga0207712_10357492
1194 Ga0207677_11199468
1195 Ga0207703_10843580
1196 Ga0207702_10050786
1197 Ga0207702_10113566
1198 Ga0207702_10138719
1199 Ga0207702_10685498
1200 Ga0207641_10088835
1201 Ga0207648_10420659
1202 Ga0207674_10002484
1203 Ga0207674_10028403
1204 Ga0207674_10155333
1205 Ga0207674_10430949
1206 Ga0207674_11525931
1207 Ga0207675_100849544
1208 Ga0207683_10316104
1209 Ga0207698_11509898
1210 Ga0207428_10105547
1211 Ga0268265_10915959
1212 Ga0265319_1232339
1213 Ga0265336_10009011
1214 Ga0265338_10002905
1215 Ga0307413_10227287
1216 Ga0307413_12061062
1217 Ga0307407_10239896
1218 Ga0307407_11400709
1219 Ga0307412_11689563
1220 Ga0307409_100066010
1221 Ga0307409_100391265
1222 Ga0307416_100056460
1223 Ga0307416_101505978
1224 Ga0307415_100037113
1225 Ga0373936_0112682
1226 Ga0373931_0102191
1227 Ga0373935_0240375
1228 Ga0373935_0355061
1229 Ga0373947_0302527
1230 Ga0373937_0520878
1231 Ga0395899_0002411
1232 Ga0395899_0031639
1233 Ga0395899_0058497
1234 Ga0395899_0321583
1235 Ga0395899_0347559
1236 Ga0395899_0381515
1237 Ga0395900_0015039
1238 Ga0395900_0016859
1239 Ga0395900_0026672
1240 Ga0395900_0046334
1241 Ga0395900_0098676
1242 Ga0395900_0116389
1243 Ga0395900_0145888
1244 Ga0395900_0198342
1245 Ga0395900_0391565
1246 Ga0395900_0392546
1247 Ga0395900_0602320
1248 Ga0395900_1027484
1249 Ga0395900_1562722
1250 Ga0395900_1633065
1251 Ga0395898_0005964
1252 Ga0395898_0010490
1253 Ga0395898_0020626
1254 Ga0395898_0035987
1255 Ga0395898_0042077
1256 Ga0395898_0251346
1257 Ga0395898_0295587
1258 Ga0395898_0526726
1259 Ga0395898_0563497
1260 Ga0395898_0796234
1261 Ga0395898_0976856
1262 Ga0395898_1074671
1263 Ga0395905_0021372
1264 Ga0395905_0033208
1265 Ga0395905_0195787
1266 Ga0395905_0275419
1267 Ga0395905_0278542
1268 Ga0395905_0398685
1269 Ga0395905_0426983
1270 Ga0395905_0515519
1271 Ga0395905_1104211
1272 Ga0395905_1158925
1273 Ga0395905_1248993
1274 Ga0395901_0001730
1275 Ga0395901_0004281
1276 Ga0395901_0010470
1277 Ga0395901_0015802
1278 Ga0395901_0070123
1279 Ga0395901_0127794
1280 Ga0395901_0291942
1281 Ga0395901_0293960
1282 Ga0395901_0361120
1283 Ga0395901_0366132
1284 Ga0395901_0439071
1285 Ga0395901_0788115
1286 Ga0395901_1064239
1287 Ga0395901_1910902
1288 Ga0436363_0438143
1289 Ga0436363_1655099
1290 Ga0439438_059950
1291 Ga0439461_0198355
1292 Ga0451791_1724365
1293 Ga0451845_0704111
1294 Ga0451853_2233860
1295 Ga0439445_0117000
1296 Ga0439449_0330317
1297 Ga0439464_0171767
1298 Ga0439460_0313418
1299 Ga0450918_034132
1300 Ga0466969_0077276
1301 Ga0466969_0098555
1302 Ga0466972_0024827
1303 Ga0466965_0063247
1304 Ga0466965_0115741
1305 Ga0466965_0795297
1306 Ga0466966_0008968
1307 Ga0466966_0049950
1308 Ga0466961_0003397
1309 Ga0466961_0132303
1310 Ga0466961_0207291
1311 Ga0466963_0005916
1312 Ga0466963_0007929
1313 Ga0466963_0021952
1314 Ga0466963_0060709
1315 Ga0466963_0063407
1316 Ga0466963_0120699
1317 Ga0466963_0139871
1318 Ga0466963_0264239
1319 Ga0466963_0724772
1320 Ga0466964_0005301
1321 Ga0466964_0012711
1322 Ga0466964_0019735
1323 Ga0466964_0066236
1324 Ga0466964_0081695
1325 Ga0466964_0115124
1326 Ga0466964_0439356
1327 Ga0466964_0445748
1328 Ga0466964_0808823
1329 Ga0466971_0001034
1330 Ga0466971_0013313
1331 Ga0466971_0076211
1332 Ga0466971_0121251
1333 Ga0466968_0003414
1334 Ga0466968_0010182
1335 Ga0466968_0047138
1336 Ga0466968_0141050
1337 Ga0466968_0182082
1338 Ga0466968_0254272
1339 Ga0466970_0160019
1340 Ga0466957_0002287
1341 Ga0466957_0036114
1342 Ga0466957_0091545
1343 Ga0466957_0094593
1344 Ga0466957_0169697
1345 Ga0466957_0301668
1346 Ga0466960_0014345
1347 Ga0466960_0031867
1348 Ga0466960_0757507
1349 Ga0466959_0001467
1350 Ga0466959_0002306
1351 Ga0466959_0674705
1352 Ga0466958_0036288
1353 Ga0466958_0038426
1354 Ga0466958_0047613
1355 Ga0466958_0052618
1356 Ga0466958_0158614
1357 Ga0466958_0257172
1358 Ga0466967_0000602
1359 Ga0466967_0001349
1360 Ga0466967_0032464
1361 Ga0466967_0039396
1362 Ga0466967_0055383
1363 Ga0466967_0083108
1364 Ga0466967_0086927
1365 Ga0466967_0098577
1366 Ga0466967_0101712
1367 Ga0466967_0110092
1368 Ga0466967_0122553
1369 Ga0466967_0162735
1370 Ga0466967_0473308
1371 Ga0466967_0769062
1372 Ga0466967_1163475
1373 Ga0466967_2401569
1374 Ga0495592_0077201
1375 Ga0495592_0237019
1376 Ga0495592_0383032
1377 Ga0495603_0148007
1378 Ga0495629_0095764
1379 Ga0495629_0099393
1380 Ga0495641_0009111
1381 Ga0495641_0032020
1382 Ga0495641_0065957
1383 Ga0495641_0191704
1384 Ga0495641_0227778
1385 Ga0495641_0243097
1386 Ga0495651_0107736
1387 Ga0495651_0325319
1388 Ga0495651_0635580
1389 Ga0495651_0803713
1390 Ga0495653_0033712
1391 Ga0495653_0034462
1392 Ga0495653_0099046
1393 Ga0495653_0181593
1394 Ga0495653_0389363
1395 Ga0495653_0410521
1396 Ga0495580_0732371
1397 Ga0495582_0092313
1398 Ga0495605_0260286
1399 Ga0495664_0049809
1400 Ga0495664_0185437
1401 Ga0495664_0450768
1402 Ga0495585_0051106
1403 Ga0495596_0157621
1404 Ga0495607_0049949
1405 Ga0495607_0077240
1406 Ga0495608_0035123
1407 Ga0495608_0097069
1408 Ga0495608_0227286
1409 Ga0495608_0279069
1410 Ga0495608_0890426
1411 Ga0495618_0142277
1412 Ga0495618_0187967
1413 Ga0495618_0229465
1414 Ga0495618_0296129
1415 Ga0495618_0388755
1416 Ga0495628_0139628
1417 Ga0495628_0209349
1418 Ga0495628_1153956
1419 Ga0495630_0113983
1420 Ga0495630_0244684
1421 Ga0495630_0928068
1422 Ga0495630_1134091
1423 Ga0495637_0096930
1424 Ga0495644_0019710
1425 Ga0495642_0232982
1426 Ga0495652_0024347
1427 Ga0495652_0209574
1428 Ga0495640_0181423
1429 Ga0495640_0374373
1430 Ga0495586_0002329
1431 Ga0495587_0037387
1432 Ga0495645_0131891
1433 Ga0495645_0183865
1434 Ga0495645_0229756
1435 Ga0495667_0054984
1436 Ga0495667_0327229
1437 Ga0495667_0561778
1438 Ga0495656_0001684
1439 Ga0495656_0130155
1440 Ga0495656_0415058
1441 Ga0495634_0310045
1442 Ga0495634_0376038
1443 Ga0495634_0400167
1444 Ga0495634_0477608
1445 Ga0495611_0025198
1446 Ga0495635_0018122
1447 Ga0495635_0299988
1448 Ga0495661_0298603
1449 Ga0495657_0015450
1450 Ga0495657_0059425
1451 Ga0495657_0127289
1452 Ga0495599_0028273
1453 Ga0495623_0098893
1454 Ga0495646_0025801
1455 Ga0495658_0080923
1456 Ga0495669_0308932
1457 Ga0495613_0311274
1458 Ga0495613_0797052
1459 Ga0495624_0008048
1460 Ga0495624_0075064
1461 Ga0495624_0440241
1462 Ga0495670_0333881
1463 Ga0495589_0034291
1464 Ga0495589_0497054
1465 Ga0495600_0027831
1466 Ga0495600_0149672
1467 Ga0495600_0460786
1468 Ga0495581_0637502
1469 Ga0495604_0197669
1470 Ga0495604_0536353
1471 Ga0495636_0147460
1472 Ga0495636_0455277
1473 Ga0495674_0024505
1474 Ga0495674_0059113
1475 Ga0495674_0141769
1476 Ga0495674_0320248
1477 Ga0495674_0424085
1478 Ga0495674_0425528
1479 Ga0495674_0512956
1480 Ga0495676_0356906
1481 Ga0495676_0549670
1482 Ga0495676_0707868
1483 Ga0495676_1041327
1484 Ga0495680_0025389
1485 Ga0495680_0245197
1486 Ga0495680_0302145
1487 Ga0495680_0491831
1488 Ga0495680_0655774
1489 Ga0495680_0804026
1490 Ga0495679_121713
1491 Ga0495684_0010240
1492 Ga0495684_0898895
1493 Ga0495602_0052083
1494 Ga0495602_1118832
1495 Ga0496100_0229182
1496 Ga0496100_0391344
1497 Ga0496100_0877506
1498 Ga0496101_0014002
1499 Ga0496101_0046419
1500 Ga0496101_0172860
1501 Ga0496101_0804188
1502 Ga0496101_1116828
1503 Ga0496101_1522938
1504 Ga0496102_0048673
1505 Ga0496102_0088932
1506 Ga0496103_0091335
1507 Ga0496103_0110790
1508 Ga0496103_0257853
1509 Ga0496103_0577177
1510 Ga0496104_0002284
1511 Ga0496104_0007845
1512 Ga0496104_0046059
1513 Ga0496104_0138664
1514 Ga0496104_0148959
1515 Ga0496104_0308234
1516 Ga0496104_0961117
1517 Ga0496105_0004123
1518 Ga0496105_0008437
1519 Ga0496105_0015296
1520 Ga0496105_0034045
1521 Ga0496105_0044517
1522 Ga0496106_0383796
1523 Ga0496106_0440479
1524 Ga0496106_0827978
1525 Ga0496106_0890427
1526 Ga0496107_0021170
1527 Ga0496107_0026969
1528 Ga0496108_0020386
1529 Ga0496108_0048468
1530 Ga0496108_0052069
1531 Ga0496108_0059540
1532 Ga0496108_0520407
1533 Ga0496108_1002355
1534 Ga0496108_1066078
1535 Ga0496109_0003748
1536 Ga0496109_0010639
1537 Ga0496109_0056298
1538 Ga0496109_0079705
1539 Ga0496109_0085715
1540 Ga0496109_0303329
1541 Ga0496109_0452968
1542 Ga0496109_1990466
1543 Ga0496110_0007489
1544 Ga0496110_0134108
1545 Ga0496110_0275284
1546 Ga0496110_1270509
1547 Ga0496111_0003137
1548 Ga0496111_0007042
1549 Ga0496111_0366270
1550 Ga0496111_0382810
1551 Ga0496111_0411727
1552 Ga0496111_0677007
1553 Ga0496111_0890766
1554 Ga0496112_0002474
1555 Ga0496112_0342251
1556 Ga0496113_0004105
1557 Ga0496113_0161857
1558 Ga0496113_0466128
1559 Ga0496113_0809187
1560 Ga0496114_0037319
1561 Ga0496114_0045517
1562 Ga0496114_0068075
1563 Ga0496114_0252648
1564 Ga0496114_1043679
1565 Ga0496115_0117621
1566 Ga0496115_0141011
1567 Ga0496115_0155518
1568 Ga0496115_1197847
1569 Ga0501031_0000423
1570 Ga0501031_0528448
1571 Ga0501031_0911377
1572 Ga0501032_0002185
1573 Ga0501032_0136528
1574 Ga0501033_0004428
1575 Ga0501033_0019459
1576 Ga0501033_0150382
1577 Ga0501034_0036109
1578 Ga0501036_0001079
1579 Ga0501036_0049827
1580 Ga0501036_0133549
1581 Ga0501036_0936060
1582 Ga0501037_0000071
1583 Ga0501037_0002387
1584 Ga0501038_0000282
1585 Ga0501038_0007028
1586 Ga0501038_0450746
1587 Ga0501038_0688485
1588 Ga0501039_0001238
1589 Ga0501039_0014170
1590 Ga0501039_0083543
1591 Ga0501039_0341164
1592 Ga0501039_0982386
1593 Ga0501040_0025089
1594 Ga0501040_0031551
1595 Ga0501040_0075251
1596 Ga0501040_0125804
1597 Ga0501040_0615933
1598 Ga0501041_0002075
1599 Ga0501041_0007528
1600 Ga0501041_0018197
1601 Ga0501041_0034437
1602 Ga0501041_0234508
1603 Ga0501041_0443998
1604 Ga0501041_0668056
1605 Ga0501042_0006730
1606 Ga0501042_0025268
1607 Ga0501042_0046434
1608 Ga0501042_0344587
1609 Ga0501043_0001377
1610 Ga0501043_0004913
1611 Ga0501043_0365987
1612 Ga0501046_0000812
1613 Ga0501046_0051117
1614 Ga0501046_0935066
1615 Ga0501047_0943470
1616 Ga0501047_1212991
1617 Ga0501048_0003425
1618 Ga0501048_0059562
1619 Ga0501048_0064591
1620 Ga0501048_0274177
1621 Ga0501048_0620134
1622 Ga0501067_0227473
1623 Ga0501067_0245688
1624 Ga0501068_0000165
1625 Ga0501068_0001860
1626 Ga0501069_0000359
1627 Ga0501069_0010689
1628 Ga0501069_0221462
1629 Ga0501069_0262565
1630 Ga0501070_0006865
1631 Ga0501070_0007343
1632 Ga0501070_0439205
1633 Ga0501070_0837541
1634 Ga0501071_0002486
1635 Ga0501071_0006169
1636 Ga0501071_0062693
1637 Ga0501071_0082827
1638 Ga0501071_0187402
1639 Ga0501071_0311465
1640 Ga0501071_0396485
1641 Ga0501072_0000494
1642 Ga0501072_0037578
1643 Ga0501072_0134747
1644 Ga0501072_0349184
1645 Ga0501073_0001985
1646 Ga0501074_0006393
1647 Ga0501074_0018894
1648 Ga0501075_0000105
1649 Ga0501075_0011622
1650 Ga0501075_0025617
1651 Ga0501075_0088741
1652 Ga0501075_0247481
1653 Ga0501075_0265391
1654 Ga0501075_1235974
1655 Ga0501076_0070460
1656 Ga0501076_0198124
1657 Ga0501076_0495893
1658 Ga0501076_0685033
1659 Ga0501076_0973769
1660 Ga0501076_1560945
1661 Ga0501076_1784505
1662 Ga0501077_0000128
1663 Ga0501077_0241843
1664 Ga0501077_0311612
1665 Ga0501209_296356
1666 Ga0501079_0050948
1667 Ga0501079_0067187
1668 Ga0501079_0087521
1669 Ga0501079_0348203
1670 Ga0501079_0775869
1671 Ga0501080_0013924
1672 Ga0501080_0018014
1673 Ga0501080_0326723
1674 Ga0501080_0636533
1675 Ga0501081_0003084
1676 Ga0501081_0032217
1677 Ga0501081_0037395
1678 Ga0501081_0047880
1679 Ga0501081_0071197
1680 Ga0501081_0583888
1681 Ga0501081_0634363
1682 Ga0501083_0000352
1683 Ga0501035_0000978
1684 Ga0501035_0005703
1685 Ga0501044_0002766
1686 Ga0501044_0023380
1687 Ga0501045_0009549
1688 Ga0501045_0013003
1689 Ga0501045_0013979
1690 Ga0501045_0029991
1691 Ga0501045_0296478
1692 Ga0501045_0401695
1693 Ga0501045_0489380
1694 Ga0501045_0769471
1695 nmdc:mga03683_103721_c1
1696 nmdc:mga00v17_51181_c1
1697 nmdc:mga05p37_103565_c1
1698 nmdc:mga05p37_1277886_c1
1699 nmdc:mga05p37_42344_c1
1700 nmdc:mga05p37_95385_c2
1701 nmdc:mga05p37_985944_c1
1702 nmdc:mga09592_1586943_c1
1703 nmdc:mga09592_15894_c1
1704 nmdc:mga09592_192471_c1
1705 nmdc:mga09592_71908_c1
1706 nmdc:mga0qj67_32355_c1
1707 nmdc:mga0qj67_446629_c1
1708 nmdc:mga0qj67_581736_c1
1709 nmdc:mga06r32_1600101_c1
1710 nmdc:mga06r32_241545_c1
1711 nmdc:mga06r32_584775_c1
1712 nmdc:mga06r32_84192_c1
1713 nmdc:mga08y16_72940_c1
1714 nmdc:mga0n895_157150_c1
1715 nmdc:mga0n895_15818_c1
1716 nmdc:mga0n895_746116_c1
1717 nmdc:mga0rr50_15135_c1
1718 nmdc:mga0rr50_1743113_c1
1719 nmdc:mga0rr50_251020_c1
1720 nmdc:mga08x19_52751_c1
1721 nmdc:mga0a205_97257_c1
1722 Ga0495601_0175044
1723 Ga0495601_0181190
1724 Ga0495601_0526455
1725 Ga0495601_0707466
1726 Ga0495612_0018627
1727 Ga0495612_0114812
1728 Ga0495612_0479819
1729 Ga0495595_0005713
1730 Ga0495595_0061965
1731 Ga0495595_0095061
1732 Ga0495595_0132982
1733 Ga0495595_0481083
1734 Ga0495619_0007503
1735 Ga0495619_0268066
1736 Ga0495619_0472507
1737 Ga0495619_0832103
1738 Ga0495619_0840192
1739 Ga0495619_0914927
1740 Ga0501084_0001813
1741 Ga0501084_0036271
1742 Ga0501084_0061892
1743 Ga0501084_0082209
1744 Ga0501084_0097848
1745 Ga0501084_0109045
1746 Ga0501084_0348953
1747 Ga0501084_0863214
1748 Ga0501082_0002186
1749 Ga0501082_0099402
1750 Ga0501082_0099595
1751 Ga0501082_0339571
1752 Ga0501082_0496709
1753 Ga0466962_0031346
1754 Ga0466962_0033694
1755 Ga0466962_0045698
1756 Ga0466962_0095605
1757 Ga0530510_0000191
1758 Ga0530510_0034632
1759 Ga0530510_0035758
1760 Ga0530510_0087189

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13456

RVT_3

Reverse transcriptase-like

3

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9884 1 130
3hst-assembly2.cif.gz_B n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9865 1 131
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9735 1 130
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.9685 1 131
4h8k-assembly1.cif.gz_B crystal structure of lc11-rnase h1 in complex with rna/dna hybrid 0.958 3 131
ID Description Score Start End Superfamily
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9884 1 130 3.30.420.10
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9832 2 131 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9735 1 130 3.30.420.10
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9697 3 130 3.30.420.10
3u3gA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9574 2 131 3.30.420.10
ID Description Score Start End GO Terms
AF-X0V5Y7-F1-model_v4 RNase H type-1 domain-containing protein 0.9936 3 84 GO:0003676
GO:0004523
AF-A0A538U4U4-F1-model_v4 Ribonuclease HI family protein 0.9895 3 114 GO:0003676
GO:0004523
AF-A0A518LQG6-F1-model_v4 14.7 kDa ribonuclease H-like protein 0.9894 1 131 GO:0003676
GO:0004523
AF-A0A0F0CJ98-F1-model_v4 Ribonuclease HI 0.9885 2 131 GO:0003676
GO:0004523
AF-A0A523TY04-F1-model_v4 Ribonuclease HI family protein 0.9881 2 131 GO:0003676
GO:0004523

Map