F484466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 879 | 321 | 880 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_2135091|Ga0451807_2135091_204_572 |
| Length | 122 |
| Sequence | VFINTPLGDGGKHPSXXXXMNWGMKNPINGLNKVFDNRIRLGVMSVLMVNEEVNFNDLKQMLEVTDGNLATHLVNLEDNGYIKVHKGFIGRKTNTTYAVTKTGEKAFSDHIAALENMIKGVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 206 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 215 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 216 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 223 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 224 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 225 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 226 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 227 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 273 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 274 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 282 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 283 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 284 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 285 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 292 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 293 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 295 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 299 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 307 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 309 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 310 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 311 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 314 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 316 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 317 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 318 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 319 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 321 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.41 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 92.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6259703 | 2162886012 | Bacteria | 1158 |
| 2 | JGI24740J21852_10014977 | 3300001979 | Bacteria | 2844 |
| 3 | JGI24749J21850_1039359 | 3300002076 | Unclassified | 690 |
| 4 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 5 | JGI25157J39369_1005105 | 3300002741 | Unclassified | 2200 |
| 6 | JGI25153J46596_10001206 | 3300003215 | Bacteria | 15645 |
| 7 | rootH2_10169946 | 3300003320 | Bacteria | 1231 |
| 8 | rootL2_10217998 | 3300003322 | Bacteria | 3674 |
| 9 | rootL2_10347437 | 3300003322 | Bacteria | 1347 |
| 10 | rootL2_10370816 | 3300003322 | Bacteria | 1777 |
| 11 | rootH1_10019517 | 3300003316 | Bacteria | 1426 |
| 12 | rootH1_10019517 | 3300003323 | Bacteria | 4895 |
| 13 | JGI25160J50197_1008388 | 3300003354 | Unclassified | 3942 |
| 14 | Ga0065165_1034982 | 3300005262 | Unclassified | 1547 |
| 15 | Ga0065714_10546582 | 3300005288 | Bacteria | 500 |
| 16 | Ga0065704_10457232 | 3300005289 | Bacteria | 700 |
| 17 | Ga0065712_10008807 | 3300005290 | Bacteria | 2662 |
| 18 | Ga0065712_10427440 | 3300005290 | Unclassified | 706 |
| 19 | Ga0065712_10839525 | 3300005290 | Bacteria | 500 |
| 20 | Ga0065715_10199574 | 3300005293 | Bacteria | 1369 |
| 21 | Ga0065715_10583807 | 3300005293 | Unclassified | 710 |
| 22 | Ga0065715_10970823 | 3300005293 | Bacteria | 553 |
| 23 | Ga0065707_10140963 | 3300005295 | Bacteria | 1773 |
| 24 | Ga0065707_10149320 | 3300005295 | Bacteria | 1673 |
| 25 | Ga0065707_10488707 | 3300005295 | Bacteria | 723 |
| 26 | Ga0065707_10838841 | 3300005295 | Bacteria | 586 |
| 27 | Ga0070676_10007859 | 3300005328 | Bacteria | 5734 |
| 28 | Ga0070676_10020642 | 3300005328 | Bacteria | 3681 |
| 29 | Ga0070676_10232763 | 3300005328 | Bacteria | 1222 |
| 30 | Ga0070676_10436259 | 3300005328 | Bacteria | 918 |
| 31 | Ga0070676_10513734 | 3300005328 | Bacteria | 852 |
| 32 | Ga0070676_10989545 | 3300005328 | Bacteria | 631 |
| 33 | Ga0070683_100035991 | 3300005329 | Bacteria | 4528 |
| 34 | Ga0070683_100059027 | 3300005329 | Bacteria | 3564 |
| 35 | Ga0070683_100393287 | 3300005329 | Bacteria | 1322 |
| 36 | Ga0070683_100434135 | 3300005329 | Bacteria | 1253 |
| 37 | Ga0070690_100012749 | 3300005330 | Bacteria | 4951 |
| 38 | Ga0070690_100024644 | 3300005330 | Bacteria | 3701 |
| 39 | Ga0070690_100078041 | 3300005330 | Bacteria | 2163 |
| 40 | Ga0070670_100071916 | 3300005331 | Bacteria | 2970 |
| 41 | Ga0070670_100196621 | 3300005331 | Bacteria | 1752 |
| 42 | Ga0070670_100417294 | 3300005331 | Bacteria | 1186 |
| 43 | Ga0070670_100438144 | 3300005331 | Bacteria | 1157 |
| 44 | Ga0070670_100666928 | 3300005331 | Bacteria | 934 |
| 45 | Ga0070670_100684610 | 3300005331 | Unclassified | 921 |
| 46 | Ga0070670_100878895 | 3300005331 | Bacteria | 812 |
| 47 | Ga0070677_10054505 | 3300005333 | Bacteria | 1629 |
| 48 | Ga0070677_10141832 | 3300005333 | Bacteria | 1109 |
| 49 | Ga0070677_10407330 | 3300005333 | Unclassified | 718 |
| 50 | Ga0070677_10562623 | 3300005333 | Bacteria | 626 |
| 51 | Ga0068869_100017799 | 3300005334 | Bacteria | 4826 |
| 52 | Ga0068869_100022931 | 3300005334 | Bacteria | 4306 |
| 53 | Ga0068869_100053417 | 3300005334 | Bacteria | 2938 |
| 54 | Ga0068869_100058198 | 3300005334 | Bacteria | 2825 |
| 55 | Ga0068869_100078567 | 3300005334 | Bacteria | 2458 |
| 56 | Ga0068869_100098868 | 3300005334 | Unclassified | 2205 |
| 57 | Ga0070666_10004480 | 3300005335 | Bacteria | 8511 |
| 58 | Ga0070666_10216688 | 3300005335 | Bacteria | 1349 |
| 59 | Ga0070666_10338710 | 3300005335 | Unclassified | 1075 |
| 60 | Ga0070666_10361528 | 3300005335 | Bacteria | 1040 |
| 61 | Ga0070666_10770773 | 3300005335 | Bacteria | 708 |
| 62 | Ga0070682_100000074 | 3300005337 | Bacteria | 91549 |
| 63 | Ga0070682_100004396 | 3300005337 | Bacteria | 7822 |
| 64 | Ga0070682_101222467 | 3300005337 | Bacteria | 635 |
| 65 | Ga0068868_100005937 | 3300005338 | Bacteria | 8612 |
| 66 | Ga0068868_100013130 | 3300005338 | Bacteria | 6067 |
| 67 | Ga0068868_100261978 | 3300005338 | Bacteria | 1458 |
| 68 | Ga0068868_100273456 | 3300005338 | Bacteria | 1428 |
| 69 | Ga0068868_100387346 | 3300005338 | Bacteria | 1204 |
| 70 | Ga0068868_100763262 | 3300005338 | Bacteria | 870 |
| 71 | Ga0068868_101826814 | 3300005338 | Bacteria | 574 |
| 72 | Ga0070689_100014907 | 3300005340 | Bacteria | 5656 |
| 73 | Ga0070689_100024173 | 3300005340 | Bacteria | 4556 |
| 74 | Ga0070689_100025709 | 3300005340 | Bacteria | 4425 |
| 75 | Ga0070689_100040531 | 3300005340 | Bacteria | 3571 |
| 76 | Ga0070687_100013203 | 3300005343 | Unclassified | 3672 |
| 77 | Ga0070661_100019629 | 3300005344 | Bacteria | 4816 |
| 78 | Ga0070661_100110631 | 3300005344 | Bacteria | 2051 |
| 79 | Ga0070661_100218317 | 3300005344 | Bacteria | 1462 |
| 80 | Ga0070661_100720103 | 3300005344 | Bacteria | 814 |
| 81 | Ga0070661_101586447 | 3300005344 | Unclassified | 553 |
| 82 | Ga0070668_100013719 | 3300005347 | Bacteria | 6052 |
| 83 | Ga0070668_100148831 | 3300005347 | Unclassified | 1892 |
| 84 | Ga0070668_100532105 | 3300005347 | Bacteria | 1021 |
| 85 | Ga0070668_101709677 | 3300005347 | Bacteria | 578 |
| 86 | Ga0070669_100004915 | 3300005353 | Bacteria | 9654 |
| 87 | Ga0070669_100055836 | 3300005353 | Bacteria | 2894 |
| 88 | Ga0070669_100068950 | 3300005353 | Bacteria | 2611 |
| 89 | Ga0070669_100617202 | 3300005353 | Unclassified | 910 |
| 90 | Ga0070675_100009178 | 3300005354 | Bacteria | 7681 |
| 91 | Ga0070675_100030573 | 3300005354 | Bacteria | 4348 |
| 92 | Ga0070675_100167024 | 3300005354 | Bacteria | 1896 |
| 93 | Ga0070675_101292958 | 3300005354 | Bacteria | 672 |
| 94 | Ga0070671_100048852 | 3300005355 | Bacteria | 3520 |
| 95 | Ga0070671_100110351 | 3300005355 | Bacteria | 2310 |
| 96 | Ga0070671_100150056 | 3300005355 | Bacteria | 1968 |
| 97 | Ga0070671_100232786 | 3300005355 | Bacteria | 1563 |
| 98 | Ga0070671_100235221 | 3300005355 | Bacteria | 1555 |
| 99 | Ga0070671_101282248 | 3300005355 | Unclassified | 646 |
| 100 | Ga0070674_100317527 | 3300005356 | Bacteria | 1248 |
| 101 | Ga0070674_100484704 | 3300005356 | Bacteria | 1027 |
| 102 | Ga0070673_100028363 | 3300005364 | Bacteria | 4162 |
| 103 | Ga0070673_100112443 | 3300005364 | Bacteria | 2260 |
| 104 | Ga0070673_100346225 | 3300005364 | Bacteria | 1318 |
| 105 | Ga0070673_100380156 | 3300005364 | Bacteria | 1259 |
| 106 | Ga0070673_100895384 | 3300005364 | Unclassified | 823 |
| 107 | Ga0070673_101091602 | 3300005364 | Bacteria | 745 |
| 108 | Ga0070673_101256805 | 3300005364 | Bacteria | 695 |
| 109 | Ga0070673_101281909 | 3300005364 | Unclassified | 688 |
| 110 | Ga0070673_101754742 | 3300005364 | Bacteria | 588 |
| 111 | Ga0070673_102007834 | 3300005364 | Unclassified | 549 |
| 112 | Ga0070688_100007885 | 3300005365 | Bacteria | 5756 |
| 113 | Ga0070688_100008468 | 3300005365 | Bacteria | 5583 |
| 114 | Ga0070688_100021223 | 3300005365 | Bacteria | 3791 |
| 115 | Ga0070688_101357769 | 3300005365 | Bacteria | 575 |
| 116 | Ga0070659_100003078 | 3300005366 | Bacteria | 11846 |
| 117 | Ga0070659_100266940 | 3300005366 | Bacteria | 1421 |
| 118 | Ga0070659_100691773 | 3300005366 | Unclassified | 881 |
| 119 | Ga0070659_100771798 | 3300005366 | Unclassified | 835 |
| 120 | Ga0070667_100008847 | 3300005367 | Bacteria | 8335 |
| 121 | Ga0070667_100112891 | 3300005367 | Bacteria | 2358 |
| 122 | Ga0070667_100136660 | 3300005367 | Bacteria | 2144 |
| 123 | Ga0070667_100577028 | 3300005367 | Bacteria | 1035 |
| 124 | Ga0070667_100638213 | 3300005367 | Bacteria | 983 |
| 125 | Ga0070667_101358270 | 3300005367 | Bacteria | 666 |
| 126 | Ga0070667_101648569 | 3300005367 | Bacteria | 603 |
| 127 | Ga0070667_102162299 | 3300005367 | Bacteria | 524 |
| 128 | Ga0070713_102246801 | 3300005436 | Bacteria | 528 |
| 129 | Ga0070701_10169195 | 3300005438 | Bacteria | 1271 |
| 130 | Ga0070701_10223048 | 3300005438 | Bacteria | 1125 |
| 131 | Ga0070701_10263551 | 3300005438 | Unclassified | 1045 |
| 132 | Ga0070701_10470025 | 3300005438 | Bacteria | 811 |
| 133 | Ga0070711_101177192 | 3300005439 | Unclassified | 662 |
| 134 | Ga0070705_100529708 | 3300005440 | Unclassified | 899 |
| 135 | Ga0070700_100288151 | 3300005441 | Unclassified | 1193 |
| 136 | Ga0070700_100495782 | 3300005441 | Bacteria | 938 |
| 137 | Ga0070700_101228894 | 3300005441 | Bacteria | 627 |
| 138 | Ga0070700_101462030 | 3300005441 | Unclassified | 580 |
| 139 | Ga0070694_100984849 | 3300005444 | Bacteria | 699 |
| 140 | Ga0070663_100123580 | 3300005455 | Bacteria | 1958 |
| 141 | Ga0070678_100018654 | 3300005456 | Bacteria | 4501 |
| 142 | Ga0070678_100035603 | 3300005456 | Bacteria | 3478 |
| 143 | Ga0070678_101137725 | 3300005456 | Bacteria | 722 |
| 144 | Ga0070678_101400438 | 3300005456 | Bacteria | 653 |
| 145 | Ga0070662_100010383 | 3300005457 | Bacteria | 6106 |
| 146 | Ga0070662_100023417 | 3300005457 | Bacteria | 4241 |
| 147 | Ga0070662_100078135 | 3300005457 | Bacteria | 2458 |
| 148 | Ga0070662_100123997 | 3300005457 | Bacteria | 1983 |
| 149 | Ga0070662_101071192 | 3300005457 | Bacteria | 691 |
| 150 | Ga0068867_100025237 | 3300005459 | Bacteria | 4264 |
| 151 | Ga0068867_100054133 | 3300005459 | Bacteria | 2964 |
| 152 | Ga0068867_100133752 | 3300005459 | Unclassified | 1930 |
| 153 | Ga0068867_100170091 | 3300005459 | Bacteria | 1725 |
| 154 | Ga0068867_100219713 | 3300005459 | Bacteria | 1531 |
| 155 | Ga0068867_100316363 | 3300005459 | Bacteria | 1292 |
| 156 | Ga0068867_100664133 | 3300005459 | Unclassified | 916 |
| 157 | Ga0068867_101127578 | 3300005459 | Bacteria | 717 |
| 158 | Ga0070685_10003971 | 3300005466 | Bacteria | 7477 |
| 159 | Ga0070685_10010419 | 3300005466 | Bacteria | 4831 |
| 160 | Ga0070685_10041829 | 3300005466 | Bacteria | 2613 |
| 161 | Ga0070685_10126283 | 3300005466 | Bacteria | 1594 |
| 162 | Ga0070685_10263780 | 3300005466 | Bacteria | 1146 |
| 163 | Ga0070685_10371365 | 3300005466 | Bacteria | 983 |
| 164 | Ga0070685_11485740 | 3300005466 | Bacteria | 522 |
| 165 | Ga0070698_100056168 | 3300005471 | Bacteria | 3990 |
| 166 | Ga0070699_100328589 | 3300005518 | Bacteria | 1375 |
| 167 | Ga0070699_100774410 | 3300005518 | Bacteria | 878 |
| 168 | Ga0070699_101099472 | 3300005518 | Bacteria | 729 |
| 169 | Ga0070679_100009158 | 3300005530 | Bacteria | 9346 |
| 170 | Ga0070684_100000995 | 3300005535 | Bacteria | 20208 |
| 171 | Ga0070684_100007553 | 3300005535 | Bacteria | 8465 |
| 172 | Ga0070684_100054427 | 3300005535 | Bacteria | 3487 |
| 173 | Ga0070684_100375061 | 3300005535 | Bacteria | 1310 |
| 174 | Ga0070684_100376607 | 3300005535 | Bacteria | 1307 |
| 175 | Ga0068853_100004736 | 3300005539 | Bacteria | 10567 |
| 176 | Ga0068853_100509371 | 3300005539 | Bacteria | 1137 |
| 177 | Ga0068853_100537705 | 3300005539 | Bacteria | 1106 |
| 178 | Ga0068853_100553412 | 3300005539 | Unclassified | 1090 |
| 179 | Ga0070672_100074663 | 3300005543 | Bacteria | 2705 |
| 180 | Ga0070672_100496091 | 3300005543 | Bacteria | 1056 |
| 181 | Ga0070672_100607859 | 3300005543 | Unclassified | 953 |
| 182 | Ga0070672_100732556 | 3300005543 | Bacteria | 867 |
| 183 | Ga0070672_101701053 | 3300005543 | Unclassified | 567 |
| 184 | Ga0070672_101718224 | 3300005543 | Bacteria | 564 |
| 185 | Ga0070686_100032440 | 3300005544 | Unclassified | 3203 |
| 186 | Ga0070686_100122814 | 3300005544 | Bacteria | 1785 |
| 187 | Ga0070686_100479820 | 3300005544 | Unclassified | 961 |
| 188 | Ga0070686_100513841 | 3300005544 | Bacteria | 931 |
| 189 | Ga0070695_100649834 | 3300005545 | Bacteria | 833 |
| 190 | Ga0070695_101065316 | 3300005545 | Unclassified | 660 |
| 191 | Ga0070696_100338710 | 3300005546 | Bacteria | 1162 |
| 192 | Ga0070693_100222641 | 3300005547 | Bacteria | 1237 |
| 193 | Ga0070665_100002492 | 3300005548 | Bacteria | 20261 |
| 194 | Ga0070665_100199412 | 3300005548 | Unclassified | 2002 |
| 195 | Ga0070665_100722115 | 3300005548 | Unclassified | 1009 |
| 196 | Ga0070665_101354247 | 3300005548 | Bacteria | 721 |
| 197 | Ga0070704_101567279 | 3300005549 | Bacteria | 607 |
| 198 | Ga0068855_100061427 | 3300005563 | Bacteria | 4391 |
| 199 | Ga0068855_101877061 | 3300005563 | Bacteria | 607 |
| 200 | Ga0070664_100001774 | 3300005564 | Bacteria | 17302 |
| 201 | Ga0070664_100006101 | 3300005564 | Bacteria | 9745 |
| 202 | Ga0070664_100162585 | 3300005564 | Bacteria | 1976 |
| 203 | Ga0070664_100191340 | 3300005564 | Bacteria | 1823 |
| 204 | Ga0070664_101695314 | 3300005564 | Unclassified | 599 |
| 205 | Ga0068857_100026740 | 3300005577 | Bacteria | 5086 |
| 206 | Ga0068857_100035852 | 3300005577 | Bacteria | 4394 |
| 207 | Ga0068857_100113353 | 3300005577 | Bacteria | 2438 |
| 208 | Ga0068857_100185247 | 3300005577 | Bacteria | 1895 |
| 209 | Ga0068857_100215771 | 3300005577 | Bacteria | 1751 |
| 210 | Ga0068857_100295426 | 3300005577 | Unclassified | 1493 |
| 211 | Ga0068857_100442603 | 3300005577 | Bacteria | 1214 |
| 212 | Ga0068857_100599055 | 3300005577 | Bacteria | 1042 |
| 213 | Ga0068857_100806248 | 3300005577 | Bacteria | 897 |
| 214 | Ga0068857_101144879 | 3300005577 | Bacteria | 752 |
| 215 | Ga0068854_100020807 | 3300005578 | Bacteria | 4445 |
| 216 | Ga0068854_101258726 | 3300005578 | Bacteria | 665 |
| 217 | Ga0068856_102227666 | 3300005614 | Bacteria | 557 |
| 218 | Ga0070702_100464833 | 3300005615 | Bacteria | 921 |
| 219 | Ga0068852_100307303 | 3300005616 | Bacteria | 1537 |
| 220 | Ga0068852_101290221 | 3300005616 | Unclassified | 752 |
| 221 | Ga0068859_100002822 | 3300005617 | Bacteria | 17618 |
| 222 | Ga0068859_100029450 | 3300005617 | Bacteria | 5508 |
| 223 | Ga0068859_100091945 | 3300005617 | Bacteria | 3085 |
| 224 | Ga0068859_100118674 | 3300005617 | Bacteria | 2711 |
| 225 | Ga0068859_100222328 | 3300005617 | Bacteria | 1976 |
| 226 | Ga0068859_100308909 | 3300005617 | Bacteria | 1675 |
| 227 | Ga0068859_100795581 | 3300005617 | Bacteria | 1033 |
| 228 | Ga0068864_100023594 | 3300005618 | Bacteria | 5168 |
| 229 | Ga0068864_100189701 | 3300005618 | Bacteria | 1884 |
| 230 | Ga0068864_100769360 | 3300005618 | Unclassified | 945 |
| 231 | Ga0068864_101424500 | 3300005618 | Unclassified | 695 |
| 232 | Ga0068864_101688576 | 3300005618 | Bacteria | 638 |
| 233 | Ga0068864_101889295 | 3300005618 | Bacteria | 603 |
| 234 | Ga0068866_10008998 | 3300005718 | Bacteria | 4229 |
| 235 | Ga0068861_100001772 | 3300005719 | Bacteria | 13883 |
| 236 | Ga0068861_100017269 | 3300005719 | Bacteria | 5118 |
| 237 | Ga0068861_100044377 | 3300005719 | Bacteria | 3343 |
| 238 | Ga0068861_100258144 | 3300005719 | Unclassified | 1490 |
| 239 | Ga0068861_100290374 | 3300005719 | Bacteria | 1412 |
| 240 | Ga0068861_100412765 | 3300005719 | Bacteria | 1201 |
| 241 | Ga0068861_100550602 | 3300005719 | Unclassified | 1051 |
| 242 | Ga0068861_101593426 | 3300005719 | Bacteria | 643 |
| 243 | Ga0068861_101951319 | 3300005719 | Unclassified | 585 |
| 244 | Ga0068861_102253362 | 3300005719 | Unclassified | 546 |
| 245 | Ga0068851_10262209 | 3300005834 | Bacteria | 983 |
| 246 | Ga0068870_10230219 | 3300005840 | Unclassified | 1139 |
| 247 | Ga0068870_10857559 | 3300005840 | Unclassified | 639 |
| 248 | Ga0068863_100030815 | 3300005841 | Bacteria | 5122 |
| 249 | Ga0068863_100047050 | 3300005841 | Bacteria | 4093 |
| 250 | Ga0068863_100076286 | 3300005841 | Bacteria | 3171 |
| 251 | Ga0068863_100383849 | 3300005841 | Unclassified | 1372 |
| 252 | Ga0068863_100559999 | 3300005841 | Bacteria | 1129 |
| 253 | Ga0068863_100696940 | 3300005841 | Unclassified | 1009 |
| 254 | Ga0068863_101866351 | 3300005841 | Bacteria | 611 |
| 255 | Ga0068858_100048719 | 3300005842 | Bacteria | 3924 |
| 256 | Ga0068858_100065866 | 3300005842 | Bacteria | 3353 |
| 257 | Ga0068858_100174823 | 3300005842 | Bacteria | 2026 |
| 258 | Ga0068858_100185574 | 3300005842 | Unclassified | 1964 |
| 259 | Ga0068858_100357793 | 3300005842 | Bacteria | 1399 |
| 260 | Ga0068858_101959183 | 3300005842 | Unclassified | 579 |
| 261 | Ga0068860_100204138 | 3300005843 | Bacteria | 1916 |
| 262 | Ga0068860_100261214 | 3300005843 | Bacteria | 1688 |
| 263 | Ga0068860_100345388 | 3300005843 | Unclassified | 1464 |
| 264 | Ga0068860_100587538 | 3300005843 | Bacteria | 1118 |
| 265 | Ga0068860_101084025 | 3300005843 | Bacteria | 820 |
| 266 | Ga0068862_100009580 | 3300005844 | Bacteria | 8007 |
| 267 | Ga0068862_100100885 | 3300005844 | Bacteria | 2524 |
| 268 | Ga0068862_100169160 | 3300005844 | Bacteria | 1956 |
| 269 | Ga0068862_100201988 | 3300005844 | Bacteria | 1793 |
| 270 | Ga0068862_100335512 | 3300005844 | Unclassified | 1399 |
| 271 | Ga0068862_100860558 | 3300005844 | Unclassified | 889 |
| 272 | Ga0068862_102254094 | 3300005844 | Bacteria | 556 |
| 273 | Ga0068862_102676828 | 3300005844 | Bacteria | 510 |
| 274 | Ga0070717_11704411 | 3300006028 | Unclassified | 570 |
| 275 | Ga0070715_10284825 | 3300006163 | Bacteria | 878 |
| 276 | Ga0075366_10004353 | 3300006195 | Bacteria | 7592 |
| 277 | Ga0075366_10128109 | 3300006195 | Bacteria | 1531 |
| 278 | Ga0075366_10378713 | 3300006195 | Bacteria | 870 |
| 279 | Ga0097621_100004695 | 3300006237 | Bacteria | 9545 |
| 280 | Ga0097621_100028621 | 3300006237 | Bacteria | 4393 |
| 281 | Ga0097621_100500564 | 3300006237 | Bacteria | 1100 |
| 282 | Ga0097621_100686158 | 3300006237 | Unclassified | 942 |
| 283 | Ga0097621_101679292 | 3300006237 | Unclassified | 605 |
| 284 | Ga0097621_101811841 | 3300006237 | Unclassified | 582 |
| 285 | Ga0097621_102068902 | 3300006237 | Unclassified | 544 |
| 286 | Ga0068871_100047999 | 3300006358 | Unclassified | 3445 |
| 287 | Ga0068871_100093437 | 3300006358 | Unclassified | 2509 |
| 288 | Ga0068871_100246264 | 3300006358 | Unclassified | 1556 |
| 289 | Ga0068871_101482432 | 3300006358 | Bacteria | 641 |
| 290 | Ga0068871_101573206 | 3300006358 | Unclassified | 622 |
| 291 | Ga0075428_100025886 | 3300006844 | Bacteria | 6497 |
| 292 | Ga0075428_100078023 | 3300006844 | Bacteria | 3615 |
| 293 | Ga0075430_100014225 | 3300006846 | Bacteria | 6783 |
| 294 | Ga0075431_100083698 | 3300006847 | Bacteria | 3294 |
| 295 | Ga0075433_10865034 | 3300006852 | Unclassified | 789 |
| 296 | Ga0075429_100000533 | 3300006880 | Bacteria | 28947 |
| 297 | Ga0075429_100176026 | 3300006880 | Bacteria | 1874 |
| 298 | Ga0068865_100016762 | 3300006881 | Bacteria | 4696 |
| 299 | Ga0068865_100375037 | 3300006881 | Bacteria | 1159 |
| 300 | Ga0068865_100759975 | 3300006881 | Bacteria | 833 |
| 301 | Ga0068865_101155883 | 3300006881 | Bacteria | 684 |
| 302 | Ga0068865_101247691 | 3300006881 | Bacteria | 659 |
| 303 | Ga0068865_101706434 | 3300006881 | Bacteria | 568 |
| 304 | Ga0097620_100002822 | 3300006931 | Bacteria | 17618 |
| 305 | Ga0097620_100029453 | 3300006931 | Bacteria | 5508 |
| 306 | Ga0097620_100091940 | 3300006931 | Bacteria | 3085 |
| 307 | Ga0097620_100118676 | 3300006931 | Bacteria | 2711 |
| 308 | Ga0097620_100222338 | 3300006931 | Bacteria | 1976 |
| 309 | Ga0097620_100308913 | 3300006931 | Bacteria | 1675 |
| 310 | Ga0097620_100795552 | 3300006931 | Bacteria | 1033 |
| 311 | Ga0105251_10167642 | 3300009011 | Bacteria | 990 |
| 312 | Ga0105240_10006100 | 3300009093 | Bacteria | 17784 |
| 313 | Ga0105240_10403482 | 3300009093 | Bacteria | 1539 |
| 314 | Ga0105240_10825950 | 3300009093 | Bacteria | 1002 |
| 315 | Ga0105240_10921344 | 3300009093 | Bacteria | 939 |
| 316 | Ga0111539_10003935 | 3300009094 | Bacteria | 19527 |
| 317 | Ga0111539_10194276 | 3300009094 | Bacteria | 2367 |
| 318 | Ga0111539_10405992 | 3300009094 | Bacteria | 1587 |
| 319 | Ga0111539_11238718 | 3300009094 | Bacteria | 866 |
| 320 | Ga0111539_11928083 | 3300009094 | Bacteria | 685 |
| 321 | Ga0111539_12121033 | 3300009094 | Bacteria | 652 |
| 322 | Ga0111539_12176837 | 3300009094 | Unclassified | 643 |
| 323 | Ga0111539_12889943 | 3300009094 | Bacteria | 556 |
| 324 | Ga0105245_12055894 | 3300009098 | Bacteria | 625 |
| 325 | Ga0105247_10003381 | 3300009101 | Bacteria | 10432 |
| 326 | Ga0105247_10350040 | 3300009101 | Bacteria | 1039 |
| 327 | Ga0105247_10713407 | 3300009101 | Bacteria | 756 |
| 328 | Ga0105247_11487146 | 3300009101 | Bacteria | 552 |
| 329 | Ga0105247_11491109 | 3300009101 | Bacteria | 551 |
| 330 | Ga0114129_10055628 | 3300009147 | Bacteria | 5544 |
| 331 | Ga0114129_10527949 | 3300009147 | Bacteria | 1538 |
| 332 | Ga0114129_10743522 | 3300009147 | Bacteria | 1256 |
| 333 | Ga0114129_12027959 | 3300009147 | Bacteria | 695 |
| 334 | Ga0105243_10748645 | 3300009148 | Bacteria | 958 |
| 335 | Ga0105241_10002034 | 3300009174 | Bacteria | 15304 |
| 336 | Ga0105241_10202248 | 3300009174 | Bacteria | 1660 |
| 337 | Ga0105241_10370709 | 3300009174 | Bacteria | 1248 |
| 338 | Ga0105241_10387242 | 3300009174 | Bacteria | 1223 |
| 339 | Ga0105241_10832695 | 3300009174 | Bacteria | 852 |
| 340 | Ga0105241_10908279 | 3300009174 | Bacteria | 818 |
| 341 | Ga0105242_10088493 | 3300009176 | Bacteria | 2602 |
| 342 | Ga0105242_10428946 | 3300009176 | Bacteria | 1241 |
| 343 | Ga0105242_11067601 | 3300009176 | Unclassified | 819 |
| 344 | Ga0105242_11254731 | 3300009176 | Bacteria | 763 |
| 345 | Ga0105242_12644916 | 3300009176 | Bacteria | 551 |
| 346 | Ga0105248_10208097 | 3300009177 | Bacteria | 2204 |
| 347 | Ga0105248_11472085 | 3300009177 | Bacteria | 771 |
| 348 | Ga0105248_11717501 | 3300009177 | Bacteria | 712 |
| 349 | Ga0105248_11948589 | 3300009177 | Bacteria | 667 |
| 350 | Ga0105248_12818266 | 3300009177 | Unclassified | 554 |
| 351 | Ga0105237_10445914 | 3300009545 | Bacteria | 1300 |
| 352 | Ga0105237_10641414 | 3300009545 | Bacteria | 1069 |
| 353 | Ga0105237_10676782 | 3300009545 | Unclassified | 1039 |
| 354 | Ga0105238_11998972 | 3300009551 | Bacteria | 613 |
| 355 | Ga0105249_10002193 | 3300009553 | Bacteria | 16909 |
| 356 | Ga0105249_10006815 | 3300009553 | Bacteria | 9962 |
| 357 | Ga0105249_10012704 | 3300009553 | Bacteria | 7421 |
| 358 | Ga0105249_10023038 | 3300009553 | Bacteria | 5583 |
| 359 | Ga0105249_10046670 | 3300009553 | Bacteria | 3943 |
| 360 | Ga0105249_10247832 | 3300009553 | Bacteria | 1764 |
| 361 | Ga0105249_10294614 | 3300009553 | Bacteria | 1625 |
| 362 | Ga0105249_10417805 | 3300009553 | Bacteria | 1374 |
| 363 | Ga0105249_10604077 | 3300009553 | Bacteria | 1152 |
| 364 | Ga0105249_10841050 | 3300009553 | Bacteria | 983 |
| 365 | Ga0105249_12264764 | 3300009553 | Unclassified | 616 |
| 366 | Ga0105239_10145403 | 3300010375 | Unclassified | 2644 |
| 367 | Ga0105239_10534590 | 3300010375 | Bacteria | 1334 |
| 368 | Ga0105239_10601323 | 3300010375 | Bacteria | 1254 |
| 369 | Ga0105239_11832559 | 3300010375 | Bacteria | 703 |
| 370 | Ga0105246_10257922 | 3300011119 | Bacteria | 1387 |
| 371 | Ga0105246_10684602 | 3300011119 | Bacteria | 897 |
| 372 | Ga0105246_10788380 | 3300011119 | Unclassified | 842 |
| 373 | Ga0105246_11840854 | 3300011119 | Unclassified | 579 |
| 374 | Ga0157325_1031292 | 3300012485 | Unclassified | 535 |
| 375 | Ga0157373_10315527 | 3300013100 | Bacteria | 1111 |
| 376 | Ga0157373_10846155 | 3300013100 | Bacteria | 676 |
| 377 | Ga0157371_10869579 | 3300013102 | Unclassified | 682 |
| 378 | Ga0157371_11093060 | 3300013102 | Unclassified | 611 |
| 379 | Ga0157370_10006548 | 3300013104 | Bacteria | 12825 |
| 380 | Ga0157370_10018237 | 3300013104 | Bacteria | 7060 |
| 381 | Ga0157370_10049385 | 3300013104 | Bacteria | 4027 |
| 382 | Ga0157370_10187902 | 3300013104 | Unclassified | 1918 |
| 383 | Ga0157370_11607282 | 3300013104 | Unclassified | 584 |
| 384 | Ga0157369_10372541 | 3300013105 | Bacteria | 1482 |
| 385 | Ga0157369_10396855 | 3300013105 | Bacteria | 1431 |
| 386 | Ga0157369_10710774 | 3300013105 | Bacteria | 1035 |
| 387 | Ga0157374_10002306 | 3300013296 | Bacteria | 16074 |
| 388 | Ga0157374_10014218 | 3300013296 | Bacteria | 6960 |
| 389 | Ga0157374_10019065 | 3300013296 | Bacteria | 6070 |
| 390 | Ga0157374_10798772 | 3300013296 | Unclassified | 959 |
| 391 | Ga0157374_10833797 | 3300013296 | Bacteria | 939 |
| 392 | Ga0157374_10851903 | 3300013296 | Bacteria | 928 |
| 393 | Ga0157374_10939380 | 3300013296 | Unclassified | 883 |
| 394 | Ga0157374_11091731 | 3300013296 | Unclassified | 818 |
| 395 | Ga0157378_10028079 | 3300013297 | Bacteria | 4962 |
| 396 | Ga0157378_10121956 | 3300013297 | Bacteria | 2404 |
| 397 | Ga0157378_10382625 | 3300013297 | Bacteria | 1382 |
| 398 | Ga0157378_11200077 | 3300013297 | Bacteria | 798 |
| 399 | Ga0157378_11790281 | 3300013297 | Bacteria | 662 |
| 400 | Ga0157378_12848215 | 3300013297 | Bacteria | 536 |
| 401 | Ga0157378_13298139 | 3300013297 | Bacteria | 501 |
| 402 | Ga0163162_10004448 | 3300013306 | Bacteria | 13498 |
| 403 | Ga0163162_10014246 | 3300013306 | Bacteria | 7767 |
| 404 | Ga0163162_10020100 | 3300013306 | Bacteria | 6556 |
| 405 | Ga0163162_10027978 | 3300013306 | Bacteria | 5577 |
| 406 | Ga0163162_10117366 | 3300013306 | Bacteria | 2762 |
| 407 | Ga0163162_10240533 | 3300013306 | Bacteria | 1941 |
| 408 | Ga0163162_10322890 | 3300013306 | Bacteria | 1676 |
| 409 | Ga0163162_10656575 | 3300013306 | Bacteria | 1172 |
| 410 | Ga0163162_10677439 | 3300013306 | Unclassified | 1154 |
| 411 | Ga0163162_10923735 | 3300013306 | Bacteria | 985 |
| 412 | Ga0163162_11148221 | 3300013306 | Bacteria | 881 |
| 413 | Ga0163162_11396635 | 3300013306 | Unclassified | 797 |
| 414 | Ga0163162_11844183 | 3300013306 | Unclassified | 692 |
| 415 | Ga0157372_10137420 | 3300013307 | Unclassified | 2815 |
| 416 | Ga0157372_10164580 | 3300013307 | Bacteria | 2564 |
| 417 | Ga0157372_10292130 | 3300013307 | Bacteria | 1896 |
| 418 | Ga0157372_10450393 | 3300013307 | Unclassified | 1500 |
| 419 | Ga0157372_11329778 | 3300013307 | Unclassified | 829 |
| 420 | Ga0157372_11700051 | 3300013307 | Unclassified | 726 |
| 421 | Ga0157372_11786148 | 3300013307 | Bacteria | 707 |
| 422 | Ga0157372_12505393 | 3300013307 | Unclassified | 592 |
| 423 | Ga0157375_10009467 | 3300013308 | Bacteria | 8553 |
| 424 | Ga0157375_10017272 | 3300013308 | Bacteria | 6507 |
| 425 | Ga0157375_10019432 | 3300013308 | Bacteria | 6179 |
| 426 | Ga0157375_10060278 | 3300013308 | Bacteria | 3763 |
| 427 | Ga0157375_10071276 | 3300013308 | Bacteria | 3488 |
| 428 | Ga0157375_10077537 | 3300013308 | Bacteria | 3353 |
| 429 | Ga0157375_10152664 | 3300013308 | Bacteria | 2446 |
| 430 | Ga0157375_10285313 | 3300013308 | Bacteria | 1814 |
| 431 | Ga0157375_10415384 | 3300013308 | Bacteria | 1512 |
| 432 | Ga0157375_11266564 | 3300013308 | Unclassified | 866 |
| 433 | Ga0157375_12936614 | 3300013308 | Unclassified | 569 |
| 434 | Ga0157375_13559694 | 3300013308 | Bacteria | 518 |
| 435 | Ga0163163_10000846 | 3300014325 | Bacteria | 26044 |
| 436 | Ga0163163_10080496 | 3300014325 | Bacteria | 3257 |
| 437 | Ga0163163_10220152 | 3300014325 | Bacteria | 1947 |
| 438 | Ga0163163_10454991 | 3300014325 | Bacteria | 1340 |
| 439 | Ga0163163_10527248 | 3300014325 | Bacteria | 1243 |
| 440 | Ga0163163_10739491 | 3300014325 | Bacteria | 1047 |
| 441 | Ga0157380_10001544 | 3300014326 | Bacteria | 15133 |
| 442 | Ga0157380_10008119 | 3300014326 | Bacteria | 7480 |
| 443 | Ga0157380_10038502 | 3300014326 | Bacteria | 3713 |
| 444 | Ga0157380_10041354 | 3300014326 | Unclassified | 3597 |
| 445 | Ga0157380_10109060 | 3300014326 | Bacteria | 2322 |
| 446 | Ga0157380_10514667 | 3300014326 | Bacteria | 1166 |
| 447 | Ga0157380_11302793 | 3300014326 | Bacteria | 774 |
| 448 | Ga0157380_11553029 | 3300014326 | Bacteria | 716 |
| 449 | Ga0157380_13302594 | 3300014326 | Bacteria | 516 |
| 450 | Ga0157377_10004687 | 3300014745 | Bacteria | 6328 |
| 451 | Ga0157377_10012607 | 3300014745 | Bacteria | 4254 |
| 452 | Ga0157377_10013025 | 3300014745 | Unclassified | 4199 |
| 453 | Ga0157377_10135349 | 3300014745 | Bacteria | 1509 |
| 454 | Ga0157377_10367270 | 3300014745 | Bacteria | 970 |
| 455 | Ga0157377_10423808 | 3300014745 | Unclassified | 912 |
| 456 | Ga0157377_10635274 | 3300014745 | Bacteria | 766 |
| 457 | Ga0157379_10062128 | 3300014968 | Bacteria | 3341 |
| 458 | Ga0157379_10067074 | 3300014968 | Bacteria | 3208 |
| 459 | Ga0157379_10145731 | 3300014968 | Bacteria | 2135 |
| 460 | Ga0157379_10158486 | 3300014968 | Bacteria | 2043 |
| 461 | Ga0157379_10244990 | 3300014968 | Bacteria | 1626 |
| 462 | Ga0157379_10319184 | 3300014968 | Bacteria | 1418 |
| 463 | Ga0157379_11164634 | 3300014968 | Unclassified | 740 |
| 464 | Ga0157379_11367115 | 3300014968 | Bacteria | 685 |
| 465 | Ga0157376_10019085 | 3300014969 | Bacteria | 5275 |
| 466 | Ga0157376_10052830 | 3300014969 | Bacteria | 3380 |
| 467 | Ga0157376_10395123 | 3300014969 | Unclassified | 1335 |
| 468 | Ga0157376_11020896 | 3300014969 | Bacteria | 850 |
| 469 | Ga0157376_11427980 | 3300014969 | Bacteria | 724 |
| 470 | Ga0157376_11500046 | 3300014969 | Viruses | 707 |
| 471 | Ga0157376_11867280 | 3300014969 | Bacteria | 637 |
| 472 | Ga0163161_10003828 | 3300017792 | Bacteria | 10550 |
| 473 | Ga0163161_10023481 | 3300017792 | Bacteria | 4350 |
| 474 | Ga0163161_10142714 | 3300017792 | Bacteria | 1814 |
| 475 | Ga0163161_10165050 | 3300017792 | Bacteria | 1690 |
| 476 | Ga0163161_10351633 | 3300017792 | Unclassified | 1172 |
| 477 | Ga0163161_10681461 | 3300017792 | Unclassified | 854 |
| 478 | Ga0163161_10833487 | 3300017792 | Bacteria | 777 |
| 479 | Ga0163161_11023592 | 3300017792 | Unclassified | 706 |
| 480 | Ga0163161_11154013 | 3300017792 | Bacteria | 668 |
| 481 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 482 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 483 | Ga0207666_1078129 | 3300025271 | Unclassified | 534 |
| 484 | Ga0209758_1002724 | 3300025297 | Bacteria | 17405 |
| 485 | Ga0207426_1000445 | 3300025302 | Bacteria | 66319 |
| 486 | Ga0207697_10061135 | 3300025315 | Bacteria | 1567 |
| 487 | Ga0207697_10137364 | 3300025315 | Bacteria | 1059 |
| 488 | Ga0207656_10615310 | 3300025321 | Unclassified | 555 |
| 489 | Ga0207682_10021788 | 3300025893 | Bacteria | 2522 |
| 490 | Ga0207682_10124900 | 3300025893 | Bacteria | 1144 |
| 491 | Ga0207682_10424806 | 3300025893 | Unclassified | 629 |
| 492 | Ga0207682_10435376 | 3300025893 | Unclassified | 620 |
| 493 | Ga0207642_10691675 | 3300025899 | Bacteria | 642 |
| 494 | Ga0207710_10001761 | 3300025900 | Bacteria | 10447 |
| 495 | Ga0207688_10014698 | 3300025901 | Unclassified | 4251 |
| 496 | Ga0207688_10298365 | 3300025901 | Bacteria | 985 |
| 497 | Ga0207680_10458512 | 3300025903 | Bacteria | 905 |
| 498 | Ga0207680_10499920 | 3300025903 | Unclassified | 866 |
| 499 | Ga0207680_10764423 | 3300025903 | Bacteria | 693 |
| 500 | Ga0207680_10805807 | 3300025903 | Bacteria | 673 |
| 501 | Ga0207647_10097550 | 3300025904 | Bacteria | 1747 |
| 502 | Ga0207647_10470476 | 3300025904 | Bacteria | 703 |
| 503 | Ga0207647_10678212 | 3300025904 | Unclassified | 563 |
| 504 | Ga0207645_10011686 | 3300025907 | Bacteria | 5986 |
| 505 | Ga0207645_10013131 | 3300025907 | Bacteria | 5595 |
| 506 | Ga0207645_10160475 | 3300025907 | Bacteria | 1471 |
| 507 | Ga0207645_10283516 | 3300025907 | Bacteria | 1100 |
| 508 | Ga0207643_10002640 | 3300025908 | Bacteria | 9706 |
| 509 | Ga0207643_10464015 | 3300025908 | Bacteria | 807 |
| 510 | Ga0207654_10066629 | 3300025911 | Unclassified | 2125 |
| 511 | Ga0207707_10000117 | 3300025912 | Bacteria | 80929 |
| 512 | Ga0207695_10013789 | 3300025913 | Bacteria | 9617 |
| 513 | Ga0207695_10013922 | 3300025913 | Bacteria | 9563 |
| 514 | Ga0207695_11434771 | 3300025913 | Bacteria | 571 |
| 515 | Ga0207671_10000340 | 3300025914 | Bacteria | 68615 |
| 516 | Ga0207671_10202020 | 3300025914 | Unclassified | 1552 |
| 517 | Ga0207671_10450063 | 3300025914 | Bacteria | 1026 |
| 518 | Ga0207671_11104634 | 3300025914 | Unclassified | 623 |
| 519 | Ga0207660_10038339 | 3300025917 | Bacteria | 3344 |
| 520 | Ga0207662_10792836 | 3300025918 | Unclassified | 667 |
| 521 | Ga0207657_10003538 | 3300025919 | Bacteria | 16689 |
| 522 | Ga0207657_10735459 | 3300025919 | Unclassified | 765 |
| 523 | Ga0207657_11298647 | 3300025919 | Bacteria | 550 |
| 524 | Ga0207649_10005540 | 3300025920 | Bacteria | 6833 |
| 525 | Ga0207649_10265570 | 3300025920 | Bacteria | 1242 |
| 526 | Ga0207649_11242006 | 3300025920 | Unclassified | 589 |
| 527 | Ga0207649_11588672 | 3300025920 | Unclassified | 518 |
| 528 | Ga0207652_10001410 | 3300025921 | Bacteria | 21328 |
| 529 | Ga0207646_10185678 | 3300025922 | Bacteria | 1878 |
| 530 | Ga0207681_10029387 | 3300025923 | Bacteria | 3569 |
| 531 | Ga0207650_10049153 | 3300025925 | Bacteria | 3113 |
| 532 | Ga0207650_10331440 | 3300025925 | Bacteria | 1248 |
| 533 | Ga0207650_10678078 | 3300025925 | Bacteria | 870 |
| 534 | Ga0207650_10895026 | 3300025925 | Bacteria | 754 |
| 535 | Ga0207650_11662322 | 3300025925 | Bacteria | 541 |
| 536 | Ga0207659_10022271 | 3300025926 | Bacteria | 4217 |
| 537 | Ga0207659_11133202 | 3300025926 | Bacteria | 673 |
| 538 | Ga0207659_11804344 | 3300025926 | Unclassified | 520 |
| 539 | Ga0207700_11700435 | 3300025928 | Bacteria | 556 |
| 540 | Ga0207644_10013769 | 3300025931 | Bacteria | 5402 |
| 541 | Ga0207644_10052928 | 3300025931 | Bacteria | 2920 |
| 542 | Ga0207644_10274475 | 3300025931 | Bacteria | 1352 |
| 543 | Ga0207644_10739578 | 3300025931 | Bacteria | 821 |
| 544 | Ga0207644_10787053 | 3300025931 | Unclassified | 795 |
| 545 | Ga0207644_11464484 | 3300025931 | Unclassified | 573 |
| 546 | Ga0207690_10016335 | 3300025932 | Bacteria | 4513 |
| 547 | Ga0207690_10083872 | 3300025932 | Bacteria | 2232 |
| 548 | Ga0207690_10299448 | 3300025932 | Bacteria | 1258 |
| 549 | Ga0207690_10382033 | 3300025932 | Unclassified | 1120 |
| 550 | Ga0207690_10767534 | 3300025932 | Bacteria | 796 |
| 551 | Ga0207706_10029992 | 3300025933 | Bacteria | 4854 |
| 552 | Ga0207706_10219698 | 3300025933 | Bacteria | 1664 |
| 553 | Ga0207706_10336811 | 3300025933 | Unclassified | 1312 |
| 554 | Ga0207706_10558755 | 3300025933 | Bacteria | 985 |
| 555 | Ga0207706_10599568 | 3300025933 | Bacteria | 946 |
| 556 | Ga0207686_10000200 | 3300025934 | Bacteria | 46234 |
| 557 | Ga0207686_10280350 | 3300025934 | Bacteria | 1230 |
| 558 | Ga0207709_10323025 | 3300025935 | Bacteria | 1156 |
| 559 | Ga0207670_10011457 | 3300025936 | Bacteria | 5151 |
| 560 | Ga0207670_10020366 | 3300025936 | Bacteria | 4075 |
| 561 | Ga0207670_10648966 | 3300025936 | Bacteria | 870 |
| 562 | Ga0207669_10216475 | 3300025937 | Unclassified | 1402 |
| 563 | Ga0207669_10379027 | 3300025937 | Bacteria | 1102 |
| 564 | Ga0207669_11656279 | 3300025937 | Bacteria | 546 |
| 565 | Ga0207704_10457392 | 3300025938 | Bacteria | 1020 |
| 566 | Ga0207704_10833285 | 3300025938 | Unclassified | 772 |
| 567 | Ga0207704_10835615 | 3300025938 | Bacteria | 771 |
| 568 | Ga0207704_11006887 | 3300025938 | Unclassified | 705 |
| 569 | Ga0207704_11319105 | 3300025938 | Bacteria | 617 |
| 570 | Ga0207691_10102453 | 3300025940 | Bacteria | 2553 |
| 571 | Ga0207691_10192586 | 3300025940 | Bacteria | 1778 |
| 572 | Ga0207691_10195192 | 3300025940 | Bacteria | 1764 |
| 573 | Ga0207691_10258706 | 3300025940 | Unclassified | 1501 |
| 574 | Ga0207691_10698200 | 3300025940 | Bacteria | 856 |
| 575 | Ga0207689_10012246 | 3300025942 | Bacteria | 7336 |
| 576 | Ga0207689_10013498 | 3300025942 | Bacteria | 6976 |
| 577 | Ga0207689_10029076 | 3300025942 | Bacteria | 4618 |
| 578 | Ga0207689_10030736 | 3300025942 | Bacteria | 4475 |
| 579 | Ga0207689_10033224 | 3300025942 | Bacteria | 4287 |
| 580 | Ga0207689_10095003 | 3300025942 | Bacteria | 2448 |
| 581 | Ga0207689_10099860 | 3300025942 | Bacteria | 2385 |
| 582 | Ga0207661_10007465 | 3300025944 | Bacteria | 7778 |
| 583 | Ga0207661_10042713 | 3300025944 | Bacteria | 3575 |
| 584 | Ga0207661_10085814 | 3300025944 | Bacteria | 2611 |
| 585 | Ga0207661_11165435 | 3300025944 | Unclassified | 709 |
| 586 | Ga0207679_10000358 | 3300025945 | Bacteria | 33285 |
| 587 | Ga0207679_10002098 | 3300025945 | Bacteria | 12378 |
| 588 | Ga0207679_10125588 | 3300025945 | Bacteria | 2050 |
| 589 | Ga0207679_10196273 | 3300025945 | Bacteria | 1682 |
| 590 | Ga0207679_10245673 | 3300025945 | Unclassified | 1519 |
| 591 | Ga0207679_10339423 | 3300025945 | Bacteria | 1306 |
| 592 | Ga0207667_11060516 | 3300025949 | Unclassified | 795 |
| 593 | Ga0207667_11224048 | 3300025949 | Bacteria | 730 |
| 594 | Ga0207667_11562255 | 3300025949 | Unclassified | 629 |
| 595 | Ga0207651_10004538 | 3300025960 | Bacteria | 7019 |
| 596 | Ga0207651_10029439 | 3300025960 | Unclassified | 3479 |
| 597 | Ga0207651_10229823 | 3300025960 | Unclassified | 1505 |
| 598 | Ga0207651_10328510 | 3300025960 | Bacteria | 1281 |
| 599 | Ga0207651_10565329 | 3300025960 | Bacteria | 990 |
| 600 | Ga0207651_11221230 | 3300025960 | Bacteria | 675 |
| 601 | Ga0207712_10002374 | 3300025961 | Bacteria | 12203 |
| 602 | Ga0207712_10002523 | 3300025961 | Bacteria | 11776 |
| 603 | Ga0207712_10012531 | 3300025961 | Bacteria | 5418 |
| 604 | Ga0207712_10029486 | 3300025961 | Bacteria | 3681 |
| 605 | Ga0207712_10625360 | 3300025961 | Bacteria | 934 |
| 606 | Ga0207712_10635113 | 3300025961 | Bacteria | 927 |
| 607 | Ga0207712_10854483 | 3300025961 | Unclassified | 802 |
| 608 | Ga0207712_11218001 | 3300025961 | Bacteria | 672 |
| 609 | Ga0207668_10048989 | 3300025972 | Bacteria | 2902 |
| 610 | Ga0207668_10457024 | 3300025972 | Bacteria | 1091 |
| 611 | Ga0207668_10617136 | 3300025972 | Unclassified | 946 |
| 612 | Ga0207640_10029303 | 3300025981 | Bacteria | 3378 |
| 613 | Ga0207640_10384796 | 3300025981 | Bacteria | 1138 |
| 614 | Ga0207640_11648987 | 3300025981 | Bacteria | 578 |
| 615 | Ga0207658_10087359 | 3300025986 | Bacteria | 2408 |
| 616 | Ga0207658_10104663 | 3300025986 | Bacteria | 2224 |
| 617 | Ga0207658_10334110 | 3300025986 | Bacteria | 1315 |
| 618 | Ga0207658_10401872 | 3300025986 | Unclassified | 1204 |
| 619 | Ga0207677_10019526 | 3300026023 | Bacteria | 4094 |
| 620 | Ga0207677_10089210 | 3300026023 | Bacteria | 2238 |
| 621 | Ga0207677_10129508 | 3300026023 | Bacteria | 1913 |
| 622 | Ga0207677_10300032 | 3300026023 | Bacteria | 1327 |
| 623 | Ga0207677_11705918 | 3300026023 | Bacteria | 584 |
| 624 | Ga0207703_10455001 | 3300026035 | Bacteria | 1196 |
| 625 | Ga0207703_10922304 | 3300026035 | Bacteria | 837 |
| 626 | Ga0207703_11270083 | 3300026035 | Unclassified | 708 |
| 627 | Ga0207639_10004252 | 3300026041 | Bacteria | 9654 |
| 628 | Ga0207639_10404767 | 3300026041 | Bacteria | 1230 |
| 629 | Ga0207678_10047747 | 3300026067 | Unclassified | 3702 |
| 630 | Ga0207678_10236120 | 3300026067 | Bacteria | 1566 |
| 631 | Ga0207708_10555326 | 3300026075 | Bacteria | 969 |
| 632 | Ga0207708_11045247 | 3300026075 | Unclassified | 711 |
| 633 | Ga0207708_11114227 | 3300026075 | Unclassified | 688 |
| 634 | Ga0207708_11261117 | 3300026075 | Bacteria | 647 |
| 635 | Ga0207708_11275394 | 3300026075 | Unclassified | 643 |
| 636 | Ga0207702_10483212 | 3300026078 | Bacteria | 1206 |
| 637 | Ga0207641_10003037 | 3300026088 | Bacteria | 15123 |
| 638 | Ga0207641_10260204 | 3300026088 | Bacteria | 1624 |
| 639 | Ga0207641_10448510 | 3300026088 | Unclassified | 1246 |
| 640 | Ga0207641_11596044 | 3300026088 | Bacteria | 654 |
| 641 | Ga0207648_10027044 | 3300026089 | Bacteria | 5094 |
| 642 | Ga0207648_10029173 | 3300026089 | Bacteria | 4893 |
| 643 | Ga0207648_10072864 | 3300026089 | Bacteria | 2993 |
| 644 | Ga0207648_10157155 | 3300026089 | Bacteria | 2007 |
| 645 | Ga0207648_10515340 | 3300026089 | Bacteria | 1095 |
| 646 | Ga0207648_10885411 | 3300026089 | Bacteria | 833 |
| 647 | Ga0207648_11089033 | 3300026089 | Bacteria | 749 |
| 648 | Ga0207648_11593965 | 3300026089 | Unclassified | 614 |
| 649 | Ga0207676_10005548 | 3300026095 | Bacteria | 8927 |
| 650 | Ga0207676_10049441 | 3300026095 | Bacteria | 3271 |
| 651 | Ga0207676_10121958 | 3300026095 | Bacteria | 2200 |
| 652 | Ga0207676_10763576 | 3300026095 | Unclassified | 941 |
| 653 | Ga0207674_10004933 | 3300026116 | Bacteria | 15944 |
| 654 | Ga0207674_10011410 | 3300026116 | Bacteria | 9983 |
| 655 | Ga0207674_10021661 | 3300026116 | Bacteria | 6919 |
| 656 | Ga0207674_10058910 | 3300026116 | Bacteria | 3888 |
| 657 | Ga0207674_10226948 | 3300026116 | Bacteria | 1816 |
| 658 | Ga0207674_10227812 | 3300026116 | Bacteria | 1812 |
| 659 | Ga0207674_10341398 | 3300026116 | Unclassified | 1448 |
| 660 | Ga0207674_10472594 | 3300026116 | Unclassified | 1212 |
| 661 | Ga0207674_10477156 | 3300026116 | Bacteria | 1205 |
| 662 | Ga0207675_100000085 | 3300026118 | Bacteria | 73716 |
| 663 | Ga0207675_100027224 | 3300026118 | Bacteria | 5325 |
| 664 | Ga0207675_100082125 | 3300026118 | Bacteria | 3022 |
| 665 | Ga0207675_100095578 | 3300026118 | Bacteria | 2796 |
| 666 | Ga0207675_100166729 | 3300026118 | Bacteria | 2104 |
| 667 | Ga0207675_100443262 | 3300026118 | Unclassified | 1285 |
| 668 | Ga0207675_100566753 | 3300026118 | Bacteria | 1136 |
| 669 | Ga0207675_100629304 | 3300026118 | Unclassified | 1078 |
| 670 | Ga0207675_101141858 | 3300026118 | Unclassified | 799 |
| 671 | Ga0207675_101322475 | 3300026118 | Unclassified | 741 |
| 672 | Ga0207675_102591949 | 3300026118 | Bacteria | 517 |
| 673 | Ga0207683_10006456 | 3300026121 | Bacteria | 10037 |
| 674 | Ga0207683_10302819 | 3300026121 | Bacteria | 1462 |
| 675 | Ga0207683_10326931 | 3300026121 | Unclassified | 1405 |
| 676 | Ga0207683_10845395 | 3300026121 | Bacteria | 850 |
| 677 | Ga0207683_11128068 | 3300026121 | Bacteria | 727 |
| 678 | Ga0207698_10048842 | 3300026142 | Unclassified | 3216 |
| 679 | Ga0207698_10322775 | 3300026142 | Bacteria | 1447 |
| 680 | Ga0207698_11021677 | 3300026142 | Unclassified | 838 |
| 681 | Ga0207698_11099809 | 3300026142 | Bacteria | 807 |
| 682 | Ga0209995_1097655 | 3300027471 | Bacteria | 506 |
| 683 | Ga0207428_10018900 | 3300027907 | Bacteria | 5877 |
| 684 | Ga0207428_10452927 | 3300027907 | Bacteria | 935 |
| 685 | Ga0207428_10505350 | 3300027907 | Bacteria | 877 |
| 686 | Ga0268266_10009751 | 3300028379 | Bacteria | 8447 |
| 687 | Ga0268266_11195776 | 3300028379 | Bacteria | 735 |
| 688 | Ga0268266_11926170 | 3300028379 | Bacteria | 565 |
| 689 | Ga0268265_10005897 | 3300028380 | Bacteria | 8348 |
| 690 | Ga0268265_10266748 | 3300028380 | Bacteria | 1525 |
| 691 | Ga0268265_10537861 | 3300028380 | Bacteria | 1107 |
| 692 | Ga0268265_10793044 | 3300028380 | Unclassified | 923 |
| 693 | Ga0268265_10995431 | 3300028380 | Bacteria | 828 |
| 694 | Ga0268265_11727422 | 3300028380 | Unclassified | 632 |
| 695 | Ga0268265_11733824 | 3300028380 | Unclassified | 631 |
| 696 | Ga0268265_11850382 | 3300028380 | Bacteria | 610 |
| 697 | Ga0268265_12646252 | 3300028380 | Unclassified | 507 |
| 698 | Ga0268264_10345284 | 3300028381 | Bacteria | 1415 |
| 699 | Ga0268264_10400065 | 3300028381 | Bacteria | 1319 |
| 700 | Ga0268264_10466405 | 3300028381 | Bacteria | 1226 |
| 701 | Ga0268264_10573009 | 3300028381 | Unclassified | 1110 |
| 702 | Ga0268264_10698351 | 3300028381 | Bacteria | 1007 |
| 703 | Ga0268264_11251621 | 3300028381 | Bacteria | 752 |
| 704 | Ga0307517_10540871 | 3300028786 | Unclassified | 584 |
| 705 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 706 | Ga0265327_10000059 | 3300031251 | Bacteria | 236935 |
| 707 | Ga0307408_100170105 | 3300031548 | Bacteria | 1739 |
| 708 | Ga0307405_10083700 | 3300031731 | Bacteria | 2092 |
| 709 | Ga0307413_10472757 | 3300031824 | Bacteria | 1000 |
| 710 | Ga0307410_10063775 | 3300031852 | Bacteria | 2529 |
| 711 | Ga0307407_10309073 | 3300031903 | Bacteria | 1105 |
| 712 | Ga0307412_10228231 | 3300031911 | Bacteria | 1432 |
| 713 | Ga0307409_100758348 | 3300031995 | Bacteria | 975 |
| 714 | Ga0307416_100292561 | 3300032002 | Bacteria | 1613 |
| 715 | Ga0307414_10150978 | 3300032004 | Unclassified | 1833 |
| 716 | Ga0307414_10556517 | 3300032004 | Bacteria | 1023 |
| 717 | Ga0307414_11488234 | 3300032004 | Bacteria | 630 |
| 718 | Ga0307411_11129186 | 3300032005 | Bacteria | 708 |
| 719 | Ga0307411_11423294 | 3300032005 | Bacteria | 635 |
| 720 | Ga0307415_100472539 | 3300032126 | Bacteria | 1089 |
| 721 | Ga0373946_0435626 | 3300035171 | Unclassified | 666 |
| 722 | Ga0373947_0704037 | 3300035725 | Bacteria | 689 |
| 723 | Ga0436365_0493931 | 3300039437 | Bacteria | 27882 |
| 724 | Ga0436365_1327844 | 3300039437 | Bacteria | 894 |
| 725 | Ga0439436_0206236 | 3300041404 | Bacteria | 563 |
| 726 | Ga0439439_0053237 | 3300041406 | Bacteria | 1064 |
| 727 | Ga0439453_0011440 | 3300041408 | Bacteria | 1480 |
| 728 | Ga0451787_209659 | 3300041441 | Bacteria | 839 |
| 729 | Ga0451789_0074387 | 3300041443 | Bacteria | 713 |
| 730 | Ga0451793_0088457 | 3300041452 | Unclassified | 713 |
| 731 | Ga0451793_0633286 | 3300041452 | Unclassified | 526 |
| 732 | Ga0451797_1238182 | 3300041453 | Bacteria | 582 |
| 733 | Ga0451797_1272057 | 3300041453 | Unclassified | 774 |
| 734 | Ga0451798_0072829 | 3300041458 | Unclassified | 561 |
| 735 | Ga0451800_0156830 | 3300041459 | Bacteria | 638 |
| 736 | Ga0451800_1096925 | 3300041459 | Bacteria | 546 |
| 737 | Ga0451804_0371286 | 3300041463 | Viruses | 1929 |
| 738 | Ga0451807_0471232 | 3300041486 | Unclassified | 985 |
| 739 | Ga0451807_2135091 | 3300041486 | Unclassified | 631 |
| 740 | Ga0451835_0339757 | 3300041492 | Bacteria | 514 |
| 741 | Ga0451837_1358824 | 3300041494 | Bacteria | 708 |
| 742 | Ga0451845_0387093 | 3300041501 | Bacteria | 575 |
| 743 | Ga0439431_0002433 | 3300041997 | Bacteria | 4118 |
| 744 | Ga0439431_0042447 | 3300041997 | Bacteria | 1162 |
| 745 | Ga0439442_083987 | 3300042002 | Bacteria | 683 |
| 746 | Ga0439442_096915 | 3300042002 | Bacteria | 637 |
| 747 | Ga0439445_0006805 | 3300042004 | Bacteria | 2636 |
| 748 | Ga0439445_0125592 | 3300042004 | Unclassified | 738 |
| 749 | Ga0439449_0307247 | 3300042007 | Bacteria | 599 |
| 750 | Ga0439457_048890 | 3300042014 | Bacteria | 948 |
| 751 | Ga0439462_0217034 | 3300042015 | Bacteria | 547 |
| 752 | Ga0450923_006679 | 3300042125 | Bacteria | 1922 |
| 753 | Ga0450897_005451 | 3300042128 | Bacteria | 1103 |
| 754 | Ga0450894_033998 | 3300042131 | Bacteria | 718 |
| 755 | Ga0450898_021742 | 3300042134 | Bacteria | 1131 |
| 756 | Ga0439458_0154600 | 3300042157 | Bacteria | 616 |
| 757 | Ga0439434_0119407 | 3300042435 | Bacteria | 859 |
| 758 | Ga0439435_0021750 | 3300042436 | Bacteria | 1668 |
| 759 | Ga0439460_0022668 | 3300042461 | Bacteria | 1725 |
| 760 | Ga0451577_0062070 | 3300042876 | Bacteria | 3333 |
| 761 | Ga0451577_0697901 | 3300042876 | Unclassified | 919 |
| 762 | Ga0453684_0208488 | 3300044712 | Bacteria | 2273 |
| 763 | Ga0466970_0240314 | 3300044765 | Bacteria | 1013 |
| 764 | Ga0495638_0040588 | 3300046460 | Bacteria | 2949 |
| 765 | Ga0495582_0882012 | 3300046473 | Unclassified | 517 |
| 766 | Ga0495639_0434254 | 3300046475 | Bacteria | 666 |
| 767 | Ga0495606_0643574 | 3300046507 | Bacteria | 514 |
| 768 | Ga0495643_0077408 | 3300046522 | Bacteria | 1738 |
| 769 | Ga0495644_0130645 | 3300046523 | Bacteria | 957 |
| 770 | Ga0495598_0046801 | 3300046537 | Unclassified | 1287 |
| 771 | Ga0495598_0213205 | 3300046537 | Bacteria | 702 |
| 772 | Ga0495621_0007956 | 3300046539 | Bacteria | 3158 |
| 773 | Ga0495633_0296257 | 3300046558 | Bacteria | 735 |
| 774 | Ga0495656_0330666 | 3300046615 | Bacteria | 787 |
| 775 | Ga0495668_0000419 | 3300046616 | Bacteria | 55322 |
| 776 | Ga0495670_0787622 | 3300046691 | Unclassified | 519 |
| 777 | Ga0495671_0082874 | 3300046692 | Bacteria | 1572 |
| 778 | Ga0495686_0018642 | 3300047472 | Bacteria | 4651 |
| 779 | Ga0495686_0142473 | 3300047472 | Bacteria | 1413 |
| 780 | Ga0495615_0292335 | 3300048090 | Bacteria | 526 |
| 781 | Ga0496100_0355843 | 3300048903 | Bacteria | 1107 |
| 782 | Ga0496104_0218756 | 3300048907 | Bacteria | 1817 |
| 783 | Ga0496105_0605234 | 3300048908 | Bacteria | 850 |
| 784 | Ga0496106_0115248 | 3300048909 | Bacteria | 2096 |
| 785 | Ga0496108_0850428 | 3300048911 | Unclassified | 785 |
| 786 | Ga0496109_0362844 | 3300048912 | Bacteria | 1369 |
| 787 | Ga0496110_0278233 | 3300048913 | Bacteria | 1524 |
| 788 | Ga0496110_0659702 | 3300048913 | Unclassified | 946 |
| 789 | Ga0496114_0458875 | 3300048917 | Bacteria | 1128 |
| 790 | Ga0501292_004190 | 3300049515 | Bacteria | 1960 |
| 791 | Ga0501031_0012012 | 3300049568 | Bacteria | 5647 |
| 792 | Ga0501032_0023583 | 3300049569 | Bacteria | 4248 |
| 793 | Ga0501033_0922630 | 3300049570 | Bacteria | 586 |
| 794 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 795 | Ga0501034_0237544 | 3300049571 | Bacteria | 1769 |
| 796 | Ga0501034_0670537 | 3300049571 | Bacteria | 937 |
| 797 | Ga0501036_0052234 | 3300049572 | Unclassified | 3461 |
| 798 | Ga0501037_0035208 | 3300049573 | Bacteria | 3693 |
| 799 | Ga0501038_0013031 | 3300049574 | Bacteria | 7582 |
| 800 | Ga0501039_0060788 | 3300049575 | Bacteria | 2925 |
| 801 | Ga0501043_0005755 | 3300049579 | Bacteria | 9987 |
| 802 | Ga0501043_0215561 | 3300049579 | Bacteria | 1487 |
| 803 | Ga0501047_0042984 | 3300049581 | Bacteria | 4366 |
| 804 | Ga0501047_0379367 | 3300049581 | Bacteria | 1248 |
| 805 | Ga0501072_0216067 | 3300049588 | Unclassified | 1528 |
| 806 | Ga0501073_0359182 | 3300049589 | Bacteria | 1006 |
| 807 | Ga0501198_032552 | 3300049649 | Bacteria | 876 |
| 808 | Ga0501198_077838 | 3300049649 | Bacteria | 637 |
| 809 | Ga0501202_002367 | 3300049652 | Bacteria | 3159 |
| 810 | Ga0501207_063934 | 3300049654 | Bacteria | 679 |
| 811 | Ga0501217_024258 | 3300049661 | Bacteria | 1450 |
| 812 | Ga0501223_018439 | 3300049663 | Bacteria | 1373 |
| 813 | Ga0501233_043334 | 3300049668 | Bacteria | 1066 |
| 814 | Ga0501233_067672 | 3300049668 | Unclassified | 899 |
| 815 | Ga0501235_170670 | 3300049669 | Bacteria | 574 |
| 816 | Ga0501238_016909 | 3300049671 | Bacteria | 1014 |
| 817 | Ga0501239_035940 | 3300049672 | Bacteria | 668 |
| 818 | Ga0501242_000522 | 3300049674 | Bacteria | 3418 |
| 819 | Ga0501252_026207 | 3300049682 | Bacteria | 788 |
| 820 | Ga0501253_019527 | 3300049683 | Bacteria | 1171 |
| 821 | Ga0501257_006107 | 3300049686 | Unclassified | 2669 |
| 822 | Ga0501259_013024 | 3300049688 | Unclassified | 1393 |
| 823 | Ga0501219_000358 | 3300049703 | Bacteria | 7717 |
| 824 | Ga0501225_0076768 | 3300049705 | Unclassified | 955 |
| 825 | Ga0501225_0251245 | 3300049705 | Bacteria | 581 |
| 826 | Ga0501234_008968 | 3300049707 | Bacteria | 1560 |
| 827 | Ga0501234_040403 | 3300049707 | Bacteria | 763 |
| 828 | Ga0501245_020018 | 3300049708 | Unclassified | 1041 |
| 829 | Ga0501080_0783468 | 3300049742 | Bacteria | 837 |
| 830 | Ga0501080_0800587 | 3300049742 | Bacteria | 827 |
| 831 | Ga0501080_0815416 | 3300049742 | Unclassified | 818 |
| 832 | Ga0501083_0166958 | 3300049744 | Bacteria | 1439 |
| 833 | Ga0501241_019508 | 3300049758 | Bacteria | 1245 |
| 834 | Ga0501241_035496 | 3300049758 | Bacteria | 953 |
| 835 | Ga0501263_041564 | 3300049760 | Unclassified | 677 |
| 836 | Ga0501263_059066 | 3300049760 | Bacteria | 598 |
| 837 | Ga0501266_000690 | 3300049763 | Unclassified | 4388 |
| 838 | Ga0501268_015588 | 3300049765 | Unclassified | 1251 |
| 839 | Ga0501273_002008 | 3300049770 | Bacteria | 2029 |
| 840 | Ga0501280_050901 | 3300049776 | Bacteria | 697 |
| 841 | Ga0501035_0027999 | 3300049822 | Bacteria | 5148 |
| 842 | Ga0501044_0004089 | 3300049823 | Bacteria | 16365 |
| 843 | Ga0501044_1415416 | 3300049823 | Unclassified | 561 |
| 844 | Ga0501204_039276 | 3300049850 | Bacteria | 688 |
| 845 | Ga0501284_00086 | 3300050005 | Bacteria | 22701 |
| 846 | nmdc:mga0k408_190414_c1 | 3300050493 | Bacteria | 1224 |
| 847 | nmdc:mga0k408_76831_c1 | 3300050493 | Bacteria | 1952 |
| 848 | nmdc:mga0k408_826427_c1 | 3300050493 | Unclassified | 539 |
| 849 | nmdc:mga05p37_1152140_c1 | 3300050507 | Bacteria | 806 |
| 850 | nmdc:mga05p37_373068_c1 | 3300050507 | Bacteria | 1674 |
| 851 | nmdc:mga05p37_428199_c1 | 3300050507 | Bacteria | 1538 |
| 852 | nmdc:mga09592_131869_c1 | 3300050508 | Bacteria | 2151 |
| 853 | nmdc:mga09592_1556392_c1 | 3300050508 | Unclassified | 536 |
| 854 | nmdc:mga06r32_286869_c1 | 3300050510 | Bacteria | 1633 |
| 855 | nmdc:mga06r32_43908_c1 | 3300050510 | Bacteria | 4254 |
| 856 | nmdc:mga08y16_2583_c1 | 3300050511 | Bacteria | 18619 |
| 857 | nmdc:mga08y16_517132_c1 | 3300050511 | Bacteria | 1211 |
| 858 | nmdc:mga08y16_614776_c1 | 3300050511 | Bacteria | 1094 |
| 859 | nmdc:mga08y16_770698_c1 | 3300050511 | Bacteria | 957 |
| 860 | nmdc:mga08y16_985824_c1 | 3300050511 | Bacteria | 823 |
| 861 | nmdc:mga0n895_58110_c1 | 3300050512 | Unclassified | 3813 |
| 862 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 863 | Ga0500644_0349568 | 3300053088 | Unclassified | 639 |
| 864 | Ga0500646_0233192 | 3300053090 | Bacteria | 642 |
| 865 | Ga0500583_0002475 | 3300053092 | Bacteria | 5558 |
| 866 | Ga0500651_0697976 | 3300053093 | Bacteria | 543 |
| 867 | Ga0500641_0101597 | 3300053096 | Unclassified | 1233 |
| 868 | Ga0500556_0003123 | 3300053104 | Bacteria | 4946 |
| 869 | Ga0500557_173339 | 3300053105 | Bacteria | 703 |
| 870 | Ga0500562_000011 | 3300053108 | Bacteria | 179510 |
| 871 | Ga0500628_149582 | 3300053129 | Bacteria | 652 |
| 872 | Ga0500628_165708 | 3300053129 | Bacteria | 625 |
| 873 | Ga0500652_001199 | 3300053131 | Bacteria | 8262 |
| 874 | Ga0500568_0028144 | 3300053139 | Bacteria | 2345 |
| 875 | Ga0500611_000019 | 3300053727 | Bacteria | 110161 |
| 876 | Ga0500611_036298 | 3300053727 | Bacteria | 1055 |
| 877 | Ga0500645_008152 | 3300053730 | Bacteria | 3600 |
| 878 | Ga0500645_009433 | 3300053730 | Unclassified | 3278 |
| 879 | Ga0500587_043235 | 3300053739 | Unclassified | 651 |
| 880 | Ga0500661_012706 | 3300055283 | Bacteria | 1520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001979 | JGI24740J21852_10014977 | JGI24740J21852_100149773 | 98 |
| 2 | 3300002738 | JGI25154J39366_1000006 | JGI25154J39366_100000682 | 98 |
| 3 | 3300002741 | JGI25157J39369_1005105 | JGI25157J39369_10051051 | 98 |
| 4 | 3300003215 | JGI25153J46596_10001206 | JGI25153J46596_100012064 | 98 |
| 5 | 3300003323 | rootH1_10019517 | rootH1_100195172 | 98 |
| 6 | 3300003354 | JGI25160J50197_1008388 | JGI25160J50197_10083883 | 98 |
| 7 | 3300005262 | Ga0065165_1034982 | Ga0065165_10349822 | 98 |
| 8 | 3300005288 | Ga0065714_10546582 | Ga0065714_105465822 | 98 |
| 9 | 3300005289 | Ga0065704_10457232 | Ga0065704_104572322 | 98 |
| 10 | 3300005290 | Ga0065712_10839525 | Ga0065712_108395251 | 98 |
| 11 | 3300005293 | Ga0065715_10583807 | Ga0065715_105838072 | 98 |
| 12 | 3300005293 | Ga0065715_10970823 | Ga0065715_109708231 | 98 |
| 13 | 3300005335 | Ga0070666_10216688 | Ga0070666_102166883 | 98 |
| 14 | 3300005337 | Ga0070682_100000074 | Ga0070682_10000007438 | 98 |
| 15 | 3300005355 | Ga0070671_100048852 | Ga0070671_1000488523 | 98 |
| 16 | 3300005564 | Ga0070664_101695314 | Ga0070664_1016953142 | 98 |
| 17 | 3300006237 | Ga0097621_100004695 | Ga0097621_1000046953 | 98 |
| 18 | 3300006358 | Ga0068871_100047999 | Ga0068871_1000479994 | 98 |
| 19 | 3300009094 | Ga0111539_11928083 | Ga0111539_119280832 | 98 |
| 20 | 3300009094 | Ga0111539_12889943 | Ga0111539_128899431 | 98 |
| 21 | 3300009098 | Ga0105245_12055894 | Ga0105245_120558942 | 98 |
| 22 | 3300010375 | Ga0105239_11832559 | Ga0105239_118325592 | 98 |
| 23 | 3300013104 | Ga0157370_10187902 | Ga0157370_101879022 | 98 |
| 24 | 3300013296 | Ga0157374_10833797 | Ga0157374_108337971 | 98 |
| 25 | 3300013296 | Ga0157374_10939380 | Ga0157374_109393802 | 98 |
| 26 | 3300013297 | Ga0157378_10028079 | Ga0157378_100280797 | 98 |
| 27 | 3300013297 | Ga0157378_13298139 | Ga0157378_132981391 | 98 |
| 28 | 3300013306 | Ga0163162_10656575 | Ga0163162_106565752 | 98 |
| 29 | 3300013306 | Ga0163162_11148221 | Ga0163162_111482212 | 98 |
| 30 | 3300013306 | Ga0163162_11844183 | Ga0163162_118441831 | 98 |
| 31 | 3300013308 | Ga0157375_11266564 | Ga0157375_112665642 | 98 |
| 32 | 3300014326 | Ga0157380_10038502 | Ga0157380_100385023 | 98 |
| 33 | 3300014326 | Ga0157380_13302594 | Ga0157380_133025941 | 98 |
| 34 | 3300014968 | Ga0157379_10145731 | Ga0157379_101457313 | 98 |
| 35 | 3300014969 | Ga0157376_11500046 | Ga0157376_115000462 | 98 |
| 36 | 3300025246 | Ga0209646_1000031 | Ga0209646_1000031115 | 98 |
| 37 | 3300025250 | Ga0209026_1000019 | Ga0209026_1000019115 | 98 |
| 38 | 3300025297 | Ga0209758_1002724 | Ga0209758_100272415 | 98 |
| 39 | 3300025302 | Ga0207426_1000445 | Ga0207426_100044533 | 98 |
| 40 | 3300025903 | Ga0207680_10764423 | Ga0207680_107644231 | 98 |
| 41 | 3300025931 | Ga0207644_10274475 | Ga0207644_102744752 | 98 |
| 42 | 3300025940 | Ga0207691_10258706 | Ga0207691_102587062 | 98 |
| 43 | 3300025981 | Ga0207640_11648987 | Ga0207640_116489872 | 98 |
| 44 | 3300028786 | Ga0307517_10540871 | Ga0307517_105408712 | 98 |
| 45 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011988 | 98 |
| 46 | 3300031251 | Ga0265327_10000059 | Ga0265327_1000005997 | 98 |
| 47 | 3300032004 | Ga0307414_10556517 | Ga0307414_105565173 | 98 |
| 48 | 3300041452 | Ga0451793_0633286 | Ga0451793_0633286_138_434 | 98 |
| 49 | 3300041453 | Ga0451797_1272057 | Ga0451797_1272057_350_646 | 98 |
| 50 | 3300041459 | Ga0451800_0156830 | Ga0451800_0156830_133_429 | 98 |
| 51 | 3300041997 | Ga0439431_0002433 | Ga0439431_0002433_1463_1765 | 98 |
| 52 | 3300042004 | Ga0439445_0006805 | Ga0439445_0006805_682_984 | 98 |
| 53 | 3300049570 | Ga0501033_0922630 | Ga0501033_0922630_191_487 | 98 |
| 54 | 3300049571 | Ga0501034_0670537 | Ga0501034_0670537_108_404 | 98 |
| 55 | 3300049581 | Ga0501047_0042984 | Ga0501047_0042984_1927_2223 | 98 |
| 56 | 3300053105 | Ga0500557_173339 | Ga0500557_173339_193_489 | 98 |
| 57 | 3300053131 | Ga0500652_001199 | Ga0500652_001199_7364_7660 | 98 |
| 58 | 3300053139 | Ga0500568_0028144 | Ga0500568_0028144_287_583 | 98 |
| 59 | 2162886012 | MBSR1b_contig_6259703 | MBSR1b_0581.00004520 | 99 |
| 60 | 3300002076 | JGI24749J21850_1039359 | JGI24749J21850_10393591 | 99 |
| 61 | 3300003320 | rootH2_10169946 | rootH2_101699461 | 99 |
| 62 | 3300003322 | rootL2_10217998 | rootL2_102179983 | 99 |
| 63 | 3300003322 | rootL2_10347437 | rootL2_103474371 | 99 |
| 64 | 3300003322 | rootL2_10370816 | rootL2_103708162 | 99 |
| 65 | 3300005290 | Ga0065712_10008807 | Ga0065712_100088074 | 99 |
| 66 | 3300005290 | Ga0065712_10427440 | Ga0065712_104274402 | 99 |
| 67 | 3300005293 | Ga0065715_10199574 | Ga0065715_101995742 | 99 |
| 68 | 3300005295 | Ga0065707_10140963 | Ga0065707_101409633 | 99 |
| 69 | 3300005295 | Ga0065707_10149320 | Ga0065707_101493202 | 99 |
| 70 | 3300005295 | Ga0065707_10488707 | Ga0065707_104887072 | 99 |
| 71 | 3300005295 | Ga0065707_10838841 | Ga0065707_108388411 | 99 |
| 72 | 3300005328 | Ga0070676_10007859 | Ga0070676_100078594 | 99 |
| 73 | 3300005328 | Ga0070676_10020642 | Ga0070676_100206423 | 99 |
| 74 | 3300005328 | Ga0070676_10232763 | Ga0070676_102327632 | 99 |
| 75 | 3300005328 | Ga0070676_10436259 | Ga0070676_104362592 | 99 |
| 76 | 3300005328 | Ga0070676_10513734 | Ga0070676_105137341 | 99 |
| 77 | 3300005328 | Ga0070676_10989545 | Ga0070676_109895451 | 99 |
| 78 | 3300005329 | Ga0070683_100035991 | Ga0070683_1000359913 | 99 |
| 79 | 3300005329 | Ga0070683_100059027 | Ga0070683_1000590272 | 99 |
| 80 | 3300005329 | Ga0070683_100393287 | Ga0070683_1003932872 | 99 |
| 81 | 3300005329 | Ga0070683_100434135 | Ga0070683_1004341352 | 99 |
| 82 | 3300005330 | Ga0070690_100012749 | Ga0070690_1000127494 | 99 |
| 83 | 3300005330 | Ga0070690_100024644 | Ga0070690_1000246441 | 99 |
| 84 | 3300005330 | Ga0070690_100078041 | Ga0070690_1000780414 | 99 |
| 85 | 3300005331 | Ga0070670_100071916 | Ga0070670_1000719163 | 99 |
| 86 | 3300005331 | Ga0070670_100196621 | Ga0070670_1001966212 | 99 |
| 87 | 3300005331 | Ga0070670_100417294 | Ga0070670_1004172942 | 99 |
| 88 | 3300005331 | Ga0070670_100438144 | Ga0070670_1004381441 | 99 |
| 89 | 3300005331 | Ga0070670_100666928 | Ga0070670_1006669281 | 99 |
| 90 | 3300005331 | Ga0070670_100684610 | Ga0070670_1006846101 | 99 |
| 91 | 3300005331 | Ga0070670_100878895 | Ga0070670_1008788952 | 99 |
| 92 | 3300005333 | Ga0070677_10054505 | Ga0070677_100545052 | 99 |
| 93 | 3300005333 | Ga0070677_10141832 | Ga0070677_101418322 | 99 |
| 94 | 3300005333 | Ga0070677_10407330 | Ga0070677_104073301 | 99 |
| 95 | 3300005333 | Ga0070677_10562623 | Ga0070677_105626231 | 99 |
| 96 | 3300005334 | Ga0068869_100017799 | Ga0068869_1000177993 | 99 |
| 97 | 3300005334 | Ga0068869_100022931 | Ga0068869_1000229313 | 99 |
| 98 | 3300005334 | Ga0068869_100053417 | Ga0068869_1000534172 | 99 |
| 99 | 3300005334 | Ga0068869_100058198 | Ga0068869_1000581983 | 99 |
| 100 | 3300005334 | Ga0068869_100078567 | Ga0068869_1000785674 | 99 |
| 101 | 3300005334 | Ga0068869_100098868 | Ga0068869_1000988684 | 99 |
| 102 | 3300005335 | Ga0070666_10004480 | Ga0070666_100044806 | 99 |
| 103 | 3300005335 | Ga0070666_10338710 | Ga0070666_103387102 | 99 |
| 104 | 3300005335 | Ga0070666_10361528 | Ga0070666_103615282 | 99 |
| 105 | 3300005335 | Ga0070666_10770773 | Ga0070666_107707732 | 99 |
| 106 | 3300005337 | Ga0070682_100004396 | Ga0070682_1000043968 | 99 |
| 107 | 3300005337 | Ga0070682_101222467 | Ga0070682_1012224671 | 99 |
| 108 | 3300005338 | Ga0068868_100005937 | Ga0068868_1000059376 | 99 |
| 109 | 3300005338 | Ga0068868_100013130 | Ga0068868_1000131303 | 99 |
| 110 | 3300005338 | Ga0068868_100261978 | Ga0068868_1002619783 | 99 |
| 111 | 3300005338 | Ga0068868_100273456 | Ga0068868_1002734562 | 99 |
| 112 | 3300005338 | Ga0068868_100387346 | Ga0068868_1003873462 | 99 |
| 113 | 3300005338 | Ga0068868_100763262 | Ga0068868_1007632622 | 99 |
| 114 | 3300005338 | Ga0068868_101826814 | Ga0068868_1018268142 | 99 |
| 115 | 3300005340 | Ga0070689_100014907 | Ga0070689_1000149074 | 99 |
| 116 | 3300005340 | Ga0070689_100024173 | Ga0070689_1000241733 | 99 |
| 117 | 3300005340 | Ga0070689_100025709 | Ga0070689_1000257093 | 99 |
| 118 | 3300005340 | Ga0070689_100040531 | Ga0070689_1000405313 | 99 |
| 119 | 3300005343 | Ga0070687_100013203 | Ga0070687_1000132035 | 99 |
| 120 | 3300005344 | Ga0070661_100019629 | Ga0070661_1000196297 | 99 |
| 121 | 3300005344 | Ga0070661_100110631 | Ga0070661_1001106312 | 99 |
| 122 | 3300005344 | Ga0070661_100218317 | Ga0070661_1002183172 | 99 |
| 123 | 3300005344 | Ga0070661_100720103 | Ga0070661_1007201032 | 99 |
| 124 | 3300005344 | Ga0070661_101586447 | Ga0070661_1015864471 | 99 |
| 125 | 3300005347 | Ga0070668_100013719 | Ga0070668_1000137195 | 99 |
| 126 | 3300005347 | Ga0070668_100148831 | Ga0070668_1001488314 | 99 |
| 127 | 3300005347 | Ga0070668_100532105 | Ga0070668_1005321052 | 99 |
| 128 | 3300005347 | Ga0070668_101709677 | Ga0070668_1017096771 | 99 |
| 129 | 3300005353 | Ga0070669_100004915 | Ga0070669_10000491511 | 99 |
| 130 | 3300005353 | Ga0070669_100055836 | Ga0070669_1000558362 | 99 |
| 131 | 3300005353 | Ga0070669_100068950 | Ga0070669_1000689501 | 99 |
| 132 | 3300005353 | Ga0070669_100617202 | Ga0070669_1006172022 | 99 |
| 133 | 3300005354 | Ga0070675_100009178 | Ga0070675_1000091785 | 99 |
| 134 | 3300005354 | Ga0070675_100030573 | Ga0070675_1000305734 | 99 |
| 135 | 3300005354 | Ga0070675_100167024 | Ga0070675_1001670244 | 99 |
| 136 | 3300005354 | Ga0070675_101292958 | Ga0070675_1012929581 | 99 |
| 137 | 3300005355 | Ga0070671_100110351 | Ga0070671_1001103512 | 99 |
| 138 | 3300005355 | Ga0070671_100150056 | Ga0070671_1001500563 | 99 |
| 139 | 3300005355 | Ga0070671_100232786 | Ga0070671_1002327863 | 99 |
| 140 | 3300005355 | Ga0070671_100235221 | Ga0070671_1002352211 | 99 |
| 141 | 3300005355 | Ga0070671_101282248 | Ga0070671_1012822482 | 99 |
| 142 | 3300005356 | Ga0070674_100317527 | Ga0070674_1003175272 | 99 |
| 143 | 3300005356 | Ga0070674_100484704 | Ga0070674_1004847042 | 99 |
| 144 | 3300005364 | Ga0070673_100028363 | Ga0070673_1000283633 | 99 |
| 145 | 3300005364 | Ga0070673_100112443 | Ga0070673_1001124433 | 99 |
| 146 | 3300005364 | Ga0070673_100346225 | Ga0070673_1003462253 | 99 |
| 147 | 3300005364 | Ga0070673_100380156 | Ga0070673_1003801562 | 99 |
| 148 | 3300005364 | Ga0070673_100895384 | Ga0070673_1008953842 | 99 |
| 149 | 3300005364 | Ga0070673_101091602 | Ga0070673_1010916022 | 99 |
| 150 | 3300005364 | Ga0070673_101256805 | Ga0070673_1012568052 | 99 |
| 151 | 3300005364 | Ga0070673_101281909 | Ga0070673_1012819092 | 99 |
| 152 | 3300005364 | Ga0070673_101754742 | Ga0070673_1017547421 | 99 |
| 153 | 3300005364 | Ga0070673_102007834 | Ga0070673_1020078342 | 99 |
| 154 | 3300005365 | Ga0070688_100007885 | Ga0070688_1000078853 | 99 |
| 155 | 3300005365 | Ga0070688_100008468 | Ga0070688_1000084684 | 99 |
| 156 | 3300005365 | Ga0070688_100021223 | Ga0070688_1000212235 | 99 |
| 157 | 3300005365 | Ga0070688_101357769 | Ga0070688_1013577692 | 99 |
| 158 | 3300005366 | Ga0070659_100003078 | Ga0070659_10000307813 | 99 |
| 159 | 3300005366 | Ga0070659_100266940 | Ga0070659_1002669401 | 99 |
| 160 | 3300005366 | Ga0070659_100691773 | Ga0070659_1006917732 | 99 |
| 161 | 3300005366 | Ga0070659_100771798 | Ga0070659_1007717981 | 99 |
| 162 | 3300005367 | Ga0070667_100008847 | Ga0070667_1000088475 | 99 |
| 163 | 3300005367 | Ga0070667_100112891 | Ga0070667_1001128912 | 99 |
| 164 | 3300005367 | Ga0070667_100136660 | Ga0070667_1001366602 | 99 |
| 165 | 3300005367 | Ga0070667_100577028 | Ga0070667_1005770282 | 99 |
| 166 | 3300005367 | Ga0070667_100638213 | Ga0070667_1006382132 | 99 |
| 167 | 3300005367 | Ga0070667_101358270 | Ga0070667_1013582702 | 99 |
| 168 | 3300005367 | Ga0070667_101648569 | Ga0070667_1016485692 | 99 |
| 169 | 3300005367 | Ga0070667_102162299 | Ga0070667_1021622992 | 99 |
| 170 | 3300005436 | Ga0070713_102246801 | Ga0070713_1022468012 | 99 |
| 171 | 3300005438 | Ga0070701_10169195 | Ga0070701_101691952 | 99 |
| 172 | 3300005438 | Ga0070701_10223048 | Ga0070701_102230482 | 99 |
| 173 | 3300005438 | Ga0070701_10263551 | Ga0070701_102635511 | 99 |
| 174 | 3300005438 | Ga0070701_10470025 | Ga0070701_104700251 | 99 |
| 175 | 3300005439 | Ga0070711_101177192 | Ga0070711_1011771922 | 99 |
| 176 | 3300005440 | Ga0070705_100529708 | Ga0070705_1005297082 | 99 |
| 177 | 3300005441 | Ga0070700_100288151 | Ga0070700_1002881512 | 99 |
| 178 | 3300005441 | Ga0070700_100495782 | Ga0070700_1004957821 | 99 |
| 179 | 3300005441 | Ga0070700_101228894 | Ga0070700_1012288941 | 99 |
| 180 | 3300005441 | Ga0070700_101462030 | Ga0070700_1014620301 | 99 |
| 181 | 3300005444 | Ga0070694_100984849 | Ga0070694_1009848491 | 99 |
| 182 | 3300005455 | Ga0070663_100123580 | Ga0070663_1001235802 | 99 |
| 183 | 3300005456 | Ga0070678_100018654 | Ga0070678_1000186543 | 99 |
| 184 | 3300005456 | Ga0070678_100035603 | Ga0070678_1000356032 | 99 |
| 185 | 3300005456 | Ga0070678_101137725 | Ga0070678_1011377252 | 99 |
| 186 | 3300005456 | Ga0070678_101400438 | Ga0070678_1014004382 | 99 |
| 187 | 3300005457 | Ga0070662_100010383 | Ga0070662_1000103834 | 99 |
| 188 | 3300005457 | Ga0070662_100023417 | Ga0070662_1000234172 | 99 |
| 189 | 3300005457 | Ga0070662_100078135 | Ga0070662_1000781354 | 99 |
| 190 | 3300005457 | Ga0070662_100123997 | Ga0070662_1001239972 | 99 |
| 191 | 3300005457 | Ga0070662_101071192 | Ga0070662_1010711921 | 99 |
| 192 | 3300005459 | Ga0068867_100025237 | Ga0068867_1000252372 | 99 |
| 193 | 3300005459 | Ga0068867_100054133 | Ga0068867_1000541334 | 99 |
| 194 | 3300005459 | Ga0068867_100133752 | Ga0068867_1001337523 | 99 |
| 195 | 3300005459 | Ga0068867_100170091 | Ga0068867_1001700912 | 99 |
| 196 | 3300005459 | Ga0068867_100219713 | Ga0068867_1002197132 | 99 |
| 197 | 3300005459 | Ga0068867_100316363 | Ga0068867_1003163632 | 99 |
| 198 | 3300005459 | Ga0068867_100664133 | Ga0068867_1006641332 | 99 |
| 199 | 3300005459 | Ga0068867_101127578 | Ga0068867_1011275781 | 99 |
| 200 | 3300005466 | Ga0070685_10003971 | Ga0070685_100039712 | 99 |
| 201 | 3300005466 | Ga0070685_10010419 | Ga0070685_100104194 | 99 |
| 202 | 3300005466 | Ga0070685_10041829 | Ga0070685_100418293 | 99 |
| 203 | 3300005466 | Ga0070685_10126283 | Ga0070685_101262832 | 99 |
| 204 | 3300005466 | Ga0070685_10263780 | Ga0070685_102637801 | 99 |
| 205 | 3300005466 | Ga0070685_10371365 | Ga0070685_103713652 | 99 |
| 206 | 3300005466 | Ga0070685_11485740 | Ga0070685_114857401 | 99 |
| 207 | 3300005471 | Ga0070698_100056168 | Ga0070698_1000561684 | 99 |
| 208 | 3300005518 | Ga0070699_100328589 | Ga0070699_1003285892 | 99 |
| 209 | 3300005518 | Ga0070699_100774410 | Ga0070699_1007744101 | 99 |
| 210 | 3300005518 | Ga0070699_101099472 | Ga0070699_1010994722 | 99 |
| 211 | 3300005530 | Ga0070679_100009158 | Ga0070679_1000091582 | 99 |
| 212 | 3300005535 | Ga0070684_100000995 | Ga0070684_10000099517 | 99 |
| 213 | 3300005535 | Ga0070684_100007553 | Ga0070684_1000075536 | 99 |
| 214 | 3300005535 | Ga0070684_100054427 | Ga0070684_1000544272 | 99 |
| 215 | 3300005535 | Ga0070684_100375061 | Ga0070684_1003750612 | 99 |
| 216 | 3300005535 | Ga0070684_100376607 | Ga0070684_1003766072 | 99 |
| 217 | 3300005539 | Ga0068853_100004736 | Ga0068853_1000047363 | 99 |
| 218 | 3300005539 | Ga0068853_100509371 | Ga0068853_1005093714 | 99 |
| 219 | 3300005539 | Ga0068853_100537705 | Ga0068853_1005377053 | 99 |
| 220 | 3300005539 | Ga0068853_100553412 | Ga0068853_1005534122 | 99 |
| 221 | 3300005543 | Ga0070672_100074663 | Ga0070672_1000746632 | 99 |
| 222 | 3300005543 | Ga0070672_100496091 | Ga0070672_1004960912 | 99 |
| 223 | 3300005543 | Ga0070672_100607859 | Ga0070672_1006078591 | 99 |
| 224 | 3300005543 | Ga0070672_100732556 | Ga0070672_1007325562 | 99 |
| 225 | 3300005543 | Ga0070672_101701053 | Ga0070672_1017010531 | 99 |
| 226 | 3300005543 | Ga0070672_101718224 | Ga0070672_1017182242 | 99 |
| 227 | 3300005544 | Ga0070686_100032440 | Ga0070686_1000324404 | 99 |
| 228 | 3300005544 | Ga0070686_100122814 | Ga0070686_1001228144 | 99 |
| 229 | 3300005544 | Ga0070686_100479820 | Ga0070686_1004798202 | 99 |
| 230 | 3300005544 | Ga0070686_100513841 | Ga0070686_1005138412 | 99 |
| 231 | 3300005545 | Ga0070695_100649834 | Ga0070695_1006498342 | 99 |
| 232 | 3300005545 | Ga0070695_101065316 | Ga0070695_1010653161 | 99 |
| 233 | 3300005546 | Ga0070696_100338710 | Ga0070696_1003387103 | 99 |
| 234 | 3300005547 | Ga0070693_100222641 | Ga0070693_1002226412 | 99 |
| 235 | 3300005548 | Ga0070665_100002492 | Ga0070665_10000249213 | 99 |
| 236 | 3300005548 | Ga0070665_100199412 | Ga0070665_1001994123 | 99 |
| 237 | 3300005548 | Ga0070665_100722115 | Ga0070665_1007221152 | 99 |
| 238 | 3300005548 | Ga0070665_101354247 | Ga0070665_1013542472 | 99 |
| 239 | 3300005549 | Ga0070704_101567279 | Ga0070704_1015672792 | 99 |
| 240 | 3300005563 | Ga0068855_100061427 | Ga0068855_1000614275 | 99 |
| 241 | 3300005563 | Ga0068855_101877061 | Ga0068855_1018770612 | 99 |
| 242 | 3300005564 | Ga0070664_100001774 | Ga0070664_1000017746 | 99 |
| 243 | 3300005564 | Ga0070664_100006101 | Ga0070664_1000061013 | 99 |
| 244 | 3300005564 | Ga0070664_100162585 | Ga0070664_1001625854 | 99 |
| 245 | 3300005564 | Ga0070664_100191340 | Ga0070664_1001913403 | 99 |
| 246 | 3300005577 | Ga0068857_100026740 | Ga0068857_1000267402 | 99 |
| 247 | 3300005577 | Ga0068857_100035852 | Ga0068857_1000358525 | 99 |
| 248 | 3300005577 | Ga0068857_100113353 | Ga0068857_1001133531 | 99 |
| 249 | 3300005577 | Ga0068857_100185247 | Ga0068857_1001852472 | 99 |
| 250 | 3300005577 | Ga0068857_100215771 | Ga0068857_1002157712 | 99 |
| 251 | 3300005577 | Ga0068857_100295426 | Ga0068857_1002954262 | 99 |
| 252 | 3300005577 | Ga0068857_100442603 | Ga0068857_1004426032 | 99 |
| 253 | 3300005577 | Ga0068857_100599055 | Ga0068857_1005990551 | 99 |
| 254 | 3300005577 | Ga0068857_100806248 | Ga0068857_1008062482 | 99 |
| 255 | 3300005577 | Ga0068857_101144879 | Ga0068857_1011448792 | 99 |
| 256 | 3300005578 | Ga0068854_100020807 | Ga0068854_1000208074 | 99 |
| 257 | 3300005578 | Ga0068854_101258726 | Ga0068854_1012587261 | 99 |
| 258 | 3300005614 | Ga0068856_102227666 | Ga0068856_1022276662 | 99 |
| 259 | 3300005615 | Ga0070702_100464833 | Ga0070702_1004648332 | 99 |
| 260 | 3300005616 | Ga0068852_100307303 | Ga0068852_1003073032 | 99 |
| 261 | 3300005616 | Ga0068852_101290221 | Ga0068852_1012902212 | 99 |
| 262 | 3300005617 | Ga0068859_100002822 | Ga0068859_1000028224 | 99 |
| 263 | 3300005617 | Ga0068859_100029450 | Ga0068859_1000294504 | 99 |
| 264 | 3300005617 | Ga0068859_100091945 | Ga0068859_1000919453 | 99 |
| 265 | 3300005617 | Ga0068859_100118674 | Ga0068859_1001186741 | 99 |
| 266 | 3300005617 | Ga0068859_100222328 | Ga0068859_1002223281 | 99 |
| 267 | 3300005617 | Ga0068859_100308909 | Ga0068859_1003089093 | 99 |
| 268 | 3300005617 | Ga0068859_100795581 | Ga0068859_1007955812 | 99 |
| 269 | 3300005618 | Ga0068864_100023594 | Ga0068864_1000235943 | 99 |
| 270 | 3300005618 | Ga0068864_100189701 | Ga0068864_1001897013 | 99 |
| 271 | 3300005618 | Ga0068864_100769360 | Ga0068864_1007693602 | 99 |
| 272 | 3300005618 | Ga0068864_101424500 | Ga0068864_1014245001 | 99 |
| 273 | 3300005618 | Ga0068864_101688576 | Ga0068864_1016885761 | 99 |
| 274 | 3300005618 | Ga0068864_101889295 | Ga0068864_1018892952 | 99 |
| 275 | 3300005718 | Ga0068866_10008998 | Ga0068866_100089984 | 99 |
| 276 | 3300005719 | Ga0068861_100001772 | Ga0068861_1000017724 | 99 |
| 277 | 3300005719 | Ga0068861_100017269 | Ga0068861_1000172694 | 99 |
| 278 | 3300005719 | Ga0068861_100044377 | Ga0068861_1000443775 | 99 |
| 279 | 3300005719 | Ga0068861_100258144 | Ga0068861_1002581442 | 99 |
| 280 | 3300005719 | Ga0068861_100290374 | Ga0068861_1002903742 | 99 |
| 281 | 3300005719 | Ga0068861_100412765 | Ga0068861_1004127652 | 99 |
| 282 | 3300005719 | Ga0068861_100550602 | Ga0068861_1005506023 | 99 |
| 283 | 3300005719 | Ga0068861_101593426 | Ga0068861_1015934262 | 99 |
| 284 | 3300005719 | Ga0068861_101951319 | Ga0068861_1019513191 | 99 |
| 285 | 3300005719 | Ga0068861_102253362 | Ga0068861_1022533621 | 99 |
| 286 | 3300005834 | Ga0068851_10262209 | Ga0068851_102622092 | 99 |
| 287 | 3300005840 | Ga0068870_10230219 | Ga0068870_102302192 | 99 |
| 288 | 3300005840 | Ga0068870_10857559 | Ga0068870_108575592 | 99 |
| 289 | 3300005841 | Ga0068863_100030815 | Ga0068863_1000308153 | 99 |
| 290 | 3300005841 | Ga0068863_100047050 | Ga0068863_1000470505 | 99 |
| 291 | 3300005841 | Ga0068863_100076286 | Ga0068863_1000762864 | 99 |
| 292 | 3300005841 | Ga0068863_100383849 | Ga0068863_1003838492 | 99 |
| 293 | 3300005841 | Ga0068863_100559999 | Ga0068863_1005599993 | 99 |
| 294 | 3300005841 | Ga0068863_100696940 | Ga0068863_1006969402 | 99 |
| 295 | 3300005841 | Ga0068863_101866351 | Ga0068863_1018663512 | 99 |
| 296 | 3300005842 | Ga0068858_100048719 | Ga0068858_1000487193 | 99 |
| 297 | 3300005842 | Ga0068858_100065866 | Ga0068858_1000658663 | 99 |
| 298 | 3300005842 | Ga0068858_100174823 | Ga0068858_1001748232 | 99 |
| 299 | 3300005842 | Ga0068858_100185574 | Ga0068858_1001855742 | 99 |
| 300 | 3300005842 | Ga0068858_100357793 | Ga0068858_1003577931 | 99 |
| 301 | 3300005842 | Ga0068858_101959183 | Ga0068858_1019591832 | 99 |
| 302 | 3300005843 | Ga0068860_100204138 | Ga0068860_1002041383 | 99 |
| 303 | 3300005843 | Ga0068860_100261214 | Ga0068860_1002612142 | 99 |
| 304 | 3300005843 | Ga0068860_100345388 | Ga0068860_1003453881 | 99 |
| 305 | 3300005843 | Ga0068860_100587538 | Ga0068860_1005875382 | 99 |
| 306 | 3300005843 | Ga0068860_101084025 | Ga0068860_1010840252 | 99 |
| 307 | 3300005844 | Ga0068862_100009580 | Ga0068862_1000095809 | 99 |
| 308 | 3300005844 | Ga0068862_100100885 | Ga0068862_1001008853 | 99 |
| 309 | 3300005844 | Ga0068862_100169160 | Ga0068862_1001691604 | 99 |
| 310 | 3300005844 | Ga0068862_100201988 | Ga0068862_1002019883 | 99 |
| 311 | 3300005844 | Ga0068862_100335512 | Ga0068862_1003355122 | 99 |
| 312 | 3300005844 | Ga0068862_100860558 | Ga0068862_1008605581 | 99 |
| 313 | 3300005844 | Ga0068862_102254094 | Ga0068862_1022540941 | 99 |
| 314 | 3300005844 | Ga0068862_102676828 | Ga0068862_1026768282 | 99 |
| 315 | 3300006028 | Ga0070717_11704411 | Ga0070717_117044111 | 99 |
| 316 | 3300006163 | Ga0070715_10284825 | Ga0070715_102848252 | 99 |
| 317 | 3300006195 | Ga0075366_10004353 | Ga0075366_100043533 | 99 |
| 318 | 3300006195 | Ga0075366_10128109 | Ga0075366_101281094 | 99 |
| 319 | 3300006195 | Ga0075366_10378713 | Ga0075366_103787132 | 99 |
| 320 | 3300006237 | Ga0097621_100028621 | Ga0097621_1000286216 | 99 |
| 321 | 3300006237 | Ga0097621_100500564 | Ga0097621_1005005642 | 99 |
| 322 | 3300006237 | Ga0097621_100686158 | Ga0097621_1006861582 | 99 |
| 323 | 3300006237 | Ga0097621_101679292 | Ga0097621_1016792921 | 99 |
| 324 | 3300006237 | Ga0097621_101811841 | Ga0097621_1018118411 | 99 |
| 325 | 3300006237 | Ga0097621_102068902 | Ga0097621_1020689022 | 99 |
| 326 | 3300006358 | Ga0068871_100093437 | Ga0068871_1000934373 | 99 |
| 327 | 3300006358 | Ga0068871_100246264 | Ga0068871_1002462641 | 99 |
| 328 | 3300006358 | Ga0068871_101482432 | Ga0068871_1014824322 | 99 |
| 329 | 3300006358 | Ga0068871_101573206 | Ga0068871_1015732061 | 99 |
| 330 | 3300006844 | Ga0075428_100025886 | Ga0075428_10002588611 | 99 |
| 331 | 3300006844 | Ga0075428_100078023 | Ga0075428_1000780234 | 99 |
| 332 | 3300006846 | Ga0075430_100014225 | Ga0075430_1000142259 | 99 |
| 333 | 3300006847 | Ga0075431_100083698 | Ga0075431_1000836982 | 99 |
| 334 | 3300006852 | Ga0075433_10865034 | Ga0075433_108650342 | 99 |
| 335 | 3300006880 | Ga0075429_100000533 | Ga0075429_10000053331 | 99 |
| 336 | 3300006880 | Ga0075429_100176026 | Ga0075429_1001760261 | 99 |
| 337 | 3300006881 | Ga0068865_100016762 | Ga0068865_1000167625 | 99 |
| 338 | 3300006881 | Ga0068865_100375037 | Ga0068865_1003750373 | 99 |
| 339 | 3300006881 | Ga0068865_100759975 | Ga0068865_1007599752 | 99 |
| 340 | 3300006881 | Ga0068865_101155883 | Ga0068865_1011558831 | 99 |
| 341 | 3300006881 | Ga0068865_101247691 | Ga0068865_1012476912 | 99 |
| 342 | 3300006881 | Ga0068865_101706434 | Ga0068865_1017064342 | 99 |
| 343 | 3300006931 | Ga0097620_100002822 | Ga0097620_10000282217 | 99 |
| 344 | 3300006931 | Ga0097620_100029453 | Ga0097620_1000294534 | 99 |
| 345 | 3300006931 | Ga0097620_100091940 | Ga0097620_1000919403 | 99 |
| 346 | 3300006931 | Ga0097620_100118676 | Ga0097620_1001186761 | 99 |
| 347 | 3300006931 | Ga0097620_100222338 | Ga0097620_1002223381 | 99 |
| 348 | 3300006931 | Ga0097620_100308913 | Ga0097620_1003089132 | 99 |
| 349 | 3300006931 | Ga0097620_100795552 | Ga0097620_1007955522 | 99 |
| 350 | 3300009011 | Ga0105251_10167642 | Ga0105251_101676421 | 99 |
| 351 | 3300009093 | Ga0105240_10006100 | Ga0105240_1000610018 | 99 |
| 352 | 3300009093 | Ga0105240_10403482 | Ga0105240_104034822 | 99 |
| 353 | 3300009093 | Ga0105240_10825950 | Ga0105240_108259502 | 99 |
| 354 | 3300009093 | Ga0105240_10921344 | Ga0105240_109213442 | 99 |
| 355 | 3300009094 | Ga0111539_10003935 | Ga0111539_100039355 | 99 |
| 356 | 3300009094 | Ga0111539_10194276 | Ga0111539_101942762 | 99 |
| 357 | 3300009094 | Ga0111539_10405992 | Ga0111539_104059922 | 99 |
| 358 | 3300009094 | Ga0111539_11238718 | Ga0111539_112387181 | 99 |
| 359 | 3300009094 | Ga0111539_12121033 | Ga0111539_121210332 | 99 |
| 360 | 3300009094 | Ga0111539_12176837 | Ga0111539_121768372 | 99 |
| 361 | 3300009101 | Ga0105247_10003381 | Ga0105247_1000338112 | 99 |
| 362 | 3300009101 | Ga0105247_10350040 | Ga0105247_103500401 | 99 |
| 363 | 3300009101 | Ga0105247_10713407 | Ga0105247_107134072 | 99 |
| 364 | 3300009101 | Ga0105247_11487146 | Ga0105247_114871461 | 99 |
| 365 | 3300009101 | Ga0105247_11491109 | Ga0105247_114911091 | 99 |
| 366 | 3300009147 | Ga0114129_10055628 | Ga0114129_100556282 | 99 |
| 367 | 3300009147 | Ga0114129_10527949 | Ga0114129_105279493 | 99 |
| 368 | 3300009147 | Ga0114129_10743522 | Ga0114129_107435222 | 99 |
| 369 | 3300009147 | Ga0114129_12027959 | Ga0114129_120279592 | 99 |
| 370 | 3300009148 | Ga0105243_10748645 | Ga0105243_107486452 | 99 |
| 371 | 3300009174 | Ga0105241_10002034 | Ga0105241_100020342 | 99 |
| 372 | 3300009174 | Ga0105241_10202248 | Ga0105241_102022482 | 99 |
| 373 | 3300009174 | Ga0105241_10370709 | Ga0105241_103707092 | 99 |
| 374 | 3300009174 | Ga0105241_10387242 | Ga0105241_103872423 | 99 |
| 375 | 3300009174 | Ga0105241_10832695 | Ga0105241_108326952 | 99 |
| 376 | 3300009174 | Ga0105241_10908279 | Ga0105241_109082792 | 99 |
| 377 | 3300009176 | Ga0105242_10088493 | Ga0105242_100884935 | 99 |
| 378 | 3300009176 | Ga0105242_10428946 | Ga0105242_104289462 | 99 |
| 379 | 3300009176 | Ga0105242_11067601 | Ga0105242_110676011 | 99 |
| 380 | 3300009176 | Ga0105242_11254731 | Ga0105242_112547312 | 99 |
| 381 | 3300009176 | Ga0105242_12644916 | Ga0105242_126449162 | 99 |
| 382 | 3300009177 | Ga0105248_10208097 | Ga0105248_102080974 | 99 |
| 383 | 3300009177 | Ga0105248_11472085 | Ga0105248_114720852 | 99 |
| 384 | 3300009177 | Ga0105248_11717501 | Ga0105248_117175012 | 99 |
| 385 | 3300009177 | Ga0105248_11948589 | Ga0105248_119485892 | 99 |
| 386 | 3300009177 | Ga0105248_12818266 | Ga0105248_128182662 | 99 |
| 387 | 3300009545 | Ga0105237_10445914 | Ga0105237_104459142 | 99 |
| 388 | 3300009545 | Ga0105237_10641414 | Ga0105237_106414142 | 99 |
| 389 | 3300009545 | Ga0105237_10676782 | Ga0105237_106767823 | 99 |
| 390 | 3300009551 | Ga0105238_11998972 | Ga0105238_119989722 | 99 |
| 391 | 3300009553 | Ga0105249_10002193 | Ga0105249_1000219312 | 99 |
| 392 | 3300009553 | Ga0105249_10006815 | Ga0105249_100068158 | 99 |
| 393 | 3300009553 | Ga0105249_10012704 | Ga0105249_100127044 | 99 |
| 394 | 3300009553 | Ga0105249_10023038 | Ga0105249_100230384 | 99 |
| 395 | 3300009553 | Ga0105249_10046670 | Ga0105249_100466703 | 99 |
| 396 | 3300009553 | Ga0105249_10247832 | Ga0105249_102478322 | 99 |
| 397 | 3300009553 | Ga0105249_10294614 | Ga0105249_102946143 | 99 |
| 398 | 3300009553 | Ga0105249_10417805 | Ga0105249_104178053 | 99 |
| 399 | 3300009553 | Ga0105249_10604077 | Ga0105249_106040772 | 99 |
| 400 | 3300009553 | Ga0105249_10841050 | Ga0105249_108410502 | 99 |
| 401 | 3300009553 | Ga0105249_12264764 | Ga0105249_122647642 | 99 |
| 402 | 3300010375 | Ga0105239_10145403 | Ga0105239_101454032 | 99 |
| 403 | 3300010375 | Ga0105239_10534590 | Ga0105239_105345902 | 99 |
| 404 | 3300010375 | Ga0105239_10601323 | Ga0105239_106013232 | 99 |
| 405 | 3300011119 | Ga0105246_10257922 | Ga0105246_102579221 | 99 |
| 406 | 3300011119 | Ga0105246_10684602 | Ga0105246_106846021 | 99 |
| 407 | 3300011119 | Ga0105246_10788380 | Ga0105246_107883802 | 99 |
| 408 | 3300011119 | Ga0105246_11840854 | Ga0105246_118408541 | 99 |
| 409 | 3300012485 | Ga0157325_1031292 | Ga0157325_10312921 | 99 |
| 410 | 3300013100 | Ga0157373_10315527 | Ga0157373_103155272 | 99 |
| 411 | 3300013100 | Ga0157373_10846155 | Ga0157373_108461551 | 99 |
| 412 | 3300013102 | Ga0157371_10869579 | Ga0157371_108695791 | 99 |
| 413 | 3300013102 | Ga0157371_11093060 | Ga0157371_110930602 | 99 |
| 414 | 3300013104 | Ga0157370_10006548 | Ga0157370_100065485 | 99 |
| 415 | 3300013104 | Ga0157370_10018237 | Ga0157370_100182379 | 99 |
| 416 | 3300013104 | Ga0157370_10049385 | Ga0157370_100493853 | 99 |
| 417 | 3300013104 | Ga0157370_11607282 | Ga0157370_116072822 | 99 |
| 418 | 3300013105 | Ga0157369_10372541 | Ga0157369_103725412 | 99 |
| 419 | 3300013105 | Ga0157369_10396855 | Ga0157369_103968553 | 99 |
| 420 | 3300013105 | Ga0157369_10710774 | Ga0157369_107107742 | 99 |
| 421 | 3300013296 | Ga0157374_10002306 | Ga0157374_1000230614 | 99 |
| 422 | 3300013296 | Ga0157374_10014218 | Ga0157374_1001421810 | 99 |
| 423 | 3300013296 | Ga0157374_10019065 | Ga0157374_100190653 | 99 |
| 424 | 3300013296 | Ga0157374_10798772 | Ga0157374_107987723 | 99 |
| 425 | 3300013296 | Ga0157374_10851903 | Ga0157374_108519032 | 99 |
| 426 | 3300013296 | Ga0157374_11091731 | Ga0157374_110917312 | 99 |
| 427 | 3300013297 | Ga0157378_10121956 | Ga0157378_101219562 | 99 |
| 428 | 3300013297 | Ga0157378_10382625 | Ga0157378_103826253 | 99 |
| 429 | 3300013297 | Ga0157378_11200077 | Ga0157378_112000772 | 99 |
| 430 | 3300013297 | Ga0157378_11790281 | Ga0157378_117902812 | 99 |
| 431 | 3300013297 | Ga0157378_12848215 | Ga0157378_128482152 | 99 |
| 432 | 3300013306 | Ga0163162_10004448 | Ga0163162_100044487 | 99 |
| 433 | 3300013306 | Ga0163162_10014246 | Ga0163162_100142466 | 99 |
| 434 | 3300013306 | Ga0163162_10020100 | Ga0163162_100201006 | 99 |
| 435 | 3300013306 | Ga0163162_10027978 | Ga0163162_100279782 | 99 |
| 436 | 3300013306 | Ga0163162_10117366 | Ga0163162_101173661 | 99 |
| 437 | 3300013306 | Ga0163162_10240533 | Ga0163162_102405335 | 99 |
| 438 | 3300013306 | Ga0163162_10322890 | Ga0163162_103228903 | 99 |
| 439 | 3300013306 | Ga0163162_10677439 | Ga0163162_106774392 | 99 |
| 440 | 3300013306 | Ga0163162_10923735 | Ga0163162_109237351 | 99 |
| 441 | 3300013306 | Ga0163162_11396635 | Ga0163162_113966352 | 99 |
| 442 | 3300013307 | Ga0157372_10137420 | Ga0157372_101374203 | 99 |
| 443 | 3300013307 | Ga0157372_10164580 | Ga0157372_101645802 | 99 |
| 444 | 3300013307 | Ga0157372_10292130 | Ga0157372_102921302 | 99 |
| 445 | 3300013307 | Ga0157372_10450393 | Ga0157372_104503931 | 99 |
| 446 | 3300013307 | Ga0157372_11329778 | Ga0157372_113297782 | 99 |
| 447 | 3300013307 | Ga0157372_11700051 | Ga0157372_117000512 | 99 |
| 448 | 3300013307 | Ga0157372_11786148 | Ga0157372_117861482 | 99 |
| 449 | 3300013307 | Ga0157372_12505393 | Ga0157372_125053932 | 99 |
| 450 | 3300013308 | Ga0157375_10009467 | Ga0157375_100094672 | 99 |
| 451 | 3300013308 | Ga0157375_10017272 | Ga0157375_100172722 | 99 |
| 452 | 3300013308 | Ga0157375_10019432 | Ga0157375_100194327 | 99 |
| 453 | 3300013308 | Ga0157375_10060278 | Ga0157375_100602783 | 99 |
| 454 | 3300013308 | Ga0157375_10071276 | Ga0157375_100712763 | 99 |
| 455 | 3300013308 | Ga0157375_10077537 | Ga0157375_100775372 | 99 |
| 456 | 3300013308 | Ga0157375_10152664 | Ga0157375_101526643 | 99 |
| 457 | 3300013308 | Ga0157375_10285313 | Ga0157375_102853132 | 99 |
| 458 | 3300013308 | Ga0157375_10415384 | Ga0157375_104153842 | 99 |
| 459 | 3300013308 | Ga0157375_12936614 | Ga0157375_129366141 | 99 |
| 460 | 3300013308 | Ga0157375_13559694 | Ga0157375_135596941 | 99 |
| 461 | 3300014325 | Ga0163163_10000846 | Ga0163163_1000084619 | 99 |
| 462 | 3300014325 | Ga0163163_10080496 | Ga0163163_100804963 | 99 |
| 463 | 3300014325 | Ga0163163_10220152 | Ga0163163_102201525 | 99 |
| 464 | 3300014325 | Ga0163163_10454991 | Ga0163163_104549912 | 99 |
| 465 | 3300014325 | Ga0163163_10527248 | Ga0163163_105272482 | 99 |
| 466 | 3300014325 | Ga0163163_10739491 | Ga0163163_107394912 | 99 |
| 467 | 3300014326 | Ga0157380_10001544 | Ga0157380_100015443 | 99 |
| 468 | 3300014326 | Ga0157380_10008119 | Ga0157380_100081192 | 99 |
| 469 | 3300014326 | Ga0157380_10041354 | Ga0157380_100413543 | 99 |
| 470 | 3300014326 | Ga0157380_10109060 | Ga0157380_101090604 | 99 |
| 471 | 3300014326 | Ga0157380_10514667 | Ga0157380_105146671 | 99 |
| 472 | 3300014326 | Ga0157380_11302793 | Ga0157380_113027932 | 99 |
| 473 | 3300014326 | Ga0157380_11553029 | Ga0157380_115530292 | 99 |
| 474 | 3300014745 | Ga0157377_10004687 | Ga0157377_100046877 | 99 |
| 475 | 3300014745 | Ga0157377_10012607 | Ga0157377_100126073 | 99 |
| 476 | 3300014745 | Ga0157377_10013025 | Ga0157377_100130253 | 99 |
| 477 | 3300014745 | Ga0157377_10135349 | Ga0157377_101353494 | 99 |
| 478 | 3300014745 | Ga0157377_10367270 | Ga0157377_103672702 | 99 |
| 479 | 3300014745 | Ga0157377_10423808 | Ga0157377_104238082 | 99 |
| 480 | 3300014745 | Ga0157377_10635274 | Ga0157377_106352741 | 99 |
| 481 | 3300014968 | Ga0157379_10062128 | Ga0157379_100621282 | 99 |
| 482 | 3300014968 | Ga0157379_10067074 | Ga0157379_100670744 | 99 |
| 483 | 3300014968 | Ga0157379_10158486 | Ga0157379_101584861 | 99 |
| 484 | 3300014968 | Ga0157379_10244990 | Ga0157379_102449902 | 99 |
| 485 | 3300014968 | Ga0157379_10319184 | Ga0157379_103191842 | 99 |
| 486 | 3300014968 | Ga0157379_11164634 | Ga0157379_111646342 | 99 |
| 487 | 3300014968 | Ga0157379_11367115 | Ga0157379_113671151 | 99 |
| 488 | 3300014969 | Ga0157376_10019085 | Ga0157376_100190854 | 99 |
| 489 | 3300014969 | Ga0157376_10052830 | Ga0157376_100528303 | 99 |
| 490 | 3300014969 | Ga0157376_10395123 | Ga0157376_103951234 | 99 |
| 491 | 3300014969 | Ga0157376_11020896 | Ga0157376_110208962 | 99 |
| 492 | 3300014969 | Ga0157376_11427980 | Ga0157376_114279802 | 99 |
| 493 | 3300014969 | Ga0157376_11867280 | Ga0157376_118672801 | 99 |
| 494 | 3300017792 | Ga0163161_10003828 | Ga0163161_100038289 | 99 |
| 495 | 3300017792 | Ga0163161_10023481 | Ga0163161_100234816 | 99 |
| 496 | 3300017792 | Ga0163161_10142714 | Ga0163161_101427142 | 99 |
| 497 | 3300017792 | Ga0163161_10165050 | Ga0163161_101650502 | 99 |
| 498 | 3300017792 | Ga0163161_10351633 | Ga0163161_103516334 | 99 |
| 499 | 3300017792 | Ga0163161_10681461 | Ga0163161_106814612 | 99 |
| 500 | 3300017792 | Ga0163161_10833487 | Ga0163161_108334871 | 99 |
| 501 | 3300017792 | Ga0163161_11023592 | Ga0163161_110235922 | 99 |
| 502 | 3300017792 | Ga0163161_11154013 | Ga0163161_111540132 | 99 |
| 503 | 3300025271 | Ga0207666_1078129 | Ga0207666_10781292 | 99 |
| 504 | 3300025315 | Ga0207697_10061135 | Ga0207697_100611351 | 99 |
| 505 | 3300025315 | Ga0207697_10137364 | Ga0207697_101373642 | 99 |
| 506 | 3300025321 | Ga0207656_10615310 | Ga0207656_106153101 | 99 |
| 507 | 3300025893 | Ga0207682_10021788 | Ga0207682_100217882 | 99 |
| 508 | 3300025893 | Ga0207682_10124900 | Ga0207682_101249002 | 99 |
| 509 | 3300025893 | Ga0207682_10424806 | Ga0207682_104248061 | 99 |
| 510 | 3300025893 | Ga0207682_10435376 | Ga0207682_104353761 | 99 |
| 511 | 3300025899 | Ga0207642_10691675 | Ga0207642_106916752 | 99 |
| 512 | 3300025900 | Ga0207710_10001761 | Ga0207710_100017614 | 99 |
| 513 | 3300025901 | Ga0207688_10014698 | Ga0207688_100146983 | 99 |
| 514 | 3300025901 | Ga0207688_10298365 | Ga0207688_102983652 | 99 |
| 515 | 3300025903 | Ga0207680_10458512 | Ga0207680_104585122 | 99 |
| 516 | 3300025903 | Ga0207680_10499920 | Ga0207680_104999201 | 99 |
| 517 | 3300025903 | Ga0207680_10805807 | Ga0207680_108058072 | 99 |
| 518 | 3300025904 | Ga0207647_10097550 | Ga0207647_100975502 | 99 |
| 519 | 3300025904 | Ga0207647_10470476 | Ga0207647_104704762 | 99 |
| 520 | 3300025904 | Ga0207647_10678212 | Ga0207647_106782122 | 99 |
| 521 | 3300025907 | Ga0207645_10011686 | Ga0207645_100116864 | 99 |
| 522 | 3300025907 | Ga0207645_10013131 | Ga0207645_100131313 | 99 |
| 523 | 3300025907 | Ga0207645_10160475 | Ga0207645_101604752 | 99 |
| 524 | 3300025907 | Ga0207645_10283516 | Ga0207645_102835162 | 99 |
| 525 | 3300025908 | Ga0207643_10002640 | Ga0207643_1000264010 | 99 |
| 526 | 3300025908 | Ga0207643_10464015 | Ga0207643_104640152 | 99 |
| 527 | 3300025911 | Ga0207654_10066629 | Ga0207654_100666295 | 99 |
| 528 | 3300025912 | Ga0207707_10000117 | Ga0207707_1000011726 | 99 |
| 529 | 3300025913 | Ga0207695_10013789 | Ga0207695_100137896 | 99 |
| 530 | 3300025913 | Ga0207695_10013922 | Ga0207695_100139228 | 99 |
| 531 | 3300025913 | Ga0207695_11434771 | Ga0207695_114347711 | 99 |
| 532 | 3300025914 | Ga0207671_10000340 | Ga0207671_1000034026 | 99 |
| 533 | 3300025914 | Ga0207671_10202020 | Ga0207671_102020203 | 99 |
| 534 | 3300025914 | Ga0207671_10450063 | Ga0207671_104500632 | 99 |
| 535 | 3300025914 | Ga0207671_11104634 | Ga0207671_111046341 | 99 |
| 536 | 3300025917 | Ga0207660_10038339 | Ga0207660_100383393 | 99 |
| 537 | 3300025918 | Ga0207662_10792836 | Ga0207662_107928362 | 99 |
| 538 | 3300025919 | Ga0207657_10003538 | Ga0207657_1000353810 | 99 |
| 539 | 3300025919 | Ga0207657_10735459 | Ga0207657_107354592 | 99 |
| 540 | 3300025919 | Ga0207657_11298647 | Ga0207657_112986472 | 99 |
| 541 | 3300025920 | Ga0207649_10005540 | Ga0207649_100055403 | 99 |
| 542 | 3300025920 | Ga0207649_10265570 | Ga0207649_102655702 | 99 |
| 543 | 3300025920 | Ga0207649_11242006 | Ga0207649_112420062 | 99 |
| 544 | 3300025920 | Ga0207649_11588672 | Ga0207649_115886721 | 99 |
| 545 | 3300025921 | Ga0207652_10001410 | Ga0207652_1000141021 | 99 |
| 546 | 3300025922 | Ga0207646_10185678 | Ga0207646_101856782 | 99 |
| 547 | 3300025923 | Ga0207681_10029387 | Ga0207681_100293874 | 99 |
| 548 | 3300025925 | Ga0207650_10049153 | Ga0207650_100491533 | 99 |
| 549 | 3300025925 | Ga0207650_10331440 | Ga0207650_103314402 | 99 |
| 550 | 3300025925 | Ga0207650_10678078 | Ga0207650_106780782 | 99 |
| 551 | 3300025925 | Ga0207650_10895026 | Ga0207650_108950261 | 99 |
| 552 | 3300025925 | Ga0207650_11662322 | Ga0207650_116623221 | 99 |
| 553 | 3300025926 | Ga0207659_10022271 | Ga0207659_100222715 | 99 |
| 554 | 3300025926 | Ga0207659_11133202 | Ga0207659_111332022 | 99 |
| 555 | 3300025926 | Ga0207659_11804344 | Ga0207659_118043441 | 99 |
| 556 | 3300025928 | Ga0207700_11700435 | Ga0207700_117004352 | 99 |
| 557 | 3300025931 | Ga0207644_10013769 | Ga0207644_100137692 | 99 |
| 558 | 3300025931 | Ga0207644_10052928 | Ga0207644_100529283 | 99 |
| 559 | 3300025931 | Ga0207644_10739578 | Ga0207644_107395781 | 99 |
| 560 | 3300025931 | Ga0207644_10787053 | Ga0207644_107870531 | 99 |
| 561 | 3300025931 | Ga0207644_11464484 | Ga0207644_114644842 | 99 |
| 562 | 3300025932 | Ga0207690_10016335 | Ga0207690_100163354 | 99 |
| 563 | 3300025932 | Ga0207690_10083872 | Ga0207690_100838722 | 99 |
| 564 | 3300025932 | Ga0207690_10299448 | Ga0207690_102994481 | 99 |
| 565 | 3300025932 | Ga0207690_10382033 | Ga0207690_103820332 | 99 |
| 566 | 3300025932 | Ga0207690_10767534 | Ga0207690_107675341 | 99 |
| 567 | 3300025933 | Ga0207706_10029992 | Ga0207706_100299923 | 99 |
| 568 | 3300025933 | Ga0207706_10219698 | Ga0207706_102196982 | 99 |
| 569 | 3300025933 | Ga0207706_10336811 | Ga0207706_103368113 | 99 |
| 570 | 3300025933 | Ga0207706_10558755 | Ga0207706_105587552 | 99 |
| 571 | 3300025933 | Ga0207706_10599568 | Ga0207706_105995682 | 99 |
| 572 | 3300025934 | Ga0207686_10000200 | Ga0207686_1000020041 | 99 |
| 573 | 3300025934 | Ga0207686_10280350 | Ga0207686_102803502 | 99 |
| 574 | 3300025935 | Ga0207709_10323025 | Ga0207709_103230252 | 99 |
| 575 | 3300025936 | Ga0207670_10011457 | Ga0207670_100114571 | 99 |
| 576 | 3300025936 | Ga0207670_10020366 | Ga0207670_100203663 | 99 |
| 577 | 3300025936 | Ga0207670_10648966 | Ga0207670_106489661 | 99 |
| 578 | 3300025937 | Ga0207669_10216475 | Ga0207669_102164752 | 99 |
| 579 | 3300025937 | Ga0207669_10379027 | Ga0207669_103790273 | 99 |
| 580 | 3300025937 | Ga0207669_11656279 | Ga0207669_116562792 | 99 |
| 581 | 3300025938 | Ga0207704_10457392 | Ga0207704_104573922 | 99 |
| 582 | 3300025938 | Ga0207704_10833285 | Ga0207704_108332852 | 99 |
| 583 | 3300025938 | Ga0207704_10835615 | Ga0207704_108356151 | 99 |
| 584 | 3300025938 | Ga0207704_11006887 | Ga0207704_110068872 | 99 |
| 585 | 3300025938 | Ga0207704_11319105 | Ga0207704_113191052 | 99 |
| 586 | 3300025940 | Ga0207691_10102453 | Ga0207691_101024535 | 99 |
| 587 | 3300025940 | Ga0207691_10192586 | Ga0207691_101925863 | 99 |
| 588 | 3300025940 | Ga0207691_10195192 | Ga0207691_101951922 | 99 |
| 589 | 3300025940 | Ga0207691_10698200 | Ga0207691_106982002 | 99 |
| 590 | 3300025942 | Ga0207689_10012246 | Ga0207689_100122462 | 99 |
| 591 | 3300025942 | Ga0207689_10013498 | Ga0207689_100134986 | 99 |
| 592 | 3300025942 | Ga0207689_10029076 | Ga0207689_100290764 | 99 |
| 593 | 3300025942 | Ga0207689_10030736 | Ga0207689_100307363 | 99 |
| 594 | 3300025942 | Ga0207689_10033224 | Ga0207689_100332242 | 99 |
| 595 | 3300025942 | Ga0207689_10095003 | Ga0207689_100950031 | 99 |
| 596 | 3300025942 | Ga0207689_10099860 | Ga0207689_100998604 | 99 |
| 597 | 3300025944 | Ga0207661_10007465 | Ga0207661_100074651 | 99 |
| 598 | 3300025944 | Ga0207661_10042713 | Ga0207661_100427132 | 99 |
| 599 | 3300025944 | Ga0207661_10085814 | Ga0207661_100858143 | 99 |
| 600 | 3300025944 | Ga0207661_11165435 | Ga0207661_111654352 | 99 |
| 601 | 3300025945 | Ga0207679_10000358 | Ga0207679_1000035820 | 99 |
| 602 | 3300025945 | Ga0207679_10002098 | Ga0207679_100020983 | 99 |
| 603 | 3300025945 | Ga0207679_10125588 | Ga0207679_101255882 | 99 |
| 604 | 3300025945 | Ga0207679_10196273 | Ga0207679_101962733 | 99 |
| 605 | 3300025945 | Ga0207679_10245673 | Ga0207679_102456732 | 99 |
| 606 | 3300025945 | Ga0207679_10339423 | Ga0207679_103394232 | 99 |
| 607 | 3300025949 | Ga0207667_11060516 | Ga0207667_110605162 | 99 |
| 608 | 3300025949 | Ga0207667_11224048 | Ga0207667_112240482 | 99 |
| 609 | 3300025949 | Ga0207667_11562255 | Ga0207667_115622552 | 99 |
| 610 | 3300025960 | Ga0207651_10004538 | Ga0207651_100045386 | 99 |
| 611 | 3300025960 | Ga0207651_10029439 | Ga0207651_100294393 | 99 |
| 612 | 3300025960 | Ga0207651_10229823 | Ga0207651_102298234 | 99 |
| 613 | 3300025960 | Ga0207651_10328510 | Ga0207651_103285102 | 99 |
| 614 | 3300025960 | Ga0207651_10565329 | Ga0207651_105653292 | 99 |
| 615 | 3300025960 | Ga0207651_11221230 | Ga0207651_112212302 | 99 |
| 616 | 3300025961 | Ga0207712_10002374 | Ga0207712_100023749 | 99 |
| 617 | 3300025961 | Ga0207712_10002523 | Ga0207712_1000252311 | 99 |
| 618 | 3300025961 | Ga0207712_10012531 | Ga0207712_100125315 | 99 |
| 619 | 3300025961 | Ga0207712_10029486 | Ga0207712_100294863 | 99 |
| 620 | 3300025961 | Ga0207712_10625360 | Ga0207712_106253602 | 99 |
| 621 | 3300025961 | Ga0207712_10635113 | Ga0207712_106351132 | 99 |
| 622 | 3300025961 | Ga0207712_10854483 | Ga0207712_108544832 | 99 |
| 623 | 3300025961 | Ga0207712_11218001 | Ga0207712_112180012 | 99 |
| 624 | 3300025972 | Ga0207668_10048989 | Ga0207668_100489893 | 99 |
| 625 | 3300025972 | Ga0207668_10457024 | Ga0207668_104570241 | 99 |
| 626 | 3300025972 | Ga0207668_10617136 | Ga0207668_106171362 | 99 |
| 627 | 3300025981 | Ga0207640_10029303 | Ga0207640_100293032 | 99 |
| 628 | 3300025981 | Ga0207640_10384796 | Ga0207640_103847963 | 99 |
| 629 | 3300025986 | Ga0207658_10087359 | Ga0207658_100873593 | 99 |
| 630 | 3300025986 | Ga0207658_10104663 | Ga0207658_101046634 | 99 |
| 631 | 3300025986 | Ga0207658_10334110 | Ga0207658_103341102 | 99 |
| 632 | 3300025986 | Ga0207658_10401872 | Ga0207658_104018722 | 99 |
| 633 | 3300026023 | Ga0207677_10019526 | Ga0207677_100195266 | 99 |
| 634 | 3300026023 | Ga0207677_10089210 | Ga0207677_100892105 | 99 |
| 635 | 3300026023 | Ga0207677_10129508 | Ga0207677_101295082 | 99 |
| 636 | 3300026023 | Ga0207677_10300032 | Ga0207677_103000322 | 99 |
| 637 | 3300026023 | Ga0207677_11705918 | Ga0207677_117059181 | 99 |
| 638 | 3300026035 | Ga0207703_10455001 | Ga0207703_104550012 | 99 |
| 639 | 3300026035 | Ga0207703_10922304 | Ga0207703_109223042 | 99 |
| 640 | 3300026035 | Ga0207703_11270083 | Ga0207703_112700831 | 99 |
| 641 | 3300026041 | Ga0207639_10004252 | Ga0207639_100042523 | 99 |
| 642 | 3300026041 | Ga0207639_10404767 | Ga0207639_104047672 | 99 |
| 643 | 3300026067 | Ga0207678_10047747 | Ga0207678_100477473 | 99 |
| 644 | 3300026067 | Ga0207678_10236120 | Ga0207678_102361202 | 99 |
| 645 | 3300026075 | Ga0207708_10555326 | Ga0207708_105553261 | 99 |
| 646 | 3300026075 | Ga0207708_11045247 | Ga0207708_110452471 | 99 |
| 647 | 3300026075 | Ga0207708_11114227 | Ga0207708_111142272 | 99 |
| 648 | 3300026075 | Ga0207708_11261117 | Ga0207708_112611171 | 99 |
| 649 | 3300026075 | Ga0207708_11275394 | Ga0207708_112753941 | 99 |
| 650 | 3300026078 | Ga0207702_10483212 | Ga0207702_104832122 | 99 |
| 651 | 3300026088 | Ga0207641_10003037 | Ga0207641_100030376 | 99 |
| 652 | 3300026088 | Ga0207641_10260204 | Ga0207641_102602041 | 99 |
| 653 | 3300026088 | Ga0207641_10448510 | Ga0207641_104485101 | 99 |
| 654 | 3300026088 | Ga0207641_11596044 | Ga0207641_115960441 | 99 |
| 655 | 3300026089 | Ga0207648_10027044 | Ga0207648_100270445 | 99 |
| 656 | 3300026089 | Ga0207648_10029173 | Ga0207648_100291733 | 99 |
| 657 | 3300026089 | Ga0207648_10072864 | Ga0207648_100728643 | 99 |
| 658 | 3300026089 | Ga0207648_10157155 | Ga0207648_101571553 | 99 |
| 659 | 3300026089 | Ga0207648_10515340 | Ga0207648_105153401 | 99 |
| 660 | 3300026089 | Ga0207648_10885411 | Ga0207648_108854112 | 99 |
| 661 | 3300026089 | Ga0207648_11089033 | Ga0207648_110890332 | 99 |
| 662 | 3300026089 | Ga0207648_11593965 | Ga0207648_115939652 | 99 |
| 663 | 3300026095 | Ga0207676_10005548 | Ga0207676_100055483 | 99 |
| 664 | 3300026095 | Ga0207676_10049441 | Ga0207676_100494413 | 99 |
| 665 | 3300026095 | Ga0207676_10121958 | Ga0207676_101219584 | 99 |
| 666 | 3300026095 | Ga0207676_10763576 | Ga0207676_107635762 | 99 |
| 667 | 3300026116 | Ga0207674_10004933 | Ga0207674_1000493313 | 99 |
| 668 | 3300026116 | Ga0207674_10011410 | Ga0207674_100114103 | 99 |
| 669 | 3300026116 | Ga0207674_10021661 | Ga0207674_100216614 | 99 |
| 670 | 3300026116 | Ga0207674_10058910 | Ga0207674_100589101 | 99 |
| 671 | 3300026116 | Ga0207674_10226948 | Ga0207674_102269482 | 99 |
| 672 | 3300026116 | Ga0207674_10227812 | Ga0207674_102278121 | 99 |
| 673 | 3300026116 | Ga0207674_10341398 | Ga0207674_103413983 | 99 |
| 674 | 3300026116 | Ga0207674_10472594 | Ga0207674_104725943 | 99 |
| 675 | 3300026116 | Ga0207674_10477156 | Ga0207674_104771563 | 99 |
| 676 | 3300026118 | Ga0207675_100000085 | Ga0207675_10000008528 | 99 |
| 677 | 3300026118 | Ga0207675_100027224 | Ga0207675_1000272244 | 99 |
| 678 | 3300026118 | Ga0207675_100082125 | Ga0207675_1000821253 | 99 |
| 679 | 3300026118 | Ga0207675_100095578 | Ga0207675_1000955782 | 99 |
| 680 | 3300026118 | Ga0207675_100166729 | Ga0207675_1001667293 | 99 |
| 681 | 3300026118 | Ga0207675_100443262 | Ga0207675_1004432623 | 99 |
| 682 | 3300026118 | Ga0207675_100566753 | Ga0207675_1005667532 | 99 |
| 683 | 3300026118 | Ga0207675_100629304 | Ga0207675_1006293042 | 99 |
| 684 | 3300026118 | Ga0207675_101141858 | Ga0207675_1011418582 | 99 |
| 685 | 3300026118 | Ga0207675_101322475 | Ga0207675_1013224751 | 99 |
| 686 | 3300026118 | Ga0207675_102591949 | Ga0207675_1025919491 | 99 |
| 687 | 3300026121 | Ga0207683_10006456 | Ga0207683_100064564 | 99 |
| 688 | 3300026121 | Ga0207683_10302819 | Ga0207683_103028192 | 99 |
| 689 | 3300026121 | Ga0207683_10326931 | Ga0207683_103269312 | 99 |
| 690 | 3300026121 | Ga0207683_10845395 | Ga0207683_108453951 | 99 |
| 691 | 3300026121 | Ga0207683_11128068 | Ga0207683_111280682 | 99 |
| 692 | 3300026142 | Ga0207698_10048842 | Ga0207698_100488423 | 99 |
| 693 | 3300026142 | Ga0207698_10322775 | Ga0207698_103227752 | 99 |
| 694 | 3300026142 | Ga0207698_11021677 | Ga0207698_110216771 | 99 |
| 695 | 3300026142 | Ga0207698_11099809 | Ga0207698_110998092 | 99 |
| 696 | 3300027471 | Ga0209995_1097655 | Ga0209995_10976552 | 99 |
| 697 | 3300027907 | Ga0207428_10018900 | Ga0207428_100189004 | 99 |
| 698 | 3300027907 | Ga0207428_10452927 | Ga0207428_104529272 | 99 |
| 699 | 3300027907 | Ga0207428_10505350 | Ga0207428_105053502 | 99 |
| 700 | 3300028379 | Ga0268266_10009751 | Ga0268266_100097517 | 99 |
| 701 | 3300028379 | Ga0268266_11195776 | Ga0268266_111957762 | 99 |
| 702 | 3300028379 | Ga0268266_11926170 | Ga0268266_119261702 | 99 |
| 703 | 3300028380 | Ga0268265_10005897 | Ga0268265_100058975 | 99 |
| 704 | 3300028380 | Ga0268265_10266748 | Ga0268265_102667484 | 99 |
| 705 | 3300028380 | Ga0268265_10537861 | Ga0268265_105378612 | 99 |
| 706 | 3300028380 | Ga0268265_10793044 | Ga0268265_107930442 | 99 |
| 707 | 3300028380 | Ga0268265_10995431 | Ga0268265_109954311 | 99 |
| 708 | 3300028380 | Ga0268265_11727422 | Ga0268265_117274222 | 99 |
| 709 | 3300028380 | Ga0268265_11733824 | Ga0268265_117338241 | 99 |
| 710 | 3300028380 | Ga0268265_11850382 | Ga0268265_118503821 | 99 |
| 711 | 3300028380 | Ga0268265_12646252 | Ga0268265_126462521 | 99 |
| 712 | 3300028381 | Ga0268264_10345284 | Ga0268264_103452842 | 99 |
| 713 | 3300028381 | Ga0268264_10400065 | Ga0268264_104000652 | 99 |
| 714 | 3300028381 | Ga0268264_10466405 | Ga0268264_104664052 | 99 |
| 715 | 3300028381 | Ga0268264_10573009 | Ga0268264_105730092 | 99 |
| 716 | 3300028381 | Ga0268264_10698351 | Ga0268264_106983512 | 99 |
| 717 | 3300028381 | Ga0268264_11251621 | Ga0268264_112516212 | 99 |
| 718 | 3300031548 | Ga0307408_100170105 | Ga0307408_1001701053 | 99 |
| 719 | 3300031731 | Ga0307405_10083700 | Ga0307405_100837001 | 99 |
| 720 | 3300031824 | Ga0307413_10472757 | Ga0307413_104727571 | 99 |
| 721 | 3300031852 | Ga0307410_10063775 | Ga0307410_100637752 | 99 |
| 722 | 3300031903 | Ga0307407_10309073 | Ga0307407_103090731 | 99 |
| 723 | 3300031911 | Ga0307412_10228231 | Ga0307412_102282312 | 99 |
| 724 | 3300031995 | Ga0307409_100758348 | Ga0307409_1007583482 | 99 |
| 725 | 3300032002 | Ga0307416_100292561 | Ga0307416_1002925612 | 99 |
| 726 | 3300032004 | Ga0307414_10150978 | Ga0307414_101509782 | 99 |
| 727 | 3300032004 | Ga0307414_11488234 | Ga0307414_114882341 | 99 |
| 728 | 3300032005 | Ga0307411_11129186 | Ga0307411_111291862 | 99 |
| 729 | 3300032005 | Ga0307411_11423294 | Ga0307411_114232942 | 99 |
| 730 | 3300032126 | Ga0307415_100472539 | Ga0307415_1004725392 | 99 |
| 731 | 3300035171 | Ga0373946_0435626 | Ga0373946_0435626_354_653 | 99 |
| 732 | 3300035725 | Ga0373947_0704037 | Ga0373947_0704037_107_406 | 99 |
| 733 | 3300039437 | Ga0436365_0493931 | Ga0436365_0493931_25397_25699 | 99 |
| 734 | 3300039437 | Ga0436365_1327844 | Ga0436365_1327844_29_328 | 99 |
| 735 | 3300041404 | Ga0439436_0206236 | Ga0439436_0206236_153_452 | 99 |
| 736 | 3300041406 | Ga0439439_0053237 | Ga0439439_0053237_101_400 | 99 |
| 737 | 3300041408 | Ga0439453_0011440 | Ga0439453_0011440_985_1284 | 99 |
| 738 | 3300041441 | Ga0451787_209659 | Ga0451787_209659_486_797 | 99 |
| 739 | 3300041443 | Ga0451789_0074387 | Ga0451789_0074387_248_547 | 99 |
| 740 | 3300041452 | Ga0451793_0088457 | Ga0451793_0088457_158_457 | 99 |
| 741 | 3300041453 | Ga0451797_1238182 | Ga0451797_1238182_156_455 | 99 |
| 742 | 3300041458 | Ga0451798_0072829 | Ga0451798_0072829_61_360 | 99 |
| 743 | 3300041459 | Ga0451800_1096925 | Ga0451800_1096925_121_420 | 99 |
| 744 | 3300041463 | Ga0451804_0371286 | Ga0451804_0371286_740_1039 | 99 |
| 745 | 3300041486 | Ga0451807_0471232 | Ga0451807_0471232_542_841 | 99 |
| 746 | 3300041486 | Ga0451807_2135091 | Ga0451807_2135091_204_572 | 99 |
| 747 | 3300041492 | Ga0451835_0339757 | Ga0451835_0339757_137_448 | 99 |
| 748 | 3300041494 | Ga0451837_1358824 | Ga0451837_1358824_157_456 | 99 |
| 749 | 3300041501 | Ga0451845_0387093 | Ga0451845_0387093_152_484 | 99 |
| 750 | 3300041997 | Ga0439431_0042447 | Ga0439431_0042447_125_424 | 99 |
| 751 | 3300042002 | Ga0439442_083987 | Ga0439442_083987_137_436 | 99 |
| 752 | 3300042002 | Ga0439442_096915 | Ga0439442_096915_56_355 | 99 |
| 753 | 3300042004 | Ga0439445_0125592 | Ga0439445_0125592_322_621 | 99 |
| 754 | 3300042007 | Ga0439449_0307247 | Ga0439449_0307247_231_530 | 99 |
| 755 | 3300042014 | Ga0439457_048890 | Ga0439457_048890_28_327 | 99 |
| 756 | 3300042015 | Ga0439462_0217034 | Ga0439462_0217034_36_335 | 99 |
| 757 | 3300042125 | Ga0450923_006679 | Ga0450923_006679_346_645 | 99 |
| 758 | 3300042128 | Ga0450897_005451 | Ga0450897_005451_37_336 | 99 |
| 759 | 3300042131 | Ga0450894_033998 | Ga0450894_033998_296_595 | 99 |
| 760 | 3300042134 | Ga0450898_021742 | Ga0450898_021742_41_340 | 99 |
| 761 | 3300042157 | Ga0439458_0154600 | Ga0439458_0154600_238_537 | 99 |
| 762 | 3300042435 | Ga0439434_0119407 | Ga0439434_0119407_379_678 | 99 |
| 763 | 3300042436 | Ga0439435_0021750 | Ga0439435_0021750_329_628 | 99 |
| 764 | 3300042461 | Ga0439460_0022668 | Ga0439460_0022668_716_1015 | 99 |
| 765 | 3300042876 | Ga0451577_0062070 | Ga0451577_0062070_1010_1312 | 99 |
| 766 | 3300042876 | Ga0451577_0697901 | Ga0451577_0697901_269_568 | 99 |
| 767 | 3300044712 | Ga0453684_0208488 | Ga0453684_0208488_333_635 | 99 |
| 768 | 3300044765 | Ga0466970_0240314 | Ga0466970_0240314_77_376 | 99 |
| 769 | 3300046460 | Ga0495638_0040588 | Ga0495638_0040588_957_1256 | 99 |
| 770 | 3300046473 | Ga0495582_0882012 | Ga0495582_0882012_188_487 | 99 |
| 771 | 3300046475 | Ga0495639_0434254 | Ga0495639_0434254_240_539 | 99 |
| 772 | 3300046507 | Ga0495606_0643574 | Ga0495606_0643574_79_378 | 99 |
| 773 | 3300046522 | Ga0495643_0077408 | Ga0495643_0077408_35_334 | 99 |
| 774 | 3300046523 | Ga0495644_0130645 | Ga0495644_0130645_235_534 | 99 |
| 775 | 3300046537 | Ga0495598_0046801 | Ga0495598_0046801_413_712 | 99 |
| 776 | 3300046537 | Ga0495598_0213205 | Ga0495598_0213205_296_595 | 99 |
| 777 | 3300046539 | Ga0495621_0007956 | Ga0495621_0007956_518_817 | 99 |
| 778 | 3300046558 | Ga0495633_0296257 | Ga0495633_0296257_247_546 | 99 |
| 779 | 3300046615 | Ga0495656_0330666 | Ga0495656_0330666_420_719 | 99 |
| 780 | 3300046616 | Ga0495668_0000419 | Ga0495668_0000419_13197_13496 | 99 |
| 781 | 3300046691 | Ga0495670_0787622 | Ga0495670_0787622_141_482 | 99 |
| 782 | 3300046692 | Ga0495671_0082874 | Ga0495671_0082874_365_664 | 99 |
| 783 | 3300047472 | Ga0495686_0018642 | Ga0495686_0018642_3331_3630 | 99 |
| 784 | 3300047472 | Ga0495686_0142473 | Ga0495686_0142473_698_997 | 99 |
| 785 | 3300048090 | Ga0495615_0292335 | Ga0495615_0292335_202_501 | 99 |
| 786 | 3300048903 | Ga0496100_0355843 | Ga0496100_0355843_274_618 | 99 |
| 787 | 3300048907 | Ga0496104_0218756 | Ga0496104_0218756_339_638 | 99 |
| 788 | 3300048908 | Ga0496105_0605234 | Ga0496105_0605234_109_408 | 99 |
| 789 | 3300048909 | Ga0496106_0115248 | Ga0496106_0115248_1444_1743 | 99 |
| 790 | 3300048911 | Ga0496108_0850428 | Ga0496108_0850428_314_613 | 99 |
| 791 | 3300048912 | Ga0496109_0362844 | Ga0496109_0362844_125_424 | 99 |
| 792 | 3300048913 | Ga0496110_0278233 | Ga0496110_0278233_794_1093 | 99 |
| 793 | 3300048913 | Ga0496110_0659702 | Ga0496110_0659702_137_436 | 99 |
| 794 | 3300048917 | Ga0496114_0458875 | Ga0496114_0458875_183_482 | 99 |
| 795 | 3300049515 | Ga0501292_004190 | Ga0501292_004190_551_862 | 99 |
| 796 | 3300049568 | Ga0501031_0012012 | Ga0501031_0012012_3227_3526 | 99 |
| 797 | 3300049569 | Ga0501032_0023583 | Ga0501032_0023583_3555_3854 | 99 |
| 798 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_115751_116050 | 99 |
| 799 | 3300049571 | Ga0501034_0237544 | Ga0501034_0237544_286_585 | 99 |
| 800 | 3300049572 | Ga0501036_0052234 | Ga0501036_0052234_36_335 | 99 |
| 801 | 3300049573 | Ga0501037_0035208 | Ga0501037_0035208_2653_2952 | 99 |
| 802 | 3300049574 | Ga0501038_0013031 | Ga0501038_0013031_4970_5269 | 99 |
| 803 | 3300049575 | Ga0501039_0060788 | Ga0501039_0060788_436_735 | 99 |
| 804 | 3300049579 | Ga0501043_0005755 | Ga0501043_0005755_1309_1608 | 99 |
| 805 | 3300049579 | Ga0501043_0215561 | Ga0501043_0215561_1042_1341 | 99 |
| 806 | 3300049581 | Ga0501047_0379367 | Ga0501047_0379367_11_310 | 99 |
| 807 | 3300049588 | Ga0501072_0216067 | Ga0501072_0216067_695_994 | 99 |
| 808 | 3300049589 | Ga0501073_0359182 | Ga0501073_0359182_596_895 | 99 |
| 809 | 3300049649 | Ga0501198_032552 | Ga0501198_032552_55_366 | 99 |
| 810 | 3300049649 | Ga0501198_077838 | Ga0501198_077838_26_325 | 99 |
| 811 | 3300049652 | Ga0501202_002367 | Ga0501202_002367_1807_2118 | 99 |
| 812 | 3300049654 | Ga0501207_063934 | Ga0501207_063934_257_556 | 99 |
| 813 | 3300049661 | Ga0501217_024258 | Ga0501217_024258_1041_1352 | 99 |
| 814 | 3300049663 | Ga0501223_018439 | Ga0501223_018439_185_496 | 99 |
| 815 | 3300049668 | Ga0501233_043334 | Ga0501233_043334_133_444 | 99 |
| 816 | 3300049668 | Ga0501233_067672 | Ga0501233_067672_63_362 | 99 |
| 817 | 3300049669 | Ga0501235_170670 | Ga0501235_170670_215_526 | 99 |
| 818 | 3300049671 | Ga0501238_016909 | Ga0501238_016909_659_970 | 99 |
| 819 | 3300049672 | Ga0501239_035940 | Ga0501239_035940_74_385 | 99 |
| 820 | 3300049674 | Ga0501242_000522 | Ga0501242_000522_470_769 | 99 |
| 821 | 3300049682 | Ga0501252_026207 | Ga0501252_026207_41_340 | 99 |
| 822 | 3300049683 | Ga0501253_019527 | Ga0501253_019527_277_588 | 99 |
| 823 | 3300049686 | Ga0501257_006107 | Ga0501257_006107_1929_2228 | 99 |
| 824 | 3300049688 | Ga0501259_013024 | Ga0501259_013024_915_1214 | 99 |
| 825 | 3300049703 | Ga0501219_000358 | Ga0501219_000358_5715_6014 | 99 |
| 826 | 3300049705 | Ga0501225_0076768 | Ga0501225_0076768_41_340 | 99 |
| 827 | 3300049705 | Ga0501225_0251245 | Ga0501225_0251245_76_387 | 99 |
| 828 | 3300049707 | Ga0501234_008968 | Ga0501234_008968_1180_1491 | 99 |
| 829 | 3300049707 | Ga0501234_040403 | Ga0501234_040403_243_542 | 99 |
| 830 | 3300049708 | Ga0501245_020018 | Ga0501245_020018_375_674 | 99 |
| 831 | 3300049742 | Ga0501080_0783468 | Ga0501080_0783468_382_681 | 99 |
| 832 | 3300049742 | Ga0501080_0800587 | Ga0501080_0800587_504_803 | 99 |
| 833 | 3300049742 | Ga0501080_0815416 | Ga0501080_0815416_392_691 | 99 |
| 834 | 3300049744 | Ga0501083_0166958 | Ga0501083_0166958_869_1168 | 99 |
| 835 | 3300049758 | Ga0501241_019508 | Ga0501241_019508_767_1066 | 99 |
| 836 | 3300049758 | Ga0501241_035496 | Ga0501241_035496_13_312 | 99 |
| 837 | 3300049760 | Ga0501263_041564 | Ga0501263_041564_311_610 | 99 |
| 838 | 3300049760 | Ga0501263_059066 | Ga0501263_059066_41_340 | 99 |
| 839 | 3300049763 | Ga0501266_000690 | Ga0501266_000690_618_917 | 99 |
| 840 | 3300049765 | Ga0501268_015588 | Ga0501268_015588_937_1236 | 99 |
| 841 | 3300049770 | Ga0501273_002008 | Ga0501273_002008_352_663 | 99 |
| 842 | 3300049776 | Ga0501280_050901 | Ga0501280_050901_185_496 | 99 |
| 843 | 3300049822 | Ga0501035_0027999 | Ga0501035_0027999_548_847 | 99 |
| 844 | 3300049823 | Ga0501044_0004089 | Ga0501044_0004089_2318_2617 | 99 |
| 845 | 3300049823 | Ga0501044_1415416 | Ga0501044_1415416_31_330 | 99 |
| 846 | 3300049850 | Ga0501204_039276 | Ga0501204_039276_185_496 | 99 |
| 847 | 3300050005 | Ga0501284_00086 | Ga0501284_00086_20831_21130 | 99 |
| 848 | 3300050493 | nmdc:mga0k408_190414_c1 | nmdc:mga0k408_190414_c1_833_1132 | 99 |
| 849 | 3300050493 | nmdc:mga0k408_76831_c1 | nmdc:mga0k408_76831_c1_916_1215 | 99 |
| 850 | 3300050493 | nmdc:mga0k408_826427_c1 | nmdc:mga0k408_826427_c1_54_353 | 99 |
| 851 | 3300050507 | nmdc:mga05p37_1152140_c1 | nmdc:mga05p37_1152140_c1_122_421 | 99 |
| 852 | 3300050507 | nmdc:mga05p37_373068_c1 | nmdc:mga05p37_373068_c1_100_399 | 99 |
| 853 | 3300050507 | nmdc:mga05p37_428199_c1 | nmdc:mga05p37_428199_c1_1025_1363 | 99 |
| 854 | 3300050508 | nmdc:mga09592_131869_c1 | nmdc:mga09592_131869_c1_1611_1910 | 99 |
| 855 | 3300050508 | nmdc:mga09592_1556392_c1 | nmdc:mga09592_1556392_c1_51_350 | 99 |
| 856 | 3300050510 | nmdc:mga06r32_286869_c1 | nmdc:mga06r32_286869_c1_417_755 | 99 |
| 857 | 3300050510 | nmdc:mga06r32_43908_c1 | nmdc:mga06r32_43908_c1_751_1050 | 99 |
| 858 | 3300050511 | nmdc:mga08y16_2583_c1 | nmdc:mga08y16_2583_c1_5884_6183 | 99 |
| 859 | 3300050511 | nmdc:mga08y16_517132_c1 | nmdc:mga08y16_517132_c1_555_854 | 99 |
| 860 | 3300050511 | nmdc:mga08y16_614776_c1 | nmdc:mga08y16_614776_c1_306_647 | 99 |
| 861 | 3300050511 | nmdc:mga08y16_770698_c1 | nmdc:mga08y16_770698_c1_212_514 | 99 |
| 862 | 3300050511 | nmdc:mga08y16_985824_c1 | nmdc:mga08y16_985824_c1_208_507 | 99 |
| 863 | 3300050512 | nmdc:mga0n895_58110_c1 | nmdc:mga0n895_58110_c1_1990_2289 | 99 |
| 864 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_172067_172366 | 99 |
| 865 | 3300053088 | Ga0500644_0349568 | Ga0500644_0349568_49_348 | 99 |
| 866 | 3300053090 | Ga0500646_0233192 | Ga0500646_0233192_170_469 | 99 |
| 867 | 3300053092 | Ga0500583_0002475 | Ga0500583_0002475_1255_1554 | 99 |
| 868 | 3300053093 | Ga0500651_0697976 | Ga0500651_0697976_141_440 | 99 |
| 869 | 3300053096 | Ga0500641_0101597 | Ga0500641_0101597_898_1197 | 99 |
| 870 | 3300053104 | Ga0500556_0003123 | Ga0500556_0003123_1312_1611 | 99 |
| 871 | 3300053108 | Ga0500562_000011 | Ga0500562_000011_35176_35475 | 99 |
| 872 | 3300053129 | Ga0500628_149582 | Ga0500628_149582_177_476 | 99 |
| 873 | 3300053129 | Ga0500628_165708 | Ga0500628_165708_119_418 | 99 |
| 874 | 3300053727 | Ga0500611_000019 | Ga0500611_000019_93090_93389 | 99 |
| 875 | 3300053727 | Ga0500611_036298 | Ga0500611_036298_80_379 | 99 |
| 876 | 3300053730 | Ga0500645_008152 | Ga0500645_008152_1442_1741 | 99 |
| 877 | 3300053730 | Ga0500645_009433 | Ga0500645_009433_2716_3015 | 99 |
| 878 | 3300053739 | Ga0500587_043235 | Ga0500587_043235_262_561 | 99 |
| 879 | 3300055283 | Ga0500661_012706 | Ga0500661_012706_345_644 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ub9-assembly1.cif.gz_A-2 | structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 | 0.9416 | 11 | 98 |
| 5zhv-assembly1.cif.gz_B | crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion | 0.9129 | 16 | 99 |
| 5h20-assembly1.cif.gz_A-2 | x-ray structure of padr-like transcription factor from bacteroid fragilis | 0.9037 | 16 | 98 |
| 4ija-assembly1.cif.gz_A | structure of s. aureus methicillin resistance factor mecr2 | 0.9008 | 17 | 76 |
| 5x11-assembly3.cif.gz_D | crystal structure of bacillus subtilis padr in complex with operator dna | 0.8983 | 14 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ub9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9416 | 11 | 98 | 1.10.10.10 |
| af_Q57874_1_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9294 | 9 | 99 | 1.10.10.10 |
| af_P15082_1_58_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9275 | 16 | 60 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9241 | 11 | 78 | 1.10.10.10 |
| af_Q57874_1_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9197 | 9 | 99 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349DWL9-F1-model_v4 | Transcriptional regulator | 0.9981 | 4 | 97 |
GO:0005737
|
| AF-A0A1Q3TR53-F1-model_v4 | Transcriptional regulator | 0.9967 | 1 | 98 |
GO:0005737
|
| AF-A0A5M3VXK7-F1-model_v4 | Uncharacterized protein | 0.9946 | 8 | 98 |
|
| AF-A0A543E2J2-F1-model_v4 | Winged helix DNA-binding protein | 0.9944 | 7 | 94 |
GO:0003677
|
| AF-A0A4V2PHL1-F1-model_v4 | Winged helix DNA-binding protein | 0.9943 | 7 | 98 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar