F484466

General Info

Members Datasets Scaffolds Average Seq Length
879 321 880 100

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2135091|Ga0451807_2135091_204_572
Length 122
Sequence VFINTPLGDGGKHPSXXXXMNWGMKNPINGLNKVFDNRIRLGVMSVLMVNEEVNFNDLKQMLEVTDGNLATHLVNLEDNGYIKVHKGFIGRKTNTTYAVTKTGEKAFSDHIAALENMIKGVK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
206 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
207 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
224 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
225 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
226 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
271 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
272 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
273 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
274 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
275 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
276 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
277 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
278 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
279 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
280 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
281 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
282 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
283 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
284 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
287 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
291 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
292 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
293 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
294 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
295 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
299 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
307 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
313 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
314 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
315 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
316 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
319 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
320 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 2.39
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6259703 2162886012 Bacteria 1158
2 JGI24740J21852_10014977 3300001979 Bacteria 2844
3 JGI24749J21850_1039359 3300002076 Unclassified 690
4 JGI25154J39366_1000006 3300002738 Bacteria 336396
5 JGI25157J39369_1005105 3300002741 Unclassified 2200
6 JGI25153J46596_10001206 3300003215 Bacteria 15645
7 rootH2_10169946 3300003320 Bacteria 1231
8 rootL2_10217998 3300003322 Bacteria 3674
9 rootL2_10347437 3300003322 Bacteria 1347
10 rootL2_10370816 3300003322 Bacteria 1777
11 rootH1_10019517 3300003316 Bacteria 1426
12 rootH1_10019517 3300003323 Bacteria 4895
13 JGI25160J50197_1008388 3300003354 Unclassified 3942
14 Ga0065165_1034982 3300005262 Unclassified 1547
15 Ga0065714_10546582 3300005288 Bacteria 500
16 Ga0065704_10457232 3300005289 Bacteria 700
17 Ga0065712_10008807 3300005290 Bacteria 2662
18 Ga0065712_10427440 3300005290 Unclassified 706
19 Ga0065712_10839525 3300005290 Bacteria 500
20 Ga0065715_10199574 3300005293 Bacteria 1369
21 Ga0065715_10583807 3300005293 Unclassified 710
22 Ga0065715_10970823 3300005293 Bacteria 553
23 Ga0065707_10140963 3300005295 Bacteria 1773
24 Ga0065707_10149320 3300005295 Bacteria 1673
25 Ga0065707_10488707 3300005295 Bacteria 723
26 Ga0065707_10838841 3300005295 Bacteria 586
27 Ga0070676_10007859 3300005328 Bacteria 5734
28 Ga0070676_10020642 3300005328 Bacteria 3681
29 Ga0070676_10232763 3300005328 Bacteria 1222
30 Ga0070676_10436259 3300005328 Bacteria 918
31 Ga0070676_10513734 3300005328 Bacteria 852
32 Ga0070676_10989545 3300005328 Bacteria 631
33 Ga0070683_100035991 3300005329 Bacteria 4528
34 Ga0070683_100059027 3300005329 Bacteria 3564
35 Ga0070683_100393287 3300005329 Bacteria 1322
36 Ga0070683_100434135 3300005329 Bacteria 1253
37 Ga0070690_100012749 3300005330 Bacteria 4951
38 Ga0070690_100024644 3300005330 Bacteria 3701
39 Ga0070690_100078041 3300005330 Bacteria 2163
40 Ga0070670_100071916 3300005331 Bacteria 2970
41 Ga0070670_100196621 3300005331 Bacteria 1752
42 Ga0070670_100417294 3300005331 Bacteria 1186
43 Ga0070670_100438144 3300005331 Bacteria 1157
44 Ga0070670_100666928 3300005331 Bacteria 934
45 Ga0070670_100684610 3300005331 Unclassified 921
46 Ga0070670_100878895 3300005331 Bacteria 812
47 Ga0070677_10054505 3300005333 Bacteria 1629
48 Ga0070677_10141832 3300005333 Bacteria 1109
49 Ga0070677_10407330 3300005333 Unclassified 718
50 Ga0070677_10562623 3300005333 Bacteria 626
51 Ga0068869_100017799 3300005334 Bacteria 4826
52 Ga0068869_100022931 3300005334 Bacteria 4306
53 Ga0068869_100053417 3300005334 Bacteria 2938
54 Ga0068869_100058198 3300005334 Bacteria 2825
55 Ga0068869_100078567 3300005334 Bacteria 2458
56 Ga0068869_100098868 3300005334 Unclassified 2205
57 Ga0070666_10004480 3300005335 Bacteria 8511
58 Ga0070666_10216688 3300005335 Bacteria 1349
59 Ga0070666_10338710 3300005335 Unclassified 1075
60 Ga0070666_10361528 3300005335 Bacteria 1040
61 Ga0070666_10770773 3300005335 Bacteria 708
62 Ga0070682_100000074 3300005337 Bacteria 91549
63 Ga0070682_100004396 3300005337 Bacteria 7822
64 Ga0070682_101222467 3300005337 Bacteria 635
65 Ga0068868_100005937 3300005338 Bacteria 8612
66 Ga0068868_100013130 3300005338 Bacteria 6067
67 Ga0068868_100261978 3300005338 Bacteria 1458
68 Ga0068868_100273456 3300005338 Bacteria 1428
69 Ga0068868_100387346 3300005338 Bacteria 1204
70 Ga0068868_100763262 3300005338 Bacteria 870
71 Ga0068868_101826814 3300005338 Bacteria 574
72 Ga0070689_100014907 3300005340 Bacteria 5656
73 Ga0070689_100024173 3300005340 Bacteria 4556
74 Ga0070689_100025709 3300005340 Bacteria 4425
75 Ga0070689_100040531 3300005340 Bacteria 3571
76 Ga0070687_100013203 3300005343 Unclassified 3672
77 Ga0070661_100019629 3300005344 Bacteria 4816
78 Ga0070661_100110631 3300005344 Bacteria 2051
79 Ga0070661_100218317 3300005344 Bacteria 1462
80 Ga0070661_100720103 3300005344 Bacteria 814
81 Ga0070661_101586447 3300005344 Unclassified 553
82 Ga0070668_100013719 3300005347 Bacteria 6052
83 Ga0070668_100148831 3300005347 Unclassified 1892
84 Ga0070668_100532105 3300005347 Bacteria 1021
85 Ga0070668_101709677 3300005347 Bacteria 578
86 Ga0070669_100004915 3300005353 Bacteria 9654
87 Ga0070669_100055836 3300005353 Bacteria 2894
88 Ga0070669_100068950 3300005353 Bacteria 2611
89 Ga0070669_100617202 3300005353 Unclassified 910
90 Ga0070675_100009178 3300005354 Bacteria 7681
91 Ga0070675_100030573 3300005354 Bacteria 4348
92 Ga0070675_100167024 3300005354 Bacteria 1896
93 Ga0070675_101292958 3300005354 Bacteria 672
94 Ga0070671_100048852 3300005355 Bacteria 3520
95 Ga0070671_100110351 3300005355 Bacteria 2310
96 Ga0070671_100150056 3300005355 Bacteria 1968
97 Ga0070671_100232786 3300005355 Bacteria 1563
98 Ga0070671_100235221 3300005355 Bacteria 1555
99 Ga0070671_101282248 3300005355 Unclassified 646
100 Ga0070674_100317527 3300005356 Bacteria 1248
101 Ga0070674_100484704 3300005356 Bacteria 1027
102 Ga0070673_100028363 3300005364 Bacteria 4162
103 Ga0070673_100112443 3300005364 Bacteria 2260
104 Ga0070673_100346225 3300005364 Bacteria 1318
105 Ga0070673_100380156 3300005364 Bacteria 1259
106 Ga0070673_100895384 3300005364 Unclassified 823
107 Ga0070673_101091602 3300005364 Bacteria 745
108 Ga0070673_101256805 3300005364 Bacteria 695
109 Ga0070673_101281909 3300005364 Unclassified 688
110 Ga0070673_101754742 3300005364 Bacteria 588
111 Ga0070673_102007834 3300005364 Unclassified 549
112 Ga0070688_100007885 3300005365 Bacteria 5756
113 Ga0070688_100008468 3300005365 Bacteria 5583
114 Ga0070688_100021223 3300005365 Bacteria 3791
115 Ga0070688_101357769 3300005365 Bacteria 575
116 Ga0070659_100003078 3300005366 Bacteria 11846
117 Ga0070659_100266940 3300005366 Bacteria 1421
118 Ga0070659_100691773 3300005366 Unclassified 881
119 Ga0070659_100771798 3300005366 Unclassified 835
120 Ga0070667_100008847 3300005367 Bacteria 8335
121 Ga0070667_100112891 3300005367 Bacteria 2358
122 Ga0070667_100136660 3300005367 Bacteria 2144
123 Ga0070667_100577028 3300005367 Bacteria 1035
124 Ga0070667_100638213 3300005367 Bacteria 983
125 Ga0070667_101358270 3300005367 Bacteria 666
126 Ga0070667_101648569 3300005367 Bacteria 603
127 Ga0070667_102162299 3300005367 Bacteria 524
128 Ga0070713_102246801 3300005436 Bacteria 528
129 Ga0070701_10169195 3300005438 Bacteria 1271
130 Ga0070701_10223048 3300005438 Bacteria 1125
131 Ga0070701_10263551 3300005438 Unclassified 1045
132 Ga0070701_10470025 3300005438 Bacteria 811
133 Ga0070711_101177192 3300005439 Unclassified 662
134 Ga0070705_100529708 3300005440 Unclassified 899
135 Ga0070700_100288151 3300005441 Unclassified 1193
136 Ga0070700_100495782 3300005441 Bacteria 938
137 Ga0070700_101228894 3300005441 Bacteria 627
138 Ga0070700_101462030 3300005441 Unclassified 580
139 Ga0070694_100984849 3300005444 Bacteria 699
140 Ga0070663_100123580 3300005455 Bacteria 1958
141 Ga0070678_100018654 3300005456 Bacteria 4501
142 Ga0070678_100035603 3300005456 Bacteria 3478
143 Ga0070678_101137725 3300005456 Bacteria 722
144 Ga0070678_101400438 3300005456 Bacteria 653
145 Ga0070662_100010383 3300005457 Bacteria 6106
146 Ga0070662_100023417 3300005457 Bacteria 4241
147 Ga0070662_100078135 3300005457 Bacteria 2458
148 Ga0070662_100123997 3300005457 Bacteria 1983
149 Ga0070662_101071192 3300005457 Bacteria 691
150 Ga0068867_100025237 3300005459 Bacteria 4264
151 Ga0068867_100054133 3300005459 Bacteria 2964
152 Ga0068867_100133752 3300005459 Unclassified 1930
153 Ga0068867_100170091 3300005459 Bacteria 1725
154 Ga0068867_100219713 3300005459 Bacteria 1531
155 Ga0068867_100316363 3300005459 Bacteria 1292
156 Ga0068867_100664133 3300005459 Unclassified 916
157 Ga0068867_101127578 3300005459 Bacteria 717
158 Ga0070685_10003971 3300005466 Bacteria 7477
159 Ga0070685_10010419 3300005466 Bacteria 4831
160 Ga0070685_10041829 3300005466 Bacteria 2613
161 Ga0070685_10126283 3300005466 Bacteria 1594
162 Ga0070685_10263780 3300005466 Bacteria 1146
163 Ga0070685_10371365 3300005466 Bacteria 983
164 Ga0070685_11485740 3300005466 Bacteria 522
165 Ga0070698_100056168 3300005471 Bacteria 3990
166 Ga0070699_100328589 3300005518 Bacteria 1375
167 Ga0070699_100774410 3300005518 Bacteria 878
168 Ga0070699_101099472 3300005518 Bacteria 729
169 Ga0070679_100009158 3300005530 Bacteria 9346
170 Ga0070684_100000995 3300005535 Bacteria 20208
171 Ga0070684_100007553 3300005535 Bacteria 8465
172 Ga0070684_100054427 3300005535 Bacteria 3487
173 Ga0070684_100375061 3300005535 Bacteria 1310
174 Ga0070684_100376607 3300005535 Bacteria 1307
175 Ga0068853_100004736 3300005539 Bacteria 10567
176 Ga0068853_100509371 3300005539 Bacteria 1137
177 Ga0068853_100537705 3300005539 Bacteria 1106
178 Ga0068853_100553412 3300005539 Unclassified 1090
179 Ga0070672_100074663 3300005543 Bacteria 2705
180 Ga0070672_100496091 3300005543 Bacteria 1056
181 Ga0070672_100607859 3300005543 Unclassified 953
182 Ga0070672_100732556 3300005543 Bacteria 867
183 Ga0070672_101701053 3300005543 Unclassified 567
184 Ga0070672_101718224 3300005543 Bacteria 564
185 Ga0070686_100032440 3300005544 Unclassified 3203
186 Ga0070686_100122814 3300005544 Bacteria 1785
187 Ga0070686_100479820 3300005544 Unclassified 961
188 Ga0070686_100513841 3300005544 Bacteria 931
189 Ga0070695_100649834 3300005545 Bacteria 833
190 Ga0070695_101065316 3300005545 Unclassified 660
191 Ga0070696_100338710 3300005546 Bacteria 1162
192 Ga0070693_100222641 3300005547 Bacteria 1237
193 Ga0070665_100002492 3300005548 Bacteria 20261
194 Ga0070665_100199412 3300005548 Unclassified 2002
195 Ga0070665_100722115 3300005548 Unclassified 1009
196 Ga0070665_101354247 3300005548 Bacteria 721
197 Ga0070704_101567279 3300005549 Bacteria 607
198 Ga0068855_100061427 3300005563 Bacteria 4391
199 Ga0068855_101877061 3300005563 Bacteria 607
200 Ga0070664_100001774 3300005564 Bacteria 17302
201 Ga0070664_100006101 3300005564 Bacteria 9745
202 Ga0070664_100162585 3300005564 Bacteria 1976
203 Ga0070664_100191340 3300005564 Bacteria 1823
204 Ga0070664_101695314 3300005564 Unclassified 599
205 Ga0068857_100026740 3300005577 Bacteria 5086
206 Ga0068857_100035852 3300005577 Bacteria 4394
207 Ga0068857_100113353 3300005577 Bacteria 2438
208 Ga0068857_100185247 3300005577 Bacteria 1895
209 Ga0068857_100215771 3300005577 Bacteria 1751
210 Ga0068857_100295426 3300005577 Unclassified 1493
211 Ga0068857_100442603 3300005577 Bacteria 1214
212 Ga0068857_100599055 3300005577 Bacteria 1042
213 Ga0068857_100806248 3300005577 Bacteria 897
214 Ga0068857_101144879 3300005577 Bacteria 752
215 Ga0068854_100020807 3300005578 Bacteria 4445
216 Ga0068854_101258726 3300005578 Bacteria 665
217 Ga0068856_102227666 3300005614 Bacteria 557
218 Ga0070702_100464833 3300005615 Bacteria 921
219 Ga0068852_100307303 3300005616 Bacteria 1537
220 Ga0068852_101290221 3300005616 Unclassified 752
221 Ga0068859_100002822 3300005617 Bacteria 17618
222 Ga0068859_100029450 3300005617 Bacteria 5508
223 Ga0068859_100091945 3300005617 Bacteria 3085
224 Ga0068859_100118674 3300005617 Bacteria 2711
225 Ga0068859_100222328 3300005617 Bacteria 1976
226 Ga0068859_100308909 3300005617 Bacteria 1675
227 Ga0068859_100795581 3300005617 Bacteria 1033
228 Ga0068864_100023594 3300005618 Bacteria 5168
229 Ga0068864_100189701 3300005618 Bacteria 1884
230 Ga0068864_100769360 3300005618 Unclassified 945
231 Ga0068864_101424500 3300005618 Unclassified 695
232 Ga0068864_101688576 3300005618 Bacteria 638
233 Ga0068864_101889295 3300005618 Bacteria 603
234 Ga0068866_10008998 3300005718 Bacteria 4229
235 Ga0068861_100001772 3300005719 Bacteria 13883
236 Ga0068861_100017269 3300005719 Bacteria 5118
237 Ga0068861_100044377 3300005719 Bacteria 3343
238 Ga0068861_100258144 3300005719 Unclassified 1490
239 Ga0068861_100290374 3300005719 Bacteria 1412
240 Ga0068861_100412765 3300005719 Bacteria 1201
241 Ga0068861_100550602 3300005719 Unclassified 1051
242 Ga0068861_101593426 3300005719 Bacteria 643
243 Ga0068861_101951319 3300005719 Unclassified 585
244 Ga0068861_102253362 3300005719 Unclassified 546
245 Ga0068851_10262209 3300005834 Bacteria 983
246 Ga0068870_10230219 3300005840 Unclassified 1139
247 Ga0068870_10857559 3300005840 Unclassified 639
248 Ga0068863_100030815 3300005841 Bacteria 5122
249 Ga0068863_100047050 3300005841 Bacteria 4093
250 Ga0068863_100076286 3300005841 Bacteria 3171
251 Ga0068863_100383849 3300005841 Unclassified 1372
252 Ga0068863_100559999 3300005841 Bacteria 1129
253 Ga0068863_100696940 3300005841 Unclassified 1009
254 Ga0068863_101866351 3300005841 Bacteria 611
255 Ga0068858_100048719 3300005842 Bacteria 3924
256 Ga0068858_100065866 3300005842 Bacteria 3353
257 Ga0068858_100174823 3300005842 Bacteria 2026
258 Ga0068858_100185574 3300005842 Unclassified 1964
259 Ga0068858_100357793 3300005842 Bacteria 1399
260 Ga0068858_101959183 3300005842 Unclassified 579
261 Ga0068860_100204138 3300005843 Bacteria 1916
262 Ga0068860_100261214 3300005843 Bacteria 1688
263 Ga0068860_100345388 3300005843 Unclassified 1464
264 Ga0068860_100587538 3300005843 Bacteria 1118
265 Ga0068860_101084025 3300005843 Bacteria 820
266 Ga0068862_100009580 3300005844 Bacteria 8007
267 Ga0068862_100100885 3300005844 Bacteria 2524
268 Ga0068862_100169160 3300005844 Bacteria 1956
269 Ga0068862_100201988 3300005844 Bacteria 1793
270 Ga0068862_100335512 3300005844 Unclassified 1399
271 Ga0068862_100860558 3300005844 Unclassified 889
272 Ga0068862_102254094 3300005844 Bacteria 556
273 Ga0068862_102676828 3300005844 Bacteria 510
274 Ga0070717_11704411 3300006028 Unclassified 570
275 Ga0070715_10284825 3300006163 Bacteria 878
276 Ga0075366_10004353 3300006195 Bacteria 7592
277 Ga0075366_10128109 3300006195 Bacteria 1531
278 Ga0075366_10378713 3300006195 Bacteria 870
279 Ga0097621_100004695 3300006237 Bacteria 9545
280 Ga0097621_100028621 3300006237 Bacteria 4393
281 Ga0097621_100500564 3300006237 Bacteria 1100
282 Ga0097621_100686158 3300006237 Unclassified 942
283 Ga0097621_101679292 3300006237 Unclassified 605
284 Ga0097621_101811841 3300006237 Unclassified 582
285 Ga0097621_102068902 3300006237 Unclassified 544
286 Ga0068871_100047999 3300006358 Unclassified 3445
287 Ga0068871_100093437 3300006358 Unclassified 2509
288 Ga0068871_100246264 3300006358 Unclassified 1556
289 Ga0068871_101482432 3300006358 Bacteria 641
290 Ga0068871_101573206 3300006358 Unclassified 622
291 Ga0075428_100025886 3300006844 Bacteria 6497
292 Ga0075428_100078023 3300006844 Bacteria 3615
293 Ga0075430_100014225 3300006846 Bacteria 6783
294 Ga0075431_100083698 3300006847 Bacteria 3294
295 Ga0075433_10865034 3300006852 Unclassified 789
296 Ga0075429_100000533 3300006880 Bacteria 28947
297 Ga0075429_100176026 3300006880 Bacteria 1874
298 Ga0068865_100016762 3300006881 Bacteria 4696
299 Ga0068865_100375037 3300006881 Bacteria 1159
300 Ga0068865_100759975 3300006881 Bacteria 833
301 Ga0068865_101155883 3300006881 Bacteria 684
302 Ga0068865_101247691 3300006881 Bacteria 659
303 Ga0068865_101706434 3300006881 Bacteria 568
304 Ga0097620_100002822 3300006931 Bacteria 17618
305 Ga0097620_100029453 3300006931 Bacteria 5508
306 Ga0097620_100091940 3300006931 Bacteria 3085
307 Ga0097620_100118676 3300006931 Bacteria 2711
308 Ga0097620_100222338 3300006931 Bacteria 1976
309 Ga0097620_100308913 3300006931 Bacteria 1675
310 Ga0097620_100795552 3300006931 Bacteria 1033
311 Ga0105251_10167642 3300009011 Bacteria 990
312 Ga0105240_10006100 3300009093 Bacteria 17784
313 Ga0105240_10403482 3300009093 Bacteria 1539
314 Ga0105240_10825950 3300009093 Bacteria 1002
315 Ga0105240_10921344 3300009093 Bacteria 939
316 Ga0111539_10003935 3300009094 Bacteria 19527
317 Ga0111539_10194276 3300009094 Bacteria 2367
318 Ga0111539_10405992 3300009094 Bacteria 1587
319 Ga0111539_11238718 3300009094 Bacteria 866
320 Ga0111539_11928083 3300009094 Bacteria 685
321 Ga0111539_12121033 3300009094 Bacteria 652
322 Ga0111539_12176837 3300009094 Unclassified 643
323 Ga0111539_12889943 3300009094 Bacteria 556
324 Ga0105245_12055894 3300009098 Bacteria 625
325 Ga0105247_10003381 3300009101 Bacteria 10432
326 Ga0105247_10350040 3300009101 Bacteria 1039
327 Ga0105247_10713407 3300009101 Bacteria 756
328 Ga0105247_11487146 3300009101 Bacteria 552
329 Ga0105247_11491109 3300009101 Bacteria 551
330 Ga0114129_10055628 3300009147 Bacteria 5544
331 Ga0114129_10527949 3300009147 Bacteria 1538
332 Ga0114129_10743522 3300009147 Bacteria 1256
333 Ga0114129_12027959 3300009147 Bacteria 695
334 Ga0105243_10748645 3300009148 Bacteria 958
335 Ga0105241_10002034 3300009174 Bacteria 15304
336 Ga0105241_10202248 3300009174 Bacteria 1660
337 Ga0105241_10370709 3300009174 Bacteria 1248
338 Ga0105241_10387242 3300009174 Bacteria 1223
339 Ga0105241_10832695 3300009174 Bacteria 852
340 Ga0105241_10908279 3300009174 Bacteria 818
341 Ga0105242_10088493 3300009176 Bacteria 2602
342 Ga0105242_10428946 3300009176 Bacteria 1241
343 Ga0105242_11067601 3300009176 Unclassified 819
344 Ga0105242_11254731 3300009176 Bacteria 763
345 Ga0105242_12644916 3300009176 Bacteria 551
346 Ga0105248_10208097 3300009177 Bacteria 2204
347 Ga0105248_11472085 3300009177 Bacteria 771
348 Ga0105248_11717501 3300009177 Bacteria 712
349 Ga0105248_11948589 3300009177 Bacteria 667
350 Ga0105248_12818266 3300009177 Unclassified 554
351 Ga0105237_10445914 3300009545 Bacteria 1300
352 Ga0105237_10641414 3300009545 Bacteria 1069
353 Ga0105237_10676782 3300009545 Unclassified 1039
354 Ga0105238_11998972 3300009551 Bacteria 613
355 Ga0105249_10002193 3300009553 Bacteria 16909
356 Ga0105249_10006815 3300009553 Bacteria 9962
357 Ga0105249_10012704 3300009553 Bacteria 7421
358 Ga0105249_10023038 3300009553 Bacteria 5583
359 Ga0105249_10046670 3300009553 Bacteria 3943
360 Ga0105249_10247832 3300009553 Bacteria 1764
361 Ga0105249_10294614 3300009553 Bacteria 1625
362 Ga0105249_10417805 3300009553 Bacteria 1374
363 Ga0105249_10604077 3300009553 Bacteria 1152
364 Ga0105249_10841050 3300009553 Bacteria 983
365 Ga0105249_12264764 3300009553 Unclassified 616
366 Ga0105239_10145403 3300010375 Unclassified 2644
367 Ga0105239_10534590 3300010375 Bacteria 1334
368 Ga0105239_10601323 3300010375 Bacteria 1254
369 Ga0105239_11832559 3300010375 Bacteria 703
370 Ga0105246_10257922 3300011119 Bacteria 1387
371 Ga0105246_10684602 3300011119 Bacteria 897
372 Ga0105246_10788380 3300011119 Unclassified 842
373 Ga0105246_11840854 3300011119 Unclassified 579
374 Ga0157325_1031292 3300012485 Unclassified 535
375 Ga0157373_10315527 3300013100 Bacteria 1111
376 Ga0157373_10846155 3300013100 Bacteria 676
377 Ga0157371_10869579 3300013102 Unclassified 682
378 Ga0157371_11093060 3300013102 Unclassified 611
379 Ga0157370_10006548 3300013104 Bacteria 12825
380 Ga0157370_10018237 3300013104 Bacteria 7060
381 Ga0157370_10049385 3300013104 Bacteria 4027
382 Ga0157370_10187902 3300013104 Unclassified 1918
383 Ga0157370_11607282 3300013104 Unclassified 584
384 Ga0157369_10372541 3300013105 Bacteria 1482
385 Ga0157369_10396855 3300013105 Bacteria 1431
386 Ga0157369_10710774 3300013105 Bacteria 1035
387 Ga0157374_10002306 3300013296 Bacteria 16074
388 Ga0157374_10014218 3300013296 Bacteria 6960
389 Ga0157374_10019065 3300013296 Bacteria 6070
390 Ga0157374_10798772 3300013296 Unclassified 959
391 Ga0157374_10833797 3300013296 Bacteria 939
392 Ga0157374_10851903 3300013296 Bacteria 928
393 Ga0157374_10939380 3300013296 Unclassified 883
394 Ga0157374_11091731 3300013296 Unclassified 818
395 Ga0157378_10028079 3300013297 Bacteria 4962
396 Ga0157378_10121956 3300013297 Bacteria 2404
397 Ga0157378_10382625 3300013297 Bacteria 1382
398 Ga0157378_11200077 3300013297 Bacteria 798
399 Ga0157378_11790281 3300013297 Bacteria 662
400 Ga0157378_12848215 3300013297 Bacteria 536
401 Ga0157378_13298139 3300013297 Bacteria 501
402 Ga0163162_10004448 3300013306 Bacteria 13498
403 Ga0163162_10014246 3300013306 Bacteria 7767
404 Ga0163162_10020100 3300013306 Bacteria 6556
405 Ga0163162_10027978 3300013306 Bacteria 5577
406 Ga0163162_10117366 3300013306 Bacteria 2762
407 Ga0163162_10240533 3300013306 Bacteria 1941
408 Ga0163162_10322890 3300013306 Bacteria 1676
409 Ga0163162_10656575 3300013306 Bacteria 1172
410 Ga0163162_10677439 3300013306 Unclassified 1154
411 Ga0163162_10923735 3300013306 Bacteria 985
412 Ga0163162_11148221 3300013306 Bacteria 881
413 Ga0163162_11396635 3300013306 Unclassified 797
414 Ga0163162_11844183 3300013306 Unclassified 692
415 Ga0157372_10137420 3300013307 Unclassified 2815
416 Ga0157372_10164580 3300013307 Bacteria 2564
417 Ga0157372_10292130 3300013307 Bacteria 1896
418 Ga0157372_10450393 3300013307 Unclassified 1500
419 Ga0157372_11329778 3300013307 Unclassified 829
420 Ga0157372_11700051 3300013307 Unclassified 726
421 Ga0157372_11786148 3300013307 Bacteria 707
422 Ga0157372_12505393 3300013307 Unclassified 592
423 Ga0157375_10009467 3300013308 Bacteria 8553
424 Ga0157375_10017272 3300013308 Bacteria 6507
425 Ga0157375_10019432 3300013308 Bacteria 6179
426 Ga0157375_10060278 3300013308 Bacteria 3763
427 Ga0157375_10071276 3300013308 Bacteria 3488
428 Ga0157375_10077537 3300013308 Bacteria 3353
429 Ga0157375_10152664 3300013308 Bacteria 2446
430 Ga0157375_10285313 3300013308 Bacteria 1814
431 Ga0157375_10415384 3300013308 Bacteria 1512
432 Ga0157375_11266564 3300013308 Unclassified 866
433 Ga0157375_12936614 3300013308 Unclassified 569
434 Ga0157375_13559694 3300013308 Bacteria 518
435 Ga0163163_10000846 3300014325 Bacteria 26044
436 Ga0163163_10080496 3300014325 Bacteria 3257
437 Ga0163163_10220152 3300014325 Bacteria 1947
438 Ga0163163_10454991 3300014325 Bacteria 1340
439 Ga0163163_10527248 3300014325 Bacteria 1243
440 Ga0163163_10739491 3300014325 Bacteria 1047
441 Ga0157380_10001544 3300014326 Bacteria 15133
442 Ga0157380_10008119 3300014326 Bacteria 7480
443 Ga0157380_10038502 3300014326 Bacteria 3713
444 Ga0157380_10041354 3300014326 Unclassified 3597
445 Ga0157380_10109060 3300014326 Bacteria 2322
446 Ga0157380_10514667 3300014326 Bacteria 1166
447 Ga0157380_11302793 3300014326 Bacteria 774
448 Ga0157380_11553029 3300014326 Bacteria 716
449 Ga0157380_13302594 3300014326 Bacteria 516
450 Ga0157377_10004687 3300014745 Bacteria 6328
451 Ga0157377_10012607 3300014745 Bacteria 4254
452 Ga0157377_10013025 3300014745 Unclassified 4199
453 Ga0157377_10135349 3300014745 Bacteria 1509
454 Ga0157377_10367270 3300014745 Bacteria 970
455 Ga0157377_10423808 3300014745 Unclassified 912
456 Ga0157377_10635274 3300014745 Bacteria 766
457 Ga0157379_10062128 3300014968 Bacteria 3341
458 Ga0157379_10067074 3300014968 Bacteria 3208
459 Ga0157379_10145731 3300014968 Bacteria 2135
460 Ga0157379_10158486 3300014968 Bacteria 2043
461 Ga0157379_10244990 3300014968 Bacteria 1626
462 Ga0157379_10319184 3300014968 Bacteria 1418
463 Ga0157379_11164634 3300014968 Unclassified 740
464 Ga0157379_11367115 3300014968 Bacteria 685
465 Ga0157376_10019085 3300014969 Bacteria 5275
466 Ga0157376_10052830 3300014969 Bacteria 3380
467 Ga0157376_10395123 3300014969 Unclassified 1335
468 Ga0157376_11020896 3300014969 Bacteria 850
469 Ga0157376_11427980 3300014969 Bacteria 724
470 Ga0157376_11500046 3300014969 Viruses 707
471 Ga0157376_11867280 3300014969 Bacteria 637
472 Ga0163161_10003828 3300017792 Bacteria 10550
473 Ga0163161_10023481 3300017792 Bacteria 4350
474 Ga0163161_10142714 3300017792 Bacteria 1814
475 Ga0163161_10165050 3300017792 Bacteria 1690
476 Ga0163161_10351633 3300017792 Unclassified 1172
477 Ga0163161_10681461 3300017792 Unclassified 854
478 Ga0163161_10833487 3300017792 Bacteria 777
479 Ga0163161_11023592 3300017792 Unclassified 706
480 Ga0163161_11154013 3300017792 Bacteria 668
481 Ga0209646_1000031 3300025246 Bacteria 381260
482 Ga0209026_1000019 3300025250 Bacteria 381260
483 Ga0207666_1078129 3300025271 Unclassified 534
484 Ga0209758_1002724 3300025297 Bacteria 17405
485 Ga0207426_1000445 3300025302 Bacteria 66319
486 Ga0207697_10061135 3300025315 Bacteria 1567
487 Ga0207697_10137364 3300025315 Bacteria 1059
488 Ga0207656_10615310 3300025321 Unclassified 555
489 Ga0207682_10021788 3300025893 Bacteria 2522
490 Ga0207682_10124900 3300025893 Bacteria 1144
491 Ga0207682_10424806 3300025893 Unclassified 629
492 Ga0207682_10435376 3300025893 Unclassified 620
493 Ga0207642_10691675 3300025899 Bacteria 642
494 Ga0207710_10001761 3300025900 Bacteria 10447
495 Ga0207688_10014698 3300025901 Unclassified 4251
496 Ga0207688_10298365 3300025901 Bacteria 985
497 Ga0207680_10458512 3300025903 Bacteria 905
498 Ga0207680_10499920 3300025903 Unclassified 866
499 Ga0207680_10764423 3300025903 Bacteria 693
500 Ga0207680_10805807 3300025903 Bacteria 673
501 Ga0207647_10097550 3300025904 Bacteria 1747
502 Ga0207647_10470476 3300025904 Bacteria 703
503 Ga0207647_10678212 3300025904 Unclassified 563
504 Ga0207645_10011686 3300025907 Bacteria 5986
505 Ga0207645_10013131 3300025907 Bacteria 5595
506 Ga0207645_10160475 3300025907 Bacteria 1471
507 Ga0207645_10283516 3300025907 Bacteria 1100
508 Ga0207643_10002640 3300025908 Bacteria 9706
509 Ga0207643_10464015 3300025908 Bacteria 807
510 Ga0207654_10066629 3300025911 Unclassified 2125
511 Ga0207707_10000117 3300025912 Bacteria 80929
512 Ga0207695_10013789 3300025913 Bacteria 9617
513 Ga0207695_10013922 3300025913 Bacteria 9563
514 Ga0207695_11434771 3300025913 Bacteria 571
515 Ga0207671_10000340 3300025914 Bacteria 68615
516 Ga0207671_10202020 3300025914 Unclassified 1552
517 Ga0207671_10450063 3300025914 Bacteria 1026
518 Ga0207671_11104634 3300025914 Unclassified 623
519 Ga0207660_10038339 3300025917 Bacteria 3344
520 Ga0207662_10792836 3300025918 Unclassified 667
521 Ga0207657_10003538 3300025919 Bacteria 16689
522 Ga0207657_10735459 3300025919 Unclassified 765
523 Ga0207657_11298647 3300025919 Bacteria 550
524 Ga0207649_10005540 3300025920 Bacteria 6833
525 Ga0207649_10265570 3300025920 Bacteria 1242
526 Ga0207649_11242006 3300025920 Unclassified 589
527 Ga0207649_11588672 3300025920 Unclassified 518
528 Ga0207652_10001410 3300025921 Bacteria 21328
529 Ga0207646_10185678 3300025922 Bacteria 1878
530 Ga0207681_10029387 3300025923 Bacteria 3569
531 Ga0207650_10049153 3300025925 Bacteria 3113
532 Ga0207650_10331440 3300025925 Bacteria 1248
533 Ga0207650_10678078 3300025925 Bacteria 870
534 Ga0207650_10895026 3300025925 Bacteria 754
535 Ga0207650_11662322 3300025925 Bacteria 541
536 Ga0207659_10022271 3300025926 Bacteria 4217
537 Ga0207659_11133202 3300025926 Bacteria 673
538 Ga0207659_11804344 3300025926 Unclassified 520
539 Ga0207700_11700435 3300025928 Bacteria 556
540 Ga0207644_10013769 3300025931 Bacteria 5402
541 Ga0207644_10052928 3300025931 Bacteria 2920
542 Ga0207644_10274475 3300025931 Bacteria 1352
543 Ga0207644_10739578 3300025931 Bacteria 821
544 Ga0207644_10787053 3300025931 Unclassified 795
545 Ga0207644_11464484 3300025931 Unclassified 573
546 Ga0207690_10016335 3300025932 Bacteria 4513
547 Ga0207690_10083872 3300025932 Bacteria 2232
548 Ga0207690_10299448 3300025932 Bacteria 1258
549 Ga0207690_10382033 3300025932 Unclassified 1120
550 Ga0207690_10767534 3300025932 Bacteria 796
551 Ga0207706_10029992 3300025933 Bacteria 4854
552 Ga0207706_10219698 3300025933 Bacteria 1664
553 Ga0207706_10336811 3300025933 Unclassified 1312
554 Ga0207706_10558755 3300025933 Bacteria 985
555 Ga0207706_10599568 3300025933 Bacteria 946
556 Ga0207686_10000200 3300025934 Bacteria 46234
557 Ga0207686_10280350 3300025934 Bacteria 1230
558 Ga0207709_10323025 3300025935 Bacteria 1156
559 Ga0207670_10011457 3300025936 Bacteria 5151
560 Ga0207670_10020366 3300025936 Bacteria 4075
561 Ga0207670_10648966 3300025936 Bacteria 870
562 Ga0207669_10216475 3300025937 Unclassified 1402
563 Ga0207669_10379027 3300025937 Bacteria 1102
564 Ga0207669_11656279 3300025937 Bacteria 546
565 Ga0207704_10457392 3300025938 Bacteria 1020
566 Ga0207704_10833285 3300025938 Unclassified 772
567 Ga0207704_10835615 3300025938 Bacteria 771
568 Ga0207704_11006887 3300025938 Unclassified 705
569 Ga0207704_11319105 3300025938 Bacteria 617
570 Ga0207691_10102453 3300025940 Bacteria 2553
571 Ga0207691_10192586 3300025940 Bacteria 1778
572 Ga0207691_10195192 3300025940 Bacteria 1764
573 Ga0207691_10258706 3300025940 Unclassified 1501
574 Ga0207691_10698200 3300025940 Bacteria 856
575 Ga0207689_10012246 3300025942 Bacteria 7336
576 Ga0207689_10013498 3300025942 Bacteria 6976
577 Ga0207689_10029076 3300025942 Bacteria 4618
578 Ga0207689_10030736 3300025942 Bacteria 4475
579 Ga0207689_10033224 3300025942 Bacteria 4287
580 Ga0207689_10095003 3300025942 Bacteria 2448
581 Ga0207689_10099860 3300025942 Bacteria 2385
582 Ga0207661_10007465 3300025944 Bacteria 7778
583 Ga0207661_10042713 3300025944 Bacteria 3575
584 Ga0207661_10085814 3300025944 Bacteria 2611
585 Ga0207661_11165435 3300025944 Unclassified 709
586 Ga0207679_10000358 3300025945 Bacteria 33285
587 Ga0207679_10002098 3300025945 Bacteria 12378
588 Ga0207679_10125588 3300025945 Bacteria 2050
589 Ga0207679_10196273 3300025945 Bacteria 1682
590 Ga0207679_10245673 3300025945 Unclassified 1519
591 Ga0207679_10339423 3300025945 Bacteria 1306
592 Ga0207667_11060516 3300025949 Unclassified 795
593 Ga0207667_11224048 3300025949 Bacteria 730
594 Ga0207667_11562255 3300025949 Unclassified 629
595 Ga0207651_10004538 3300025960 Bacteria 7019
596 Ga0207651_10029439 3300025960 Unclassified 3479
597 Ga0207651_10229823 3300025960 Unclassified 1505
598 Ga0207651_10328510 3300025960 Bacteria 1281
599 Ga0207651_10565329 3300025960 Bacteria 990
600 Ga0207651_11221230 3300025960 Bacteria 675
601 Ga0207712_10002374 3300025961 Bacteria 12203
602 Ga0207712_10002523 3300025961 Bacteria 11776
603 Ga0207712_10012531 3300025961 Bacteria 5418
604 Ga0207712_10029486 3300025961 Bacteria 3681
605 Ga0207712_10625360 3300025961 Bacteria 934
606 Ga0207712_10635113 3300025961 Bacteria 927
607 Ga0207712_10854483 3300025961 Unclassified 802
608 Ga0207712_11218001 3300025961 Bacteria 672
609 Ga0207668_10048989 3300025972 Bacteria 2902
610 Ga0207668_10457024 3300025972 Bacteria 1091
611 Ga0207668_10617136 3300025972 Unclassified 946
612 Ga0207640_10029303 3300025981 Bacteria 3378
613 Ga0207640_10384796 3300025981 Bacteria 1138
614 Ga0207640_11648987 3300025981 Bacteria 578
615 Ga0207658_10087359 3300025986 Bacteria 2408
616 Ga0207658_10104663 3300025986 Bacteria 2224
617 Ga0207658_10334110 3300025986 Bacteria 1315
618 Ga0207658_10401872 3300025986 Unclassified 1204
619 Ga0207677_10019526 3300026023 Bacteria 4094
620 Ga0207677_10089210 3300026023 Bacteria 2238
621 Ga0207677_10129508 3300026023 Bacteria 1913
622 Ga0207677_10300032 3300026023 Bacteria 1327
623 Ga0207677_11705918 3300026023 Bacteria 584
624 Ga0207703_10455001 3300026035 Bacteria 1196
625 Ga0207703_10922304 3300026035 Bacteria 837
626 Ga0207703_11270083 3300026035 Unclassified 708
627 Ga0207639_10004252 3300026041 Bacteria 9654
628 Ga0207639_10404767 3300026041 Bacteria 1230
629 Ga0207678_10047747 3300026067 Unclassified 3702
630 Ga0207678_10236120 3300026067 Bacteria 1566
631 Ga0207708_10555326 3300026075 Bacteria 969
632 Ga0207708_11045247 3300026075 Unclassified 711
633 Ga0207708_11114227 3300026075 Unclassified 688
634 Ga0207708_11261117 3300026075 Bacteria 647
635 Ga0207708_11275394 3300026075 Unclassified 643
636 Ga0207702_10483212 3300026078 Bacteria 1206
637 Ga0207641_10003037 3300026088 Bacteria 15123
638 Ga0207641_10260204 3300026088 Bacteria 1624
639 Ga0207641_10448510 3300026088 Unclassified 1246
640 Ga0207641_11596044 3300026088 Bacteria 654
641 Ga0207648_10027044 3300026089 Bacteria 5094
642 Ga0207648_10029173 3300026089 Bacteria 4893
643 Ga0207648_10072864 3300026089 Bacteria 2993
644 Ga0207648_10157155 3300026089 Bacteria 2007
645 Ga0207648_10515340 3300026089 Bacteria 1095
646 Ga0207648_10885411 3300026089 Bacteria 833
647 Ga0207648_11089033 3300026089 Bacteria 749
648 Ga0207648_11593965 3300026089 Unclassified 614
649 Ga0207676_10005548 3300026095 Bacteria 8927
650 Ga0207676_10049441 3300026095 Bacteria 3271
651 Ga0207676_10121958 3300026095 Bacteria 2200
652 Ga0207676_10763576 3300026095 Unclassified 941
653 Ga0207674_10004933 3300026116 Bacteria 15944
654 Ga0207674_10011410 3300026116 Bacteria 9983
655 Ga0207674_10021661 3300026116 Bacteria 6919
656 Ga0207674_10058910 3300026116 Bacteria 3888
657 Ga0207674_10226948 3300026116 Bacteria 1816
658 Ga0207674_10227812 3300026116 Bacteria 1812
659 Ga0207674_10341398 3300026116 Unclassified 1448
660 Ga0207674_10472594 3300026116 Unclassified 1212
661 Ga0207674_10477156 3300026116 Bacteria 1205
662 Ga0207675_100000085 3300026118 Bacteria 73716
663 Ga0207675_100027224 3300026118 Bacteria 5325
664 Ga0207675_100082125 3300026118 Bacteria 3022
665 Ga0207675_100095578 3300026118 Bacteria 2796
666 Ga0207675_100166729 3300026118 Bacteria 2104
667 Ga0207675_100443262 3300026118 Unclassified 1285
668 Ga0207675_100566753 3300026118 Bacteria 1136
669 Ga0207675_100629304 3300026118 Unclassified 1078
670 Ga0207675_101141858 3300026118 Unclassified 799
671 Ga0207675_101322475 3300026118 Unclassified 741
672 Ga0207675_102591949 3300026118 Bacteria 517
673 Ga0207683_10006456 3300026121 Bacteria 10037
674 Ga0207683_10302819 3300026121 Bacteria 1462
675 Ga0207683_10326931 3300026121 Unclassified 1405
676 Ga0207683_10845395 3300026121 Bacteria 850
677 Ga0207683_11128068 3300026121 Bacteria 727
678 Ga0207698_10048842 3300026142 Unclassified 3216
679 Ga0207698_10322775 3300026142 Bacteria 1447
680 Ga0207698_11021677 3300026142 Unclassified 838
681 Ga0207698_11099809 3300026142 Bacteria 807
682 Ga0209995_1097655 3300027471 Bacteria 506
683 Ga0207428_10018900 3300027907 Bacteria 5877
684 Ga0207428_10452927 3300027907 Bacteria 935
685 Ga0207428_10505350 3300027907 Bacteria 877
686 Ga0268266_10009751 3300028379 Bacteria 8447
687 Ga0268266_11195776 3300028379 Bacteria 735
688 Ga0268266_11926170 3300028379 Bacteria 565
689 Ga0268265_10005897 3300028380 Bacteria 8348
690 Ga0268265_10266748 3300028380 Bacteria 1525
691 Ga0268265_10537861 3300028380 Bacteria 1107
692 Ga0268265_10793044 3300028380 Unclassified 923
693 Ga0268265_10995431 3300028380 Bacteria 828
694 Ga0268265_11727422 3300028380 Unclassified 632
695 Ga0268265_11733824 3300028380 Unclassified 631
696 Ga0268265_11850382 3300028380 Bacteria 610
697 Ga0268265_12646252 3300028380 Unclassified 507
698 Ga0268264_10345284 3300028381 Bacteria 1415
699 Ga0268264_10400065 3300028381 Bacteria 1319
700 Ga0268264_10466405 3300028381 Bacteria 1226
701 Ga0268264_10573009 3300028381 Unclassified 1110
702 Ga0268264_10698351 3300028381 Bacteria 1007
703 Ga0268264_11251621 3300028381 Bacteria 752
704 Ga0307517_10540871 3300028786 Unclassified 584
705 Ga0307515_10000001 3300028794 Bacteria 4259510
706 Ga0265327_10000059 3300031251 Bacteria 236935
707 Ga0307408_100170105 3300031548 Bacteria 1739
708 Ga0307405_10083700 3300031731 Bacteria 2092
709 Ga0307413_10472757 3300031824 Bacteria 1000
710 Ga0307410_10063775 3300031852 Bacteria 2529
711 Ga0307407_10309073 3300031903 Bacteria 1105
712 Ga0307412_10228231 3300031911 Bacteria 1432
713 Ga0307409_100758348 3300031995 Bacteria 975
714 Ga0307416_100292561 3300032002 Bacteria 1613
715 Ga0307414_10150978 3300032004 Unclassified 1833
716 Ga0307414_10556517 3300032004 Bacteria 1023
717 Ga0307414_11488234 3300032004 Bacteria 630
718 Ga0307411_11129186 3300032005 Bacteria 708
719 Ga0307411_11423294 3300032005 Bacteria 635
720 Ga0307415_100472539 3300032126 Bacteria 1089
721 Ga0373946_0435626 3300035171 Unclassified 666
722 Ga0373947_0704037 3300035725 Bacteria 689
723 Ga0436365_0493931 3300039437 Bacteria 27882
724 Ga0436365_1327844 3300039437 Bacteria 894
725 Ga0439436_0206236 3300041404 Bacteria 563
726 Ga0439439_0053237 3300041406 Bacteria 1064
727 Ga0439453_0011440 3300041408 Bacteria 1480
728 Ga0451787_209659 3300041441 Bacteria 839
729 Ga0451789_0074387 3300041443 Bacteria 713
730 Ga0451793_0088457 3300041452 Unclassified 713
731 Ga0451793_0633286 3300041452 Unclassified 526
732 Ga0451797_1238182 3300041453 Bacteria 582
733 Ga0451797_1272057 3300041453 Unclassified 774
734 Ga0451798_0072829 3300041458 Unclassified 561
735 Ga0451800_0156830 3300041459 Bacteria 638
736 Ga0451800_1096925 3300041459 Bacteria 546
737 Ga0451804_0371286 3300041463 Viruses 1929
738 Ga0451807_0471232 3300041486 Unclassified 985
739 Ga0451807_2135091 3300041486 Unclassified 631
740 Ga0451835_0339757 3300041492 Bacteria 514
741 Ga0451837_1358824 3300041494 Bacteria 708
742 Ga0451845_0387093 3300041501 Bacteria 575
743 Ga0439431_0002433 3300041997 Bacteria 4118
744 Ga0439431_0042447 3300041997 Bacteria 1162
745 Ga0439442_083987 3300042002 Bacteria 683
746 Ga0439442_096915 3300042002 Bacteria 637
747 Ga0439445_0006805 3300042004 Bacteria 2636
748 Ga0439445_0125592 3300042004 Unclassified 738
749 Ga0439449_0307247 3300042007 Bacteria 599
750 Ga0439457_048890 3300042014 Bacteria 948
751 Ga0439462_0217034 3300042015 Bacteria 547
752 Ga0450923_006679 3300042125 Bacteria 1922
753 Ga0450897_005451 3300042128 Bacteria 1103
754 Ga0450894_033998 3300042131 Bacteria 718
755 Ga0450898_021742 3300042134 Bacteria 1131
756 Ga0439458_0154600 3300042157 Bacteria 616
757 Ga0439434_0119407 3300042435 Bacteria 859
758 Ga0439435_0021750 3300042436 Bacteria 1668
759 Ga0439460_0022668 3300042461 Bacteria 1725
760 Ga0451577_0062070 3300042876 Bacteria 3333
761 Ga0451577_0697901 3300042876 Unclassified 919
762 Ga0453684_0208488 3300044712 Bacteria 2273
763 Ga0466970_0240314 3300044765 Bacteria 1013
764 Ga0495638_0040588 3300046460 Bacteria 2949
765 Ga0495582_0882012 3300046473 Unclassified 517
766 Ga0495639_0434254 3300046475 Bacteria 666
767 Ga0495606_0643574 3300046507 Bacteria 514
768 Ga0495643_0077408 3300046522 Bacteria 1738
769 Ga0495644_0130645 3300046523 Bacteria 957
770 Ga0495598_0046801 3300046537 Unclassified 1287
771 Ga0495598_0213205 3300046537 Bacteria 702
772 Ga0495621_0007956 3300046539 Bacteria 3158
773 Ga0495633_0296257 3300046558 Bacteria 735
774 Ga0495656_0330666 3300046615 Bacteria 787
775 Ga0495668_0000419 3300046616 Bacteria 55322
776 Ga0495670_0787622 3300046691 Unclassified 519
777 Ga0495671_0082874 3300046692 Bacteria 1572
778 Ga0495686_0018642 3300047472 Bacteria 4651
779 Ga0495686_0142473 3300047472 Bacteria 1413
780 Ga0495615_0292335 3300048090 Bacteria 526
781 Ga0496100_0355843 3300048903 Bacteria 1107
782 Ga0496104_0218756 3300048907 Bacteria 1817
783 Ga0496105_0605234 3300048908 Bacteria 850
784 Ga0496106_0115248 3300048909 Bacteria 2096
785 Ga0496108_0850428 3300048911 Unclassified 785
786 Ga0496109_0362844 3300048912 Bacteria 1369
787 Ga0496110_0278233 3300048913 Bacteria 1524
788 Ga0496110_0659702 3300048913 Unclassified 946
789 Ga0496114_0458875 3300048917 Bacteria 1128
790 Ga0501292_004190 3300049515 Bacteria 1960
791 Ga0501031_0012012 3300049568 Bacteria 5647
792 Ga0501032_0023583 3300049569 Bacteria 4248
793 Ga0501033_0922630 3300049570 Bacteria 586
794 Ga0501034_0000002 3300049571 Bacteria 565510
795 Ga0501034_0237544 3300049571 Bacteria 1769
796 Ga0501034_0670537 3300049571 Bacteria 937
797 Ga0501036_0052234 3300049572 Unclassified 3461
798 Ga0501037_0035208 3300049573 Bacteria 3693
799 Ga0501038_0013031 3300049574 Bacteria 7582
800 Ga0501039_0060788 3300049575 Bacteria 2925
801 Ga0501043_0005755 3300049579 Bacteria 9987
802 Ga0501043_0215561 3300049579 Bacteria 1487
803 Ga0501047_0042984 3300049581 Bacteria 4366
804 Ga0501047_0379367 3300049581 Bacteria 1248
805 Ga0501072_0216067 3300049588 Unclassified 1528
806 Ga0501073_0359182 3300049589 Bacteria 1006
807 Ga0501198_032552 3300049649 Bacteria 876
808 Ga0501198_077838 3300049649 Bacteria 637
809 Ga0501202_002367 3300049652 Bacteria 3159
810 Ga0501207_063934 3300049654 Bacteria 679
811 Ga0501217_024258 3300049661 Bacteria 1450
812 Ga0501223_018439 3300049663 Bacteria 1373
813 Ga0501233_043334 3300049668 Bacteria 1066
814 Ga0501233_067672 3300049668 Unclassified 899
815 Ga0501235_170670 3300049669 Bacteria 574
816 Ga0501238_016909 3300049671 Bacteria 1014
817 Ga0501239_035940 3300049672 Bacteria 668
818 Ga0501242_000522 3300049674 Bacteria 3418
819 Ga0501252_026207 3300049682 Bacteria 788
820 Ga0501253_019527 3300049683 Bacteria 1171
821 Ga0501257_006107 3300049686 Unclassified 2669
822 Ga0501259_013024 3300049688 Unclassified 1393
823 Ga0501219_000358 3300049703 Bacteria 7717
824 Ga0501225_0076768 3300049705 Unclassified 955
825 Ga0501225_0251245 3300049705 Bacteria 581
826 Ga0501234_008968 3300049707 Bacteria 1560
827 Ga0501234_040403 3300049707 Bacteria 763
828 Ga0501245_020018 3300049708 Unclassified 1041
829 Ga0501080_0783468 3300049742 Bacteria 837
830 Ga0501080_0800587 3300049742 Bacteria 827
831 Ga0501080_0815416 3300049742 Unclassified 818
832 Ga0501083_0166958 3300049744 Bacteria 1439
833 Ga0501241_019508 3300049758 Bacteria 1245
834 Ga0501241_035496 3300049758 Bacteria 953
835 Ga0501263_041564 3300049760 Unclassified 677
836 Ga0501263_059066 3300049760 Bacteria 598
837 Ga0501266_000690 3300049763 Unclassified 4388
838 Ga0501268_015588 3300049765 Unclassified 1251
839 Ga0501273_002008 3300049770 Bacteria 2029
840 Ga0501280_050901 3300049776 Bacteria 697
841 Ga0501035_0027999 3300049822 Bacteria 5148
842 Ga0501044_0004089 3300049823 Bacteria 16365
843 Ga0501044_1415416 3300049823 Unclassified 561
844 Ga0501204_039276 3300049850 Bacteria 688
845 Ga0501284_00086 3300050005 Bacteria 22701
846 nmdc:mga0k408_190414_c1 3300050493 Bacteria 1224
847 nmdc:mga0k408_76831_c1 3300050493 Bacteria 1952
848 nmdc:mga0k408_826427_c1 3300050493 Unclassified 539
849 nmdc:mga05p37_1152140_c1 3300050507 Bacteria 806
850 nmdc:mga05p37_373068_c1 3300050507 Bacteria 1674
851 nmdc:mga05p37_428199_c1 3300050507 Bacteria 1538
852 nmdc:mga09592_131869_c1 3300050508 Bacteria 2151
853 nmdc:mga09592_1556392_c1 3300050508 Unclassified 536
854 nmdc:mga06r32_286869_c1 3300050510 Bacteria 1633
855 nmdc:mga06r32_43908_c1 3300050510 Bacteria 4254
856 nmdc:mga08y16_2583_c1 3300050511 Bacteria 18619
857 nmdc:mga08y16_517132_c1 3300050511 Bacteria 1211
858 nmdc:mga08y16_614776_c1 3300050511 Bacteria 1094
859 nmdc:mga08y16_770698_c1 3300050511 Bacteria 957
860 nmdc:mga08y16_985824_c1 3300050511 Bacteria 823
861 nmdc:mga0n895_58110_c1 3300050512 Unclassified 3813
862 Ga0500578_0000010 3300053086 Bacteria 217642
863 Ga0500644_0349568 3300053088 Unclassified 639
864 Ga0500646_0233192 3300053090 Bacteria 642
865 Ga0500583_0002475 3300053092 Bacteria 5558
866 Ga0500651_0697976 3300053093 Bacteria 543
867 Ga0500641_0101597 3300053096 Unclassified 1233
868 Ga0500556_0003123 3300053104 Bacteria 4946
869 Ga0500557_173339 3300053105 Bacteria 703
870 Ga0500562_000011 3300053108 Bacteria 179510
871 Ga0500628_149582 3300053129 Bacteria 652
872 Ga0500628_165708 3300053129 Bacteria 625
873 Ga0500652_001199 3300053131 Bacteria 8262
874 Ga0500568_0028144 3300053139 Bacteria 2345
875 Ga0500611_000019 3300053727 Bacteria 110161
876 Ga0500611_036298 3300053727 Bacteria 1055
877 Ga0500645_008152 3300053730 Bacteria 3600
878 Ga0500645_009433 3300053730 Unclassified 3278
879 Ga0500587_043235 3300053739 Unclassified 651
880 Ga0500661_012706 3300055283 Bacteria 1520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001979 JGI24740J21852_10014977 JGI24740J21852_100149773 98
2 3300002738 JGI25154J39366_1000006 JGI25154J39366_100000682 98
3 3300002741 JGI25157J39369_1005105 JGI25157J39369_10051051 98
4 3300003215 JGI25153J46596_10001206 JGI25153J46596_100012064 98
5 3300003323 rootH1_10019517 rootH1_100195172 98
6 3300003354 JGI25160J50197_1008388 JGI25160J50197_10083883 98
7 3300005262 Ga0065165_1034982 Ga0065165_10349822 98
8 3300005288 Ga0065714_10546582 Ga0065714_105465822 98
9 3300005289 Ga0065704_10457232 Ga0065704_104572322 98
10 3300005290 Ga0065712_10839525 Ga0065712_108395251 98
11 3300005293 Ga0065715_10583807 Ga0065715_105838072 98
12 3300005293 Ga0065715_10970823 Ga0065715_109708231 98
13 3300005335 Ga0070666_10216688 Ga0070666_102166883 98
14 3300005337 Ga0070682_100000074 Ga0070682_10000007438 98
15 3300005355 Ga0070671_100048852 Ga0070671_1000488523 98
16 3300005564 Ga0070664_101695314 Ga0070664_1016953142 98
17 3300006237 Ga0097621_100004695 Ga0097621_1000046953 98
18 3300006358 Ga0068871_100047999 Ga0068871_1000479994 98
19 3300009094 Ga0111539_11928083 Ga0111539_119280832 98
20 3300009094 Ga0111539_12889943 Ga0111539_128899431 98
21 3300009098 Ga0105245_12055894 Ga0105245_120558942 98
22 3300010375 Ga0105239_11832559 Ga0105239_118325592 98
23 3300013104 Ga0157370_10187902 Ga0157370_101879022 98
24 3300013296 Ga0157374_10833797 Ga0157374_108337971 98
25 3300013296 Ga0157374_10939380 Ga0157374_109393802 98
26 3300013297 Ga0157378_10028079 Ga0157378_100280797 98
27 3300013297 Ga0157378_13298139 Ga0157378_132981391 98
28 3300013306 Ga0163162_10656575 Ga0163162_106565752 98
29 3300013306 Ga0163162_11148221 Ga0163162_111482212 98
30 3300013306 Ga0163162_11844183 Ga0163162_118441831 98
31 3300013308 Ga0157375_11266564 Ga0157375_112665642 98
32 3300014326 Ga0157380_10038502 Ga0157380_100385023 98
33 3300014326 Ga0157380_13302594 Ga0157380_133025941 98
34 3300014968 Ga0157379_10145731 Ga0157379_101457313 98
35 3300014969 Ga0157376_11500046 Ga0157376_115000462 98
36 3300025246 Ga0209646_1000031 Ga0209646_1000031115 98
37 3300025250 Ga0209026_1000019 Ga0209026_1000019115 98
38 3300025297 Ga0209758_1002724 Ga0209758_100272415 98
39 3300025302 Ga0207426_1000445 Ga0207426_100044533 98
40 3300025903 Ga0207680_10764423 Ga0207680_107644231 98
41 3300025931 Ga0207644_10274475 Ga0207644_102744752 98
42 3300025940 Ga0207691_10258706 Ga0207691_102587062 98
43 3300025981 Ga0207640_11648987 Ga0207640_116489872 98
44 3300028786 Ga0307517_10540871 Ga0307517_105408712 98
45 3300028794 Ga0307515_10000001 Ga0307515_100000011988 98
46 3300031251 Ga0265327_10000059 Ga0265327_1000005997 98
47 3300032004 Ga0307414_10556517 Ga0307414_105565173 98
48 3300041452 Ga0451793_0633286 Ga0451793_0633286_138_434 98
49 3300041453 Ga0451797_1272057 Ga0451797_1272057_350_646 98
50 3300041459 Ga0451800_0156830 Ga0451800_0156830_133_429 98
51 3300041997 Ga0439431_0002433 Ga0439431_0002433_1463_1765 98
52 3300042004 Ga0439445_0006805 Ga0439445_0006805_682_984 98
53 3300049570 Ga0501033_0922630 Ga0501033_0922630_191_487 98
54 3300049571 Ga0501034_0670537 Ga0501034_0670537_108_404 98
55 3300049581 Ga0501047_0042984 Ga0501047_0042984_1927_2223 98
56 3300053105 Ga0500557_173339 Ga0500557_173339_193_489 98
57 3300053131 Ga0500652_001199 Ga0500652_001199_7364_7660 98
58 3300053139 Ga0500568_0028144 Ga0500568_0028144_287_583 98
59 2162886012 MBSR1b_contig_6259703 MBSR1b_0581.00004520 99
60 3300002076 JGI24749J21850_1039359 JGI24749J21850_10393591 99
61 3300003320 rootH2_10169946 rootH2_101699461 99
62 3300003322 rootL2_10217998 rootL2_102179983 99
63 3300003322 rootL2_10347437 rootL2_103474371 99
64 3300003322 rootL2_10370816 rootL2_103708162 99
65 3300005290 Ga0065712_10008807 Ga0065712_100088074 99
66 3300005290 Ga0065712_10427440 Ga0065712_104274402 99
67 3300005293 Ga0065715_10199574 Ga0065715_101995742 99
68 3300005295 Ga0065707_10140963 Ga0065707_101409633 99
69 3300005295 Ga0065707_10149320 Ga0065707_101493202 99
70 3300005295 Ga0065707_10488707 Ga0065707_104887072 99
71 3300005295 Ga0065707_10838841 Ga0065707_108388411 99
72 3300005328 Ga0070676_10007859 Ga0070676_100078594 99
73 3300005328 Ga0070676_10020642 Ga0070676_100206423 99
74 3300005328 Ga0070676_10232763 Ga0070676_102327632 99
75 3300005328 Ga0070676_10436259 Ga0070676_104362592 99
76 3300005328 Ga0070676_10513734 Ga0070676_105137341 99
77 3300005328 Ga0070676_10989545 Ga0070676_109895451 99
78 3300005329 Ga0070683_100035991 Ga0070683_1000359913 99
79 3300005329 Ga0070683_100059027 Ga0070683_1000590272 99
80 3300005329 Ga0070683_100393287 Ga0070683_1003932872 99
81 3300005329 Ga0070683_100434135 Ga0070683_1004341352 99
82 3300005330 Ga0070690_100012749 Ga0070690_1000127494 99
83 3300005330 Ga0070690_100024644 Ga0070690_1000246441 99
84 3300005330 Ga0070690_100078041 Ga0070690_1000780414 99
85 3300005331 Ga0070670_100071916 Ga0070670_1000719163 99
86 3300005331 Ga0070670_100196621 Ga0070670_1001966212 99
87 3300005331 Ga0070670_100417294 Ga0070670_1004172942 99
88 3300005331 Ga0070670_100438144 Ga0070670_1004381441 99
89 3300005331 Ga0070670_100666928 Ga0070670_1006669281 99
90 3300005331 Ga0070670_100684610 Ga0070670_1006846101 99
91 3300005331 Ga0070670_100878895 Ga0070670_1008788952 99
92 3300005333 Ga0070677_10054505 Ga0070677_100545052 99
93 3300005333 Ga0070677_10141832 Ga0070677_101418322 99
94 3300005333 Ga0070677_10407330 Ga0070677_104073301 99
95 3300005333 Ga0070677_10562623 Ga0070677_105626231 99
96 3300005334 Ga0068869_100017799 Ga0068869_1000177993 99
97 3300005334 Ga0068869_100022931 Ga0068869_1000229313 99
98 3300005334 Ga0068869_100053417 Ga0068869_1000534172 99
99 3300005334 Ga0068869_100058198 Ga0068869_1000581983 99
100 3300005334 Ga0068869_100078567 Ga0068869_1000785674 99
101 3300005334 Ga0068869_100098868 Ga0068869_1000988684 99
102 3300005335 Ga0070666_10004480 Ga0070666_100044806 99
103 3300005335 Ga0070666_10338710 Ga0070666_103387102 99
104 3300005335 Ga0070666_10361528 Ga0070666_103615282 99
105 3300005335 Ga0070666_10770773 Ga0070666_107707732 99
106 3300005337 Ga0070682_100004396 Ga0070682_1000043968 99
107 3300005337 Ga0070682_101222467 Ga0070682_1012224671 99
108 3300005338 Ga0068868_100005937 Ga0068868_1000059376 99
109 3300005338 Ga0068868_100013130 Ga0068868_1000131303 99
110 3300005338 Ga0068868_100261978 Ga0068868_1002619783 99
111 3300005338 Ga0068868_100273456 Ga0068868_1002734562 99
112 3300005338 Ga0068868_100387346 Ga0068868_1003873462 99
113 3300005338 Ga0068868_100763262 Ga0068868_1007632622 99
114 3300005338 Ga0068868_101826814 Ga0068868_1018268142 99
115 3300005340 Ga0070689_100014907 Ga0070689_1000149074 99
116 3300005340 Ga0070689_100024173 Ga0070689_1000241733 99
117 3300005340 Ga0070689_100025709 Ga0070689_1000257093 99
118 3300005340 Ga0070689_100040531 Ga0070689_1000405313 99
119 3300005343 Ga0070687_100013203 Ga0070687_1000132035 99
120 3300005344 Ga0070661_100019629 Ga0070661_1000196297 99
121 3300005344 Ga0070661_100110631 Ga0070661_1001106312 99
122 3300005344 Ga0070661_100218317 Ga0070661_1002183172 99
123 3300005344 Ga0070661_100720103 Ga0070661_1007201032 99
124 3300005344 Ga0070661_101586447 Ga0070661_1015864471 99
125 3300005347 Ga0070668_100013719 Ga0070668_1000137195 99
126 3300005347 Ga0070668_100148831 Ga0070668_1001488314 99
127 3300005347 Ga0070668_100532105 Ga0070668_1005321052 99
128 3300005347 Ga0070668_101709677 Ga0070668_1017096771 99
129 3300005353 Ga0070669_100004915 Ga0070669_10000491511 99
130 3300005353 Ga0070669_100055836 Ga0070669_1000558362 99
131 3300005353 Ga0070669_100068950 Ga0070669_1000689501 99
132 3300005353 Ga0070669_100617202 Ga0070669_1006172022 99
133 3300005354 Ga0070675_100009178 Ga0070675_1000091785 99
134 3300005354 Ga0070675_100030573 Ga0070675_1000305734 99
135 3300005354 Ga0070675_100167024 Ga0070675_1001670244 99
136 3300005354 Ga0070675_101292958 Ga0070675_1012929581 99
137 3300005355 Ga0070671_100110351 Ga0070671_1001103512 99
138 3300005355 Ga0070671_100150056 Ga0070671_1001500563 99
139 3300005355 Ga0070671_100232786 Ga0070671_1002327863 99
140 3300005355 Ga0070671_100235221 Ga0070671_1002352211 99
141 3300005355 Ga0070671_101282248 Ga0070671_1012822482 99
142 3300005356 Ga0070674_100317527 Ga0070674_1003175272 99
143 3300005356 Ga0070674_100484704 Ga0070674_1004847042 99
144 3300005364 Ga0070673_100028363 Ga0070673_1000283633 99
145 3300005364 Ga0070673_100112443 Ga0070673_1001124433 99
146 3300005364 Ga0070673_100346225 Ga0070673_1003462253 99
147 3300005364 Ga0070673_100380156 Ga0070673_1003801562 99
148 3300005364 Ga0070673_100895384 Ga0070673_1008953842 99
149 3300005364 Ga0070673_101091602 Ga0070673_1010916022 99
150 3300005364 Ga0070673_101256805 Ga0070673_1012568052 99
151 3300005364 Ga0070673_101281909 Ga0070673_1012819092 99
152 3300005364 Ga0070673_101754742 Ga0070673_1017547421 99
153 3300005364 Ga0070673_102007834 Ga0070673_1020078342 99
154 3300005365 Ga0070688_100007885 Ga0070688_1000078853 99
155 3300005365 Ga0070688_100008468 Ga0070688_1000084684 99
156 3300005365 Ga0070688_100021223 Ga0070688_1000212235 99
157 3300005365 Ga0070688_101357769 Ga0070688_1013577692 99
158 3300005366 Ga0070659_100003078 Ga0070659_10000307813 99
159 3300005366 Ga0070659_100266940 Ga0070659_1002669401 99
160 3300005366 Ga0070659_100691773 Ga0070659_1006917732 99
161 3300005366 Ga0070659_100771798 Ga0070659_1007717981 99
162 3300005367 Ga0070667_100008847 Ga0070667_1000088475 99
163 3300005367 Ga0070667_100112891 Ga0070667_1001128912 99
164 3300005367 Ga0070667_100136660 Ga0070667_1001366602 99
165 3300005367 Ga0070667_100577028 Ga0070667_1005770282 99
166 3300005367 Ga0070667_100638213 Ga0070667_1006382132 99
167 3300005367 Ga0070667_101358270 Ga0070667_1013582702 99
168 3300005367 Ga0070667_101648569 Ga0070667_1016485692 99
169 3300005367 Ga0070667_102162299 Ga0070667_1021622992 99
170 3300005436 Ga0070713_102246801 Ga0070713_1022468012 99
171 3300005438 Ga0070701_10169195 Ga0070701_101691952 99
172 3300005438 Ga0070701_10223048 Ga0070701_102230482 99
173 3300005438 Ga0070701_10263551 Ga0070701_102635511 99
174 3300005438 Ga0070701_10470025 Ga0070701_104700251 99
175 3300005439 Ga0070711_101177192 Ga0070711_1011771922 99
176 3300005440 Ga0070705_100529708 Ga0070705_1005297082 99
177 3300005441 Ga0070700_100288151 Ga0070700_1002881512 99
178 3300005441 Ga0070700_100495782 Ga0070700_1004957821 99
179 3300005441 Ga0070700_101228894 Ga0070700_1012288941 99
180 3300005441 Ga0070700_101462030 Ga0070700_1014620301 99
181 3300005444 Ga0070694_100984849 Ga0070694_1009848491 99
182 3300005455 Ga0070663_100123580 Ga0070663_1001235802 99
183 3300005456 Ga0070678_100018654 Ga0070678_1000186543 99
184 3300005456 Ga0070678_100035603 Ga0070678_1000356032 99
185 3300005456 Ga0070678_101137725 Ga0070678_1011377252 99
186 3300005456 Ga0070678_101400438 Ga0070678_1014004382 99
187 3300005457 Ga0070662_100010383 Ga0070662_1000103834 99
188 3300005457 Ga0070662_100023417 Ga0070662_1000234172 99
189 3300005457 Ga0070662_100078135 Ga0070662_1000781354 99
190 3300005457 Ga0070662_100123997 Ga0070662_1001239972 99
191 3300005457 Ga0070662_101071192 Ga0070662_1010711921 99
192 3300005459 Ga0068867_100025237 Ga0068867_1000252372 99
193 3300005459 Ga0068867_100054133 Ga0068867_1000541334 99
194 3300005459 Ga0068867_100133752 Ga0068867_1001337523 99
195 3300005459 Ga0068867_100170091 Ga0068867_1001700912 99
196 3300005459 Ga0068867_100219713 Ga0068867_1002197132 99
197 3300005459 Ga0068867_100316363 Ga0068867_1003163632 99
198 3300005459 Ga0068867_100664133 Ga0068867_1006641332 99
199 3300005459 Ga0068867_101127578 Ga0068867_1011275781 99
200 3300005466 Ga0070685_10003971 Ga0070685_100039712 99
201 3300005466 Ga0070685_10010419 Ga0070685_100104194 99
202 3300005466 Ga0070685_10041829 Ga0070685_100418293 99
203 3300005466 Ga0070685_10126283 Ga0070685_101262832 99
204 3300005466 Ga0070685_10263780 Ga0070685_102637801 99
205 3300005466 Ga0070685_10371365 Ga0070685_103713652 99
206 3300005466 Ga0070685_11485740 Ga0070685_114857401 99
207 3300005471 Ga0070698_100056168 Ga0070698_1000561684 99
208 3300005518 Ga0070699_100328589 Ga0070699_1003285892 99
209 3300005518 Ga0070699_100774410 Ga0070699_1007744101 99
210 3300005518 Ga0070699_101099472 Ga0070699_1010994722 99
211 3300005530 Ga0070679_100009158 Ga0070679_1000091582 99
212 3300005535 Ga0070684_100000995 Ga0070684_10000099517 99
213 3300005535 Ga0070684_100007553 Ga0070684_1000075536 99
214 3300005535 Ga0070684_100054427 Ga0070684_1000544272 99
215 3300005535 Ga0070684_100375061 Ga0070684_1003750612 99
216 3300005535 Ga0070684_100376607 Ga0070684_1003766072 99
217 3300005539 Ga0068853_100004736 Ga0068853_1000047363 99
218 3300005539 Ga0068853_100509371 Ga0068853_1005093714 99
219 3300005539 Ga0068853_100537705 Ga0068853_1005377053 99
220 3300005539 Ga0068853_100553412 Ga0068853_1005534122 99
221 3300005543 Ga0070672_100074663 Ga0070672_1000746632 99
222 3300005543 Ga0070672_100496091 Ga0070672_1004960912 99
223 3300005543 Ga0070672_100607859 Ga0070672_1006078591 99
224 3300005543 Ga0070672_100732556 Ga0070672_1007325562 99
225 3300005543 Ga0070672_101701053 Ga0070672_1017010531 99
226 3300005543 Ga0070672_101718224 Ga0070672_1017182242 99
227 3300005544 Ga0070686_100032440 Ga0070686_1000324404 99
228 3300005544 Ga0070686_100122814 Ga0070686_1001228144 99
229 3300005544 Ga0070686_100479820 Ga0070686_1004798202 99
230 3300005544 Ga0070686_100513841 Ga0070686_1005138412 99
231 3300005545 Ga0070695_100649834 Ga0070695_1006498342 99
232 3300005545 Ga0070695_101065316 Ga0070695_1010653161 99
233 3300005546 Ga0070696_100338710 Ga0070696_1003387103 99
234 3300005547 Ga0070693_100222641 Ga0070693_1002226412 99
235 3300005548 Ga0070665_100002492 Ga0070665_10000249213 99
236 3300005548 Ga0070665_100199412 Ga0070665_1001994123 99
237 3300005548 Ga0070665_100722115 Ga0070665_1007221152 99
238 3300005548 Ga0070665_101354247 Ga0070665_1013542472 99
239 3300005549 Ga0070704_101567279 Ga0070704_1015672792 99
240 3300005563 Ga0068855_100061427 Ga0068855_1000614275 99
241 3300005563 Ga0068855_101877061 Ga0068855_1018770612 99
242 3300005564 Ga0070664_100001774 Ga0070664_1000017746 99
243 3300005564 Ga0070664_100006101 Ga0070664_1000061013 99
244 3300005564 Ga0070664_100162585 Ga0070664_1001625854 99
245 3300005564 Ga0070664_100191340 Ga0070664_1001913403 99
246 3300005577 Ga0068857_100026740 Ga0068857_1000267402 99
247 3300005577 Ga0068857_100035852 Ga0068857_1000358525 99
248 3300005577 Ga0068857_100113353 Ga0068857_1001133531 99
249 3300005577 Ga0068857_100185247 Ga0068857_1001852472 99
250 3300005577 Ga0068857_100215771 Ga0068857_1002157712 99
251 3300005577 Ga0068857_100295426 Ga0068857_1002954262 99
252 3300005577 Ga0068857_100442603 Ga0068857_1004426032 99
253 3300005577 Ga0068857_100599055 Ga0068857_1005990551 99
254 3300005577 Ga0068857_100806248 Ga0068857_1008062482 99
255 3300005577 Ga0068857_101144879 Ga0068857_1011448792 99
256 3300005578 Ga0068854_100020807 Ga0068854_1000208074 99
257 3300005578 Ga0068854_101258726 Ga0068854_1012587261 99
258 3300005614 Ga0068856_102227666 Ga0068856_1022276662 99
259 3300005615 Ga0070702_100464833 Ga0070702_1004648332 99
260 3300005616 Ga0068852_100307303 Ga0068852_1003073032 99
261 3300005616 Ga0068852_101290221 Ga0068852_1012902212 99
262 3300005617 Ga0068859_100002822 Ga0068859_1000028224 99
263 3300005617 Ga0068859_100029450 Ga0068859_1000294504 99
264 3300005617 Ga0068859_100091945 Ga0068859_1000919453 99
265 3300005617 Ga0068859_100118674 Ga0068859_1001186741 99
266 3300005617 Ga0068859_100222328 Ga0068859_1002223281 99
267 3300005617 Ga0068859_100308909 Ga0068859_1003089093 99
268 3300005617 Ga0068859_100795581 Ga0068859_1007955812 99
269 3300005618 Ga0068864_100023594 Ga0068864_1000235943 99
270 3300005618 Ga0068864_100189701 Ga0068864_1001897013 99
271 3300005618 Ga0068864_100769360 Ga0068864_1007693602 99
272 3300005618 Ga0068864_101424500 Ga0068864_1014245001 99
273 3300005618 Ga0068864_101688576 Ga0068864_1016885761 99
274 3300005618 Ga0068864_101889295 Ga0068864_1018892952 99
275 3300005718 Ga0068866_10008998 Ga0068866_100089984 99
276 3300005719 Ga0068861_100001772 Ga0068861_1000017724 99
277 3300005719 Ga0068861_100017269 Ga0068861_1000172694 99
278 3300005719 Ga0068861_100044377 Ga0068861_1000443775 99
279 3300005719 Ga0068861_100258144 Ga0068861_1002581442 99
280 3300005719 Ga0068861_100290374 Ga0068861_1002903742 99
281 3300005719 Ga0068861_100412765 Ga0068861_1004127652 99
282 3300005719 Ga0068861_100550602 Ga0068861_1005506023 99
283 3300005719 Ga0068861_101593426 Ga0068861_1015934262 99
284 3300005719 Ga0068861_101951319 Ga0068861_1019513191 99
285 3300005719 Ga0068861_102253362 Ga0068861_1022533621 99
286 3300005834 Ga0068851_10262209 Ga0068851_102622092 99
287 3300005840 Ga0068870_10230219 Ga0068870_102302192 99
288 3300005840 Ga0068870_10857559 Ga0068870_108575592 99
289 3300005841 Ga0068863_100030815 Ga0068863_1000308153 99
290 3300005841 Ga0068863_100047050 Ga0068863_1000470505 99
291 3300005841 Ga0068863_100076286 Ga0068863_1000762864 99
292 3300005841 Ga0068863_100383849 Ga0068863_1003838492 99
293 3300005841 Ga0068863_100559999 Ga0068863_1005599993 99
294 3300005841 Ga0068863_100696940 Ga0068863_1006969402 99
295 3300005841 Ga0068863_101866351 Ga0068863_1018663512 99
296 3300005842 Ga0068858_100048719 Ga0068858_1000487193 99
297 3300005842 Ga0068858_100065866 Ga0068858_1000658663 99
298 3300005842 Ga0068858_100174823 Ga0068858_1001748232 99
299 3300005842 Ga0068858_100185574 Ga0068858_1001855742 99
300 3300005842 Ga0068858_100357793 Ga0068858_1003577931 99
301 3300005842 Ga0068858_101959183 Ga0068858_1019591832 99
302 3300005843 Ga0068860_100204138 Ga0068860_1002041383 99
303 3300005843 Ga0068860_100261214 Ga0068860_1002612142 99
304 3300005843 Ga0068860_100345388 Ga0068860_1003453881 99
305 3300005843 Ga0068860_100587538 Ga0068860_1005875382 99
306 3300005843 Ga0068860_101084025 Ga0068860_1010840252 99
307 3300005844 Ga0068862_100009580 Ga0068862_1000095809 99
308 3300005844 Ga0068862_100100885 Ga0068862_1001008853 99
309 3300005844 Ga0068862_100169160 Ga0068862_1001691604 99
310 3300005844 Ga0068862_100201988 Ga0068862_1002019883 99
311 3300005844 Ga0068862_100335512 Ga0068862_1003355122 99
312 3300005844 Ga0068862_100860558 Ga0068862_1008605581 99
313 3300005844 Ga0068862_102254094 Ga0068862_1022540941 99
314 3300005844 Ga0068862_102676828 Ga0068862_1026768282 99
315 3300006028 Ga0070717_11704411 Ga0070717_117044111 99
316 3300006163 Ga0070715_10284825 Ga0070715_102848252 99
317 3300006195 Ga0075366_10004353 Ga0075366_100043533 99
318 3300006195 Ga0075366_10128109 Ga0075366_101281094 99
319 3300006195 Ga0075366_10378713 Ga0075366_103787132 99
320 3300006237 Ga0097621_100028621 Ga0097621_1000286216 99
321 3300006237 Ga0097621_100500564 Ga0097621_1005005642 99
322 3300006237 Ga0097621_100686158 Ga0097621_1006861582 99
323 3300006237 Ga0097621_101679292 Ga0097621_1016792921 99
324 3300006237 Ga0097621_101811841 Ga0097621_1018118411 99
325 3300006237 Ga0097621_102068902 Ga0097621_1020689022 99
326 3300006358 Ga0068871_100093437 Ga0068871_1000934373 99
327 3300006358 Ga0068871_100246264 Ga0068871_1002462641 99
328 3300006358 Ga0068871_101482432 Ga0068871_1014824322 99
329 3300006358 Ga0068871_101573206 Ga0068871_1015732061 99
330 3300006844 Ga0075428_100025886 Ga0075428_10002588611 99
331 3300006844 Ga0075428_100078023 Ga0075428_1000780234 99
332 3300006846 Ga0075430_100014225 Ga0075430_1000142259 99
333 3300006847 Ga0075431_100083698 Ga0075431_1000836982 99
334 3300006852 Ga0075433_10865034 Ga0075433_108650342 99
335 3300006880 Ga0075429_100000533 Ga0075429_10000053331 99
336 3300006880 Ga0075429_100176026 Ga0075429_1001760261 99
337 3300006881 Ga0068865_100016762 Ga0068865_1000167625 99
338 3300006881 Ga0068865_100375037 Ga0068865_1003750373 99
339 3300006881 Ga0068865_100759975 Ga0068865_1007599752 99
340 3300006881 Ga0068865_101155883 Ga0068865_1011558831 99
341 3300006881 Ga0068865_101247691 Ga0068865_1012476912 99
342 3300006881 Ga0068865_101706434 Ga0068865_1017064342 99
343 3300006931 Ga0097620_100002822 Ga0097620_10000282217 99
344 3300006931 Ga0097620_100029453 Ga0097620_1000294534 99
345 3300006931 Ga0097620_100091940 Ga0097620_1000919403 99
346 3300006931 Ga0097620_100118676 Ga0097620_1001186761 99
347 3300006931 Ga0097620_100222338 Ga0097620_1002223381 99
348 3300006931 Ga0097620_100308913 Ga0097620_1003089132 99
349 3300006931 Ga0097620_100795552 Ga0097620_1007955522 99
350 3300009011 Ga0105251_10167642 Ga0105251_101676421 99
351 3300009093 Ga0105240_10006100 Ga0105240_1000610018 99
352 3300009093 Ga0105240_10403482 Ga0105240_104034822 99
353 3300009093 Ga0105240_10825950 Ga0105240_108259502 99
354 3300009093 Ga0105240_10921344 Ga0105240_109213442 99
355 3300009094 Ga0111539_10003935 Ga0111539_100039355 99
356 3300009094 Ga0111539_10194276 Ga0111539_101942762 99
357 3300009094 Ga0111539_10405992 Ga0111539_104059922 99
358 3300009094 Ga0111539_11238718 Ga0111539_112387181 99
359 3300009094 Ga0111539_12121033 Ga0111539_121210332 99
360 3300009094 Ga0111539_12176837 Ga0111539_121768372 99
361 3300009101 Ga0105247_10003381 Ga0105247_1000338112 99
362 3300009101 Ga0105247_10350040 Ga0105247_103500401 99
363 3300009101 Ga0105247_10713407 Ga0105247_107134072 99
364 3300009101 Ga0105247_11487146 Ga0105247_114871461 99
365 3300009101 Ga0105247_11491109 Ga0105247_114911091 99
366 3300009147 Ga0114129_10055628 Ga0114129_100556282 99
367 3300009147 Ga0114129_10527949 Ga0114129_105279493 99
368 3300009147 Ga0114129_10743522 Ga0114129_107435222 99
369 3300009147 Ga0114129_12027959 Ga0114129_120279592 99
370 3300009148 Ga0105243_10748645 Ga0105243_107486452 99
371 3300009174 Ga0105241_10002034 Ga0105241_100020342 99
372 3300009174 Ga0105241_10202248 Ga0105241_102022482 99
373 3300009174 Ga0105241_10370709 Ga0105241_103707092 99
374 3300009174 Ga0105241_10387242 Ga0105241_103872423 99
375 3300009174 Ga0105241_10832695 Ga0105241_108326952 99
376 3300009174 Ga0105241_10908279 Ga0105241_109082792 99
377 3300009176 Ga0105242_10088493 Ga0105242_100884935 99
378 3300009176 Ga0105242_10428946 Ga0105242_104289462 99
379 3300009176 Ga0105242_11067601 Ga0105242_110676011 99
380 3300009176 Ga0105242_11254731 Ga0105242_112547312 99
381 3300009176 Ga0105242_12644916 Ga0105242_126449162 99
382 3300009177 Ga0105248_10208097 Ga0105248_102080974 99
383 3300009177 Ga0105248_11472085 Ga0105248_114720852 99
384 3300009177 Ga0105248_11717501 Ga0105248_117175012 99
385 3300009177 Ga0105248_11948589 Ga0105248_119485892 99
386 3300009177 Ga0105248_12818266 Ga0105248_128182662 99
387 3300009545 Ga0105237_10445914 Ga0105237_104459142 99
388 3300009545 Ga0105237_10641414 Ga0105237_106414142 99
389 3300009545 Ga0105237_10676782 Ga0105237_106767823 99
390 3300009551 Ga0105238_11998972 Ga0105238_119989722 99
391 3300009553 Ga0105249_10002193 Ga0105249_1000219312 99
392 3300009553 Ga0105249_10006815 Ga0105249_100068158 99
393 3300009553 Ga0105249_10012704 Ga0105249_100127044 99
394 3300009553 Ga0105249_10023038 Ga0105249_100230384 99
395 3300009553 Ga0105249_10046670 Ga0105249_100466703 99
396 3300009553 Ga0105249_10247832 Ga0105249_102478322 99
397 3300009553 Ga0105249_10294614 Ga0105249_102946143 99
398 3300009553 Ga0105249_10417805 Ga0105249_104178053 99
399 3300009553 Ga0105249_10604077 Ga0105249_106040772 99
400 3300009553 Ga0105249_10841050 Ga0105249_108410502 99
401 3300009553 Ga0105249_12264764 Ga0105249_122647642 99
402 3300010375 Ga0105239_10145403 Ga0105239_101454032 99
403 3300010375 Ga0105239_10534590 Ga0105239_105345902 99
404 3300010375 Ga0105239_10601323 Ga0105239_106013232 99
405 3300011119 Ga0105246_10257922 Ga0105246_102579221 99
406 3300011119 Ga0105246_10684602 Ga0105246_106846021 99
407 3300011119 Ga0105246_10788380 Ga0105246_107883802 99
408 3300011119 Ga0105246_11840854 Ga0105246_118408541 99
409 3300012485 Ga0157325_1031292 Ga0157325_10312921 99
410 3300013100 Ga0157373_10315527 Ga0157373_103155272 99
411 3300013100 Ga0157373_10846155 Ga0157373_108461551 99
412 3300013102 Ga0157371_10869579 Ga0157371_108695791 99
413 3300013102 Ga0157371_11093060 Ga0157371_110930602 99
414 3300013104 Ga0157370_10006548 Ga0157370_100065485 99
415 3300013104 Ga0157370_10018237 Ga0157370_100182379 99
416 3300013104 Ga0157370_10049385 Ga0157370_100493853 99
417 3300013104 Ga0157370_11607282 Ga0157370_116072822 99
418 3300013105 Ga0157369_10372541 Ga0157369_103725412 99
419 3300013105 Ga0157369_10396855 Ga0157369_103968553 99
420 3300013105 Ga0157369_10710774 Ga0157369_107107742 99
421 3300013296 Ga0157374_10002306 Ga0157374_1000230614 99
422 3300013296 Ga0157374_10014218 Ga0157374_1001421810 99
423 3300013296 Ga0157374_10019065 Ga0157374_100190653 99
424 3300013296 Ga0157374_10798772 Ga0157374_107987723 99
425 3300013296 Ga0157374_10851903 Ga0157374_108519032 99
426 3300013296 Ga0157374_11091731 Ga0157374_110917312 99
427 3300013297 Ga0157378_10121956 Ga0157378_101219562 99
428 3300013297 Ga0157378_10382625 Ga0157378_103826253 99
429 3300013297 Ga0157378_11200077 Ga0157378_112000772 99
430 3300013297 Ga0157378_11790281 Ga0157378_117902812 99
431 3300013297 Ga0157378_12848215 Ga0157378_128482152 99
432 3300013306 Ga0163162_10004448 Ga0163162_100044487 99
433 3300013306 Ga0163162_10014246 Ga0163162_100142466 99
434 3300013306 Ga0163162_10020100 Ga0163162_100201006 99
435 3300013306 Ga0163162_10027978 Ga0163162_100279782 99
436 3300013306 Ga0163162_10117366 Ga0163162_101173661 99
437 3300013306 Ga0163162_10240533 Ga0163162_102405335 99
438 3300013306 Ga0163162_10322890 Ga0163162_103228903 99
439 3300013306 Ga0163162_10677439 Ga0163162_106774392 99
440 3300013306 Ga0163162_10923735 Ga0163162_109237351 99
441 3300013306 Ga0163162_11396635 Ga0163162_113966352 99
442 3300013307 Ga0157372_10137420 Ga0157372_101374203 99
443 3300013307 Ga0157372_10164580 Ga0157372_101645802 99
444 3300013307 Ga0157372_10292130 Ga0157372_102921302 99
445 3300013307 Ga0157372_10450393 Ga0157372_104503931 99
446 3300013307 Ga0157372_11329778 Ga0157372_113297782 99
447 3300013307 Ga0157372_11700051 Ga0157372_117000512 99
448 3300013307 Ga0157372_11786148 Ga0157372_117861482 99
449 3300013307 Ga0157372_12505393 Ga0157372_125053932 99
450 3300013308 Ga0157375_10009467 Ga0157375_100094672 99
451 3300013308 Ga0157375_10017272 Ga0157375_100172722 99
452 3300013308 Ga0157375_10019432 Ga0157375_100194327 99
453 3300013308 Ga0157375_10060278 Ga0157375_100602783 99
454 3300013308 Ga0157375_10071276 Ga0157375_100712763 99
455 3300013308 Ga0157375_10077537 Ga0157375_100775372 99
456 3300013308 Ga0157375_10152664 Ga0157375_101526643 99
457 3300013308 Ga0157375_10285313 Ga0157375_102853132 99
458 3300013308 Ga0157375_10415384 Ga0157375_104153842 99
459 3300013308 Ga0157375_12936614 Ga0157375_129366141 99
460 3300013308 Ga0157375_13559694 Ga0157375_135596941 99
461 3300014325 Ga0163163_10000846 Ga0163163_1000084619 99
462 3300014325 Ga0163163_10080496 Ga0163163_100804963 99
463 3300014325 Ga0163163_10220152 Ga0163163_102201525 99
464 3300014325 Ga0163163_10454991 Ga0163163_104549912 99
465 3300014325 Ga0163163_10527248 Ga0163163_105272482 99
466 3300014325 Ga0163163_10739491 Ga0163163_107394912 99
467 3300014326 Ga0157380_10001544 Ga0157380_100015443 99
468 3300014326 Ga0157380_10008119 Ga0157380_100081192 99
469 3300014326 Ga0157380_10041354 Ga0157380_100413543 99
470 3300014326 Ga0157380_10109060 Ga0157380_101090604 99
471 3300014326 Ga0157380_10514667 Ga0157380_105146671 99
472 3300014326 Ga0157380_11302793 Ga0157380_113027932 99
473 3300014326 Ga0157380_11553029 Ga0157380_115530292 99
474 3300014745 Ga0157377_10004687 Ga0157377_100046877 99
475 3300014745 Ga0157377_10012607 Ga0157377_100126073 99
476 3300014745 Ga0157377_10013025 Ga0157377_100130253 99
477 3300014745 Ga0157377_10135349 Ga0157377_101353494 99
478 3300014745 Ga0157377_10367270 Ga0157377_103672702 99
479 3300014745 Ga0157377_10423808 Ga0157377_104238082 99
480 3300014745 Ga0157377_10635274 Ga0157377_106352741 99
481 3300014968 Ga0157379_10062128 Ga0157379_100621282 99
482 3300014968 Ga0157379_10067074 Ga0157379_100670744 99
483 3300014968 Ga0157379_10158486 Ga0157379_101584861 99
484 3300014968 Ga0157379_10244990 Ga0157379_102449902 99
485 3300014968 Ga0157379_10319184 Ga0157379_103191842 99
486 3300014968 Ga0157379_11164634 Ga0157379_111646342 99
487 3300014968 Ga0157379_11367115 Ga0157379_113671151 99
488 3300014969 Ga0157376_10019085 Ga0157376_100190854 99
489 3300014969 Ga0157376_10052830 Ga0157376_100528303 99
490 3300014969 Ga0157376_10395123 Ga0157376_103951234 99
491 3300014969 Ga0157376_11020896 Ga0157376_110208962 99
492 3300014969 Ga0157376_11427980 Ga0157376_114279802 99
493 3300014969 Ga0157376_11867280 Ga0157376_118672801 99
494 3300017792 Ga0163161_10003828 Ga0163161_100038289 99
495 3300017792 Ga0163161_10023481 Ga0163161_100234816 99
496 3300017792 Ga0163161_10142714 Ga0163161_101427142 99
497 3300017792 Ga0163161_10165050 Ga0163161_101650502 99
498 3300017792 Ga0163161_10351633 Ga0163161_103516334 99
499 3300017792 Ga0163161_10681461 Ga0163161_106814612 99
500 3300017792 Ga0163161_10833487 Ga0163161_108334871 99
501 3300017792 Ga0163161_11023592 Ga0163161_110235922 99
502 3300017792 Ga0163161_11154013 Ga0163161_111540132 99
503 3300025271 Ga0207666_1078129 Ga0207666_10781292 99
504 3300025315 Ga0207697_10061135 Ga0207697_100611351 99
505 3300025315 Ga0207697_10137364 Ga0207697_101373642 99
506 3300025321 Ga0207656_10615310 Ga0207656_106153101 99
507 3300025893 Ga0207682_10021788 Ga0207682_100217882 99
508 3300025893 Ga0207682_10124900 Ga0207682_101249002 99
509 3300025893 Ga0207682_10424806 Ga0207682_104248061 99
510 3300025893 Ga0207682_10435376 Ga0207682_104353761 99
511 3300025899 Ga0207642_10691675 Ga0207642_106916752 99
512 3300025900 Ga0207710_10001761 Ga0207710_100017614 99
513 3300025901 Ga0207688_10014698 Ga0207688_100146983 99
514 3300025901 Ga0207688_10298365 Ga0207688_102983652 99
515 3300025903 Ga0207680_10458512 Ga0207680_104585122 99
516 3300025903 Ga0207680_10499920 Ga0207680_104999201 99
517 3300025903 Ga0207680_10805807 Ga0207680_108058072 99
518 3300025904 Ga0207647_10097550 Ga0207647_100975502 99
519 3300025904 Ga0207647_10470476 Ga0207647_104704762 99
520 3300025904 Ga0207647_10678212 Ga0207647_106782122 99
521 3300025907 Ga0207645_10011686 Ga0207645_100116864 99
522 3300025907 Ga0207645_10013131 Ga0207645_100131313 99
523 3300025907 Ga0207645_10160475 Ga0207645_101604752 99
524 3300025907 Ga0207645_10283516 Ga0207645_102835162 99
525 3300025908 Ga0207643_10002640 Ga0207643_1000264010 99
526 3300025908 Ga0207643_10464015 Ga0207643_104640152 99
527 3300025911 Ga0207654_10066629 Ga0207654_100666295 99
528 3300025912 Ga0207707_10000117 Ga0207707_1000011726 99
529 3300025913 Ga0207695_10013789 Ga0207695_100137896 99
530 3300025913 Ga0207695_10013922 Ga0207695_100139228 99
531 3300025913 Ga0207695_11434771 Ga0207695_114347711 99
532 3300025914 Ga0207671_10000340 Ga0207671_1000034026 99
533 3300025914 Ga0207671_10202020 Ga0207671_102020203 99
534 3300025914 Ga0207671_10450063 Ga0207671_104500632 99
535 3300025914 Ga0207671_11104634 Ga0207671_111046341 99
536 3300025917 Ga0207660_10038339 Ga0207660_100383393 99
537 3300025918 Ga0207662_10792836 Ga0207662_107928362 99
538 3300025919 Ga0207657_10003538 Ga0207657_1000353810 99
539 3300025919 Ga0207657_10735459 Ga0207657_107354592 99
540 3300025919 Ga0207657_11298647 Ga0207657_112986472 99
541 3300025920 Ga0207649_10005540 Ga0207649_100055403 99
542 3300025920 Ga0207649_10265570 Ga0207649_102655702 99
543 3300025920 Ga0207649_11242006 Ga0207649_112420062 99
544 3300025920 Ga0207649_11588672 Ga0207649_115886721 99
545 3300025921 Ga0207652_10001410 Ga0207652_1000141021 99
546 3300025922 Ga0207646_10185678 Ga0207646_101856782 99
547 3300025923 Ga0207681_10029387 Ga0207681_100293874 99
548 3300025925 Ga0207650_10049153 Ga0207650_100491533 99
549 3300025925 Ga0207650_10331440 Ga0207650_103314402 99
550 3300025925 Ga0207650_10678078 Ga0207650_106780782 99
551 3300025925 Ga0207650_10895026 Ga0207650_108950261 99
552 3300025925 Ga0207650_11662322 Ga0207650_116623221 99
553 3300025926 Ga0207659_10022271 Ga0207659_100222715 99
554 3300025926 Ga0207659_11133202 Ga0207659_111332022 99
555 3300025926 Ga0207659_11804344 Ga0207659_118043441 99
556 3300025928 Ga0207700_11700435 Ga0207700_117004352 99
557 3300025931 Ga0207644_10013769 Ga0207644_100137692 99
558 3300025931 Ga0207644_10052928 Ga0207644_100529283 99
559 3300025931 Ga0207644_10739578 Ga0207644_107395781 99
560 3300025931 Ga0207644_10787053 Ga0207644_107870531 99
561 3300025931 Ga0207644_11464484 Ga0207644_114644842 99
562 3300025932 Ga0207690_10016335 Ga0207690_100163354 99
563 3300025932 Ga0207690_10083872 Ga0207690_100838722 99
564 3300025932 Ga0207690_10299448 Ga0207690_102994481 99
565 3300025932 Ga0207690_10382033 Ga0207690_103820332 99
566 3300025932 Ga0207690_10767534 Ga0207690_107675341 99
567 3300025933 Ga0207706_10029992 Ga0207706_100299923 99
568 3300025933 Ga0207706_10219698 Ga0207706_102196982 99
569 3300025933 Ga0207706_10336811 Ga0207706_103368113 99
570 3300025933 Ga0207706_10558755 Ga0207706_105587552 99
571 3300025933 Ga0207706_10599568 Ga0207706_105995682 99
572 3300025934 Ga0207686_10000200 Ga0207686_1000020041 99
573 3300025934 Ga0207686_10280350 Ga0207686_102803502 99
574 3300025935 Ga0207709_10323025 Ga0207709_103230252 99
575 3300025936 Ga0207670_10011457 Ga0207670_100114571 99
576 3300025936 Ga0207670_10020366 Ga0207670_100203663 99
577 3300025936 Ga0207670_10648966 Ga0207670_106489661 99
578 3300025937 Ga0207669_10216475 Ga0207669_102164752 99
579 3300025937 Ga0207669_10379027 Ga0207669_103790273 99
580 3300025937 Ga0207669_11656279 Ga0207669_116562792 99
581 3300025938 Ga0207704_10457392 Ga0207704_104573922 99
582 3300025938 Ga0207704_10833285 Ga0207704_108332852 99
583 3300025938 Ga0207704_10835615 Ga0207704_108356151 99
584 3300025938 Ga0207704_11006887 Ga0207704_110068872 99
585 3300025938 Ga0207704_11319105 Ga0207704_113191052 99
586 3300025940 Ga0207691_10102453 Ga0207691_101024535 99
587 3300025940 Ga0207691_10192586 Ga0207691_101925863 99
588 3300025940 Ga0207691_10195192 Ga0207691_101951922 99
589 3300025940 Ga0207691_10698200 Ga0207691_106982002 99
590 3300025942 Ga0207689_10012246 Ga0207689_100122462 99
591 3300025942 Ga0207689_10013498 Ga0207689_100134986 99
592 3300025942 Ga0207689_10029076 Ga0207689_100290764 99
593 3300025942 Ga0207689_10030736 Ga0207689_100307363 99
594 3300025942 Ga0207689_10033224 Ga0207689_100332242 99
595 3300025942 Ga0207689_10095003 Ga0207689_100950031 99
596 3300025942 Ga0207689_10099860 Ga0207689_100998604 99
597 3300025944 Ga0207661_10007465 Ga0207661_100074651 99
598 3300025944 Ga0207661_10042713 Ga0207661_100427132 99
599 3300025944 Ga0207661_10085814 Ga0207661_100858143 99
600 3300025944 Ga0207661_11165435 Ga0207661_111654352 99
601 3300025945 Ga0207679_10000358 Ga0207679_1000035820 99
602 3300025945 Ga0207679_10002098 Ga0207679_100020983 99
603 3300025945 Ga0207679_10125588 Ga0207679_101255882 99
604 3300025945 Ga0207679_10196273 Ga0207679_101962733 99
605 3300025945 Ga0207679_10245673 Ga0207679_102456732 99
606 3300025945 Ga0207679_10339423 Ga0207679_103394232 99
607 3300025949 Ga0207667_11060516 Ga0207667_110605162 99
608 3300025949 Ga0207667_11224048 Ga0207667_112240482 99
609 3300025949 Ga0207667_11562255 Ga0207667_115622552 99
610 3300025960 Ga0207651_10004538 Ga0207651_100045386 99
611 3300025960 Ga0207651_10029439 Ga0207651_100294393 99
612 3300025960 Ga0207651_10229823 Ga0207651_102298234 99
613 3300025960 Ga0207651_10328510 Ga0207651_103285102 99
614 3300025960 Ga0207651_10565329 Ga0207651_105653292 99
615 3300025960 Ga0207651_11221230 Ga0207651_112212302 99
616 3300025961 Ga0207712_10002374 Ga0207712_100023749 99
617 3300025961 Ga0207712_10002523 Ga0207712_1000252311 99
618 3300025961 Ga0207712_10012531 Ga0207712_100125315 99
619 3300025961 Ga0207712_10029486 Ga0207712_100294863 99
620 3300025961 Ga0207712_10625360 Ga0207712_106253602 99
621 3300025961 Ga0207712_10635113 Ga0207712_106351132 99
622 3300025961 Ga0207712_10854483 Ga0207712_108544832 99
623 3300025961 Ga0207712_11218001 Ga0207712_112180012 99
624 3300025972 Ga0207668_10048989 Ga0207668_100489893 99
625 3300025972 Ga0207668_10457024 Ga0207668_104570241 99
626 3300025972 Ga0207668_10617136 Ga0207668_106171362 99
627 3300025981 Ga0207640_10029303 Ga0207640_100293032 99
628 3300025981 Ga0207640_10384796 Ga0207640_103847963 99
629 3300025986 Ga0207658_10087359 Ga0207658_100873593 99
630 3300025986 Ga0207658_10104663 Ga0207658_101046634 99
631 3300025986 Ga0207658_10334110 Ga0207658_103341102 99
632 3300025986 Ga0207658_10401872 Ga0207658_104018722 99
633 3300026023 Ga0207677_10019526 Ga0207677_100195266 99
634 3300026023 Ga0207677_10089210 Ga0207677_100892105 99
635 3300026023 Ga0207677_10129508 Ga0207677_101295082 99
636 3300026023 Ga0207677_10300032 Ga0207677_103000322 99
637 3300026023 Ga0207677_11705918 Ga0207677_117059181 99
638 3300026035 Ga0207703_10455001 Ga0207703_104550012 99
639 3300026035 Ga0207703_10922304 Ga0207703_109223042 99
640 3300026035 Ga0207703_11270083 Ga0207703_112700831 99
641 3300026041 Ga0207639_10004252 Ga0207639_100042523 99
642 3300026041 Ga0207639_10404767 Ga0207639_104047672 99
643 3300026067 Ga0207678_10047747 Ga0207678_100477473 99
644 3300026067 Ga0207678_10236120 Ga0207678_102361202 99
645 3300026075 Ga0207708_10555326 Ga0207708_105553261 99
646 3300026075 Ga0207708_11045247 Ga0207708_110452471 99
647 3300026075 Ga0207708_11114227 Ga0207708_111142272 99
648 3300026075 Ga0207708_11261117 Ga0207708_112611171 99
649 3300026075 Ga0207708_11275394 Ga0207708_112753941 99
650 3300026078 Ga0207702_10483212 Ga0207702_104832122 99
651 3300026088 Ga0207641_10003037 Ga0207641_100030376 99
652 3300026088 Ga0207641_10260204 Ga0207641_102602041 99
653 3300026088 Ga0207641_10448510 Ga0207641_104485101 99
654 3300026088 Ga0207641_11596044 Ga0207641_115960441 99
655 3300026089 Ga0207648_10027044 Ga0207648_100270445 99
656 3300026089 Ga0207648_10029173 Ga0207648_100291733 99
657 3300026089 Ga0207648_10072864 Ga0207648_100728643 99
658 3300026089 Ga0207648_10157155 Ga0207648_101571553 99
659 3300026089 Ga0207648_10515340 Ga0207648_105153401 99
660 3300026089 Ga0207648_10885411 Ga0207648_108854112 99
661 3300026089 Ga0207648_11089033 Ga0207648_110890332 99
662 3300026089 Ga0207648_11593965 Ga0207648_115939652 99
663 3300026095 Ga0207676_10005548 Ga0207676_100055483 99
664 3300026095 Ga0207676_10049441 Ga0207676_100494413 99
665 3300026095 Ga0207676_10121958 Ga0207676_101219584 99
666 3300026095 Ga0207676_10763576 Ga0207676_107635762 99
667 3300026116 Ga0207674_10004933 Ga0207674_1000493313 99
668 3300026116 Ga0207674_10011410 Ga0207674_100114103 99
669 3300026116 Ga0207674_10021661 Ga0207674_100216614 99
670 3300026116 Ga0207674_10058910 Ga0207674_100589101 99
671 3300026116 Ga0207674_10226948 Ga0207674_102269482 99
672 3300026116 Ga0207674_10227812 Ga0207674_102278121 99
673 3300026116 Ga0207674_10341398 Ga0207674_103413983 99
674 3300026116 Ga0207674_10472594 Ga0207674_104725943 99
675 3300026116 Ga0207674_10477156 Ga0207674_104771563 99
676 3300026118 Ga0207675_100000085 Ga0207675_10000008528 99
677 3300026118 Ga0207675_100027224 Ga0207675_1000272244 99
678 3300026118 Ga0207675_100082125 Ga0207675_1000821253 99
679 3300026118 Ga0207675_100095578 Ga0207675_1000955782 99
680 3300026118 Ga0207675_100166729 Ga0207675_1001667293 99
681 3300026118 Ga0207675_100443262 Ga0207675_1004432623 99
682 3300026118 Ga0207675_100566753 Ga0207675_1005667532 99
683 3300026118 Ga0207675_100629304 Ga0207675_1006293042 99
684 3300026118 Ga0207675_101141858 Ga0207675_1011418582 99
685 3300026118 Ga0207675_101322475 Ga0207675_1013224751 99
686 3300026118 Ga0207675_102591949 Ga0207675_1025919491 99
687 3300026121 Ga0207683_10006456 Ga0207683_100064564 99
688 3300026121 Ga0207683_10302819 Ga0207683_103028192 99
689 3300026121 Ga0207683_10326931 Ga0207683_103269312 99
690 3300026121 Ga0207683_10845395 Ga0207683_108453951 99
691 3300026121 Ga0207683_11128068 Ga0207683_111280682 99
692 3300026142 Ga0207698_10048842 Ga0207698_100488423 99
693 3300026142 Ga0207698_10322775 Ga0207698_103227752 99
694 3300026142 Ga0207698_11021677 Ga0207698_110216771 99
695 3300026142 Ga0207698_11099809 Ga0207698_110998092 99
696 3300027471 Ga0209995_1097655 Ga0209995_10976552 99
697 3300027907 Ga0207428_10018900 Ga0207428_100189004 99
698 3300027907 Ga0207428_10452927 Ga0207428_104529272 99
699 3300027907 Ga0207428_10505350 Ga0207428_105053502 99
700 3300028379 Ga0268266_10009751 Ga0268266_100097517 99
701 3300028379 Ga0268266_11195776 Ga0268266_111957762 99
702 3300028379 Ga0268266_11926170 Ga0268266_119261702 99
703 3300028380 Ga0268265_10005897 Ga0268265_100058975 99
704 3300028380 Ga0268265_10266748 Ga0268265_102667484 99
705 3300028380 Ga0268265_10537861 Ga0268265_105378612 99
706 3300028380 Ga0268265_10793044 Ga0268265_107930442 99
707 3300028380 Ga0268265_10995431 Ga0268265_109954311 99
708 3300028380 Ga0268265_11727422 Ga0268265_117274222 99
709 3300028380 Ga0268265_11733824 Ga0268265_117338241 99
710 3300028380 Ga0268265_11850382 Ga0268265_118503821 99
711 3300028380 Ga0268265_12646252 Ga0268265_126462521 99
712 3300028381 Ga0268264_10345284 Ga0268264_103452842 99
713 3300028381 Ga0268264_10400065 Ga0268264_104000652 99
714 3300028381 Ga0268264_10466405 Ga0268264_104664052 99
715 3300028381 Ga0268264_10573009 Ga0268264_105730092 99
716 3300028381 Ga0268264_10698351 Ga0268264_106983512 99
717 3300028381 Ga0268264_11251621 Ga0268264_112516212 99
718 3300031548 Ga0307408_100170105 Ga0307408_1001701053 99
719 3300031731 Ga0307405_10083700 Ga0307405_100837001 99
720 3300031824 Ga0307413_10472757 Ga0307413_104727571 99
721 3300031852 Ga0307410_10063775 Ga0307410_100637752 99
722 3300031903 Ga0307407_10309073 Ga0307407_103090731 99
723 3300031911 Ga0307412_10228231 Ga0307412_102282312 99
724 3300031995 Ga0307409_100758348 Ga0307409_1007583482 99
725 3300032002 Ga0307416_100292561 Ga0307416_1002925612 99
726 3300032004 Ga0307414_10150978 Ga0307414_101509782 99
727 3300032004 Ga0307414_11488234 Ga0307414_114882341 99
728 3300032005 Ga0307411_11129186 Ga0307411_111291862 99
729 3300032005 Ga0307411_11423294 Ga0307411_114232942 99
730 3300032126 Ga0307415_100472539 Ga0307415_1004725392 99
731 3300035171 Ga0373946_0435626 Ga0373946_0435626_354_653 99
732 3300035725 Ga0373947_0704037 Ga0373947_0704037_107_406 99
733 3300039437 Ga0436365_0493931 Ga0436365_0493931_25397_25699 99
734 3300039437 Ga0436365_1327844 Ga0436365_1327844_29_328 99
735 3300041404 Ga0439436_0206236 Ga0439436_0206236_153_452 99
736 3300041406 Ga0439439_0053237 Ga0439439_0053237_101_400 99
737 3300041408 Ga0439453_0011440 Ga0439453_0011440_985_1284 99
738 3300041441 Ga0451787_209659 Ga0451787_209659_486_797 99
739 3300041443 Ga0451789_0074387 Ga0451789_0074387_248_547 99
740 3300041452 Ga0451793_0088457 Ga0451793_0088457_158_457 99
741 3300041453 Ga0451797_1238182 Ga0451797_1238182_156_455 99
742 3300041458 Ga0451798_0072829 Ga0451798_0072829_61_360 99
743 3300041459 Ga0451800_1096925 Ga0451800_1096925_121_420 99
744 3300041463 Ga0451804_0371286 Ga0451804_0371286_740_1039 99
745 3300041486 Ga0451807_0471232 Ga0451807_0471232_542_841 99
746 3300041486 Ga0451807_2135091 Ga0451807_2135091_204_572 99
747 3300041492 Ga0451835_0339757 Ga0451835_0339757_137_448 99
748 3300041494 Ga0451837_1358824 Ga0451837_1358824_157_456 99
749 3300041501 Ga0451845_0387093 Ga0451845_0387093_152_484 99
750 3300041997 Ga0439431_0042447 Ga0439431_0042447_125_424 99
751 3300042002 Ga0439442_083987 Ga0439442_083987_137_436 99
752 3300042002 Ga0439442_096915 Ga0439442_096915_56_355 99
753 3300042004 Ga0439445_0125592 Ga0439445_0125592_322_621 99
754 3300042007 Ga0439449_0307247 Ga0439449_0307247_231_530 99
755 3300042014 Ga0439457_048890 Ga0439457_048890_28_327 99
756 3300042015 Ga0439462_0217034 Ga0439462_0217034_36_335 99
757 3300042125 Ga0450923_006679 Ga0450923_006679_346_645 99
758 3300042128 Ga0450897_005451 Ga0450897_005451_37_336 99
759 3300042131 Ga0450894_033998 Ga0450894_033998_296_595 99
760 3300042134 Ga0450898_021742 Ga0450898_021742_41_340 99
761 3300042157 Ga0439458_0154600 Ga0439458_0154600_238_537 99
762 3300042435 Ga0439434_0119407 Ga0439434_0119407_379_678 99
763 3300042436 Ga0439435_0021750 Ga0439435_0021750_329_628 99
764 3300042461 Ga0439460_0022668 Ga0439460_0022668_716_1015 99
765 3300042876 Ga0451577_0062070 Ga0451577_0062070_1010_1312 99
766 3300042876 Ga0451577_0697901 Ga0451577_0697901_269_568 99
767 3300044712 Ga0453684_0208488 Ga0453684_0208488_333_635 99
768 3300044765 Ga0466970_0240314 Ga0466970_0240314_77_376 99
769 3300046460 Ga0495638_0040588 Ga0495638_0040588_957_1256 99
770 3300046473 Ga0495582_0882012 Ga0495582_0882012_188_487 99
771 3300046475 Ga0495639_0434254 Ga0495639_0434254_240_539 99
772 3300046507 Ga0495606_0643574 Ga0495606_0643574_79_378 99
773 3300046522 Ga0495643_0077408 Ga0495643_0077408_35_334 99
774 3300046523 Ga0495644_0130645 Ga0495644_0130645_235_534 99
775 3300046537 Ga0495598_0046801 Ga0495598_0046801_413_712 99
776 3300046537 Ga0495598_0213205 Ga0495598_0213205_296_595 99
777 3300046539 Ga0495621_0007956 Ga0495621_0007956_518_817 99
778 3300046558 Ga0495633_0296257 Ga0495633_0296257_247_546 99
779 3300046615 Ga0495656_0330666 Ga0495656_0330666_420_719 99
780 3300046616 Ga0495668_0000419 Ga0495668_0000419_13197_13496 99
781 3300046691 Ga0495670_0787622 Ga0495670_0787622_141_482 99
782 3300046692 Ga0495671_0082874 Ga0495671_0082874_365_664 99
783 3300047472 Ga0495686_0018642 Ga0495686_0018642_3331_3630 99
784 3300047472 Ga0495686_0142473 Ga0495686_0142473_698_997 99
785 3300048090 Ga0495615_0292335 Ga0495615_0292335_202_501 99
786 3300048903 Ga0496100_0355843 Ga0496100_0355843_274_618 99
787 3300048907 Ga0496104_0218756 Ga0496104_0218756_339_638 99
788 3300048908 Ga0496105_0605234 Ga0496105_0605234_109_408 99
789 3300048909 Ga0496106_0115248 Ga0496106_0115248_1444_1743 99
790 3300048911 Ga0496108_0850428 Ga0496108_0850428_314_613 99
791 3300048912 Ga0496109_0362844 Ga0496109_0362844_125_424 99
792 3300048913 Ga0496110_0278233 Ga0496110_0278233_794_1093 99
793 3300048913 Ga0496110_0659702 Ga0496110_0659702_137_436 99
794 3300048917 Ga0496114_0458875 Ga0496114_0458875_183_482 99
795 3300049515 Ga0501292_004190 Ga0501292_004190_551_862 99
796 3300049568 Ga0501031_0012012 Ga0501031_0012012_3227_3526 99
797 3300049569 Ga0501032_0023583 Ga0501032_0023583_3555_3854 99
798 3300049571 Ga0501034_0000002 Ga0501034_0000002_115751_116050 99
799 3300049571 Ga0501034_0237544 Ga0501034_0237544_286_585 99
800 3300049572 Ga0501036_0052234 Ga0501036_0052234_36_335 99
801 3300049573 Ga0501037_0035208 Ga0501037_0035208_2653_2952 99
802 3300049574 Ga0501038_0013031 Ga0501038_0013031_4970_5269 99
803 3300049575 Ga0501039_0060788 Ga0501039_0060788_436_735 99
804 3300049579 Ga0501043_0005755 Ga0501043_0005755_1309_1608 99
805 3300049579 Ga0501043_0215561 Ga0501043_0215561_1042_1341 99
806 3300049581 Ga0501047_0379367 Ga0501047_0379367_11_310 99
807 3300049588 Ga0501072_0216067 Ga0501072_0216067_695_994 99
808 3300049589 Ga0501073_0359182 Ga0501073_0359182_596_895 99
809 3300049649 Ga0501198_032552 Ga0501198_032552_55_366 99
810 3300049649 Ga0501198_077838 Ga0501198_077838_26_325 99
811 3300049652 Ga0501202_002367 Ga0501202_002367_1807_2118 99
812 3300049654 Ga0501207_063934 Ga0501207_063934_257_556 99
813 3300049661 Ga0501217_024258 Ga0501217_024258_1041_1352 99
814 3300049663 Ga0501223_018439 Ga0501223_018439_185_496 99
815 3300049668 Ga0501233_043334 Ga0501233_043334_133_444 99
816 3300049668 Ga0501233_067672 Ga0501233_067672_63_362 99
817 3300049669 Ga0501235_170670 Ga0501235_170670_215_526 99
818 3300049671 Ga0501238_016909 Ga0501238_016909_659_970 99
819 3300049672 Ga0501239_035940 Ga0501239_035940_74_385 99
820 3300049674 Ga0501242_000522 Ga0501242_000522_470_769 99
821 3300049682 Ga0501252_026207 Ga0501252_026207_41_340 99
822 3300049683 Ga0501253_019527 Ga0501253_019527_277_588 99
823 3300049686 Ga0501257_006107 Ga0501257_006107_1929_2228 99
824 3300049688 Ga0501259_013024 Ga0501259_013024_915_1214 99
825 3300049703 Ga0501219_000358 Ga0501219_000358_5715_6014 99
826 3300049705 Ga0501225_0076768 Ga0501225_0076768_41_340 99
827 3300049705 Ga0501225_0251245 Ga0501225_0251245_76_387 99
828 3300049707 Ga0501234_008968 Ga0501234_008968_1180_1491 99
829 3300049707 Ga0501234_040403 Ga0501234_040403_243_542 99
830 3300049708 Ga0501245_020018 Ga0501245_020018_375_674 99
831 3300049742 Ga0501080_0783468 Ga0501080_0783468_382_681 99
832 3300049742 Ga0501080_0800587 Ga0501080_0800587_504_803 99
833 3300049742 Ga0501080_0815416 Ga0501080_0815416_392_691 99
834 3300049744 Ga0501083_0166958 Ga0501083_0166958_869_1168 99
835 3300049758 Ga0501241_019508 Ga0501241_019508_767_1066 99
836 3300049758 Ga0501241_035496 Ga0501241_035496_13_312 99
837 3300049760 Ga0501263_041564 Ga0501263_041564_311_610 99
838 3300049760 Ga0501263_059066 Ga0501263_059066_41_340 99
839 3300049763 Ga0501266_000690 Ga0501266_000690_618_917 99
840 3300049765 Ga0501268_015588 Ga0501268_015588_937_1236 99
841 3300049770 Ga0501273_002008 Ga0501273_002008_352_663 99
842 3300049776 Ga0501280_050901 Ga0501280_050901_185_496 99
843 3300049822 Ga0501035_0027999 Ga0501035_0027999_548_847 99
844 3300049823 Ga0501044_0004089 Ga0501044_0004089_2318_2617 99
845 3300049823 Ga0501044_1415416 Ga0501044_1415416_31_330 99
846 3300049850 Ga0501204_039276 Ga0501204_039276_185_496 99
847 3300050005 Ga0501284_00086 Ga0501284_00086_20831_21130 99
848 3300050493 nmdc:mga0k408_190414_c1 nmdc:mga0k408_190414_c1_833_1132 99
849 3300050493 nmdc:mga0k408_76831_c1 nmdc:mga0k408_76831_c1_916_1215 99
850 3300050493 nmdc:mga0k408_826427_c1 nmdc:mga0k408_826427_c1_54_353 99
851 3300050507 nmdc:mga05p37_1152140_c1 nmdc:mga05p37_1152140_c1_122_421 99
852 3300050507 nmdc:mga05p37_373068_c1 nmdc:mga05p37_373068_c1_100_399 99
853 3300050507 nmdc:mga05p37_428199_c1 nmdc:mga05p37_428199_c1_1025_1363 99
854 3300050508 nmdc:mga09592_131869_c1 nmdc:mga09592_131869_c1_1611_1910 99
855 3300050508 nmdc:mga09592_1556392_c1 nmdc:mga09592_1556392_c1_51_350 99
856 3300050510 nmdc:mga06r32_286869_c1 nmdc:mga06r32_286869_c1_417_755 99
857 3300050510 nmdc:mga06r32_43908_c1 nmdc:mga06r32_43908_c1_751_1050 99
858 3300050511 nmdc:mga08y16_2583_c1 nmdc:mga08y16_2583_c1_5884_6183 99
859 3300050511 nmdc:mga08y16_517132_c1 nmdc:mga08y16_517132_c1_555_854 99
860 3300050511 nmdc:mga08y16_614776_c1 nmdc:mga08y16_614776_c1_306_647 99
861 3300050511 nmdc:mga08y16_770698_c1 nmdc:mga08y16_770698_c1_212_514 99
862 3300050511 nmdc:mga08y16_985824_c1 nmdc:mga08y16_985824_c1_208_507 99
863 3300050512 nmdc:mga0n895_58110_c1 nmdc:mga0n895_58110_c1_1990_2289 99
864 3300053086 Ga0500578_0000010 Ga0500578_0000010_172067_172366 99
865 3300053088 Ga0500644_0349568 Ga0500644_0349568_49_348 99
866 3300053090 Ga0500646_0233192 Ga0500646_0233192_170_469 99
867 3300053092 Ga0500583_0002475 Ga0500583_0002475_1255_1554 99
868 3300053093 Ga0500651_0697976 Ga0500651_0697976_141_440 99
869 3300053096 Ga0500641_0101597 Ga0500641_0101597_898_1197 99
870 3300053104 Ga0500556_0003123 Ga0500556_0003123_1312_1611 99
871 3300053108 Ga0500562_000011 Ga0500562_000011_35176_35475 99
872 3300053129 Ga0500628_149582 Ga0500628_149582_177_476 99
873 3300053129 Ga0500628_165708 Ga0500628_165708_119_418 99
874 3300053727 Ga0500611_000019 Ga0500611_000019_93090_93389 99
875 3300053727 Ga0500611_036298 Ga0500611_036298_80_379 99
876 3300053730 Ga0500645_008152 Ga0500645_008152_1442_1741 99
877 3300053730 Ga0500645_009433 Ga0500645_009433_2716_3015 99
878 3300053739 Ga0500587_043235 Ga0500587_043235_262_561 99
879 3300055283 Ga0500661_012706 Ga0500661_012706_345_644 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

39

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9416 11 98
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.9129 16 99
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.9037 16 98
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.9008 17 76
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8983 14 88
ID Description Score Start End Superfamily
1ub9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9416 11 98 1.10.10.10
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9294 9 99 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 16 60 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 11 78 1.10.10.10
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9197 9 99 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A349DWL9-F1-model_v4 Transcriptional regulator 0.9981 4 97 GO:0005737
AF-A0A1Q3TR53-F1-model_v4 Transcriptional regulator 0.9967 1 98 GO:0005737
AF-A0A5M3VXK7-F1-model_v4 Uncharacterized protein 0.9946 8 98
AF-A0A543E2J2-F1-model_v4 Winged helix DNA-binding protein 0.9944 7 94 GO:0003677
AF-A0A4V2PHL1-F1-model_v4 Winged helix DNA-binding protein 0.9943 7 98 GO:0003677

Feature Viewer

pLDDT pTM Quality
93 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map