F484441

General Info

Members Datasets Scaffolds Average Seq Length
878 574 1756 414

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928536128|2928538337
Length 428
Sequence SSPASRTAPDPDAPLSLADAQALACRFAVPVDACDTVALRDALDRVLAADVSAPFDIPAYDNSAMDGYAFDGGAAARASAQGEVAMTVAGTAFAGHPFDGVVAAGACVRIMTGAPMPAGCDTVIPQERVRVDGDTIRFAAQDVARGANCRRAGEDLARGACALAAGRMLRPSDLGLLASFGIADVTVRRRVRVAVFSTGDELREPGEPLGRGALYDSNRGMLIAMLERVHVDAIDLGIVRDDPAALETALRDALAAQADAVITSGGVSVGEADFTRDVMARLGDVTFASVALRPGRPLACGSLARAADGAGRALFFGLPGNPVASAVTFHAIVRPALLTLAGAQTPPPAMYTALSTQALKKRPGRTDYLRGIATRAADGQWHVAPAGSQSSASLSGLAAANCFIVLGHDSAAVDAGTPVDILPLDGLI

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
67 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
90 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
91 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
92 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
148 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
323 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
326 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
331 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
332 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
333 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
334 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
335 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
344 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
348 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
351 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
352 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
353 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 2928536128 Burkholderia sola 565 Isolate Unclassified
356 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
357 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
358 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
359 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
360 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
361 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
362 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
363 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
364 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
365 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
366 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
367 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
368 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
369 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
370 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
371 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
372 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
373 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
374 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
375 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
376 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
377 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
378 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
379 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
380 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
381 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
382 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
383 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
384 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
385 2643221651 Afipia sp. Root123D2 Isolate Unclassified
386 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
387 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
388 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
389 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
390 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
391 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
392 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
393 2791355199
394 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
395 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
396 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
397 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
398 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
399 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
400 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
401 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
402 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
403 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
404 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
405 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
406 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
407 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
408 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
409 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
410 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
411 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
412 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
413 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
414 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
415 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
416 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
417 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
418 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
419 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
420 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
421 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
422 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
423 2851182111 Bosea sp. Tri-44 Isolate Nodule
424 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
425 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
426 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
427 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
428 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
429 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
430 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
431 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
432 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
433 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
434 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
435 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
436 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
437 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
438 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
439 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
440 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
441 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
442 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
443 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
444 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
445 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
446 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
447 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
448 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
449 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
450 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
451 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
452 2904564687 Burkholderia sp. 571 Isolate Unclassified
453 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
454 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
455 2904699407
456 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
457 2906610324
458 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
459 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
460 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
461 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
462 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
463 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
464 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
465 2922368715
466 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
467 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
468 2922425934
469 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
470 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
471 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
472 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
473 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
474 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
475 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
476 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
477 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
478 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
479 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
480 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
481 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
482 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
483 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
484 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
485 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
486 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
487 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
488 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
489 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
490 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
491 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
492 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
493 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
494 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
495 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
496 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
497 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
498 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
499 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
500 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
501 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
502 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
503 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
504 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
505 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
506 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
507 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
508 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
516 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
517 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
518 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
519 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
520 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
521 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
522 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
523 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
524 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
525 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
526 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
527 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
528 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
529 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
530 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
531 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
532 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
533 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
534 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
535 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
536 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
537 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
538 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
539 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
540 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
541 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
542 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
543 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
544 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
545 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
546 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
547 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
548 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
549 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
550 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
551 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
552 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
553 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
554 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
555 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
556 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
557 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
558 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
559 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
560 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
561 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
562 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
563 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
564 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
565 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
566 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
567 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
568 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
569 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
570 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
571 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
572 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
573 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
574 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.14
Metatranscriptomes 0.23
Isolates 24.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.93
Nodule 19.82
Rhizoplane 5.81
Rhizosphere 52.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000022 3300003203 Bacteria 79225
2 JGI25406J46586_10005227 3300003203 Bacteria 6017
3 JGI25165J46597_1007189 3300003214 Bacteria 1876
4 JGI25160J50197_1002587 3300003354 Bacteria 8355
5 Ga0055531_10009154 3300003794 Bacteria 5103
6 Ga0055543_1002484 3300004625 Bacteria 6073
7 Ga0065165_1000054 3300005262 Bacteria 187351
8 Ga0065165_1002102 3300005262 Bacteria 18202
9 Ga0065165_1011420 3300005262 Bacteria 3707
10 Ga0070658_10114385 3300005327 Bacteria 2237
11 Ga0070683_100015345 3300005329 Bacteria 6725
12 Ga0070683_100226114 3300005329 Bacteria 1778
13 Ga0068869_100006026 3300005334 Bacteria 7667
14 Ga0070680_100098187 3300005336 Bacteria 2429
15 Ga0070682_100155719 3300005337 Bacteria 1573
16 Ga0068868_100011281 3300005338 Bacteria 6507
17 Ga0068868_100012390 3300005338 Bacteria 6232
18 Ga0068868_100044810 3300005338 Bacteria 3459
19 Ga0070687_100053672 3300005343 Bacteria 2097
20 Ga0070661_100068075 3300005344 Bacteria 2617
21 Ga0070668_100043813 3300005347 Bacteria 3431
22 Ga0070669_100080139 3300005353 Bacteria 2429
23 Ga0070674_100019676 3300005356 Bacteria 4293
24 Ga0070673_100059081 3300005364 Bacteria 3035
25 Ga0070688_100061045 3300005365 Bacteria 2382
26 Ga0070688_100073400 3300005365 Bacteria 2194
27 Ga0070659_100219481 3300005366 Bacteria 1569
28 Ga0070667_100163383 3300005367 Bacteria 1962
29 Ga0070709_10000227 3300005434 Bacteria 36585
30 Ga0070709_10001601 3300005434 Bacteria 12213
31 Ga0070714_100024557 3300005435 Bacteria 4966
32 Ga0070713_100024657 3300005436 Bacteria 4689
33 Ga0070713_100050036 3300005436 Bacteria 3450
34 Ga0070710_10001439 3300005437 Bacteria 11241
35 Ga0070711_100001952 3300005439 Bacteria 11570
36 Ga0070711_100002557 3300005439 Bacteria 10418
37 Ga0070711_100009680 3300005439 Bacteria 5938
38 Ga0070663_100002194 3300005455 Bacteria 10915
39 Ga0070663_100018127 3300005455 Bacteria 4609
40 Ga0070663_100031167 3300005455 Bacteria 3662
41 Ga0070663_100050646 3300005455 Bacteria 2955
42 Ga0070663_100053408 3300005455 Bacteria 2884
43 Ga0070678_100036257 3300005456 Bacteria 3451
44 Ga0070662_100137008 3300005457 Bacteria 1893
45 Ga0070681_10003153 3300005458 Bacteria 15332
46 Ga0070681_10008310 3300005458 Bacteria 10165
47 Ga0070681_10011710 3300005458 Bacteria 8689
48 Ga0068867_100007587 3300005459 Bacteria 7677
49 Ga0070706_100184860 3300005467 Bacteria 1947
50 Ga0070698_100030330 3300005471 Bacteria 5607
51 Ga0070679_100098777 3300005530 Bacteria 2907
52 Ga0070679_100155702 3300005530 Bacteria 2260
53 Ga0070679_100159355 3300005530 Bacteria 2231
54 Ga0070684_100006061 3300005535 Bacteria 9319
55 Ga0070686_100037560 3300005544 Bacteria 3005
56 Ga0070665_100020963 3300005548 Bacteria 6569
57 Ga0070665_100045884 3300005548 Bacteria 4389
58 Ga0070665_100057411 3300005548 Bacteria 3901
59 Ga0070665_100059104 3300005548 Bacteria 3843
60 Ga0070665_100153369 3300005548 Bacteria 2306
61 Ga0070665_100192578 3300005548 Bacteria 2039
62 Ga0068855_100011850 3300005563 Bacteria 10543
63 Ga0068855_100068227 3300005563 Bacteria 4140
64 Ga0068855_100074629 3300005563 Bacteria 3938
65 Ga0068855_100127070 3300005563 Bacteria 2914
66 Ga0070664_100248682 3300005564 Bacteria 1598
67 Ga0068857_100103602 3300005577 Bacteria 2555
68 Ga0068856_100000283 3300005614 Bacteria 55412
69 Ga0068856_100102578 3300005614 Bacteria 2854
70 Ga0070702_100036385 3300005615 Bacteria 2727
71 Ga0068859_100208272 3300005617 Bacteria 2041
72 Ga0068861_100205650 3300005719 Bacteria 1655
73 Ga0068851_10018844 3300005834 Bacteria 3330
74 Ga0068858_100265844 3300005842 Bacteria 1631
75 Ga0068860_100013207 3300005843 Bacteria 8102
76 Ga0068860_100252628 3300005843 Bacteria 1717
77 Ga0068862_100016934 3300005844 Bacteria 6067
78 Ga0068862_100046903 3300005844 Bacteria 3686
79 Ga0068862_100147152 3300005844 Bacteria 2094
80 Ga0081455_10005918 3300005937 Bacteria 13272
81 Ga0081455_10008904 3300005937 Bacteria 10379
82 Ga0081455_10013476 3300005937 Bacteria 8075
83 Ga0081455_10025076 3300005937 Bacteria 5511
84 Ga0081540_1010824 3300005983 Bacteria 6131
85 Ga0081540_1018602 3300005983 Bacteria 4255
86 Ga0081540_1019338 3300005983 Bacteria 4145
87 Ga0081540_1020886 3300005983 Bacteria 3921
88 Ga0081540_1040638 3300005983 Bacteria 2422
89 Ga0081540_1042834 3300005983 Bacteria 2330
90 Ga0081540_1055984 3300005983 Bacteria 1917
91 Ga0081539_10000172 3300005985 Bacteria 151505
92 Ga0081539_10000945 3300005985 Bacteria 54444
93 Ga0081539_10012821 3300005985 Bacteria 6397
94 Ga0081539_10015466 3300005985 Bacteria 5543
95 Ga0070717_10014606 3300006028 Bacteria 6047
96 Ga0070717_10021111 3300006028 Bacteria 5130
97 Ga0070717_10159291 3300006028 Bacteria 1957
98 Ga0075365_10008184 3300006038 Bacteria 5915
99 Ga0075365_10008188 3300006038 Bacteria 5914
100 Ga0075365_10034084 3300006038 Bacteria 3286
101 Ga0075365_10071325 3300006038 Bacteria 2338
102 Ga0075363_100006195 3300006048 Bacteria 5408
103 Ga0075364_10072493 3300006051 Bacteria 2270
104 Ga0070716_100007768 3300006173 Bacteria 5296
105 Ga0070712_100062560 3300006175 Bacteria 2632
106 Ga0070712_100196195 3300006175 Bacteria 1583
107 Ga0075362_10020342 3300006177 Bacteria 2772
108 Ga0075367_10008546 3300006178 Bacteria 5309
109 Ga0075367_10027983 3300006178 Bacteria 3211
110 Ga0075369_10006949 3300006186 Bacteria 4297
111 Ga0075366_10001716 3300006195 Bacteria 11020
112 Ga0075370_10000423 3300006353 Bacteria 15632
113 Ga0075370_10032507 3300006353 Bacteria 2918
114 Ga0075434_100223944 3300006871 Bacteria 1901
115 Ga0068865_100018479 3300006881 Bacteria 4498
116 Ga0097620_100208274 3300006931 Bacteria 2041
117 Ga0099825_1031522 3300006941 Bacteria 2238
118 Ga0099822_1012272 3300006943 Bacteria 10273
119 Ga0105240_10005830 3300009093 Bacteria 18268
120 Ga0105240_10023440 3300009093 Bacteria 8160
121 Ga0105240_10128469 3300009093 Bacteria 3043
122 Ga0105245_10127546 3300009098 Bacteria 2383
123 Ga0105247_10133216 3300009101 Bacteria 1622
124 Ga0114129_10101325 3300009147 Bacteria 3984
125 Ga0105243_10031979 3300009148 Bacteria 4060
126 Ga0105241_10023336 3300009174 Bacteria 4587
127 Ga0105241_10023650 3300009174 Bacteria 4557
128 Ga0105241_10176530 3300009174 Bacteria 1769
129 Ga0105237_10002080 3300009545 Bacteria 25314
130 Ga0105237_10015271 3300009545 Bacteria 7999
131 Ga0105237_10024890 3300009545 Bacteria 6124
132 Ga0105238_10020617 3300009551 Bacteria 6715
133 Ga0105238_10049428 3300009551 Bacteria 4235
134 Ga0105239_10026267 3300010375 Bacteria 6409
135 Ga0105239_10035818 3300010375 Bacteria 5449
136 Ga0105239_10082860 3300010375 Bacteria 3532
137 Ga0105246_10042152 3300011119 Bacteria 3090
138 Ga0105246_10126374 3300011119 Bacteria 1903
139 Ga0105246_10135366 3300011119 Bacteria 1846
140 Ga0157369_10009617 3300013105 Bacteria 11053
141 Ga0157369_10017510 3300013105 Bacteria 8052
142 Ga0157369_10035736 3300013105 Bacteria 5447
143 Ga0157374_10026908 3300013296 Bacteria 5180
144 Ga0157374_10030783 3300013296 Bacteria 4875
145 Ga0157378_10019008 3300013297 Bacteria 6038
146 Ga0163162_10014185 3300013306 Bacteria 7788
147 Ga0157375_10029979 3300013308 Bacteria 5123
148 Ga0157375_10062791 3300013308 Bacteria 3692
149 Ga0157375_10196522 3300013308 Bacteria 2172
150 Ga0163163_10023168 3300014325 Bacteria 5891
151 Ga0157379_10319500 3300014968 Bacteria 1417
152 Ga0157376_10036268 3300014969 Bacteria 3994
153 Ga0157376_10262303 3300014969 Bacteria 1619
154 Ga0182007_10005930 3300015262 Bacteria 5305
155 Ga0163161_10155119 3300017792 Bacteria 1743
156 Ga0206353_10820691 3300020082 Bacteria 1438
157 Ga0214544_1004900 3300021320 Bacteria 26442
158 Ga0214542_1000773 3300021321 Bacteria 61121
159 Ga0214545_1000546 3300021324 Bacteria 61121
160 Ga0214543_1000740 3300021327 Bacteria 57975
161 Ga0213876_10014871 3300021384 Bacteria 4125
162 Ga0213876_10098826 3300021384 Bacteria 1547
163 Ga0213871_10009634 3300021441 Bacteria 2169
164 Ga0224712_10030568 3300022467 Bacteria 1945
165 Ga0209677_100384 3300025253 Bacteria 27031
166 Ga0209677_103265 3300025253 Bacteria 5392
167 Ga0209233_1000823 3300025261 Bacteria 13758
168 Ga0209233_1014119 3300025261 Bacteria 2260
169 Ga0209455_1001474 3300025272 Bacteria 10580
170 Ga0209455_1011596 3300025272 Bacteria 2160
171 Ga0209564_1017567 3300025295 Bacteria 2779
172 Ga0209758_1000117 3300025297 Bacteria 198325
173 Ga0209758_1000715 3300025297 Bacteria 49020
174 Ga0209758_1001613 3300025297 Bacteria 25735
175 Ga0209758_1006716 3300025297 Bacteria 8110
176 Ga0207426_1000223 3300025302 Bacteria 132636
177 Ga0207426_1000649 3300025302 Bacteria 42959
178 Ga0207426_1016531 3300025302 Bacteria 2646
179 Ga0209257_1001759 3300025304 Bacteria 24004
180 Ga0207692_10000620 3300025898 Bacteria 12475
181 Ga0207710_10008225 3300025900 Bacteria 4403
182 Ga0207710_10029729 3300025900 Bacteria 2380
183 Ga0207647_10068869 3300025904 Bacteria 2140
184 Ga0207699_10001377 3300025906 Bacteria 11576
185 Ga0207684_10144845 3300025910 Bacteria 2043
186 Ga0207654_10018072 3300025911 Bacteria 3697
187 Ga0207654_10103305 3300025911 Bacteria 1760
188 Ga0207707_10001119 3300025912 Bacteria 25478
189 Ga0207707_10009404 3300025912 Bacteria 8478
190 Ga0207707_10056126 3300025912 Bacteria 3426
191 Ga0207695_10000136 3300025913 Bacteria 217596
192 Ga0207695_10047532 3300025913 Bacteria 4540
193 Ga0207695_10116825 3300025913 Bacteria 2641
194 Ga0207671_10015795 3300025914 Bacteria 5892
195 Ga0207693_10014092 3300025915 Bacteria 6438
196 Ga0207693_10031462 3300025915 Bacteria 4192
197 Ga0207693_10057497 3300025915 Bacteria 3048
198 Ga0207663_10029199 3300025916 Bacteria 3236
199 Ga0207660_10074503 3300025917 Bacteria 2478
200 Ga0207649_10061877 3300025920 Bacteria 2358
201 Ga0207649_10062221 3300025920 Bacteria 2352
202 Ga0207652_10008928 3300025921 Bacteria 8077
203 Ga0207652_10066764 3300025921 Bacteria 3118
204 Ga0207652_10070721 3300025921 Bacteria 3031
205 Ga0207652_10175078 3300025921 Bacteria 1927
206 Ga0207694_10021479 3300025924 Bacteria 4890
207 Ga0207694_10123521 3300025924 Bacteria 2069
208 Ga0207700_10118035 3300025928 Bacteria 2146
209 Ga0207664_10109515 3300025929 Bacteria 2295
210 Ga0207706_10044304 3300025933 Bacteria 3944
211 Ga0207686_10013907 3300025934 Bacteria 4465
212 Ga0207709_10008694 3300025935 Bacteria 5605
213 Ga0207670_10048617 3300025936 Bacteria 2832
214 Ga0207704_10097160 3300025938 Bacteria 1952
215 Ga0207665_10012662 3300025939 Bacteria 5546
216 Ga0207711_10084305 3300025941 Bacteria 2781
217 Ga0207689_10017899 3300025942 Bacteria 5984
218 Ga0207689_10023971 3300025942 Bacteria 5119
219 Ga0207661_10000190 3300025944 Bacteria 39991
220 Ga0207661_10062281 3300025944 Bacteria 3017
221 Ga0207661_10084952 3300025944 Bacteria 2623
222 Ga0207679_10112374 3300025945 Bacteria 2153
223 Ga0207679_10155920 3300025945 Bacteria 1865
224 Ga0207667_10065228 3300025949 Bacteria 3799
225 Ga0207667_10219916 3300025949 Bacteria 1946
226 Ga0207668_10041202 3300025972 Bacteria 3120
227 Ga0207668_10055435 3300025972 Bacteria 2755
228 Ga0207668_10093154 3300025972 Bacteria 2219
229 Ga0207658_10073091 3300025986 Bacteria 2602
230 Ga0207677_10044452 3300026023 Bacteria 2960
231 Ga0207703_10015770 3300026035 Bacteria 5893
232 Ga0207639_10134673 3300026041 Bacteria 2050
233 Ga0207639_10236907 3300026041 Bacteria 1585
234 Ga0207678_10016800 3300026067 Bacteria 6428
235 Ga0207678_10035083 3300026067 Bacteria 4367
236 Ga0207678_10061951 3300026067 Bacteria 3217
237 Ga0207678_10075144 3300026067 Bacteria 2895
238 Ga0207678_10076272 3300026067 Bacteria 2871
239 Ga0207678_10091313 3300026067 Bacteria 2603
240 Ga0207678_10139406 3300026067 Bacteria 2069
241 Ga0207708_10029928 3300026075 Bacteria 4129
242 Ga0207702_10000052 3300026078 Bacteria 137784
243 Ga0207702_10031891 3300026078 Bacteria 4396
244 Ga0207702_10058264 3300026078 Bacteria 3287
245 Ga0207641_10133326 3300026088 Bacteria 2233
246 Ga0207648_10027354 3300026089 Bacteria 5063
247 Ga0207674_10104491 3300026116 Bacteria 2811
248 Ga0207674_10114603 3300026116 Bacteria 2667
249 Ga0207675_100016461 3300026118 Bacteria 6906
250 Ga0207675_100112461 3300026118 Bacteria 2570
251 Ga0207675_100369869 3300026118 Bacteria 1408
252 Ga0207683_10032325 3300026121 Bacteria 4546
253 Ga0207683_10044240 3300026121 Bacteria 3893
254 Ga0207683_10062763 3300026121 Bacteria 3273
255 Ga0207683_10112080 3300026121 Bacteria 2443
256 Ga0207698_10030894 3300026142 Bacteria 3859
257 Ga0207698_10133561 3300026142 Bacteria 2125
258 Ga0207698_10140678 3300026142 Bacteria 2079
259 Ga0209389_1000028 3300027296 Bacteria 140401
260 Ga0209389_1000056 3300027296 Bacteria 107673
261 Ga0209589_1000007 3300027357 Bacteria 425699
262 Ga0209589_1000034 3300027357 Bacteria 138086
263 Ga0209489_100008 3300027361 Bacteria 425699
264 Ga0209489_100009 3300027361 Bacteria 263873
265 Ga0209489_102012 3300027361 Bacteria 41849
266 Ga0209700_100009 3300027363 Bacteria 425699
267 Ga0209700_100022 3300027363 Bacteria 229977
268 Ga0268266_10000519 3300028379 Bacteria 54346
269 Ga0268266_10003020 3300028379 Bacteria 17288
270 Ga0268266_10044108 3300028379 Bacteria 3811
271 Ga0268266_10090525 3300028379 Bacteria 2681
272 Ga0268265_10080618 3300028380 Bacteria 2567
273 Ga0268265_10180179 3300028380 Bacteria 1814
274 Ga0268265_10271288 3300028380 Bacteria 1513
275 Ga0268264_10103703 3300028381 Bacteria 2477
276 Ga0307517_10000248 3300028786 Bacteria 92084
277 Ga0307517_10136617 3300028786 Bacteria 1740
278 Ga0265330_10020141 3300031235 Bacteria 3049
279 Ga0265325_10067907 3300031241 Bacteria 1795
280 Ga0265329_10035515 3300031242 Bacteria 1608
281 Ga0265339_10013152 3300031249 Bacteria 5023
282 Ga0265339_10087431 3300031249 Bacteria 1638
283 Ga0265339_10088861 3300031249 Bacteria 1622
284 Ga0265339_10095190 3300031249 Bacteria 1556
285 Ga0265331_10030223 3300031250 Bacteria 2698
286 Ga0265316_10158753 3300031344 Bacteria 1691
287 Ga0307513_10040669 3300031456 Bacteria 5139
288 Ga0307509_10038225 3300031507 Bacteria 5238
289 Ga0307408_100067422 3300031548 Bacteria 2632
290 Ga0265313_10071475 3300031595 Bacteria 1597
291 Ga0307508_10072105 3300031616 Bacteria 3028
292 Ga0265314_10004420 3300031711 Bacteria 13054
293 Ga0265314_10053234 3300031711 Bacteria 2808
294 Ga0307407_10123247 3300031903 Bacteria 1647
295 Ga0307409_100212668 3300031995 Bacteria 1739
296 Ga0307510_10005609 3300033180 Bacteria 14962
297 Ga0307510_10012266 3300033180 Bacteria 10161
298 Ga0307510_10055497 3300033180 Bacteria 4137
299 Ga0307510_10056357 3300033180 Bacteria 4094
300 Ga0307510_10204549 3300033180 Bacteria 1504
301 Ga0373926_0039935 3300035083 Bacteria 1674
302 Ga0373944_0024045 3300035089 Bacteria 1782
303 Ga0373923_0027627 3300035111 Bacteria 2264
304 Ga0373936_0005553 3300035113 Bacteria 4760
305 Ga0373936_0032591 3300035113 Bacteria 2062
306 Ga0373945_0016860 3300035116 Bacteria 2469
307 Ga0373953_0002162 3300035117 Bacteria 5882
308 Ga0373954_0012905 3300035118 Bacteria 3720
309 Ga0373954_0018705 3300035118 Bacteria 3121
310 Ga0373956_0004523 3300035119 Bacteria 5554
311 Ga0373943_0008287 3300035170 Bacteria 4665
312 Ga0373946_0006757 3300035171 Bacteria 4168
313 Ga0373955_0000335 3300035172 Bacteria 19651
314 Ga0373955_0022709 3300035172 Bacteria 3186
315 Ga0373955_0126986 3300035172 Bacteria 1486
316 Ga0373924_0024544 3300035410 Bacteria 2376
317 Ga0373924_0036480 3300035410 Bacteria 1998
318 Ga0373935_0001283 3300035692 Bacteria 13847
319 Ga0373927_0000515 3300035695 Bacteria 29473
320 Ga0373933_0000106 3300035724 Bacteria 53181
321 Ga0373933_0034579 3300035724 Bacteria 2945
322 Ga0373947_0004303 3300035725 Bacteria 8362
323 Ga0373947_0026121 3300035725 Bacteria 3409
324 Ga0373947_0050799 3300035725 Bacteria 2493
325 Ga0373937_0042654 3300036401 Bacteria 4139
326 Ga0373937_0272472 3300036401 Bacteria 1598
327 Ga0373925_0001116 3300037068 Bacteria 23846
328 Ga0373925_0073594 3300037068 Bacteria 2586
329 Ga0373925_0186396 3300037068 Bacteria 1645
330 Ga0373925_0242119 3300037068 Bacteria 1445
331 Ga0395900_0019004 3300037418 Bacteria 7008
332 Ga0395900_0039621 3300037418 Bacteria 4854
333 Ga0395900_0081097 3300037418 Bacteria 3334
334 Ga0395898_0006007 3300037466 Bacteria 13037
335 Ga0395898_0040790 3300037466 Bacteria 4588
336 Ga0395898_0076659 3300037466 Bacteria 3228
337 Ga0395898_0184223 3300037466 Bacteria 1995
338 Ga0395905_0013314 3300037471 Bacteria 7886
339 Ga0436364_0336775 3300037853 Bacteria 4540
340 Ga0436364_0751694 3300037853 Bacteria 5851
341 Ga0395901_0082268 3300038443 Bacteria 3364
342 Ga0436365_0474195 3300039437 Bacteria 5476
343 Ga0436365_1060223 3300039437 Bacteria 3732
344 Ga0436365_1421557 3300039437 Bacteria 1461
345 Ga0436365_1919740 3300039437 Bacteria 3428
346 Ga0436360_1353130 3300039438 Bacteria 7648
347 Ga0436361_0895020 3300039447 Bacteria 2365
348 Ga0436362_0094313 3300039453 Bacteria 3989
349 Ga0436362_1189097 3300039453 Bacteria 2464
350 Ga0439458_0016549 3300042157 Bacteria 1678
351 Ga0466972_0000110 3300044658 Bacteria 71304
352 Ga0466972_0003331 3300044658 Bacteria 7968
353 Ga0466965_0008548 3300044683 Bacteria 4737
354 Ga0466966_0080251 3300044684 Bacteria 2033
355 Ga0466963_0003214 3300044694 Bacteria 9296
356 Ga0466957_0013617 3300044842 Bacteria 4721
357 Ga0466957_0016857 3300044842 Bacteria 4275
358 Ga0466957_0187640 3300044842 Bacteria 1353
359 Ga0466959_0053736 3300045049 Bacteria 2944
360 Ga0466967_0015425 3300045976 Bacteria 5989
361 Ga0466967_0062382 3300045976 Bacteria 3308
362 Ga0466967_0101911 3300045976 Bacteria 2625
363 Ga0495592_0006367 3300046454 Bacteria 8792
364 Ga0495592_0009951 3300046454 Bacteria 7161
365 Ga0495592_0036210 3300046454 Bacteria 3717
366 Ga0495603_0000156 3300046455 Bacteria 34369
367 Ga0495603_0022445 3300046455 Bacteria 3820
368 Ga0495603_0080171 3300046455 Bacteria 1913
369 Ga0495629_0000297 3300046459 Bacteria 42433
370 Ga0495629_0001966 3300046459 Bacteria 16017
371 Ga0495629_0002353 3300046459 Bacteria 14564
372 Ga0495629_0026149 3300046459 Bacteria 4147
373 Ga0495629_0106504 3300046459 Bacteria 1956
374 Ga0495638_0005955 3300046460 Bacteria 8948
375 Ga0495638_0080116 3300046460 Bacteria 1984
376 Ga0495641_0016704 3300046461 Bacteria 3856
377 Ga0495651_0003593 3300046462 Bacteria 11900
378 Ga0495651_0015887 3300046462 Bacteria 5828
379 Ga0495651_0073121 3300046462 Bacteria 2603
380 Ga0495580_0004564 3300046472 Bacteria 11624
381 Ga0495582_0000087 3300046473 Bacteria 47529
382 Ga0495639_0000153 3300046475 Bacteria 35461
383 Ga0495639_0007468 3300046475 Bacteria 4692
384 Ga0495639_0019704 3300046475 Bacteria 2944
385 Ga0495662_0004971 3300046476 Bacteria 6655
386 Ga0495664_0005395 3300046477 Bacteria 7020
387 Ga0495664_0017781 3300046477 Bacteria 4065
388 Ga0495664_0091357 3300046477 Bacteria 1830
389 Ga0495584_0101389 3300046491 Bacteria 1455
390 Ga0495594_0047103 3300046499 Bacteria 2368
391 Ga0495606_0001387 3300046507 Bacteria 32754
392 Ga0495606_0013271 3300046507 Bacteria 6528
393 Ga0495608_0025938 3300046511 Bacteria 4000
394 Ga0495608_0033974 3300046511 Bacteria 3444
395 Ga0495608_0087279 3300046511 Bacteria 2021
396 Ga0495610_0042140 3300046512 Bacteria 2286
397 Ga0495618_0037730 3300046514 Bacteria 3035
398 Ga0495618_0039213 3300046514 Bacteria 2978
399 Ga0495618_0053942 3300046514 Bacteria 2542
400 Ga0495620_0041331 3300046515 Bacteria 2023
401 Ga0495628_0039901 3300046516 Bacteria 3754
402 Ga0495628_0079926 3300046516 Bacteria 2542
403 Ga0495628_0104296 3300046516 Bacteria 2185
404 Ga0495628_0208444 3300046516 Bacteria 1471
405 Ga0495630_0000735 3300046517 Bacteria 23119
406 Ga0495630_0040595 3300046517 Bacteria 3478
407 Ga0495631_0019230 3300046518 Bacteria 3205
408 Ga0495632_0044841 3300046519 Bacteria 2205
409 Ga0495644_0028898 3300046523 Bacteria 2097
410 Ga0495648_0003807 3300046524 Bacteria 13105
411 Ga0495648_0014960 3300046524 Bacteria 5652
412 Ga0495648_0036506 3300046524 Bacteria 3169
413 Ga0495666_0017403 3300046526 Bacteria 3580
414 Ga0495652_0003411 3300046529 Bacteria 15714
415 Ga0495652_0023747 3300046529 Bacteria 5434
416 Ga0495652_0035587 3300046529 Bacteria 4333
417 Ga0495665_0000117 3300046531 Bacteria 37802
418 Ga0495665_0008372 3300046531 Bacteria 5609
419 Ga0495640_0002597 3300046533 Bacteria 14524
420 Ga0495640_0046425 3300046533 Bacteria 3009
421 Ga0495587_0001788 3300046536 Bacteria 14356
422 Ga0495645_0012372 3300046543 Bacteria 6013
423 Ga0495645_0056154 3300046543 Bacteria 2859
424 Ga0495622_0002118 3300046557 Bacteria 9668
425 Ga0495667_0022986 3300046559 Bacteria 4201
426 Ga0495667_0049104 3300046559 Bacteria 2785
427 Ga0495667_0078753 3300046559 Bacteria 2143
428 Ga0495667_0124882 3300046559 Bacteria 1661
429 Ga0495667_0175298 3300046559 Bacteria 1377
430 Ga0495656_0026908 3300046615 Bacteria 2293
431 Ga0495656_0034975 3300046615 Bacteria 2061
432 Ga0495668_0022219 3300046616 Bacteria 3627
433 Ga0495634_0009937 3300046642 Bacteria 6992
434 Ga0495634_0041078 3300046642 Bacteria 3142
435 Ga0495611_0018358 3300046648 Bacteria 2999
436 Ga0495611_0089746 3300046648 Bacteria 1420
437 Ga0495625_0029766 3300046660 Bacteria 4081
438 Ga0495625_0157597 3300046660 Bacteria 1523
439 Ga0495635_0011937 3300046663 Bacteria 6085
440 Ga0495635_0016105 3300046663 Bacteria 5221
441 Ga0495635_0054427 3300046663 Bacteria 2756
442 Ga0495635_0056628 3300046663 Bacteria 2698
443 Ga0495635_0117662 3300046663 Bacteria 1813
444 Ga0495657_0002601 3300046675 Bacteria 15103
445 Ga0495657_0008132 3300046675 Bacteria 8041
446 Ga0495623_0001847 3300046679 Bacteria 14193
447 Ga0495646_0004576 3300046680 Bacteria 8718
448 Ga0495646_0027733 3300046680 Bacteria 3550
449 Ga0495646_0087452 3300046680 Bacteria 1806
450 Ga0495647_0000365 3300046681 Bacteria 12760
451 Ga0495647_0005771 3300046681 Bacteria 4070
452 Ga0495658_0000644 3300046683 Bacteria 18891
453 Ga0495658_0086515 3300046683 Bacteria 1849
454 Ga0495669_0004390 3300046684 Bacteria 5821
455 Ga0495613_0009744 3300046689 Bacteria 7140
456 Ga0495613_0046869 3300046689 Bacteria 3195
457 Ga0495613_0059264 3300046689 Bacteria 2807
458 Ga0495624_0001012 3300046690 Bacteria 22250
459 Ga0495624_0028607 3300046690 Bacteria 3640
460 Ga0495624_0041473 3300046690 Bacteria 2943
461 Ga0495670_0070693 3300046691 Bacteria 1766
462 Ga0495649_0033464 3300046694 Bacteria 2829
463 Ga0495589_0043201 3300046794 Bacteria 2244
464 Ga0495600_0000869 3300046809 Bacteria 16143
465 Ga0495600_0006623 3300046809 Bacteria 7057
466 Ga0495581_0000543 3300047315 Bacteria 19442
467 Ga0495604_0000751 3300047317 Bacteria 27241
468 Ga0495604_0078967 3300047317 Bacteria 2468
469 Ga0495604_0127905 3300047317 Bacteria 1829
470 Ga0495674_0000177 3300047319 Bacteria 50030
471 Ga0495674_0004259 3300047319 Bacteria 13781
472 Ga0495674_0020467 3300047319 Bacteria 6123
473 Ga0495674_0064002 3300047319 Bacteria 3198
474 Ga0495674_0127546 3300047319 Bacteria 2145
475 Ga0495672_0057036 3300047320 Bacteria 2269
476 Ga0495676_0017162 3300047321 Bacteria 6406
477 Ga0495676_0117392 3300047321 Bacteria 1941
478 Ga0495680_0001530 3300047322 Bacteria 24762
479 Ga0495683_0073021 3300047323 Bacteria 1683
480 Ga0495675_0025225 3300047444 Bacteria 3790
481 Ga0495685_015376 3300047447 Bacteria 2609
482 Ga0495673_0011890 3300047469 Bacteria 4650
483 Ga0495684_0002187 3300047471 Bacteria 15656
484 Ga0495684_0013598 3300047471 Bacteria 6267
485 Ga0495684_0023802 3300047471 Bacteria 4709
486 Ga0495684_0035668 3300047471 Bacteria 3813
487 Ga0495686_0021609 3300047472 Bacteria 4269
488 Ga0495686_0090603 3300047472 Bacteria 1857
489 Ga0495593_0000156 3300047673 Bacteria 34308
490 Ga0495593_0013164 3300047673 Bacteria 4723
491 Ga0495602_0046473 3300048088 Bacteria 3921
492 Ga0495602_0081730 3300048088 Bacteria 2715
493 Ga0495602_0235101 3300048088 Bacteria 1374
494 Ga0495614_0012177 3300048089 Bacteria 3776
495 Ga0495626_0073230 3300048091 Bacteria 1535
496 Ga0496100_0021481 3300048903 Bacteria 3888
497 Ga0496100_0069060 3300048903 Bacteria 2352
498 Ga0496100_0072789 3300048903 Bacteria 2298
499 Ga0496101_0007180 3300048904 Bacteria 7207
500 Ga0496101_0227745 3300048904 Bacteria 1448
501 Ga0496102_0010384 3300048905 Bacteria 8013
502 Ga0496102_0029354 3300048905 Bacteria 4922
503 Ga0496102_0070377 3300048905 Bacteria 3212
504 Ga0496102_0074351 3300048905 Bacteria 3123
505 Ga0496103_0050663 3300048906 Bacteria 2568
506 Ga0496104_0010798 3300048907 Bacteria 8169
507 Ga0496104_0032296 3300048907 Bacteria 4871
508 Ga0496104_0060567 3300048907 Bacteria 3586
509 Ga0496105_0001079 3300048908 Bacteria 18889
510 Ga0496105_0026645 3300048908 Bacteria 4718
511 Ga0496105_0124205 3300048908 Bacteria 2128
512 Ga0496106_0006989 3300048909 Bacteria 8338
513 Ga0496106_0033779 3300048909 Bacteria 3818
514 Ga0496106_0049553 3300048909 Bacteria 3164
515 Ga0496106_0065373 3300048909 Bacteria 2769
516 Ga0496107_0056443 3300048910 Bacteria 2837
517 Ga0496107_0163708 3300048910 Bacteria 1649
518 Ga0496108_0013601 3300048911 Bacteria 6642
519 Ga0496108_0016621 3300048911 Bacteria 6009
520 Ga0496108_0060904 3300048911 Bacteria 3176
521 Ga0496108_0086966 3300048911 Bacteria 2654
522 Ga0496108_0125987 3300048911 Bacteria 2199
523 Ga0496109_0035982 3300048912 Bacteria 4469
524 Ga0496110_0006206 3300048913 Bacteria 9434
525 Ga0496110_0067614 3300048913 Bacteria 3162
526 Ga0496110_0146203 3300048913 Bacteria 2138
527 Ga0496111_0035227 3300048914 Bacteria 3576
528 Ga0496111_0037826 3300048914 Bacteria 3455
529 Ga0496111_0084233 3300048914 Bacteria 2324
530 Ga0496112_0000057 3300048915 Bacteria 77700
531 Ga0496112_0051942 3300048915 Bacteria 4022
532 Ga0496113_0021724 3300048916 Bacteria 4530
533 Ga0496113_0021863 3300048916 Bacteria 4516
534 Ga0496113_0048355 3300048916 Bacteria 3164
535 Ga0496114_0010492 3300048917 Bacteria 7372
536 Ga0496114_0054300 3300048917 Bacteria 3341
537 Ga0496114_0317929 3300048917 Bacteria 1375
538 Ga0496115_0003709 3300048918 Bacteria 10987
539 Ga0496115_0010430 3300048918 Bacteria 6943
540 Ga0496115_0023069 3300048918 Bacteria 4828
541 Ga0496115_0045050 3300048918 Bacteria 3521
542 Ga0496115_0062901 3300048918 Bacteria 2994
543 Ga0496115_0187762 3300048918 Bacteria 1708
544 Ga0496116_0059844 3300048919 Bacteria 2474
545 Ga0496118_0054933 3300048921 Bacteria 3011
546 Ga0496118_0072960 3300048921 Bacteria 2462
547 Ga0496118_0073569 3300048921 Bacteria 2447
548 Ga0496120_0019659 3300048923 Bacteria 4314
549 Ga0496121_0000287 3300048924 Bacteria 104774
550 Ga0496121_0011016 3300048924 Bacteria 10094
551 Ga0496121_0036889 3300048924 Bacteria 4350
552 Ga0496121_0063418 3300048924 Bacteria 3019
553 Ga0496121_0080134 3300048924 Bacteria 2590
554 Ga0496124_0051160 3300048927 Bacteria 3516
555 Ga0496124_0094198 3300048927 Bacteria 2436
556 Ga0496125_0000654 3300048928 Bacteria 57851
557 Ga0496125_0039845 3300048928 Bacteria 4038
558 Ga0496125_0083438 3300048928 Bacteria 2431
559 Ga0496126_0001378 3300048929 Bacteria 38419
560 Ga0496126_0023389 3300048929 Bacteria 5989
561 Ga0496126_0028392 3300048929 Bacteria 5333
562 Ga0496126_0028525 3300048929 Bacteria 5316
563 Ga0496126_0034253 3300048929 Bacteria 4771
564 Ga0496126_0050313 3300048929 Bacteria 3798
565 Ga0496126_0079318 3300048929 Bacteria 2906
566 Ga0496126_0129558 3300048929 Bacteria 2181
567 Ga0496126_0193331 3300048929 Bacteria 1722
568 Ga0496126_0207872 3300048929 Bacteria 1649
569 Ga0496126_0233560 3300048929 Bacteria 1540
570 Ga0495678_030305 3300049459 Bacteria 2265
571 Ga0501032_0058911 3300049569 Bacteria 2577
572 Ga0501034_0139494 3300049571 Bacteria 2404
573 Ga0501037_0112815 3300049573 Bacteria 1958
574 Ga0501038_0029631 3300049574 Bacteria 4847
575 Ga0501038_0203292 3300049574 Bacteria 1588
576 Ga0501042_0091096 3300049578 Bacteria 2188
577 Ga0501043_0159584 3300049579 Bacteria 1762
578 Ga0501046_0084995 3300049580 Bacteria 2440
579 Ga0501047_0041969 3300049581 Bacteria 4421
580 Ga0501067_0096608 3300049583 Bacteria 1640
581 Ga0501070_0019833 3300049586 Bacteria 5638
582 Ga0501073_0029828 3300049589 Bacteria 3897
583 Ga0501073_0055687 3300049589 Bacteria 2766
584 Ga0501074_0053891 3300049590 Bacteria 2901
585 Ga0501076_0203126 3300049592 Bacteria 1619
586 Ga0501080_0006437 3300049742 Bacteria 10542
587 Ga0501080_0027935 3300049742 Bacteria 5246
588 Ga0501044_0075584 3300049823 Bacteria 3420
589 Ga0501045_0037272 3300049824 Bacteria 3533
590 nmdc:mga03n38_569_c1 3300050490 Bacteria 9359
591 nmdc:mga0yw44_136181_c1 3300050492 Bacteria 1593
592 nmdc:mga0yw44_4755_c1 3300050492 Bacteria 6293
593 nmdc:mga0k408_132838_c1 3300050493 Bacteria 1478
594 nmdc:mga06z11_20219_c1 3300050494 Bacteria 3074
595 nmdc:mga07m45_12920_c1 3300050496 Bacteria 1408
596 nmdc:mga07m45_27846_c1 3300050496 Bacteria 3117
597 Ga0495601_0034886 3300053077 Bacteria 3139
598 Ga0495601_0057604 3300053077 Bacteria 2461
599 Ga0495601_0105705 3300053077 Bacteria 1820
600 Ga0495612_0023956 3300053078 Bacteria 2451
601 Ga0500635_0008657 3300053080 Bacteria 2797
602 Ga0500635_0015857 3300053080 Bacteria 2231
603 Ga0495595_0009305 3300053084 Bacteria 4059
604 Ga0495595_0051750 3300053084 Bacteria 1904
605 Ga0495619_0014155 3300053085 Bacteria 5037
606 Ga0500578_0094824 3300053086 Bacteria 1893
607 Ga0500643_000095 3300053087 Bacteria 92535
608 Ga0500651_0001950 3300053093 Bacteria 10674
609 Ga0500651_0079684 3300053093 Bacteria 2029
610 Ga0500566_0000035 3300053094 Bacteria 69457
611 Ga0500566_0000228 3300053094 Bacteria 29965
612 Ga0500640_000054 3300053095 Bacteria 17851
613 Ga0500641_0006106 3300053096 Bacteria 4269
614 Ga0500555_001063 3300053103 Bacteria 9241
615 Ga0500557_000117 3300053105 Bacteria 22427
616 Ga0500569_000782 3300053109 Bacteria 5570
617 Ga0500572_000122 3300053111 Bacteria 26114
618 Ga0500572_001570 3300053111 Bacteria 6081
619 Ga0500595_000651 3300053119 Bacteria 20888
620 Ga0500595_000743 3300053119 Bacteria 19196
621 Ga0500595_009830 3300053119 Bacteria 3840
622 Ga0500595_011238 3300053119 Bacteria 3515
623 Ga0500595_015038 3300053119 Bacteria 2917
624 Ga0500595_024553 3300053119 Bacteria 2103
625 Ga0500642_0002741 3300053130 Bacteria 5221
626 Ga0500642_0013901 3300053130 Bacteria 2977
627 Ga0500642_0043444 3300053130 Bacteria 1952
628 Ga0500655_005578 3300053133 Bacteria 2267
629 Ga0500559_0001632 3300053136 Bacteria 12429
630 Ga0500559_0001963 3300053136 Bacteria 11120
631 Ga0500559_0011974 3300053136 Bacteria 3696
632 Ga0500564_046065 3300053138 Bacteria 2000
633 Ga0500568_0004068 3300053139 Bacteria 7918
634 Ga0500568_0053547 3300053139 Bacteria 1581
635 Ga0500577_0010289 3300053142 Bacteria 2749
636 Ga0500590_009170 3300053148 Bacteria 4969
637 Ga0500603_001828 3300053150 Bacteria 4768
638 Ga0500620_002550 3300053155 Bacteria 3701
639 Ga0500622_0007366 3300053156 Bacteria 6255
640 Ga0500627_0050356 3300053158 Bacteria 1814
641 Ga0500630_000187 3300053159 Bacteria 23623
642 Ga0500634_0058506 3300053161 Bacteria 2053
643 Ga0500638_000347 3300053162 Bacteria 10652
644 Ga0500638_018935 3300053162 Bacteria 3220
645 Ga0500639_000038 3300053163 Bacteria 65317
646 Ga0500639_046351 3300053163 Bacteria 2273
647 Ga0500636_0000157 3300053177 Bacteria 35453
648 Ga0500636_0086178 3300053177 Bacteria 1804
649 Ga0500637_0000502 3300053178 Bacteria 15181
650 Ga0500637_0000714 3300053178 Bacteria 13261
651 Ga0500576_028447 3300053725 Bacteria 2547
652 Ga0500625_022516 3300053729 Bacteria 2975
653 Ga0500645_002932 3300053730 Bacteria 7262
654 Ga0500609_001193 3300053731 Bacteria 3858
655 Ga0500596_008841 3300053735 Bacteria 1595
656 Ga0500601_000133 3300053737 Bacteria 15043
657 Ga0500661_001633 3300055283 Bacteria 4228
658 Ga0501082_0052818 3300060353 Bacteria 3503
659 2928538337 2928536128 Bacteria 7657547
660 2507506859 2507262055 Bacteria 8048963
661 2508540894 2508501009 Bacteria 7784016
662 2508696823 2508501042 Bacteria 8719808
663 2509154162 2508501128 Bacteria 8613869
664 2511399239 2511231028 Bacteria 8046582
665 2513623816 2513237092 Bacteria 8341956
666 2513641489 2513237094 Bacteria 8789602
667 2513650496 2513237095 Bacteria 8976980
668 2513654894 2513237096 Bacteria 8722461
669 2513676652 2513237098 Bacteria 9902361
670 2513693431 2513237101 Bacteria 7952346
671 2513705239 2513237102 Bacteria 7703324
672 2513720114 2513237104 Bacteria 10034502
673 2513861309 2513237137 Bacteria 9558895
674 2513877412 2513237139 Bacteria 8737671
675 2513892269 2513237141 Bacteria 8496279
676 2513916083 2513237145 Bacteria 8979722
677 2514013091 2513237161 Bacteria 8871253
678 2515629681 2515154112 Bacteria 8294334
679 2517106375 2517093001 Bacteria 9002274
680 2517894618 2517572143 Bacteria 9484767
681 2524439395 2524023205 Bacteria 8918781
682 2524471274 2524023210 Bacteria 9029266
683 2524534716 2524023228 Bacteria 10118060
684 2528853120 2528768022 Bacteria 10457665
685 2599738105 2599185239 Bacteria 8686614
686 2599742523 2599185240 Bacteria 7968121
687 2617348202 2617270735 Bacteria 9163226
688 2617377585 2617270741 Bacteria 8201522
689 2644287487 2643221651 Bacteria 4798932
690 2671119044 2667528175 Bacteria 7532676
691 2723848324 2721755755 Bacteria 8322773
692 2728748821 2728368998 Bacteria 8720350
693 2739353332 2738543032 Bacteria 5115625
694 2745078107 2744054633 Bacteria 8678936
695 2793064264 2791355196 Bacteria 7323613
696 2793072294 2791355197 Bacteria 8420563
697 2793079575
698 2805918937 2802429603 Bacteria 8777136
699 2818242093 2816332527 Bacteria 8933356
700 2824603118 2824600985 Bacteria 8488197
701 2824613610 2824609381 Bacteria 8672835
702 2824620524 2824617872 Bacteria 8814715
703 2824634140 2824626560 Bacteria 8813858
704 2824641496 2824635225 Bacteria 8785348
705 2824652271 2824644064 Bacteria 8743947
706 2824658151 2824653114 Bacteria 8493680
707 2824664339 2824661429 Bacteria 9877870
708 2824686785 2824679649 Bacteria 8248951
709 2824711714 2824704595 Bacteria 9667483
710 2824722698 2824714736 Bacteria 8717648
711 2824729320 2824723954 Bacteria 8758240
712 2824752040 2824746037 Bacteria 7911610
713 2824757524 2824753945 Bacteria 9787441
714 2824768044 2824763712 Bacteria 9792355
715 2824779650 2824773399 Bacteria 8360218
716 2838126825 2838122688 Bacteria 8803140
717 2841945703 2841941048 Bacteria 8688029
718 2841954895 2841949485 Bacteria 8680857
719 2841963261 2841957949 Bacteria 8652217
720 2841972302 2841966195 Bacteria 8673214
721 2841980385 2841974524 Bacteria 8931498
722 2841988550 2841983080 Bacteria 8395090
723 2842044849 2842038055 Bacteria 8002051
724 2842052965 2842045827 Bacteria 8006841
725 2847938280 2847930680 Bacteria 9342022
726 2847940198 2847939898 Bacteria 8606328
727 2851182991 2851182111 Bacteria 6047226
728 2857510834 2857509624 Bacteria 7472071
729 2857529781 2857524615 Bacteria 6615449
730 2863421932 2863421361 Bacteria 7300805
731 2874593994 2874590934 Bacteria 8299676
732 2874607453 2874604998 Bacteria 7834745
733 2874618854 2874612657 Bacteria 8252029
734 2874626005 2874620515 Bacteria 8290088
735 2874630758 2874628541 Bacteria 8630250
736 2874647925 2874645413 Bacteria 8214782
737 2876761943 2876761206 Bacteria 10111113
738 2876774140 2876771140 Bacteria 8287509
739 2876821092 2876818435 Bacteria 8274608
740 2879078917 2879074833 Bacteria 8279565
741 2879086133 2879083081 Bacteria 8587928
742 2879104828 2879099564 Bacteria 10442239
743 2879127924 2879127579 Bacteria 8294491
744 2879147648 2879142872 Bacteria 8267021
745 2881364341 2881364244 Bacteria 7710352
746 2881666752 2881665667 Bacteria 8175609
747 2885367916 2885366525 Bacteria 8326213
748 2885378103 2885374607 Bacteria 8927485
749 2885388799 2885383462 Bacteria 9473874
750 2885414694 2885409591 Bacteria 9235467
751 2888386155 2888378607 Bacteria 9652610
752 2888392116 2888388044 Bacteria 7304136
753 2888426301 2888419890 Bacteria 7857137
754 2889037132 2889033259 Bacteria 9099371
755 2903769802 2903768456 Bacteria 9749579
756 2904566097 2904564687 Bacteria 7609577
757 2904672487 2904666416 Bacteria 8226587
758 2904698024 2904690495 Bacteria 9412302
759 2904700141
760 2904712911 2904711408 Bacteria 9771557
761 2906611346
762 2906643454 2906635258 Bacteria 8601019
763 2906645275 2906643746 Bacteria 8722424
764 2906661322 2906660503 Bacteria 8595048
765 2908744926 2908739725 Bacteria 8628932
766 2908763062 2908756301 Bacteria 8864324
767 2908782379 2908775508 Bacteria 8092255
768 2922361279 2922361189 Bacteria 7436256
769 2922370398
770 2922392907 2922386360 Bacteria 7017218
771 2922399730 2922393267 Bacteria 8285685
772 2922428026
773 2929621410 2929615660 Bacteria 9193770
774 2929631776 2929624759 Bacteria 9339455
775 2932792553 2932784394 Bacteria 9704911
776 2932798659 2932794094 Bacteria 7915132
777 2932806529 2932801729 Bacteria 7987968
778 2932815361 2932809354 Bacteria 9135765
779 2932824360 2932818245 Bacteria 9955613
780 2932832240 2932828146 Bacteria 9745859
781 2933583565 2933577622 Bacteria 9116884
782 2935615859 2935608549 Bacteria 8203142
783 2935622178 2935616580 Bacteria 9032984
784 2935632048 2935630451 Bacteria 8169952
785 2935646436 2935638405 Bacteria 10015038
786 2935653875 2935648319 Bacteria 8801166
787 2935662624 2935656913 Bacteria 8965014
788 2935669273 2935665750 Bacteria 9571747
789 2935683168 2935675223 Bacteria 9928132
790 2935692110 2935684952 Bacteria 9590419
791 2935702485 2935694250 Bacteria 9291695
792 2935708651 2935703347 Bacteria 10242284
793 2935720651 2935713505 Bacteria 9608509
794 2935729932 2935722832 Bacteria 9608746
795 2935739085 2935732158 Bacteria 9706831
796 2935748374 2935741537 Bacteria 9707219
797 2935758576 2935750917 Bacteria 9590372
798 2935765996 2935760218 Bacteria 9817913
799 2935772255 2935769743 Bacteria 7878163
800 2935783791 2935777560 Bacteria 8077691
801 2935787705 2935785616 Bacteria 7962367
802 2935793738 2935793552 Bacteria 8012592
803 2935805989 2935801545 Bacteria 9301974
804 2935815451 2935810662 Bacteria 9401221
805 2935826806 2935819856 Bacteria 8261050
806 2935835589 2935827899 Bacteria 10038562
807 2935843367 2935837841 Bacteria 9454360
808 2935853986 2935847175 Bacteria 8228321
809 2935860425 2935855204 Bacteria 9035059
810 2935867823 2935864058 Bacteria 9784707
811 2935878368 2935873716 Bacteria 9632195
812 2935888632 2935883170 Bacteria 7964738
813 2935914924 2935908558 Bacteria 8568796
814 2935923121 2935916978 Bacteria 9113783
815 2935932397 2935926038 Bacteria 8601059
816 2935940995 2935934488 Bacteria 8602579
817 2935949112 2935942939 Bacteria 8599779
818 2935957807 2935951376 Bacteria 8602333
819 2935964807 2935959822 Bacteria 7869783
820 2935974072 2935967501 Bacteria 8603075
821 2935981363 2935975950 Bacteria 8347125
822 2935990271 2935984226 Bacteria 8302647
823 2935998749 2935992306 Bacteria 9802711
824 2936007054 2936002035 Bacteria 9362176
825 2936015375 2936011229 Bacteria 8801034
826 2936024009 2936019824 Bacteria 8804134
827 2936033024 2936028420 Bacteria 8965941
828 2936040689 2936037263 Bacteria 9446081
829 2936051117 2936046547 Bacteria 8903709
830 2936058494 2936055302 Bacteria 8785755
831 2940564480 2940556831 Bacteria 9590747
832 2941507996 2941507105 Bacteria 8166816
833 2941515499 2941515067 Bacteria 8166720
834 2941523926 2941523033 Bacteria 8169134
835 2941536575 2941531003 Bacteria 7653939
836 2941544913 2941538514 Bacteria 9402094
837 3005477727 3005474847 Bacteria 9259049
838 3005485331 3005483717 Bacteria 7877331
839 3005507670 3005506211 Bacteria 6943378
840 3005593901 3005587118 Bacteria 7794411
841 3005601072 3005594810 Bacteria 8716512
842 3005716539 3005710791 Bacteria 7622528
843 8006933848 8006933436 Bacteria 10410654
844 8006969637 8006964411 Bacteria 8966052
845 8006983520 8006973647 Bacteria 10679141
846 8006990646 8006984368 Bacteria 9651211
847 8006998713 8006994254 Bacteria 8309700
848 8016519912 8016511872 Bacteria 9921665
849 8016527823 8016522445 Bacteria 8156687
850 8016532933 8016530956 Bacteria 8155261
851 8016546169 8016539877 Bacteria 8155419
852 8016564309 8016557553 Bacteria 8154380
853 8016583728 8016575299 Bacteria 8154085
854 8016601995 8016595262 Bacteria 8149947
855 8016608228 8016603502 Bacteria 8731218
856 8016624513 8016622563 Bacteria 7999408
857 8016633975 8016630954 Bacteria 9217207
858 8017065632 8017057580 Bacteria 10023680
859 8019532734 8019530166 Bacteria 8155624
860 8019547117 8019538911 Bacteria 7872763
861 8019551544 8019547302 Bacteria 7996444
862 8019559401 8019555841 Bacteria 9642137
863 8019569497 8019565922 Bacteria 9639779
864 8019598459 8019597564 Bacteria 10041141
865 8019609918 8019608314 Bacteria 10042931
866 8019632472 8019629233 Bacteria 8687553
867 8019647413 8019638758 Bacteria 9062356
868 8019655251 8019648815 Bacteria 10014479
869 8019660389 8019659431 Bacteria 8577854
870 8019669808 8019668869 Bacteria 8791617
871 8019686285 8019678201 Bacteria 8863603
872 8019692442 8019687851 Bacteria 8712826
873 8055744387 8055742211 Bacteria 9226248
874 8056676652 8056673599 Bacteria 7871253
875 8056689648 8056681323 Bacteria 8472857
876 8056691050 8056689827 Bacteria 6712655
877 8056969239 8056967851 Bacteria 9038162
878 8057534326 8057529695 Bacteria 6306553
879 JGI25406J46586_10000022
880 JGI25406J46586_10005227
881 JGI25165J46597_1007189
882 JGI25160J50197_1002587
883 Ga0055531_10009154
884 Ga0055543_1002484
885 Ga0065165_1000054
886 Ga0065165_1002102
887 Ga0065165_1011420
888 Ga0070658_10114385
889 Ga0070683_100015345
890 Ga0070683_100226114
891 Ga0068869_100006026
892 Ga0070680_100098187
893 Ga0070682_100155719
894 Ga0068868_100011281
895 Ga0068868_100012390
896 Ga0068868_100044810
897 Ga0070687_100053672
898 Ga0070661_100068075
899 Ga0070668_100043813
900 Ga0070669_100080139
901 Ga0070674_100019676
902 Ga0070673_100059081
903 Ga0070688_100061045
904 Ga0070688_100073400
905 Ga0070659_100219481
906 Ga0070667_100163383
907 Ga0070709_10000227
908 Ga0070709_10001601
909 Ga0070714_100024557
910 Ga0070713_100024657
911 Ga0070713_100050036
912 Ga0070710_10001439
913 Ga0070711_100001952
914 Ga0070711_100002557
915 Ga0070711_100009680
916 Ga0070663_100002194
917 Ga0070663_100018127
918 Ga0070663_100031167
919 Ga0070663_100050646
920 Ga0070663_100053408
921 Ga0070678_100036257
922 Ga0070662_100137008
923 Ga0070681_10003153
924 Ga0070681_10008310
925 Ga0070681_10011710
926 Ga0068867_100007587
927 Ga0070706_100184860
928 Ga0070698_100030330
929 Ga0070679_100098777
930 Ga0070679_100155702
931 Ga0070679_100159355
932 Ga0070684_100006061
933 Ga0070686_100037560
934 Ga0070665_100020963
935 Ga0070665_100045884
936 Ga0070665_100057411
937 Ga0070665_100059104
938 Ga0070665_100153369
939 Ga0070665_100192578
940 Ga0068855_100011850
941 Ga0068855_100068227
942 Ga0068855_100074629
943 Ga0068855_100127070
944 Ga0070664_100248682
945 Ga0068857_100103602
946 Ga0068856_100000283
947 Ga0068856_100102578
948 Ga0070702_100036385
949 Ga0068859_100208272
950 Ga0068861_100205650
951 Ga0068851_10018844
952 Ga0068858_100265844
953 Ga0068860_100013207
954 Ga0068860_100252628
955 Ga0068862_100016934
956 Ga0068862_100046903
957 Ga0068862_100147152
958 Ga0081455_10005918
959 Ga0081455_10008904
960 Ga0081455_10013476
961 Ga0081455_10025076
962 Ga0081540_1010824
963 Ga0081540_1018602
964 Ga0081540_1019338
965 Ga0081540_1020886
966 Ga0081540_1040638
967 Ga0081540_1042834
968 Ga0081540_1055984
969 Ga0081539_10000172
970 Ga0081539_10000945
971 Ga0081539_10012821
972 Ga0081539_10015466
973 Ga0070717_10014606
974 Ga0070717_10021111
975 Ga0070717_10159291
976 Ga0075365_10008184
977 Ga0075365_10008188
978 Ga0075365_10034084
979 Ga0075365_10071325
980 Ga0075363_100006195
981 Ga0075364_10072493
982 Ga0070716_100007768
983 Ga0070712_100062560
984 Ga0070712_100196195
985 Ga0075362_10020342
986 Ga0075367_10008546
987 Ga0075367_10027983
988 Ga0075369_10006949
989 Ga0075366_10001716
990 Ga0075370_10000423
991 Ga0075370_10032507
992 Ga0075434_100223944
993 Ga0068865_100018479
994 Ga0097620_100208274
995 Ga0099825_1031522
996 Ga0099822_1012272
997 Ga0105240_10005830
998 Ga0105240_10023440
999 Ga0105240_10128469
1000 Ga0105245_10127546
1001 Ga0105247_10133216
1002 Ga0114129_10101325
1003 Ga0105243_10031979
1004 Ga0105241_10023336
1005 Ga0105241_10023650
1006 Ga0105241_10176530
1007 Ga0105237_10002080
1008 Ga0105237_10015271
1009 Ga0105237_10024890
1010 Ga0105238_10020617
1011 Ga0105238_10049428
1012 Ga0105239_10026267
1013 Ga0105239_10035818
1014 Ga0105239_10082860
1015 Ga0105246_10042152
1016 Ga0105246_10126374
1017 Ga0105246_10135366
1018 Ga0157369_10009617
1019 Ga0157369_10017510
1020 Ga0157369_10035736
1021 Ga0157374_10026908
1022 Ga0157374_10030783
1023 Ga0157378_10019008
1024 Ga0163162_10014185
1025 Ga0157375_10029979
1026 Ga0157375_10062791
1027 Ga0157375_10196522
1028 Ga0163163_10023168
1029 Ga0157379_10319500
1030 Ga0157376_10036268
1031 Ga0157376_10262303
1032 Ga0182007_10005930
1033 Ga0163161_10155119
1034 Ga0206353_10820691
1035 Ga0214544_1004900
1036 Ga0214542_1000773
1037 Ga0214545_1000546
1038 Ga0214543_1000740
1039 Ga0213876_10014871
1040 Ga0213876_10098826
1041 Ga0213871_10009634
1042 Ga0224712_10030568
1043 Ga0209677_100384
1044 Ga0209677_103265
1045 Ga0209233_1000823
1046 Ga0209233_1014119
1047 Ga0209455_1001474
1048 Ga0209455_1011596
1049 Ga0209564_1017567
1050 Ga0209758_1000117
1051 Ga0209758_1000715
1052 Ga0209758_1001613
1053 Ga0209758_1006716
1054 Ga0207426_1000223
1055 Ga0207426_1000649
1056 Ga0207426_1016531
1057 Ga0209257_1001759
1058 Ga0207692_10000620
1059 Ga0207710_10008225
1060 Ga0207710_10029729
1061 Ga0207647_10068869
1062 Ga0207699_10001377
1063 Ga0207684_10144845
1064 Ga0207654_10018072
1065 Ga0207654_10103305
1066 Ga0207707_10001119
1067 Ga0207707_10009404
1068 Ga0207707_10056126
1069 Ga0207695_10000136
1070 Ga0207695_10047532
1071 Ga0207695_10116825
1072 Ga0207671_10015795
1073 Ga0207693_10014092
1074 Ga0207693_10031462
1075 Ga0207693_10057497
1076 Ga0207663_10029199
1077 Ga0207660_10074503
1078 Ga0207649_10061877
1079 Ga0207649_10062221
1080 Ga0207652_10008928
1081 Ga0207652_10066764
1082 Ga0207652_10070721
1083 Ga0207652_10175078
1084 Ga0207694_10021479
1085 Ga0207694_10123521
1086 Ga0207700_10118035
1087 Ga0207664_10109515
1088 Ga0207706_10044304
1089 Ga0207686_10013907
1090 Ga0207709_10008694
1091 Ga0207670_10048617
1092 Ga0207704_10097160
1093 Ga0207665_10012662
1094 Ga0207711_10084305
1095 Ga0207689_10017899
1096 Ga0207689_10023971
1097 Ga0207661_10000190
1098 Ga0207661_10062281
1099 Ga0207661_10084952
1100 Ga0207679_10112374
1101 Ga0207679_10155920
1102 Ga0207667_10065228
1103 Ga0207667_10219916
1104 Ga0207668_10041202
1105 Ga0207668_10055435
1106 Ga0207668_10093154
1107 Ga0207658_10073091
1108 Ga0207677_10044452
1109 Ga0207703_10015770
1110 Ga0207639_10134673
1111 Ga0207639_10236907
1112 Ga0207678_10016800
1113 Ga0207678_10035083
1114 Ga0207678_10061951
1115 Ga0207678_10075144
1116 Ga0207678_10076272
1117 Ga0207678_10091313
1118 Ga0207678_10139406
1119 Ga0207708_10029928
1120 Ga0207702_10000052
1121 Ga0207702_10031891
1122 Ga0207702_10058264
1123 Ga0207641_10133326
1124 Ga0207648_10027354
1125 Ga0207674_10104491
1126 Ga0207674_10114603
1127 Ga0207675_100016461
1128 Ga0207675_100112461
1129 Ga0207675_100369869
1130 Ga0207683_10032325
1131 Ga0207683_10044240
1132 Ga0207683_10062763
1133 Ga0207683_10112080
1134 Ga0207698_10030894
1135 Ga0207698_10133561
1136 Ga0207698_10140678
1137 Ga0209389_1000028
1138 Ga0209389_1000056
1139 Ga0209589_1000007
1140 Ga0209589_1000034
1141 Ga0209489_100008
1142 Ga0209489_100009
1143 Ga0209489_102012
1144 Ga0209700_100009
1145 Ga0209700_100022
1146 Ga0268266_10000519
1147 Ga0268266_10003020
1148 Ga0268266_10044108
1149 Ga0268266_10090525
1150 Ga0268265_10080618
1151 Ga0268265_10180179
1152 Ga0268265_10271288
1153 Ga0268264_10103703
1154 Ga0307517_10000248
1155 Ga0307517_10136617
1156 Ga0265330_10020141
1157 Ga0265325_10067907
1158 Ga0265329_10035515
1159 Ga0265339_10013152
1160 Ga0265339_10087431
1161 Ga0265339_10088861
1162 Ga0265339_10095190
1163 Ga0265331_10030223
1164 Ga0265316_10158753
1165 Ga0307513_10040669
1166 Ga0307509_10038225
1167 Ga0307408_100067422
1168 Ga0265313_10071475
1169 Ga0307508_10072105
1170 Ga0265314_10004420
1171 Ga0265314_10053234
1172 Ga0307407_10123247
1173 Ga0307409_100212668
1174 Ga0307510_10005609
1175 Ga0307510_10012266
1176 Ga0307510_10055497
1177 Ga0307510_10056357
1178 Ga0307510_10204549
1179 Ga0373926_0039935
1180 Ga0373944_0024045
1181 Ga0373923_0027627
1182 Ga0373936_0005553
1183 Ga0373936_0032591
1184 Ga0373945_0016860
1185 Ga0373953_0002162
1186 Ga0373954_0012905
1187 Ga0373954_0018705
1188 Ga0373956_0004523
1189 Ga0373943_0008287
1190 Ga0373946_0006757
1191 Ga0373955_0000335
1192 Ga0373955_0022709
1193 Ga0373955_0126986
1194 Ga0373924_0024544
1195 Ga0373924_0036480
1196 Ga0373935_0001283
1197 Ga0373927_0000515
1198 Ga0373933_0000106
1199 Ga0373933_0034579
1200 Ga0373947_0004303
1201 Ga0373947_0026121
1202 Ga0373947_0050799
1203 Ga0373937_0042654
1204 Ga0373937_0272472
1205 Ga0373925_0001116
1206 Ga0373925_0073594
1207 Ga0373925_0186396
1208 Ga0373925_0242119
1209 Ga0395900_0019004
1210 Ga0395900_0039621
1211 Ga0395900_0081097
1212 Ga0395898_0006007
1213 Ga0395898_0040790
1214 Ga0395898_0076659
1215 Ga0395898_0184223
1216 Ga0395905_0013314
1217 Ga0436364_0336775
1218 Ga0436364_0751694
1219 Ga0395901_0082268
1220 Ga0436365_0474195
1221 Ga0436365_1060223
1222 Ga0436365_1421557
1223 Ga0436365_1919740
1224 Ga0436360_1353130
1225 Ga0436361_0895020
1226 Ga0436362_0094313
1227 Ga0436362_1189097
1228 Ga0439458_0016549
1229 Ga0466972_0000110
1230 Ga0466972_0003331
1231 Ga0466965_0008548
1232 Ga0466966_0080251
1233 Ga0466963_0003214
1234 Ga0466957_0013617
1235 Ga0466957_0016857
1236 Ga0466957_0187640
1237 Ga0466959_0053736
1238 Ga0466967_0015425
1239 Ga0466967_0062382
1240 Ga0466967_0101911
1241 Ga0495592_0006367
1242 Ga0495592_0009951
1243 Ga0495592_0036210
1244 Ga0495603_0000156
1245 Ga0495603_0022445
1246 Ga0495603_0080171
1247 Ga0495629_0000297
1248 Ga0495629_0001966
1249 Ga0495629_0002353
1250 Ga0495629_0026149
1251 Ga0495629_0106504
1252 Ga0495638_0005955
1253 Ga0495638_0080116
1254 Ga0495641_0016704
1255 Ga0495651_0003593
1256 Ga0495651_0015887
1257 Ga0495651_0073121
1258 Ga0495580_0004564
1259 Ga0495582_0000087
1260 Ga0495639_0000153
1261 Ga0495639_0007468
1262 Ga0495639_0019704
1263 Ga0495662_0004971
1264 Ga0495664_0005395
1265 Ga0495664_0017781
1266 Ga0495664_0091357
1267 Ga0495584_0101389
1268 Ga0495594_0047103
1269 Ga0495606_0001387
1270 Ga0495606_0013271
1271 Ga0495608_0025938
1272 Ga0495608_0033974
1273 Ga0495608_0087279
1274 Ga0495610_0042140
1275 Ga0495618_0037730
1276 Ga0495618_0039213
1277 Ga0495618_0053942
1278 Ga0495620_0041331
1279 Ga0495628_0039901
1280 Ga0495628_0079926
1281 Ga0495628_0104296
1282 Ga0495628_0208444
1283 Ga0495630_0000735
1284 Ga0495630_0040595
1285 Ga0495631_0019230
1286 Ga0495632_0044841
1287 Ga0495644_0028898
1288 Ga0495648_0003807
1289 Ga0495648_0014960
1290 Ga0495648_0036506
1291 Ga0495666_0017403
1292 Ga0495652_0003411
1293 Ga0495652_0023747
1294 Ga0495652_0035587
1295 Ga0495665_0000117
1296 Ga0495665_0008372
1297 Ga0495640_0002597
1298 Ga0495640_0046425
1299 Ga0495587_0001788
1300 Ga0495645_0012372
1301 Ga0495645_0056154
1302 Ga0495622_0002118
1303 Ga0495667_0022986
1304 Ga0495667_0049104
1305 Ga0495667_0078753
1306 Ga0495667_0124882
1307 Ga0495667_0175298
1308 Ga0495656_0026908
1309 Ga0495656_0034975
1310 Ga0495668_0022219
1311 Ga0495634_0009937
1312 Ga0495634_0041078
1313 Ga0495611_0018358
1314 Ga0495611_0089746
1315 Ga0495625_0029766
1316 Ga0495625_0157597
1317 Ga0495635_0011937
1318 Ga0495635_0016105
1319 Ga0495635_0054427
1320 Ga0495635_0056628
1321 Ga0495635_0117662
1322 Ga0495657_0002601
1323 Ga0495657_0008132
1324 Ga0495623_0001847
1325 Ga0495646_0004576
1326 Ga0495646_0027733
1327 Ga0495646_0087452
1328 Ga0495647_0000365
1329 Ga0495647_0005771
1330 Ga0495658_0000644
1331 Ga0495658_0086515
1332 Ga0495669_0004390
1333 Ga0495613_0009744
1334 Ga0495613_0046869
1335 Ga0495613_0059264
1336 Ga0495624_0001012
1337 Ga0495624_0028607
1338 Ga0495624_0041473
1339 Ga0495670_0070693
1340 Ga0495649_0033464
1341 Ga0495589_0043201
1342 Ga0495600_0000869
1343 Ga0495600_0006623
1344 Ga0495581_0000543
1345 Ga0495604_0000751
1346 Ga0495604_0078967
1347 Ga0495604_0127905
1348 Ga0495674_0000177
1349 Ga0495674_0004259
1350 Ga0495674_0020467
1351 Ga0495674_0064002
1352 Ga0495674_0127546
1353 Ga0495672_0057036
1354 Ga0495676_0017162
1355 Ga0495676_0117392
1356 Ga0495680_0001530
1357 Ga0495683_0073021
1358 Ga0495675_0025225
1359 Ga0495685_015376
1360 Ga0495673_0011890
1361 Ga0495684_0002187
1362 Ga0495684_0013598
1363 Ga0495684_0023802
1364 Ga0495684_0035668
1365 Ga0495686_0021609
1366 Ga0495686_0090603
1367 Ga0495593_0000156
1368 Ga0495593_0013164
1369 Ga0495602_0046473
1370 Ga0495602_0081730
1371 Ga0495602_0235101
1372 Ga0495614_0012177
1373 Ga0495626_0073230
1374 Ga0496100_0021481
1375 Ga0496100_0069060
1376 Ga0496100_0072789
1377 Ga0496101_0007180
1378 Ga0496101_0227745
1379 Ga0496102_0010384
1380 Ga0496102_0029354
1381 Ga0496102_0070377
1382 Ga0496102_0074351
1383 Ga0496103_0050663
1384 Ga0496104_0010798
1385 Ga0496104_0032296
1386 Ga0496104_0060567
1387 Ga0496105_0001079
1388 Ga0496105_0026645
1389 Ga0496105_0124205
1390 Ga0496106_0006989
1391 Ga0496106_0033779
1392 Ga0496106_0049553
1393 Ga0496106_0065373
1394 Ga0496107_0056443
1395 Ga0496107_0163708
1396 Ga0496108_0013601
1397 Ga0496108_0016621
1398 Ga0496108_0060904
1399 Ga0496108_0086966
1400 Ga0496108_0125987
1401 Ga0496109_0035982
1402 Ga0496110_0006206
1403 Ga0496110_0067614
1404 Ga0496110_0146203
1405 Ga0496111_0035227
1406 Ga0496111_0037826
1407 Ga0496111_0084233
1408 Ga0496112_0000057
1409 Ga0496112_0051942
1410 Ga0496113_0021724
1411 Ga0496113_0021863
1412 Ga0496113_0048355
1413 Ga0496114_0010492
1414 Ga0496114_0054300
1415 Ga0496114_0317929
1416 Ga0496115_0003709
1417 Ga0496115_0010430
1418 Ga0496115_0023069
1419 Ga0496115_0045050
1420 Ga0496115_0062901
1421 Ga0496115_0187762
1422 Ga0496116_0059844
1423 Ga0496118_0054933
1424 Ga0496118_0072960
1425 Ga0496118_0073569
1426 Ga0496120_0019659
1427 Ga0496121_0000287
1428 Ga0496121_0011016
1429 Ga0496121_0036889
1430 Ga0496121_0063418
1431 Ga0496121_0080134
1432 Ga0496124_0051160
1433 Ga0496124_0094198
1434 Ga0496125_0000654
1435 Ga0496125_0039845
1436 Ga0496125_0083438
1437 Ga0496126_0001378
1438 Ga0496126_0023389
1439 Ga0496126_0028392
1440 Ga0496126_0028525
1441 Ga0496126_0034253
1442 Ga0496126_0050313
1443 Ga0496126_0079318
1444 Ga0496126_0129558
1445 Ga0496126_0193331
1446 Ga0496126_0207872
1447 Ga0496126_0233560
1448 Ga0495678_030305
1449 Ga0501032_0058911
1450 Ga0501034_0139494
1451 Ga0501037_0112815
1452 Ga0501038_0029631
1453 Ga0501038_0203292
1454 Ga0501042_0091096
1455 Ga0501043_0159584
1456 Ga0501046_0084995
1457 Ga0501047_0041969
1458 Ga0501067_0096608
1459 Ga0501070_0019833
1460 Ga0501073_0029828
1461 Ga0501073_0055687
1462 Ga0501074_0053891
1463 Ga0501076_0203126
1464 Ga0501080_0006437
1465 Ga0501080_0027935
1466 Ga0501044_0075584
1467 Ga0501045_0037272
1468 nmdc:mga03n38_569_c1
1469 nmdc:mga0yw44_136181_c1
1470 nmdc:mga0yw44_4755_c1
1471 nmdc:mga0k408_132838_c1
1472 nmdc:mga06z11_20219_c1
1473 nmdc:mga07m45_12920_c1
1474 nmdc:mga07m45_27846_c1
1475 Ga0495601_0034886
1476 Ga0495601_0057604
1477 Ga0495601_0105705
1478 Ga0495612_0023956
1479 Ga0500635_0008657
1480 Ga0500635_0015857
1481 Ga0495595_0009305
1482 Ga0495595_0051750
1483 Ga0495619_0014155
1484 Ga0500578_0094824
1485 Ga0500643_000095
1486 Ga0500651_0001950
1487 Ga0500651_0079684
1488 Ga0500566_0000035
1489 Ga0500566_0000228
1490 Ga0500640_000054
1491 Ga0500641_0006106
1492 Ga0500555_001063
1493 Ga0500557_000117
1494 Ga0500569_000782
1495 Ga0500572_000122
1496 Ga0500572_001570
1497 Ga0500595_000651
1498 Ga0500595_000743
1499 Ga0500595_009830
1500 Ga0500595_011238
1501 Ga0500595_015038
1502 Ga0500595_024553
1503 Ga0500642_0002741
1504 Ga0500642_0013901
1505 Ga0500642_0043444
1506 Ga0500655_005578
1507 Ga0500559_0001632
1508 Ga0500559_0001963
1509 Ga0500559_0011974
1510 Ga0500564_046065
1511 Ga0500568_0004068
1512 Ga0500568_0053547
1513 Ga0500577_0010289
1514 Ga0500590_009170
1515 Ga0500603_001828
1516 Ga0500620_002550
1517 Ga0500622_0007366
1518 Ga0500627_0050356
1519 Ga0500630_000187
1520 Ga0500634_0058506
1521 Ga0500638_000347
1522 Ga0500638_018935
1523 Ga0500639_000038
1524 Ga0500639_046351
1525 Ga0500636_0000157
1526 Ga0500636_0086178
1527 Ga0500637_0000502
1528 Ga0500637_0000714
1529 Ga0500576_028447
1530 Ga0500625_022516
1531 Ga0500645_002932
1532 Ga0500609_001193
1533 Ga0500596_008841
1534 Ga0500601_000133
1535 Ga0500661_001633
1536 Ga0501082_0052818
1537 2928538337
1538 2507506859
1539 2508540894
1540 2508696823
1541 2509154162
1542 2511399239
1543 2513623816
1544 2513641489
1545 2513650496
1546 2513654894
1547 2513676652
1548 2513693431
1549 2513705239
1550 2513720114
1551 2513861309
1552 2513877412
1553 2513892269
1554 2513916083
1555 2514013091
1556 2515629681
1557 2517106375
1558 2517894618
1559 2524439395
1560 2524471274
1561 2524534716
1562 2528853120
1563 2599738105
1564 2599742523
1565 2617348202
1566 2617377585
1567 2644287487
1568 2671119044
1569 2723848324
1570 2728748821
1571 2739353332
1572 2745078107
1573 2793064264
1574 2793072294
1575 2793079575
1576 2805918937
1577 2818242093
1578 2824603118
1579 2824613610
1580 2824620524
1581 2824634140
1582 2824641496
1583 2824652271
1584 2824658151
1585 2824664339
1586 2824686785
1587 2824711714
1588 2824722698
1589 2824729320
1590 2824752040
1591 2824757524
1592 2824768044
1593 2824779650
1594 2838126825
1595 2841945703
1596 2841954895
1597 2841963261
1598 2841972302
1599 2841980385
1600 2841988550
1601 2842044849
1602 2842052965
1603 2847938280
1604 2847940198
1605 2851182991
1606 2857510834
1607 2857529781
1608 2863421932
1609 2874593994
1610 2874607453
1611 2874618854
1612 2874626005
1613 2874630758
1614 2874647925
1615 2876761943
1616 2876774140
1617 2876821092
1618 2879078917
1619 2879086133
1620 2879104828
1621 2879127924
1622 2879147648
1623 2881364341
1624 2881666752
1625 2885367916
1626 2885378103
1627 2885388799
1628 2885414694
1629 2888386155
1630 2888392116
1631 2888426301
1632 2889037132
1633 2903769802
1634 2904566097
1635 2904672487
1636 2904698024
1637 2904700141
1638 2904712911
1639 2906611346
1640 2906643454
1641 2906645275
1642 2906661322
1643 2908744926
1644 2908763062
1645 2908782379
1646 2922361279
1647 2922370398
1648 2922392907
1649 2922399730
1650 2922428026
1651 2929621410
1652 2929631776
1653 2932792553
1654 2932798659
1655 2932806529
1656 2932815361
1657 2932824360
1658 2932832240
1659 2933583565
1660 2935615859
1661 2935622178
1662 2935632048
1663 2935646436
1664 2935653875
1665 2935662624
1666 2935669273
1667 2935683168
1668 2935692110
1669 2935702485
1670 2935708651
1671 2935720651
1672 2935729932
1673 2935739085
1674 2935748374
1675 2935758576
1676 2935765996
1677 2935772255
1678 2935783791
1679 2935787705
1680 2935793738
1681 2935805989
1682 2935815451
1683 2935826806
1684 2935835589
1685 2935843367
1686 2935853986
1687 2935860425
1688 2935867823
1689 2935878368
1690 2935888632
1691 2935914924
1692 2935923121
1693 2935932397
1694 2935940995
1695 2935949112
1696 2935957807
1697 2935964807
1698 2935974072
1699 2935981363
1700 2935990271
1701 2935998749
1702 2936007054
1703 2936015375
1704 2936024009
1705 2936033024
1706 2936040689
1707 2936051117
1708 2936058494
1709 2940564480
1710 2941507996
1711 2941515499
1712 2941523926
1713 2941536575
1714 2941544913
1715 3005477727
1716 3005485331
1717 3005507670
1718 3005593901
1719 3005601072
1720 3005716539
1721 8006933848
1722 8006969637
1723 8006983520
1724 8006990646
1725 8006998713
1726 8016519912
1727 8016527823
1728 8016532933
1729 8016546169
1730 8016564309
1731 8016583728
1732 8016601995
1733 8016608228
1734 8016624513
1735 8016633975
1736 8017065632
1737 8019532734
1738 8019547117
1739 8019551544
1740 8019559401
1741 8019569497
1742 8019598459
1743 8019609918
1744 8019632472
1745 8019647413
1746 8019655251
1747 8019660389
1748 8019669808
1749 8019686285
1750 8019692442
1751 8055744387
1752 8056676652
1753 8056689648
1754 8056691050
1755 8056969239
1756 8057534326

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03454

MoeA_C

MoeA C-terminal region (domain IV)

352

424

0.96

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

194

339

0.93

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

15

181

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nqm-assembly1.cif.gz_A moea t100a mutant 0.8182 15 390
2nqq-assembly1.cif.gz_B moea r137q 0.8123 15 390
2nqm-assembly1.cif.gz_A moea t100a mutant 0.8111 15 390
2nqq-assembly1.cif.gz_B moea r137q 0.7824 15 390
2nqr-assembly1.cif.gz_B moea d142n 0.7809 15 391
ID Description Score Start End Superfamily
af_P12281_176_326_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9492 164 314 3.40.980.10
af_P12281_176_326_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9432 164 314 3.40.980.10
1fc5A01 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9196 164 314 3.40.980.10
af_Q2FVY0_182_332_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9082 168 312 3.40.980.10
af_P9WJQ5_178_322_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9081 169 304 3.40.980.10
ID Description Score Start End GO Terms
AF-S6T8Y4-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9615 164 310 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A2T4DAF4-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9525 164 302 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A4U9HQF8-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9497 164 314 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A2V2T639-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.932 164 390 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-S6T8Y4-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9306 164 310 GO:0005829
GO:0006777
GO:0046872
GO:0061599

Map