F484441
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 878 | 574 | 1756 | 414 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2928536128|2928538337 |
| Length | 428 |
| Sequence | SSPASRTAPDPDAPLSLADAQALACRFAVPVDACDTVALRDALDRVLAADVSAPFDIPAYDNSAMDGYAFDGGAAARASAQGEVAMTVAGTAFAGHPFDGVVAAGACVRIMTGAPMPAGCDTVIPQERVRVDGDTIRFAAQDVARGANCRRAGEDLARGACALAAGRMLRPSDLGLLASFGIADVTVRRRVRVAVFSTGDELREPGEPLGRGALYDSNRGMLIAMLERVHVDAIDLGIVRDDPAALETALRDALAAQADAVITSGGVSVGEADFTRDVMARLGDVTFASVALRPGRPLACGSLARAADGAGRALFFGLPGNPVASAVTFHAIVRPALLTLAGAQTPPPAMYTALSTQALKKRPGRTDYLRGIATRAADGQWHVAPAGSQSSASLSGLAAANCFIVLGHDSAAVDAGTPVDILPLDGLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 67 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 90 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 91 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 92 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 327 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 328 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 332 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 335 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 336 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 342 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 343 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 353 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 356 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 357 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 358 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 359 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 360 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 361 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 362 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 363 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 364 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 365 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 366 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 367 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 368 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 369 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 370 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 371 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 372 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 373 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 374 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 375 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 376 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 377 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 378 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 379 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 380 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 381 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 382 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 383 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 384 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 385 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 386 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 387 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 388 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 389 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 390 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 391 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 392 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 393 | 2791355199 | |||
| 394 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 395 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 396 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 397 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 398 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 399 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 400 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 401 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 402 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 403 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 404 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 405 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 406 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 407 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 408 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 409 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 410 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 411 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 412 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 413 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 414 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 415 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 416 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 417 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 418 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 419 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 420 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 421 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 422 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 423 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 424 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 425 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 426 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 427 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 428 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 429 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 430 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 431 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 432 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 433 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 434 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 435 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 436 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 437 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 438 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 439 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 440 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 441 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 442 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 443 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 444 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 445 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 446 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 447 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 448 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 449 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 450 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 451 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 452 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 453 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 454 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 455 | 2904699407 | |||
| 456 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 457 | 2906610324 | |||
| 458 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 459 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 460 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 461 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 462 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 463 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 464 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 465 | 2922368715 | |||
| 466 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 467 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 468 | 2922425934 | |||
| 469 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 470 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 471 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 472 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 473 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 474 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 475 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 476 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 477 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 478 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 479 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 480 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 481 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 482 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 483 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 484 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 485 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 486 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 487 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 488 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 489 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 490 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 491 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 492 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 493 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 494 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 495 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 496 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 497 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 498 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 499 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 500 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 501 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 502 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 503 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 504 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 505 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 506 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 507 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 508 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 509 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 510 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 511 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 512 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 513 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 514 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 515 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 516 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 517 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 518 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 519 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 520 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 521 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 522 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 523 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 524 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 525 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 526 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 527 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 528 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 529 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 530 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 531 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 532 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 533 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 534 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 535 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 536 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 537 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 538 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 539 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 540 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 541 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 542 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 543 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 544 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 545 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 546 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 547 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 548 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 549 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 550 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 551 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 552 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 553 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 554 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 555 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 556 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 557 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 558 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 559 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 560 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 561 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 562 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 563 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 564 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 565 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 566 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 567 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 568 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 569 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 570 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 571 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 572 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 573 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 574 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.14 |
| Metatranscriptomes | 0.23 |
| Isolates | 24.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.93 |
| Nodule | 19.82 |
| Rhizoplane | 5.81 |
| Rhizosphere | 52.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000022 | 3300003203 | Bacteria | 79225 |
| 2 | JGI25406J46586_10005227 | 3300003203 | Bacteria | 6017 |
| 3 | JGI25165J46597_1007189 | 3300003214 | Bacteria | 1876 |
| 4 | JGI25160J50197_1002587 | 3300003354 | Bacteria | 8355 |
| 5 | Ga0055531_10009154 | 3300003794 | Bacteria | 5103 |
| 6 | Ga0055543_1002484 | 3300004625 | Bacteria | 6073 |
| 7 | Ga0065165_1000054 | 3300005262 | Bacteria | 187351 |
| 8 | Ga0065165_1002102 | 3300005262 | Bacteria | 18202 |
| 9 | Ga0065165_1011420 | 3300005262 | Bacteria | 3707 |
| 10 | Ga0070658_10114385 | 3300005327 | Bacteria | 2237 |
| 11 | Ga0070683_100015345 | 3300005329 | Bacteria | 6725 |
| 12 | Ga0070683_100226114 | 3300005329 | Bacteria | 1778 |
| 13 | Ga0068869_100006026 | 3300005334 | Bacteria | 7667 |
| 14 | Ga0070680_100098187 | 3300005336 | Bacteria | 2429 |
| 15 | Ga0070682_100155719 | 3300005337 | Bacteria | 1573 |
| 16 | Ga0068868_100011281 | 3300005338 | Bacteria | 6507 |
| 17 | Ga0068868_100012390 | 3300005338 | Bacteria | 6232 |
| 18 | Ga0068868_100044810 | 3300005338 | Bacteria | 3459 |
| 19 | Ga0070687_100053672 | 3300005343 | Bacteria | 2097 |
| 20 | Ga0070661_100068075 | 3300005344 | Bacteria | 2617 |
| 21 | Ga0070668_100043813 | 3300005347 | Bacteria | 3431 |
| 22 | Ga0070669_100080139 | 3300005353 | Bacteria | 2429 |
| 23 | Ga0070674_100019676 | 3300005356 | Bacteria | 4293 |
| 24 | Ga0070673_100059081 | 3300005364 | Bacteria | 3035 |
| 25 | Ga0070688_100061045 | 3300005365 | Bacteria | 2382 |
| 26 | Ga0070688_100073400 | 3300005365 | Bacteria | 2194 |
| 27 | Ga0070659_100219481 | 3300005366 | Bacteria | 1569 |
| 28 | Ga0070667_100163383 | 3300005367 | Bacteria | 1962 |
| 29 | Ga0070709_10000227 | 3300005434 | Bacteria | 36585 |
| 30 | Ga0070709_10001601 | 3300005434 | Bacteria | 12213 |
| 31 | Ga0070714_100024557 | 3300005435 | Bacteria | 4966 |
| 32 | Ga0070713_100024657 | 3300005436 | Bacteria | 4689 |
| 33 | Ga0070713_100050036 | 3300005436 | Bacteria | 3450 |
| 34 | Ga0070710_10001439 | 3300005437 | Bacteria | 11241 |
| 35 | Ga0070711_100001952 | 3300005439 | Bacteria | 11570 |
| 36 | Ga0070711_100002557 | 3300005439 | Bacteria | 10418 |
| 37 | Ga0070711_100009680 | 3300005439 | Bacteria | 5938 |
| 38 | Ga0070663_100002194 | 3300005455 | Bacteria | 10915 |
| 39 | Ga0070663_100018127 | 3300005455 | Bacteria | 4609 |
| 40 | Ga0070663_100031167 | 3300005455 | Bacteria | 3662 |
| 41 | Ga0070663_100050646 | 3300005455 | Bacteria | 2955 |
| 42 | Ga0070663_100053408 | 3300005455 | Bacteria | 2884 |
| 43 | Ga0070678_100036257 | 3300005456 | Bacteria | 3451 |
| 44 | Ga0070662_100137008 | 3300005457 | Bacteria | 1893 |
| 45 | Ga0070681_10003153 | 3300005458 | Bacteria | 15332 |
| 46 | Ga0070681_10008310 | 3300005458 | Bacteria | 10165 |
| 47 | Ga0070681_10011710 | 3300005458 | Bacteria | 8689 |
| 48 | Ga0068867_100007587 | 3300005459 | Bacteria | 7677 |
| 49 | Ga0070706_100184860 | 3300005467 | Bacteria | 1947 |
| 50 | Ga0070698_100030330 | 3300005471 | Bacteria | 5607 |
| 51 | Ga0070679_100098777 | 3300005530 | Bacteria | 2907 |
| 52 | Ga0070679_100155702 | 3300005530 | Bacteria | 2260 |
| 53 | Ga0070679_100159355 | 3300005530 | Bacteria | 2231 |
| 54 | Ga0070684_100006061 | 3300005535 | Bacteria | 9319 |
| 55 | Ga0070686_100037560 | 3300005544 | Bacteria | 3005 |
| 56 | Ga0070665_100020963 | 3300005548 | Bacteria | 6569 |
| 57 | Ga0070665_100045884 | 3300005548 | Bacteria | 4389 |
| 58 | Ga0070665_100057411 | 3300005548 | Bacteria | 3901 |
| 59 | Ga0070665_100059104 | 3300005548 | Bacteria | 3843 |
| 60 | Ga0070665_100153369 | 3300005548 | Bacteria | 2306 |
| 61 | Ga0070665_100192578 | 3300005548 | Bacteria | 2039 |
| 62 | Ga0068855_100011850 | 3300005563 | Bacteria | 10543 |
| 63 | Ga0068855_100068227 | 3300005563 | Bacteria | 4140 |
| 64 | Ga0068855_100074629 | 3300005563 | Bacteria | 3938 |
| 65 | Ga0068855_100127070 | 3300005563 | Bacteria | 2914 |
| 66 | Ga0070664_100248682 | 3300005564 | Bacteria | 1598 |
| 67 | Ga0068857_100103602 | 3300005577 | Bacteria | 2555 |
| 68 | Ga0068856_100000283 | 3300005614 | Bacteria | 55412 |
| 69 | Ga0068856_100102578 | 3300005614 | Bacteria | 2854 |
| 70 | Ga0070702_100036385 | 3300005615 | Bacteria | 2727 |
| 71 | Ga0068859_100208272 | 3300005617 | Bacteria | 2041 |
| 72 | Ga0068861_100205650 | 3300005719 | Bacteria | 1655 |
| 73 | Ga0068851_10018844 | 3300005834 | Bacteria | 3330 |
| 74 | Ga0068858_100265844 | 3300005842 | Bacteria | 1631 |
| 75 | Ga0068860_100013207 | 3300005843 | Bacteria | 8102 |
| 76 | Ga0068860_100252628 | 3300005843 | Bacteria | 1717 |
| 77 | Ga0068862_100016934 | 3300005844 | Bacteria | 6067 |
| 78 | Ga0068862_100046903 | 3300005844 | Bacteria | 3686 |
| 79 | Ga0068862_100147152 | 3300005844 | Bacteria | 2094 |
| 80 | Ga0081455_10005918 | 3300005937 | Bacteria | 13272 |
| 81 | Ga0081455_10008904 | 3300005937 | Bacteria | 10379 |
| 82 | Ga0081455_10013476 | 3300005937 | Bacteria | 8075 |
| 83 | Ga0081455_10025076 | 3300005937 | Bacteria | 5511 |
| 84 | Ga0081540_1010824 | 3300005983 | Bacteria | 6131 |
| 85 | Ga0081540_1018602 | 3300005983 | Bacteria | 4255 |
| 86 | Ga0081540_1019338 | 3300005983 | Bacteria | 4145 |
| 87 | Ga0081540_1020886 | 3300005983 | Bacteria | 3921 |
| 88 | Ga0081540_1040638 | 3300005983 | Bacteria | 2422 |
| 89 | Ga0081540_1042834 | 3300005983 | Bacteria | 2330 |
| 90 | Ga0081540_1055984 | 3300005983 | Bacteria | 1917 |
| 91 | Ga0081539_10000172 | 3300005985 | Bacteria | 151505 |
| 92 | Ga0081539_10000945 | 3300005985 | Bacteria | 54444 |
| 93 | Ga0081539_10012821 | 3300005985 | Bacteria | 6397 |
| 94 | Ga0081539_10015466 | 3300005985 | Bacteria | 5543 |
| 95 | Ga0070717_10014606 | 3300006028 | Bacteria | 6047 |
| 96 | Ga0070717_10021111 | 3300006028 | Bacteria | 5130 |
| 97 | Ga0070717_10159291 | 3300006028 | Bacteria | 1957 |
| 98 | Ga0075365_10008184 | 3300006038 | Bacteria | 5915 |
| 99 | Ga0075365_10008188 | 3300006038 | Bacteria | 5914 |
| 100 | Ga0075365_10034084 | 3300006038 | Bacteria | 3286 |
| 101 | Ga0075365_10071325 | 3300006038 | Bacteria | 2338 |
| 102 | Ga0075363_100006195 | 3300006048 | Bacteria | 5408 |
| 103 | Ga0075364_10072493 | 3300006051 | Bacteria | 2270 |
| 104 | Ga0070716_100007768 | 3300006173 | Bacteria | 5296 |
| 105 | Ga0070712_100062560 | 3300006175 | Bacteria | 2632 |
| 106 | Ga0070712_100196195 | 3300006175 | Bacteria | 1583 |
| 107 | Ga0075362_10020342 | 3300006177 | Bacteria | 2772 |
| 108 | Ga0075367_10008546 | 3300006178 | Bacteria | 5309 |
| 109 | Ga0075367_10027983 | 3300006178 | Bacteria | 3211 |
| 110 | Ga0075369_10006949 | 3300006186 | Bacteria | 4297 |
| 111 | Ga0075366_10001716 | 3300006195 | Bacteria | 11020 |
| 112 | Ga0075370_10000423 | 3300006353 | Bacteria | 15632 |
| 113 | Ga0075370_10032507 | 3300006353 | Bacteria | 2918 |
| 114 | Ga0075434_100223944 | 3300006871 | Bacteria | 1901 |
| 115 | Ga0068865_100018479 | 3300006881 | Bacteria | 4498 |
| 116 | Ga0097620_100208274 | 3300006931 | Bacteria | 2041 |
| 117 | Ga0099825_1031522 | 3300006941 | Bacteria | 2238 |
| 118 | Ga0099822_1012272 | 3300006943 | Bacteria | 10273 |
| 119 | Ga0105240_10005830 | 3300009093 | Bacteria | 18268 |
| 120 | Ga0105240_10023440 | 3300009093 | Bacteria | 8160 |
| 121 | Ga0105240_10128469 | 3300009093 | Bacteria | 3043 |
| 122 | Ga0105245_10127546 | 3300009098 | Bacteria | 2383 |
| 123 | Ga0105247_10133216 | 3300009101 | Bacteria | 1622 |
| 124 | Ga0114129_10101325 | 3300009147 | Bacteria | 3984 |
| 125 | Ga0105243_10031979 | 3300009148 | Bacteria | 4060 |
| 126 | Ga0105241_10023336 | 3300009174 | Bacteria | 4587 |
| 127 | Ga0105241_10023650 | 3300009174 | Bacteria | 4557 |
| 128 | Ga0105241_10176530 | 3300009174 | Bacteria | 1769 |
| 129 | Ga0105237_10002080 | 3300009545 | Bacteria | 25314 |
| 130 | Ga0105237_10015271 | 3300009545 | Bacteria | 7999 |
| 131 | Ga0105237_10024890 | 3300009545 | Bacteria | 6124 |
| 132 | Ga0105238_10020617 | 3300009551 | Bacteria | 6715 |
| 133 | Ga0105238_10049428 | 3300009551 | Bacteria | 4235 |
| 134 | Ga0105239_10026267 | 3300010375 | Bacteria | 6409 |
| 135 | Ga0105239_10035818 | 3300010375 | Bacteria | 5449 |
| 136 | Ga0105239_10082860 | 3300010375 | Bacteria | 3532 |
| 137 | Ga0105246_10042152 | 3300011119 | Bacteria | 3090 |
| 138 | Ga0105246_10126374 | 3300011119 | Bacteria | 1903 |
| 139 | Ga0105246_10135366 | 3300011119 | Bacteria | 1846 |
| 140 | Ga0157369_10009617 | 3300013105 | Bacteria | 11053 |
| 141 | Ga0157369_10017510 | 3300013105 | Bacteria | 8052 |
| 142 | Ga0157369_10035736 | 3300013105 | Bacteria | 5447 |
| 143 | Ga0157374_10026908 | 3300013296 | Bacteria | 5180 |
| 144 | Ga0157374_10030783 | 3300013296 | Bacteria | 4875 |
| 145 | Ga0157378_10019008 | 3300013297 | Bacteria | 6038 |
| 146 | Ga0163162_10014185 | 3300013306 | Bacteria | 7788 |
| 147 | Ga0157375_10029979 | 3300013308 | Bacteria | 5123 |
| 148 | Ga0157375_10062791 | 3300013308 | Bacteria | 3692 |
| 149 | Ga0157375_10196522 | 3300013308 | Bacteria | 2172 |
| 150 | Ga0163163_10023168 | 3300014325 | Bacteria | 5891 |
| 151 | Ga0157379_10319500 | 3300014968 | Bacteria | 1417 |
| 152 | Ga0157376_10036268 | 3300014969 | Bacteria | 3994 |
| 153 | Ga0157376_10262303 | 3300014969 | Bacteria | 1619 |
| 154 | Ga0182007_10005930 | 3300015262 | Bacteria | 5305 |
| 155 | Ga0163161_10155119 | 3300017792 | Bacteria | 1743 |
| 156 | Ga0206353_10820691 | 3300020082 | Bacteria | 1438 |
| 157 | Ga0214544_1004900 | 3300021320 | Bacteria | 26442 |
| 158 | Ga0214542_1000773 | 3300021321 | Bacteria | 61121 |
| 159 | Ga0214545_1000546 | 3300021324 | Bacteria | 61121 |
| 160 | Ga0214543_1000740 | 3300021327 | Bacteria | 57975 |
| 161 | Ga0213876_10014871 | 3300021384 | Bacteria | 4125 |
| 162 | Ga0213876_10098826 | 3300021384 | Bacteria | 1547 |
| 163 | Ga0213871_10009634 | 3300021441 | Bacteria | 2169 |
| 164 | Ga0224712_10030568 | 3300022467 | Bacteria | 1945 |
| 165 | Ga0209677_100384 | 3300025253 | Bacteria | 27031 |
| 166 | Ga0209677_103265 | 3300025253 | Bacteria | 5392 |
| 167 | Ga0209233_1000823 | 3300025261 | Bacteria | 13758 |
| 168 | Ga0209233_1014119 | 3300025261 | Bacteria | 2260 |
| 169 | Ga0209455_1001474 | 3300025272 | Bacteria | 10580 |
| 170 | Ga0209455_1011596 | 3300025272 | Bacteria | 2160 |
| 171 | Ga0209564_1017567 | 3300025295 | Bacteria | 2779 |
| 172 | Ga0209758_1000117 | 3300025297 | Bacteria | 198325 |
| 173 | Ga0209758_1000715 | 3300025297 | Bacteria | 49020 |
| 174 | Ga0209758_1001613 | 3300025297 | Bacteria | 25735 |
| 175 | Ga0209758_1006716 | 3300025297 | Bacteria | 8110 |
| 176 | Ga0207426_1000223 | 3300025302 | Bacteria | 132636 |
| 177 | Ga0207426_1000649 | 3300025302 | Bacteria | 42959 |
| 178 | Ga0207426_1016531 | 3300025302 | Bacteria | 2646 |
| 179 | Ga0209257_1001759 | 3300025304 | Bacteria | 24004 |
| 180 | Ga0207692_10000620 | 3300025898 | Bacteria | 12475 |
| 181 | Ga0207710_10008225 | 3300025900 | Bacteria | 4403 |
| 182 | Ga0207710_10029729 | 3300025900 | Bacteria | 2380 |
| 183 | Ga0207647_10068869 | 3300025904 | Bacteria | 2140 |
| 184 | Ga0207699_10001377 | 3300025906 | Bacteria | 11576 |
| 185 | Ga0207684_10144845 | 3300025910 | Bacteria | 2043 |
| 186 | Ga0207654_10018072 | 3300025911 | Bacteria | 3697 |
| 187 | Ga0207654_10103305 | 3300025911 | Bacteria | 1760 |
| 188 | Ga0207707_10001119 | 3300025912 | Bacteria | 25478 |
| 189 | Ga0207707_10009404 | 3300025912 | Bacteria | 8478 |
| 190 | Ga0207707_10056126 | 3300025912 | Bacteria | 3426 |
| 191 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 192 | Ga0207695_10047532 | 3300025913 | Bacteria | 4540 |
| 193 | Ga0207695_10116825 | 3300025913 | Bacteria | 2641 |
| 194 | Ga0207671_10015795 | 3300025914 | Bacteria | 5892 |
| 195 | Ga0207693_10014092 | 3300025915 | Bacteria | 6438 |
| 196 | Ga0207693_10031462 | 3300025915 | Bacteria | 4192 |
| 197 | Ga0207693_10057497 | 3300025915 | Bacteria | 3048 |
| 198 | Ga0207663_10029199 | 3300025916 | Bacteria | 3236 |
| 199 | Ga0207660_10074503 | 3300025917 | Bacteria | 2478 |
| 200 | Ga0207649_10061877 | 3300025920 | Bacteria | 2358 |
| 201 | Ga0207649_10062221 | 3300025920 | Bacteria | 2352 |
| 202 | Ga0207652_10008928 | 3300025921 | Bacteria | 8077 |
| 203 | Ga0207652_10066764 | 3300025921 | Bacteria | 3118 |
| 204 | Ga0207652_10070721 | 3300025921 | Bacteria | 3031 |
| 205 | Ga0207652_10175078 | 3300025921 | Bacteria | 1927 |
| 206 | Ga0207694_10021479 | 3300025924 | Bacteria | 4890 |
| 207 | Ga0207694_10123521 | 3300025924 | Bacteria | 2069 |
| 208 | Ga0207700_10118035 | 3300025928 | Bacteria | 2146 |
| 209 | Ga0207664_10109515 | 3300025929 | Bacteria | 2295 |
| 210 | Ga0207706_10044304 | 3300025933 | Bacteria | 3944 |
| 211 | Ga0207686_10013907 | 3300025934 | Bacteria | 4465 |
| 212 | Ga0207709_10008694 | 3300025935 | Bacteria | 5605 |
| 213 | Ga0207670_10048617 | 3300025936 | Bacteria | 2832 |
| 214 | Ga0207704_10097160 | 3300025938 | Bacteria | 1952 |
| 215 | Ga0207665_10012662 | 3300025939 | Bacteria | 5546 |
| 216 | Ga0207711_10084305 | 3300025941 | Bacteria | 2781 |
| 217 | Ga0207689_10017899 | 3300025942 | Bacteria | 5984 |
| 218 | Ga0207689_10023971 | 3300025942 | Bacteria | 5119 |
| 219 | Ga0207661_10000190 | 3300025944 | Bacteria | 39991 |
| 220 | Ga0207661_10062281 | 3300025944 | Bacteria | 3017 |
| 221 | Ga0207661_10084952 | 3300025944 | Bacteria | 2623 |
| 222 | Ga0207679_10112374 | 3300025945 | Bacteria | 2153 |
| 223 | Ga0207679_10155920 | 3300025945 | Bacteria | 1865 |
| 224 | Ga0207667_10065228 | 3300025949 | Bacteria | 3799 |
| 225 | Ga0207667_10219916 | 3300025949 | Bacteria | 1946 |
| 226 | Ga0207668_10041202 | 3300025972 | Bacteria | 3120 |
| 227 | Ga0207668_10055435 | 3300025972 | Bacteria | 2755 |
| 228 | Ga0207668_10093154 | 3300025972 | Bacteria | 2219 |
| 229 | Ga0207658_10073091 | 3300025986 | Bacteria | 2602 |
| 230 | Ga0207677_10044452 | 3300026023 | Bacteria | 2960 |
| 231 | Ga0207703_10015770 | 3300026035 | Bacteria | 5893 |
| 232 | Ga0207639_10134673 | 3300026041 | Bacteria | 2050 |
| 233 | Ga0207639_10236907 | 3300026041 | Bacteria | 1585 |
| 234 | Ga0207678_10016800 | 3300026067 | Bacteria | 6428 |
| 235 | Ga0207678_10035083 | 3300026067 | Bacteria | 4367 |
| 236 | Ga0207678_10061951 | 3300026067 | Bacteria | 3217 |
| 237 | Ga0207678_10075144 | 3300026067 | Bacteria | 2895 |
| 238 | Ga0207678_10076272 | 3300026067 | Bacteria | 2871 |
| 239 | Ga0207678_10091313 | 3300026067 | Bacteria | 2603 |
| 240 | Ga0207678_10139406 | 3300026067 | Bacteria | 2069 |
| 241 | Ga0207708_10029928 | 3300026075 | Bacteria | 4129 |
| 242 | Ga0207702_10000052 | 3300026078 | Bacteria | 137784 |
| 243 | Ga0207702_10031891 | 3300026078 | Bacteria | 4396 |
| 244 | Ga0207702_10058264 | 3300026078 | Bacteria | 3287 |
| 245 | Ga0207641_10133326 | 3300026088 | Bacteria | 2233 |
| 246 | Ga0207648_10027354 | 3300026089 | Bacteria | 5063 |
| 247 | Ga0207674_10104491 | 3300026116 | Bacteria | 2811 |
| 248 | Ga0207674_10114603 | 3300026116 | Bacteria | 2667 |
| 249 | Ga0207675_100016461 | 3300026118 | Bacteria | 6906 |
| 250 | Ga0207675_100112461 | 3300026118 | Bacteria | 2570 |
| 251 | Ga0207675_100369869 | 3300026118 | Bacteria | 1408 |
| 252 | Ga0207683_10032325 | 3300026121 | Bacteria | 4546 |
| 253 | Ga0207683_10044240 | 3300026121 | Bacteria | 3893 |
| 254 | Ga0207683_10062763 | 3300026121 | Bacteria | 3273 |
| 255 | Ga0207683_10112080 | 3300026121 | Bacteria | 2443 |
| 256 | Ga0207698_10030894 | 3300026142 | Bacteria | 3859 |
| 257 | Ga0207698_10133561 | 3300026142 | Bacteria | 2125 |
| 258 | Ga0207698_10140678 | 3300026142 | Bacteria | 2079 |
| 259 | Ga0209389_1000028 | 3300027296 | Bacteria | 140401 |
| 260 | Ga0209389_1000056 | 3300027296 | Bacteria | 107673 |
| 261 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 262 | Ga0209589_1000034 | 3300027357 | Bacteria | 138086 |
| 263 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 264 | Ga0209489_100009 | 3300027361 | Bacteria | 263873 |
| 265 | Ga0209489_102012 | 3300027361 | Bacteria | 41849 |
| 266 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 267 | Ga0209700_100022 | 3300027363 | Bacteria | 229977 |
| 268 | Ga0268266_10000519 | 3300028379 | Bacteria | 54346 |
| 269 | Ga0268266_10003020 | 3300028379 | Bacteria | 17288 |
| 270 | Ga0268266_10044108 | 3300028379 | Bacteria | 3811 |
| 271 | Ga0268266_10090525 | 3300028379 | Bacteria | 2681 |
| 272 | Ga0268265_10080618 | 3300028380 | Bacteria | 2567 |
| 273 | Ga0268265_10180179 | 3300028380 | Bacteria | 1814 |
| 274 | Ga0268265_10271288 | 3300028380 | Bacteria | 1513 |
| 275 | Ga0268264_10103703 | 3300028381 | Bacteria | 2477 |
| 276 | Ga0307517_10000248 | 3300028786 | Bacteria | 92084 |
| 277 | Ga0307517_10136617 | 3300028786 | Bacteria | 1740 |
| 278 | Ga0265330_10020141 | 3300031235 | Bacteria | 3049 |
| 279 | Ga0265325_10067907 | 3300031241 | Bacteria | 1795 |
| 280 | Ga0265329_10035515 | 3300031242 | Bacteria | 1608 |
| 281 | Ga0265339_10013152 | 3300031249 | Bacteria | 5023 |
| 282 | Ga0265339_10087431 | 3300031249 | Bacteria | 1638 |
| 283 | Ga0265339_10088861 | 3300031249 | Bacteria | 1622 |
| 284 | Ga0265339_10095190 | 3300031249 | Bacteria | 1556 |
| 285 | Ga0265331_10030223 | 3300031250 | Bacteria | 2698 |
| 286 | Ga0265316_10158753 | 3300031344 | Bacteria | 1691 |
| 287 | Ga0307513_10040669 | 3300031456 | Bacteria | 5139 |
| 288 | Ga0307509_10038225 | 3300031507 | Bacteria | 5238 |
| 289 | Ga0307408_100067422 | 3300031548 | Bacteria | 2632 |
| 290 | Ga0265313_10071475 | 3300031595 | Bacteria | 1597 |
| 291 | Ga0307508_10072105 | 3300031616 | Bacteria | 3028 |
| 292 | Ga0265314_10004420 | 3300031711 | Bacteria | 13054 |
| 293 | Ga0265314_10053234 | 3300031711 | Bacteria | 2808 |
| 294 | Ga0307407_10123247 | 3300031903 | Bacteria | 1647 |
| 295 | Ga0307409_100212668 | 3300031995 | Bacteria | 1739 |
| 296 | Ga0307510_10005609 | 3300033180 | Bacteria | 14962 |
| 297 | Ga0307510_10012266 | 3300033180 | Bacteria | 10161 |
| 298 | Ga0307510_10055497 | 3300033180 | Bacteria | 4137 |
| 299 | Ga0307510_10056357 | 3300033180 | Bacteria | 4094 |
| 300 | Ga0307510_10204549 | 3300033180 | Bacteria | 1504 |
| 301 | Ga0373926_0039935 | 3300035083 | Bacteria | 1674 |
| 302 | Ga0373944_0024045 | 3300035089 | Bacteria | 1782 |
| 303 | Ga0373923_0027627 | 3300035111 | Bacteria | 2264 |
| 304 | Ga0373936_0005553 | 3300035113 | Bacteria | 4760 |
| 305 | Ga0373936_0032591 | 3300035113 | Bacteria | 2062 |
| 306 | Ga0373945_0016860 | 3300035116 | Bacteria | 2469 |
| 307 | Ga0373953_0002162 | 3300035117 | Bacteria | 5882 |
| 308 | Ga0373954_0012905 | 3300035118 | Bacteria | 3720 |
| 309 | Ga0373954_0018705 | 3300035118 | Bacteria | 3121 |
| 310 | Ga0373956_0004523 | 3300035119 | Bacteria | 5554 |
| 311 | Ga0373943_0008287 | 3300035170 | Bacteria | 4665 |
| 312 | Ga0373946_0006757 | 3300035171 | Bacteria | 4168 |
| 313 | Ga0373955_0000335 | 3300035172 | Bacteria | 19651 |
| 314 | Ga0373955_0022709 | 3300035172 | Bacteria | 3186 |
| 315 | Ga0373955_0126986 | 3300035172 | Bacteria | 1486 |
| 316 | Ga0373924_0024544 | 3300035410 | Bacteria | 2376 |
| 317 | Ga0373924_0036480 | 3300035410 | Bacteria | 1998 |
| 318 | Ga0373935_0001283 | 3300035692 | Bacteria | 13847 |
| 319 | Ga0373927_0000515 | 3300035695 | Bacteria | 29473 |
| 320 | Ga0373933_0000106 | 3300035724 | Bacteria | 53181 |
| 321 | Ga0373933_0034579 | 3300035724 | Bacteria | 2945 |
| 322 | Ga0373947_0004303 | 3300035725 | Bacteria | 8362 |
| 323 | Ga0373947_0026121 | 3300035725 | Bacteria | 3409 |
| 324 | Ga0373947_0050799 | 3300035725 | Bacteria | 2493 |
| 325 | Ga0373937_0042654 | 3300036401 | Bacteria | 4139 |
| 326 | Ga0373937_0272472 | 3300036401 | Bacteria | 1598 |
| 327 | Ga0373925_0001116 | 3300037068 | Bacteria | 23846 |
| 328 | Ga0373925_0073594 | 3300037068 | Bacteria | 2586 |
| 329 | Ga0373925_0186396 | 3300037068 | Bacteria | 1645 |
| 330 | Ga0373925_0242119 | 3300037068 | Bacteria | 1445 |
| 331 | Ga0395900_0019004 | 3300037418 | Bacteria | 7008 |
| 332 | Ga0395900_0039621 | 3300037418 | Bacteria | 4854 |
| 333 | Ga0395900_0081097 | 3300037418 | Bacteria | 3334 |
| 334 | Ga0395898_0006007 | 3300037466 | Bacteria | 13037 |
| 335 | Ga0395898_0040790 | 3300037466 | Bacteria | 4588 |
| 336 | Ga0395898_0076659 | 3300037466 | Bacteria | 3228 |
| 337 | Ga0395898_0184223 | 3300037466 | Bacteria | 1995 |
| 338 | Ga0395905_0013314 | 3300037471 | Bacteria | 7886 |
| 339 | Ga0436364_0336775 | 3300037853 | Bacteria | 4540 |
| 340 | Ga0436364_0751694 | 3300037853 | Bacteria | 5851 |
| 341 | Ga0395901_0082268 | 3300038443 | Bacteria | 3364 |
| 342 | Ga0436365_0474195 | 3300039437 | Bacteria | 5476 |
| 343 | Ga0436365_1060223 | 3300039437 | Bacteria | 3732 |
| 344 | Ga0436365_1421557 | 3300039437 | Bacteria | 1461 |
| 345 | Ga0436365_1919740 | 3300039437 | Bacteria | 3428 |
| 346 | Ga0436360_1353130 | 3300039438 | Bacteria | 7648 |
| 347 | Ga0436361_0895020 | 3300039447 | Bacteria | 2365 |
| 348 | Ga0436362_0094313 | 3300039453 | Bacteria | 3989 |
| 349 | Ga0436362_1189097 | 3300039453 | Bacteria | 2464 |
| 350 | Ga0439458_0016549 | 3300042157 | Bacteria | 1678 |
| 351 | Ga0466972_0000110 | 3300044658 | Bacteria | 71304 |
| 352 | Ga0466972_0003331 | 3300044658 | Bacteria | 7968 |
| 353 | Ga0466965_0008548 | 3300044683 | Bacteria | 4737 |
| 354 | Ga0466966_0080251 | 3300044684 | Bacteria | 2033 |
| 355 | Ga0466963_0003214 | 3300044694 | Bacteria | 9296 |
| 356 | Ga0466957_0013617 | 3300044842 | Bacteria | 4721 |
| 357 | Ga0466957_0016857 | 3300044842 | Bacteria | 4275 |
| 358 | Ga0466957_0187640 | 3300044842 | Bacteria | 1353 |
| 359 | Ga0466959_0053736 | 3300045049 | Bacteria | 2944 |
| 360 | Ga0466967_0015425 | 3300045976 | Bacteria | 5989 |
| 361 | Ga0466967_0062382 | 3300045976 | Bacteria | 3308 |
| 362 | Ga0466967_0101911 | 3300045976 | Bacteria | 2625 |
| 363 | Ga0495592_0006367 | 3300046454 | Bacteria | 8792 |
| 364 | Ga0495592_0009951 | 3300046454 | Bacteria | 7161 |
| 365 | Ga0495592_0036210 | 3300046454 | Bacteria | 3717 |
| 366 | Ga0495603_0000156 | 3300046455 | Bacteria | 34369 |
| 367 | Ga0495603_0022445 | 3300046455 | Bacteria | 3820 |
| 368 | Ga0495603_0080171 | 3300046455 | Bacteria | 1913 |
| 369 | Ga0495629_0000297 | 3300046459 | Bacteria | 42433 |
| 370 | Ga0495629_0001966 | 3300046459 | Bacteria | 16017 |
| 371 | Ga0495629_0002353 | 3300046459 | Bacteria | 14564 |
| 372 | Ga0495629_0026149 | 3300046459 | Bacteria | 4147 |
| 373 | Ga0495629_0106504 | 3300046459 | Bacteria | 1956 |
| 374 | Ga0495638_0005955 | 3300046460 | Bacteria | 8948 |
| 375 | Ga0495638_0080116 | 3300046460 | Bacteria | 1984 |
| 376 | Ga0495641_0016704 | 3300046461 | Bacteria | 3856 |
| 377 | Ga0495651_0003593 | 3300046462 | Bacteria | 11900 |
| 378 | Ga0495651_0015887 | 3300046462 | Bacteria | 5828 |
| 379 | Ga0495651_0073121 | 3300046462 | Bacteria | 2603 |
| 380 | Ga0495580_0004564 | 3300046472 | Bacteria | 11624 |
| 381 | Ga0495582_0000087 | 3300046473 | Bacteria | 47529 |
| 382 | Ga0495639_0000153 | 3300046475 | Bacteria | 35461 |
| 383 | Ga0495639_0007468 | 3300046475 | Bacteria | 4692 |
| 384 | Ga0495639_0019704 | 3300046475 | Bacteria | 2944 |
| 385 | Ga0495662_0004971 | 3300046476 | Bacteria | 6655 |
| 386 | Ga0495664_0005395 | 3300046477 | Bacteria | 7020 |
| 387 | Ga0495664_0017781 | 3300046477 | Bacteria | 4065 |
| 388 | Ga0495664_0091357 | 3300046477 | Bacteria | 1830 |
| 389 | Ga0495584_0101389 | 3300046491 | Bacteria | 1455 |
| 390 | Ga0495594_0047103 | 3300046499 | Bacteria | 2368 |
| 391 | Ga0495606_0001387 | 3300046507 | Bacteria | 32754 |
| 392 | Ga0495606_0013271 | 3300046507 | Bacteria | 6528 |
| 393 | Ga0495608_0025938 | 3300046511 | Bacteria | 4000 |
| 394 | Ga0495608_0033974 | 3300046511 | Bacteria | 3444 |
| 395 | Ga0495608_0087279 | 3300046511 | Bacteria | 2021 |
| 396 | Ga0495610_0042140 | 3300046512 | Bacteria | 2286 |
| 397 | Ga0495618_0037730 | 3300046514 | Bacteria | 3035 |
| 398 | Ga0495618_0039213 | 3300046514 | Bacteria | 2978 |
| 399 | Ga0495618_0053942 | 3300046514 | Bacteria | 2542 |
| 400 | Ga0495620_0041331 | 3300046515 | Bacteria | 2023 |
| 401 | Ga0495628_0039901 | 3300046516 | Bacteria | 3754 |
| 402 | Ga0495628_0079926 | 3300046516 | Bacteria | 2542 |
| 403 | Ga0495628_0104296 | 3300046516 | Bacteria | 2185 |
| 404 | Ga0495628_0208444 | 3300046516 | Bacteria | 1471 |
| 405 | Ga0495630_0000735 | 3300046517 | Bacteria | 23119 |
| 406 | Ga0495630_0040595 | 3300046517 | Bacteria | 3478 |
| 407 | Ga0495631_0019230 | 3300046518 | Bacteria | 3205 |
| 408 | Ga0495632_0044841 | 3300046519 | Bacteria | 2205 |
| 409 | Ga0495644_0028898 | 3300046523 | Bacteria | 2097 |
| 410 | Ga0495648_0003807 | 3300046524 | Bacteria | 13105 |
| 411 | Ga0495648_0014960 | 3300046524 | Bacteria | 5652 |
| 412 | Ga0495648_0036506 | 3300046524 | Bacteria | 3169 |
| 413 | Ga0495666_0017403 | 3300046526 | Bacteria | 3580 |
| 414 | Ga0495652_0003411 | 3300046529 | Bacteria | 15714 |
| 415 | Ga0495652_0023747 | 3300046529 | Bacteria | 5434 |
| 416 | Ga0495652_0035587 | 3300046529 | Bacteria | 4333 |
| 417 | Ga0495665_0000117 | 3300046531 | Bacteria | 37802 |
| 418 | Ga0495665_0008372 | 3300046531 | Bacteria | 5609 |
| 419 | Ga0495640_0002597 | 3300046533 | Bacteria | 14524 |
| 420 | Ga0495640_0046425 | 3300046533 | Bacteria | 3009 |
| 421 | Ga0495587_0001788 | 3300046536 | Bacteria | 14356 |
| 422 | Ga0495645_0012372 | 3300046543 | Bacteria | 6013 |
| 423 | Ga0495645_0056154 | 3300046543 | Bacteria | 2859 |
| 424 | Ga0495622_0002118 | 3300046557 | Bacteria | 9668 |
| 425 | Ga0495667_0022986 | 3300046559 | Bacteria | 4201 |
| 426 | Ga0495667_0049104 | 3300046559 | Bacteria | 2785 |
| 427 | Ga0495667_0078753 | 3300046559 | Bacteria | 2143 |
| 428 | Ga0495667_0124882 | 3300046559 | Bacteria | 1661 |
| 429 | Ga0495667_0175298 | 3300046559 | Bacteria | 1377 |
| 430 | Ga0495656_0026908 | 3300046615 | Bacteria | 2293 |
| 431 | Ga0495656_0034975 | 3300046615 | Bacteria | 2061 |
| 432 | Ga0495668_0022219 | 3300046616 | Bacteria | 3627 |
| 433 | Ga0495634_0009937 | 3300046642 | Bacteria | 6992 |
| 434 | Ga0495634_0041078 | 3300046642 | Bacteria | 3142 |
| 435 | Ga0495611_0018358 | 3300046648 | Bacteria | 2999 |
| 436 | Ga0495611_0089746 | 3300046648 | Bacteria | 1420 |
| 437 | Ga0495625_0029766 | 3300046660 | Bacteria | 4081 |
| 438 | Ga0495625_0157597 | 3300046660 | Bacteria | 1523 |
| 439 | Ga0495635_0011937 | 3300046663 | Bacteria | 6085 |
| 440 | Ga0495635_0016105 | 3300046663 | Bacteria | 5221 |
| 441 | Ga0495635_0054427 | 3300046663 | Bacteria | 2756 |
| 442 | Ga0495635_0056628 | 3300046663 | Bacteria | 2698 |
| 443 | Ga0495635_0117662 | 3300046663 | Bacteria | 1813 |
| 444 | Ga0495657_0002601 | 3300046675 | Bacteria | 15103 |
| 445 | Ga0495657_0008132 | 3300046675 | Bacteria | 8041 |
| 446 | Ga0495623_0001847 | 3300046679 | Bacteria | 14193 |
| 447 | Ga0495646_0004576 | 3300046680 | Bacteria | 8718 |
| 448 | Ga0495646_0027733 | 3300046680 | Bacteria | 3550 |
| 449 | Ga0495646_0087452 | 3300046680 | Bacteria | 1806 |
| 450 | Ga0495647_0000365 | 3300046681 | Bacteria | 12760 |
| 451 | Ga0495647_0005771 | 3300046681 | Bacteria | 4070 |
| 452 | Ga0495658_0000644 | 3300046683 | Bacteria | 18891 |
| 453 | Ga0495658_0086515 | 3300046683 | Bacteria | 1849 |
| 454 | Ga0495669_0004390 | 3300046684 | Bacteria | 5821 |
| 455 | Ga0495613_0009744 | 3300046689 | Bacteria | 7140 |
| 456 | Ga0495613_0046869 | 3300046689 | Bacteria | 3195 |
| 457 | Ga0495613_0059264 | 3300046689 | Bacteria | 2807 |
| 458 | Ga0495624_0001012 | 3300046690 | Bacteria | 22250 |
| 459 | Ga0495624_0028607 | 3300046690 | Bacteria | 3640 |
| 460 | Ga0495624_0041473 | 3300046690 | Bacteria | 2943 |
| 461 | Ga0495670_0070693 | 3300046691 | Bacteria | 1766 |
| 462 | Ga0495649_0033464 | 3300046694 | Bacteria | 2829 |
| 463 | Ga0495589_0043201 | 3300046794 | Bacteria | 2244 |
| 464 | Ga0495600_0000869 | 3300046809 | Bacteria | 16143 |
| 465 | Ga0495600_0006623 | 3300046809 | Bacteria | 7057 |
| 466 | Ga0495581_0000543 | 3300047315 | Bacteria | 19442 |
| 467 | Ga0495604_0000751 | 3300047317 | Bacteria | 27241 |
| 468 | Ga0495604_0078967 | 3300047317 | Bacteria | 2468 |
| 469 | Ga0495604_0127905 | 3300047317 | Bacteria | 1829 |
| 470 | Ga0495674_0000177 | 3300047319 | Bacteria | 50030 |
| 471 | Ga0495674_0004259 | 3300047319 | Bacteria | 13781 |
| 472 | Ga0495674_0020467 | 3300047319 | Bacteria | 6123 |
| 473 | Ga0495674_0064002 | 3300047319 | Bacteria | 3198 |
| 474 | Ga0495674_0127546 | 3300047319 | Bacteria | 2145 |
| 475 | Ga0495672_0057036 | 3300047320 | Bacteria | 2269 |
| 476 | Ga0495676_0017162 | 3300047321 | Bacteria | 6406 |
| 477 | Ga0495676_0117392 | 3300047321 | Bacteria | 1941 |
| 478 | Ga0495680_0001530 | 3300047322 | Bacteria | 24762 |
| 479 | Ga0495683_0073021 | 3300047323 | Bacteria | 1683 |
| 480 | Ga0495675_0025225 | 3300047444 | Bacteria | 3790 |
| 481 | Ga0495685_015376 | 3300047447 | Bacteria | 2609 |
| 482 | Ga0495673_0011890 | 3300047469 | Bacteria | 4650 |
| 483 | Ga0495684_0002187 | 3300047471 | Bacteria | 15656 |
| 484 | Ga0495684_0013598 | 3300047471 | Bacteria | 6267 |
| 485 | Ga0495684_0023802 | 3300047471 | Bacteria | 4709 |
| 486 | Ga0495684_0035668 | 3300047471 | Bacteria | 3813 |
| 487 | Ga0495686_0021609 | 3300047472 | Bacteria | 4269 |
| 488 | Ga0495686_0090603 | 3300047472 | Bacteria | 1857 |
| 489 | Ga0495593_0000156 | 3300047673 | Bacteria | 34308 |
| 490 | Ga0495593_0013164 | 3300047673 | Bacteria | 4723 |
| 491 | Ga0495602_0046473 | 3300048088 | Bacteria | 3921 |
| 492 | Ga0495602_0081730 | 3300048088 | Bacteria | 2715 |
| 493 | Ga0495602_0235101 | 3300048088 | Bacteria | 1374 |
| 494 | Ga0495614_0012177 | 3300048089 | Bacteria | 3776 |
| 495 | Ga0495626_0073230 | 3300048091 | Bacteria | 1535 |
| 496 | Ga0496100_0021481 | 3300048903 | Bacteria | 3888 |
| 497 | Ga0496100_0069060 | 3300048903 | Bacteria | 2352 |
| 498 | Ga0496100_0072789 | 3300048903 | Bacteria | 2298 |
| 499 | Ga0496101_0007180 | 3300048904 | Bacteria | 7207 |
| 500 | Ga0496101_0227745 | 3300048904 | Bacteria | 1448 |
| 501 | Ga0496102_0010384 | 3300048905 | Bacteria | 8013 |
| 502 | Ga0496102_0029354 | 3300048905 | Bacteria | 4922 |
| 503 | Ga0496102_0070377 | 3300048905 | Bacteria | 3212 |
| 504 | Ga0496102_0074351 | 3300048905 | Bacteria | 3123 |
| 505 | Ga0496103_0050663 | 3300048906 | Bacteria | 2568 |
| 506 | Ga0496104_0010798 | 3300048907 | Bacteria | 8169 |
| 507 | Ga0496104_0032296 | 3300048907 | Bacteria | 4871 |
| 508 | Ga0496104_0060567 | 3300048907 | Bacteria | 3586 |
| 509 | Ga0496105_0001079 | 3300048908 | Bacteria | 18889 |
| 510 | Ga0496105_0026645 | 3300048908 | Bacteria | 4718 |
| 511 | Ga0496105_0124205 | 3300048908 | Bacteria | 2128 |
| 512 | Ga0496106_0006989 | 3300048909 | Bacteria | 8338 |
| 513 | Ga0496106_0033779 | 3300048909 | Bacteria | 3818 |
| 514 | Ga0496106_0049553 | 3300048909 | Bacteria | 3164 |
| 515 | Ga0496106_0065373 | 3300048909 | Bacteria | 2769 |
| 516 | Ga0496107_0056443 | 3300048910 | Bacteria | 2837 |
| 517 | Ga0496107_0163708 | 3300048910 | Bacteria | 1649 |
| 518 | Ga0496108_0013601 | 3300048911 | Bacteria | 6642 |
| 519 | Ga0496108_0016621 | 3300048911 | Bacteria | 6009 |
| 520 | Ga0496108_0060904 | 3300048911 | Bacteria | 3176 |
| 521 | Ga0496108_0086966 | 3300048911 | Bacteria | 2654 |
| 522 | Ga0496108_0125987 | 3300048911 | Bacteria | 2199 |
| 523 | Ga0496109_0035982 | 3300048912 | Bacteria | 4469 |
| 524 | Ga0496110_0006206 | 3300048913 | Bacteria | 9434 |
| 525 | Ga0496110_0067614 | 3300048913 | Bacteria | 3162 |
| 526 | Ga0496110_0146203 | 3300048913 | Bacteria | 2138 |
| 527 | Ga0496111_0035227 | 3300048914 | Bacteria | 3576 |
| 528 | Ga0496111_0037826 | 3300048914 | Bacteria | 3455 |
| 529 | Ga0496111_0084233 | 3300048914 | Bacteria | 2324 |
| 530 | Ga0496112_0000057 | 3300048915 | Bacteria | 77700 |
| 531 | Ga0496112_0051942 | 3300048915 | Bacteria | 4022 |
| 532 | Ga0496113_0021724 | 3300048916 | Bacteria | 4530 |
| 533 | Ga0496113_0021863 | 3300048916 | Bacteria | 4516 |
| 534 | Ga0496113_0048355 | 3300048916 | Bacteria | 3164 |
| 535 | Ga0496114_0010492 | 3300048917 | Bacteria | 7372 |
| 536 | Ga0496114_0054300 | 3300048917 | Bacteria | 3341 |
| 537 | Ga0496114_0317929 | 3300048917 | Bacteria | 1375 |
| 538 | Ga0496115_0003709 | 3300048918 | Bacteria | 10987 |
| 539 | Ga0496115_0010430 | 3300048918 | Bacteria | 6943 |
| 540 | Ga0496115_0023069 | 3300048918 | Bacteria | 4828 |
| 541 | Ga0496115_0045050 | 3300048918 | Bacteria | 3521 |
| 542 | Ga0496115_0062901 | 3300048918 | Bacteria | 2994 |
| 543 | Ga0496115_0187762 | 3300048918 | Bacteria | 1708 |
| 544 | Ga0496116_0059844 | 3300048919 | Bacteria | 2474 |
| 545 | Ga0496118_0054933 | 3300048921 | Bacteria | 3011 |
| 546 | Ga0496118_0072960 | 3300048921 | Bacteria | 2462 |
| 547 | Ga0496118_0073569 | 3300048921 | Bacteria | 2447 |
| 548 | Ga0496120_0019659 | 3300048923 | Bacteria | 4314 |
| 549 | Ga0496121_0000287 | 3300048924 | Bacteria | 104774 |
| 550 | Ga0496121_0011016 | 3300048924 | Bacteria | 10094 |
| 551 | Ga0496121_0036889 | 3300048924 | Bacteria | 4350 |
| 552 | Ga0496121_0063418 | 3300048924 | Bacteria | 3019 |
| 553 | Ga0496121_0080134 | 3300048924 | Bacteria | 2590 |
| 554 | Ga0496124_0051160 | 3300048927 | Bacteria | 3516 |
| 555 | Ga0496124_0094198 | 3300048927 | Bacteria | 2436 |
| 556 | Ga0496125_0000654 | 3300048928 | Bacteria | 57851 |
| 557 | Ga0496125_0039845 | 3300048928 | Bacteria | 4038 |
| 558 | Ga0496125_0083438 | 3300048928 | Bacteria | 2431 |
| 559 | Ga0496126_0001378 | 3300048929 | Bacteria | 38419 |
| 560 | Ga0496126_0023389 | 3300048929 | Bacteria | 5989 |
| 561 | Ga0496126_0028392 | 3300048929 | Bacteria | 5333 |
| 562 | Ga0496126_0028525 | 3300048929 | Bacteria | 5316 |
| 563 | Ga0496126_0034253 | 3300048929 | Bacteria | 4771 |
| 564 | Ga0496126_0050313 | 3300048929 | Bacteria | 3798 |
| 565 | Ga0496126_0079318 | 3300048929 | Bacteria | 2906 |
| 566 | Ga0496126_0129558 | 3300048929 | Bacteria | 2181 |
| 567 | Ga0496126_0193331 | 3300048929 | Bacteria | 1722 |
| 568 | Ga0496126_0207872 | 3300048929 | Bacteria | 1649 |
| 569 | Ga0496126_0233560 | 3300048929 | Bacteria | 1540 |
| 570 | Ga0495678_030305 | 3300049459 | Bacteria | 2265 |
| 571 | Ga0501032_0058911 | 3300049569 | Bacteria | 2577 |
| 572 | Ga0501034_0139494 | 3300049571 | Bacteria | 2404 |
| 573 | Ga0501037_0112815 | 3300049573 | Bacteria | 1958 |
| 574 | Ga0501038_0029631 | 3300049574 | Bacteria | 4847 |
| 575 | Ga0501038_0203292 | 3300049574 | Bacteria | 1588 |
| 576 | Ga0501042_0091096 | 3300049578 | Bacteria | 2188 |
| 577 | Ga0501043_0159584 | 3300049579 | Bacteria | 1762 |
| 578 | Ga0501046_0084995 | 3300049580 | Bacteria | 2440 |
| 579 | Ga0501047_0041969 | 3300049581 | Bacteria | 4421 |
| 580 | Ga0501067_0096608 | 3300049583 | Bacteria | 1640 |
| 581 | Ga0501070_0019833 | 3300049586 | Bacteria | 5638 |
| 582 | Ga0501073_0029828 | 3300049589 | Bacteria | 3897 |
| 583 | Ga0501073_0055687 | 3300049589 | Bacteria | 2766 |
| 584 | Ga0501074_0053891 | 3300049590 | Bacteria | 2901 |
| 585 | Ga0501076_0203126 | 3300049592 | Bacteria | 1619 |
| 586 | Ga0501080_0006437 | 3300049742 | Bacteria | 10542 |
| 587 | Ga0501080_0027935 | 3300049742 | Bacteria | 5246 |
| 588 | Ga0501044_0075584 | 3300049823 | Bacteria | 3420 |
| 589 | Ga0501045_0037272 | 3300049824 | Bacteria | 3533 |
| 590 | nmdc:mga03n38_569_c1 | 3300050490 | Bacteria | 9359 |
| 591 | nmdc:mga0yw44_136181_c1 | 3300050492 | Bacteria | 1593 |
| 592 | nmdc:mga0yw44_4755_c1 | 3300050492 | Bacteria | 6293 |
| 593 | nmdc:mga0k408_132838_c1 | 3300050493 | Bacteria | 1478 |
| 594 | nmdc:mga06z11_20219_c1 | 3300050494 | Bacteria | 3074 |
| 595 | nmdc:mga07m45_12920_c1 | 3300050496 | Bacteria | 1408 |
| 596 | nmdc:mga07m45_27846_c1 | 3300050496 | Bacteria | 3117 |
| 597 | Ga0495601_0034886 | 3300053077 | Bacteria | 3139 |
| 598 | Ga0495601_0057604 | 3300053077 | Bacteria | 2461 |
| 599 | Ga0495601_0105705 | 3300053077 | Bacteria | 1820 |
| 600 | Ga0495612_0023956 | 3300053078 | Bacteria | 2451 |
| 601 | Ga0500635_0008657 | 3300053080 | Bacteria | 2797 |
| 602 | Ga0500635_0015857 | 3300053080 | Bacteria | 2231 |
| 603 | Ga0495595_0009305 | 3300053084 | Bacteria | 4059 |
| 604 | Ga0495595_0051750 | 3300053084 | Bacteria | 1904 |
| 605 | Ga0495619_0014155 | 3300053085 | Bacteria | 5037 |
| 606 | Ga0500578_0094824 | 3300053086 | Bacteria | 1893 |
| 607 | Ga0500643_000095 | 3300053087 | Bacteria | 92535 |
| 608 | Ga0500651_0001950 | 3300053093 | Bacteria | 10674 |
| 609 | Ga0500651_0079684 | 3300053093 | Bacteria | 2029 |
| 610 | Ga0500566_0000035 | 3300053094 | Bacteria | 69457 |
| 611 | Ga0500566_0000228 | 3300053094 | Bacteria | 29965 |
| 612 | Ga0500640_000054 | 3300053095 | Bacteria | 17851 |
| 613 | Ga0500641_0006106 | 3300053096 | Bacteria | 4269 |
| 614 | Ga0500555_001063 | 3300053103 | Bacteria | 9241 |
| 615 | Ga0500557_000117 | 3300053105 | Bacteria | 22427 |
| 616 | Ga0500569_000782 | 3300053109 | Bacteria | 5570 |
| 617 | Ga0500572_000122 | 3300053111 | Bacteria | 26114 |
| 618 | Ga0500572_001570 | 3300053111 | Bacteria | 6081 |
| 619 | Ga0500595_000651 | 3300053119 | Bacteria | 20888 |
| 620 | Ga0500595_000743 | 3300053119 | Bacteria | 19196 |
| 621 | Ga0500595_009830 | 3300053119 | Bacteria | 3840 |
| 622 | Ga0500595_011238 | 3300053119 | Bacteria | 3515 |
| 623 | Ga0500595_015038 | 3300053119 | Bacteria | 2917 |
| 624 | Ga0500595_024553 | 3300053119 | Bacteria | 2103 |
| 625 | Ga0500642_0002741 | 3300053130 | Bacteria | 5221 |
| 626 | Ga0500642_0013901 | 3300053130 | Bacteria | 2977 |
| 627 | Ga0500642_0043444 | 3300053130 | Bacteria | 1952 |
| 628 | Ga0500655_005578 | 3300053133 | Bacteria | 2267 |
| 629 | Ga0500559_0001632 | 3300053136 | Bacteria | 12429 |
| 630 | Ga0500559_0001963 | 3300053136 | Bacteria | 11120 |
| 631 | Ga0500559_0011974 | 3300053136 | Bacteria | 3696 |
| 632 | Ga0500564_046065 | 3300053138 | Bacteria | 2000 |
| 633 | Ga0500568_0004068 | 3300053139 | Bacteria | 7918 |
| 634 | Ga0500568_0053547 | 3300053139 | Bacteria | 1581 |
| 635 | Ga0500577_0010289 | 3300053142 | Bacteria | 2749 |
| 636 | Ga0500590_009170 | 3300053148 | Bacteria | 4969 |
| 637 | Ga0500603_001828 | 3300053150 | Bacteria | 4768 |
| 638 | Ga0500620_002550 | 3300053155 | Bacteria | 3701 |
| 639 | Ga0500622_0007366 | 3300053156 | Bacteria | 6255 |
| 640 | Ga0500627_0050356 | 3300053158 | Bacteria | 1814 |
| 641 | Ga0500630_000187 | 3300053159 | Bacteria | 23623 |
| 642 | Ga0500634_0058506 | 3300053161 | Bacteria | 2053 |
| 643 | Ga0500638_000347 | 3300053162 | Bacteria | 10652 |
| 644 | Ga0500638_018935 | 3300053162 | Bacteria | 3220 |
| 645 | Ga0500639_000038 | 3300053163 | Bacteria | 65317 |
| 646 | Ga0500639_046351 | 3300053163 | Bacteria | 2273 |
| 647 | Ga0500636_0000157 | 3300053177 | Bacteria | 35453 |
| 648 | Ga0500636_0086178 | 3300053177 | Bacteria | 1804 |
| 649 | Ga0500637_0000502 | 3300053178 | Bacteria | 15181 |
| 650 | Ga0500637_0000714 | 3300053178 | Bacteria | 13261 |
| 651 | Ga0500576_028447 | 3300053725 | Bacteria | 2547 |
| 652 | Ga0500625_022516 | 3300053729 | Bacteria | 2975 |
| 653 | Ga0500645_002932 | 3300053730 | Bacteria | 7262 |
| 654 | Ga0500609_001193 | 3300053731 | Bacteria | 3858 |
| 655 | Ga0500596_008841 | 3300053735 | Bacteria | 1595 |
| 656 | Ga0500601_000133 | 3300053737 | Bacteria | 15043 |
| 657 | Ga0500661_001633 | 3300055283 | Bacteria | 4228 |
| 658 | Ga0501082_0052818 | 3300060353 | Bacteria | 3503 |
| 659 | 2928538337 | 2928536128 | Bacteria | 7657547 |
| 660 | 2507506859 | 2507262055 | Bacteria | 8048963 |
| 661 | 2508540894 | 2508501009 | Bacteria | 7784016 |
| 662 | 2508696823 | 2508501042 | Bacteria | 8719808 |
| 663 | 2509154162 | 2508501128 | Bacteria | 8613869 |
| 664 | 2511399239 | 2511231028 | Bacteria | 8046582 |
| 665 | 2513623816 | 2513237092 | Bacteria | 8341956 |
| 666 | 2513641489 | 2513237094 | Bacteria | 8789602 |
| 667 | 2513650496 | 2513237095 | Bacteria | 8976980 |
| 668 | 2513654894 | 2513237096 | Bacteria | 8722461 |
| 669 | 2513676652 | 2513237098 | Bacteria | 9902361 |
| 670 | 2513693431 | 2513237101 | Bacteria | 7952346 |
| 671 | 2513705239 | 2513237102 | Bacteria | 7703324 |
| 672 | 2513720114 | 2513237104 | Bacteria | 10034502 |
| 673 | 2513861309 | 2513237137 | Bacteria | 9558895 |
| 674 | 2513877412 | 2513237139 | Bacteria | 8737671 |
| 675 | 2513892269 | 2513237141 | Bacteria | 8496279 |
| 676 | 2513916083 | 2513237145 | Bacteria | 8979722 |
| 677 | 2514013091 | 2513237161 | Bacteria | 8871253 |
| 678 | 2515629681 | 2515154112 | Bacteria | 8294334 |
| 679 | 2517106375 | 2517093001 | Bacteria | 9002274 |
| 680 | 2517894618 | 2517572143 | Bacteria | 9484767 |
| 681 | 2524439395 | 2524023205 | Bacteria | 8918781 |
| 682 | 2524471274 | 2524023210 | Bacteria | 9029266 |
| 683 | 2524534716 | 2524023228 | Bacteria | 10118060 |
| 684 | 2528853120 | 2528768022 | Bacteria | 10457665 |
| 685 | 2599738105 | 2599185239 | Bacteria | 8686614 |
| 686 | 2599742523 | 2599185240 | Bacteria | 7968121 |
| 687 | 2617348202 | 2617270735 | Bacteria | 9163226 |
| 688 | 2617377585 | 2617270741 | Bacteria | 8201522 |
| 689 | 2644287487 | 2643221651 | Bacteria | 4798932 |
| 690 | 2671119044 | 2667528175 | Bacteria | 7532676 |
| 691 | 2723848324 | 2721755755 | Bacteria | 8322773 |
| 692 | 2728748821 | 2728368998 | Bacteria | 8720350 |
| 693 | 2739353332 | 2738543032 | Bacteria | 5115625 |
| 694 | 2745078107 | 2744054633 | Bacteria | 8678936 |
| 695 | 2793064264 | 2791355196 | Bacteria | 7323613 |
| 696 | 2793072294 | 2791355197 | Bacteria | 8420563 |
| 697 | 2793079575 | |||
| 698 | 2805918937 | 2802429603 | Bacteria | 8777136 |
| 699 | 2818242093 | 2816332527 | Bacteria | 8933356 |
| 700 | 2824603118 | 2824600985 | Bacteria | 8488197 |
| 701 | 2824613610 | 2824609381 | Bacteria | 8672835 |
| 702 | 2824620524 | 2824617872 | Bacteria | 8814715 |
| 703 | 2824634140 | 2824626560 | Bacteria | 8813858 |
| 704 | 2824641496 | 2824635225 | Bacteria | 8785348 |
| 705 | 2824652271 | 2824644064 | Bacteria | 8743947 |
| 706 | 2824658151 | 2824653114 | Bacteria | 8493680 |
| 707 | 2824664339 | 2824661429 | Bacteria | 9877870 |
| 708 | 2824686785 | 2824679649 | Bacteria | 8248951 |
| 709 | 2824711714 | 2824704595 | Bacteria | 9667483 |
| 710 | 2824722698 | 2824714736 | Bacteria | 8717648 |
| 711 | 2824729320 | 2824723954 | Bacteria | 8758240 |
| 712 | 2824752040 | 2824746037 | Bacteria | 7911610 |
| 713 | 2824757524 | 2824753945 | Bacteria | 9787441 |
| 714 | 2824768044 | 2824763712 | Bacteria | 9792355 |
| 715 | 2824779650 | 2824773399 | Bacteria | 8360218 |
| 716 | 2838126825 | 2838122688 | Bacteria | 8803140 |
| 717 | 2841945703 | 2841941048 | Bacteria | 8688029 |
| 718 | 2841954895 | 2841949485 | Bacteria | 8680857 |
| 719 | 2841963261 | 2841957949 | Bacteria | 8652217 |
| 720 | 2841972302 | 2841966195 | Bacteria | 8673214 |
| 721 | 2841980385 | 2841974524 | Bacteria | 8931498 |
| 722 | 2841988550 | 2841983080 | Bacteria | 8395090 |
| 723 | 2842044849 | 2842038055 | Bacteria | 8002051 |
| 724 | 2842052965 | 2842045827 | Bacteria | 8006841 |
| 725 | 2847938280 | 2847930680 | Bacteria | 9342022 |
| 726 | 2847940198 | 2847939898 | Bacteria | 8606328 |
| 727 | 2851182991 | 2851182111 | Bacteria | 6047226 |
| 728 | 2857510834 | 2857509624 | Bacteria | 7472071 |
| 729 | 2857529781 | 2857524615 | Bacteria | 6615449 |
| 730 | 2863421932 | 2863421361 | Bacteria | 7300805 |
| 731 | 2874593994 | 2874590934 | Bacteria | 8299676 |
| 732 | 2874607453 | 2874604998 | Bacteria | 7834745 |
| 733 | 2874618854 | 2874612657 | Bacteria | 8252029 |
| 734 | 2874626005 | 2874620515 | Bacteria | 8290088 |
| 735 | 2874630758 | 2874628541 | Bacteria | 8630250 |
| 736 | 2874647925 | 2874645413 | Bacteria | 8214782 |
| 737 | 2876761943 | 2876761206 | Bacteria | 10111113 |
| 738 | 2876774140 | 2876771140 | Bacteria | 8287509 |
| 739 | 2876821092 | 2876818435 | Bacteria | 8274608 |
| 740 | 2879078917 | 2879074833 | Bacteria | 8279565 |
| 741 | 2879086133 | 2879083081 | Bacteria | 8587928 |
| 742 | 2879104828 | 2879099564 | Bacteria | 10442239 |
| 743 | 2879127924 | 2879127579 | Bacteria | 8294491 |
| 744 | 2879147648 | 2879142872 | Bacteria | 8267021 |
| 745 | 2881364341 | 2881364244 | Bacteria | 7710352 |
| 746 | 2881666752 | 2881665667 | Bacteria | 8175609 |
| 747 | 2885367916 | 2885366525 | Bacteria | 8326213 |
| 748 | 2885378103 | 2885374607 | Bacteria | 8927485 |
| 749 | 2885388799 | 2885383462 | Bacteria | 9473874 |
| 750 | 2885414694 | 2885409591 | Bacteria | 9235467 |
| 751 | 2888386155 | 2888378607 | Bacteria | 9652610 |
| 752 | 2888392116 | 2888388044 | Bacteria | 7304136 |
| 753 | 2888426301 | 2888419890 | Bacteria | 7857137 |
| 754 | 2889037132 | 2889033259 | Bacteria | 9099371 |
| 755 | 2903769802 | 2903768456 | Bacteria | 9749579 |
| 756 | 2904566097 | 2904564687 | Bacteria | 7609577 |
| 757 | 2904672487 | 2904666416 | Bacteria | 8226587 |
| 758 | 2904698024 | 2904690495 | Bacteria | 9412302 |
| 759 | 2904700141 | |||
| 760 | 2904712911 | 2904711408 | Bacteria | 9771557 |
| 761 | 2906611346 | |||
| 762 | 2906643454 | 2906635258 | Bacteria | 8601019 |
| 763 | 2906645275 | 2906643746 | Bacteria | 8722424 |
| 764 | 2906661322 | 2906660503 | Bacteria | 8595048 |
| 765 | 2908744926 | 2908739725 | Bacteria | 8628932 |
| 766 | 2908763062 | 2908756301 | Bacteria | 8864324 |
| 767 | 2908782379 | 2908775508 | Bacteria | 8092255 |
| 768 | 2922361279 | 2922361189 | Bacteria | 7436256 |
| 769 | 2922370398 | |||
| 770 | 2922392907 | 2922386360 | Bacteria | 7017218 |
| 771 | 2922399730 | 2922393267 | Bacteria | 8285685 |
| 772 | 2922428026 | |||
| 773 | 2929621410 | 2929615660 | Bacteria | 9193770 |
| 774 | 2929631776 | 2929624759 | Bacteria | 9339455 |
| 775 | 2932792553 | 2932784394 | Bacteria | 9704911 |
| 776 | 2932798659 | 2932794094 | Bacteria | 7915132 |
| 777 | 2932806529 | 2932801729 | Bacteria | 7987968 |
| 778 | 2932815361 | 2932809354 | Bacteria | 9135765 |
| 779 | 2932824360 | 2932818245 | Bacteria | 9955613 |
| 780 | 2932832240 | 2932828146 | Bacteria | 9745859 |
| 781 | 2933583565 | 2933577622 | Bacteria | 9116884 |
| 782 | 2935615859 | 2935608549 | Bacteria | 8203142 |
| 783 | 2935622178 | 2935616580 | Bacteria | 9032984 |
| 784 | 2935632048 | 2935630451 | Bacteria | 8169952 |
| 785 | 2935646436 | 2935638405 | Bacteria | 10015038 |
| 786 | 2935653875 | 2935648319 | Bacteria | 8801166 |
| 787 | 2935662624 | 2935656913 | Bacteria | 8965014 |
| 788 | 2935669273 | 2935665750 | Bacteria | 9571747 |
| 789 | 2935683168 | 2935675223 | Bacteria | 9928132 |
| 790 | 2935692110 | 2935684952 | Bacteria | 9590419 |
| 791 | 2935702485 | 2935694250 | Bacteria | 9291695 |
| 792 | 2935708651 | 2935703347 | Bacteria | 10242284 |
| 793 | 2935720651 | 2935713505 | Bacteria | 9608509 |
| 794 | 2935729932 | 2935722832 | Bacteria | 9608746 |
| 795 | 2935739085 | 2935732158 | Bacteria | 9706831 |
| 796 | 2935748374 | 2935741537 | Bacteria | 9707219 |
| 797 | 2935758576 | 2935750917 | Bacteria | 9590372 |
| 798 | 2935765996 | 2935760218 | Bacteria | 9817913 |
| 799 | 2935772255 | 2935769743 | Bacteria | 7878163 |
| 800 | 2935783791 | 2935777560 | Bacteria | 8077691 |
| 801 | 2935787705 | 2935785616 | Bacteria | 7962367 |
| 802 | 2935793738 | 2935793552 | Bacteria | 8012592 |
| 803 | 2935805989 | 2935801545 | Bacteria | 9301974 |
| 804 | 2935815451 | 2935810662 | Bacteria | 9401221 |
| 805 | 2935826806 | 2935819856 | Bacteria | 8261050 |
| 806 | 2935835589 | 2935827899 | Bacteria | 10038562 |
| 807 | 2935843367 | 2935837841 | Bacteria | 9454360 |
| 808 | 2935853986 | 2935847175 | Bacteria | 8228321 |
| 809 | 2935860425 | 2935855204 | Bacteria | 9035059 |
| 810 | 2935867823 | 2935864058 | Bacteria | 9784707 |
| 811 | 2935878368 | 2935873716 | Bacteria | 9632195 |
| 812 | 2935888632 | 2935883170 | Bacteria | 7964738 |
| 813 | 2935914924 | 2935908558 | Bacteria | 8568796 |
| 814 | 2935923121 | 2935916978 | Bacteria | 9113783 |
| 815 | 2935932397 | 2935926038 | Bacteria | 8601059 |
| 816 | 2935940995 | 2935934488 | Bacteria | 8602579 |
| 817 | 2935949112 | 2935942939 | Bacteria | 8599779 |
| 818 | 2935957807 | 2935951376 | Bacteria | 8602333 |
| 819 | 2935964807 | 2935959822 | Bacteria | 7869783 |
| 820 | 2935974072 | 2935967501 | Bacteria | 8603075 |
| 821 | 2935981363 | 2935975950 | Bacteria | 8347125 |
| 822 | 2935990271 | 2935984226 | Bacteria | 8302647 |
| 823 | 2935998749 | 2935992306 | Bacteria | 9802711 |
| 824 | 2936007054 | 2936002035 | Bacteria | 9362176 |
| 825 | 2936015375 | 2936011229 | Bacteria | 8801034 |
| 826 | 2936024009 | 2936019824 | Bacteria | 8804134 |
| 827 | 2936033024 | 2936028420 | Bacteria | 8965941 |
| 828 | 2936040689 | 2936037263 | Bacteria | 9446081 |
| 829 | 2936051117 | 2936046547 | Bacteria | 8903709 |
| 830 | 2936058494 | 2936055302 | Bacteria | 8785755 |
| 831 | 2940564480 | 2940556831 | Bacteria | 9590747 |
| 832 | 2941507996 | 2941507105 | Bacteria | 8166816 |
| 833 | 2941515499 | 2941515067 | Bacteria | 8166720 |
| 834 | 2941523926 | 2941523033 | Bacteria | 8169134 |
| 835 | 2941536575 | 2941531003 | Bacteria | 7653939 |
| 836 | 2941544913 | 2941538514 | Bacteria | 9402094 |
| 837 | 3005477727 | 3005474847 | Bacteria | 9259049 |
| 838 | 3005485331 | 3005483717 | Bacteria | 7877331 |
| 839 | 3005507670 | 3005506211 | Bacteria | 6943378 |
| 840 | 3005593901 | 3005587118 | Bacteria | 7794411 |
| 841 | 3005601072 | 3005594810 | Bacteria | 8716512 |
| 842 | 3005716539 | 3005710791 | Bacteria | 7622528 |
| 843 | 8006933848 | 8006933436 | Bacteria | 10410654 |
| 844 | 8006969637 | 8006964411 | Bacteria | 8966052 |
| 845 | 8006983520 | 8006973647 | Bacteria | 10679141 |
| 846 | 8006990646 | 8006984368 | Bacteria | 9651211 |
| 847 | 8006998713 | 8006994254 | Bacteria | 8309700 |
| 848 | 8016519912 | 8016511872 | Bacteria | 9921665 |
| 849 | 8016527823 | 8016522445 | Bacteria | 8156687 |
| 850 | 8016532933 | 8016530956 | Bacteria | 8155261 |
| 851 | 8016546169 | 8016539877 | Bacteria | 8155419 |
| 852 | 8016564309 | 8016557553 | Bacteria | 8154380 |
| 853 | 8016583728 | 8016575299 | Bacteria | 8154085 |
| 854 | 8016601995 | 8016595262 | Bacteria | 8149947 |
| 855 | 8016608228 | 8016603502 | Bacteria | 8731218 |
| 856 | 8016624513 | 8016622563 | Bacteria | 7999408 |
| 857 | 8016633975 | 8016630954 | Bacteria | 9217207 |
| 858 | 8017065632 | 8017057580 | Bacteria | 10023680 |
| 859 | 8019532734 | 8019530166 | Bacteria | 8155624 |
| 860 | 8019547117 | 8019538911 | Bacteria | 7872763 |
| 861 | 8019551544 | 8019547302 | Bacteria | 7996444 |
| 862 | 8019559401 | 8019555841 | Bacteria | 9642137 |
| 863 | 8019569497 | 8019565922 | Bacteria | 9639779 |
| 864 | 8019598459 | 8019597564 | Bacteria | 10041141 |
| 865 | 8019609918 | 8019608314 | Bacteria | 10042931 |
| 866 | 8019632472 | 8019629233 | Bacteria | 8687553 |
| 867 | 8019647413 | 8019638758 | Bacteria | 9062356 |
| 868 | 8019655251 | 8019648815 | Bacteria | 10014479 |
| 869 | 8019660389 | 8019659431 | Bacteria | 8577854 |
| 870 | 8019669808 | 8019668869 | Bacteria | 8791617 |
| 871 | 8019686285 | 8019678201 | Bacteria | 8863603 |
| 872 | 8019692442 | 8019687851 | Bacteria | 8712826 |
| 873 | 8055744387 | 8055742211 | Bacteria | 9226248 |
| 874 | 8056676652 | 8056673599 | Bacteria | 7871253 |
| 875 | 8056689648 | 8056681323 | Bacteria | 8472857 |
| 876 | 8056691050 | 8056689827 | Bacteria | 6712655 |
| 877 | 8056969239 | 8056967851 | Bacteria | 9038162 |
| 878 | 8057534326 | 8057529695 | Bacteria | 6306553 |
| 879 | JGI25406J46586_10000022 | |||
| 880 | JGI25406J46586_10005227 | |||
| 881 | JGI25165J46597_1007189 | |||
| 882 | JGI25160J50197_1002587 | |||
| 883 | Ga0055531_10009154 | |||
| 884 | Ga0055543_1002484 | |||
| 885 | Ga0065165_1000054 | |||
| 886 | Ga0065165_1002102 | |||
| 887 | Ga0065165_1011420 | |||
| 888 | Ga0070658_10114385 | |||
| 889 | Ga0070683_100015345 | |||
| 890 | Ga0070683_100226114 | |||
| 891 | Ga0068869_100006026 | |||
| 892 | Ga0070680_100098187 | |||
| 893 | Ga0070682_100155719 | |||
| 894 | Ga0068868_100011281 | |||
| 895 | Ga0068868_100012390 | |||
| 896 | Ga0068868_100044810 | |||
| 897 | Ga0070687_100053672 | |||
| 898 | Ga0070661_100068075 | |||
| 899 | Ga0070668_100043813 | |||
| 900 | Ga0070669_100080139 | |||
| 901 | Ga0070674_100019676 | |||
| 902 | Ga0070673_100059081 | |||
| 903 | Ga0070688_100061045 | |||
| 904 | Ga0070688_100073400 | |||
| 905 | Ga0070659_100219481 | |||
| 906 | Ga0070667_100163383 | |||
| 907 | Ga0070709_10000227 | |||
| 908 | Ga0070709_10001601 | |||
| 909 | Ga0070714_100024557 | |||
| 910 | Ga0070713_100024657 | |||
| 911 | Ga0070713_100050036 | |||
| 912 | Ga0070710_10001439 | |||
| 913 | Ga0070711_100001952 | |||
| 914 | Ga0070711_100002557 | |||
| 915 | Ga0070711_100009680 | |||
| 916 | Ga0070663_100002194 | |||
| 917 | Ga0070663_100018127 | |||
| 918 | Ga0070663_100031167 | |||
| 919 | Ga0070663_100050646 | |||
| 920 | Ga0070663_100053408 | |||
| 921 | Ga0070678_100036257 | |||
| 922 | Ga0070662_100137008 | |||
| 923 | Ga0070681_10003153 | |||
| 924 | Ga0070681_10008310 | |||
| 925 | Ga0070681_10011710 | |||
| 926 | Ga0068867_100007587 | |||
| 927 | Ga0070706_100184860 | |||
| 928 | Ga0070698_100030330 | |||
| 929 | Ga0070679_100098777 | |||
| 930 | Ga0070679_100155702 | |||
| 931 | Ga0070679_100159355 | |||
| 932 | Ga0070684_100006061 | |||
| 933 | Ga0070686_100037560 | |||
| 934 | Ga0070665_100020963 | |||
| 935 | Ga0070665_100045884 | |||
| 936 | Ga0070665_100057411 | |||
| 937 | Ga0070665_100059104 | |||
| 938 | Ga0070665_100153369 | |||
| 939 | Ga0070665_100192578 | |||
| 940 | Ga0068855_100011850 | |||
| 941 | Ga0068855_100068227 | |||
| 942 | Ga0068855_100074629 | |||
| 943 | Ga0068855_100127070 | |||
| 944 | Ga0070664_100248682 | |||
| 945 | Ga0068857_100103602 | |||
| 946 | Ga0068856_100000283 | |||
| 947 | Ga0068856_100102578 | |||
| 948 | Ga0070702_100036385 | |||
| 949 | Ga0068859_100208272 | |||
| 950 | Ga0068861_100205650 | |||
| 951 | Ga0068851_10018844 | |||
| 952 | Ga0068858_100265844 | |||
| 953 | Ga0068860_100013207 | |||
| 954 | Ga0068860_100252628 | |||
| 955 | Ga0068862_100016934 | |||
| 956 | Ga0068862_100046903 | |||
| 957 | Ga0068862_100147152 | |||
| 958 | Ga0081455_10005918 | |||
| 959 | Ga0081455_10008904 | |||
| 960 | Ga0081455_10013476 | |||
| 961 | Ga0081455_10025076 | |||
| 962 | Ga0081540_1010824 | |||
| 963 | Ga0081540_1018602 | |||
| 964 | Ga0081540_1019338 | |||
| 965 | Ga0081540_1020886 | |||
| 966 | Ga0081540_1040638 | |||
| 967 | Ga0081540_1042834 | |||
| 968 | Ga0081540_1055984 | |||
| 969 | Ga0081539_10000172 | |||
| 970 | Ga0081539_10000945 | |||
| 971 | Ga0081539_10012821 | |||
| 972 | Ga0081539_10015466 | |||
| 973 | Ga0070717_10014606 | |||
| 974 | Ga0070717_10021111 | |||
| 975 | Ga0070717_10159291 | |||
| 976 | Ga0075365_10008184 | |||
| 977 | Ga0075365_10008188 | |||
| 978 | Ga0075365_10034084 | |||
| 979 | Ga0075365_10071325 | |||
| 980 | Ga0075363_100006195 | |||
| 981 | Ga0075364_10072493 | |||
| 982 | Ga0070716_100007768 | |||
| 983 | Ga0070712_100062560 | |||
| 984 | Ga0070712_100196195 | |||
| 985 | Ga0075362_10020342 | |||
| 986 | Ga0075367_10008546 | |||
| 987 | Ga0075367_10027983 | |||
| 988 | Ga0075369_10006949 | |||
| 989 | Ga0075366_10001716 | |||
| 990 | Ga0075370_10000423 | |||
| 991 | Ga0075370_10032507 | |||
| 992 | Ga0075434_100223944 | |||
| 993 | Ga0068865_100018479 | |||
| 994 | Ga0097620_100208274 | |||
| 995 | Ga0099825_1031522 | |||
| 996 | Ga0099822_1012272 | |||
| 997 | Ga0105240_10005830 | |||
| 998 | Ga0105240_10023440 | |||
| 999 | Ga0105240_10128469 | |||
| 1000 | Ga0105245_10127546 | |||
| 1001 | Ga0105247_10133216 | |||
| 1002 | Ga0114129_10101325 | |||
| 1003 | Ga0105243_10031979 | |||
| 1004 | Ga0105241_10023336 | |||
| 1005 | Ga0105241_10023650 | |||
| 1006 | Ga0105241_10176530 | |||
| 1007 | Ga0105237_10002080 | |||
| 1008 | Ga0105237_10015271 | |||
| 1009 | Ga0105237_10024890 | |||
| 1010 | Ga0105238_10020617 | |||
| 1011 | Ga0105238_10049428 | |||
| 1012 | Ga0105239_10026267 | |||
| 1013 | Ga0105239_10035818 | |||
| 1014 | Ga0105239_10082860 | |||
| 1015 | Ga0105246_10042152 | |||
| 1016 | Ga0105246_10126374 | |||
| 1017 | Ga0105246_10135366 | |||
| 1018 | Ga0157369_10009617 | |||
| 1019 | Ga0157369_10017510 | |||
| 1020 | Ga0157369_10035736 | |||
| 1021 | Ga0157374_10026908 | |||
| 1022 | Ga0157374_10030783 | |||
| 1023 | Ga0157378_10019008 | |||
| 1024 | Ga0163162_10014185 | |||
| 1025 | Ga0157375_10029979 | |||
| 1026 | Ga0157375_10062791 | |||
| 1027 | Ga0157375_10196522 | |||
| 1028 | Ga0163163_10023168 | |||
| 1029 | Ga0157379_10319500 | |||
| 1030 | Ga0157376_10036268 | |||
| 1031 | Ga0157376_10262303 | |||
| 1032 | Ga0182007_10005930 | |||
| 1033 | Ga0163161_10155119 | |||
| 1034 | Ga0206353_10820691 | |||
| 1035 | Ga0214544_1004900 | |||
| 1036 | Ga0214542_1000773 | |||
| 1037 | Ga0214545_1000546 | |||
| 1038 | Ga0214543_1000740 | |||
| 1039 | Ga0213876_10014871 | |||
| 1040 | Ga0213876_10098826 | |||
| 1041 | Ga0213871_10009634 | |||
| 1042 | Ga0224712_10030568 | |||
| 1043 | Ga0209677_100384 | |||
| 1044 | Ga0209677_103265 | |||
| 1045 | Ga0209233_1000823 | |||
| 1046 | Ga0209233_1014119 | |||
| 1047 | Ga0209455_1001474 | |||
| 1048 | Ga0209455_1011596 | |||
| 1049 | Ga0209564_1017567 | |||
| 1050 | Ga0209758_1000117 | |||
| 1051 | Ga0209758_1000715 | |||
| 1052 | Ga0209758_1001613 | |||
| 1053 | Ga0209758_1006716 | |||
| 1054 | Ga0207426_1000223 | |||
| 1055 | Ga0207426_1000649 | |||
| 1056 | Ga0207426_1016531 | |||
| 1057 | Ga0209257_1001759 | |||
| 1058 | Ga0207692_10000620 | |||
| 1059 | Ga0207710_10008225 | |||
| 1060 | Ga0207710_10029729 | |||
| 1061 | Ga0207647_10068869 | |||
| 1062 | Ga0207699_10001377 | |||
| 1063 | Ga0207684_10144845 | |||
| 1064 | Ga0207654_10018072 | |||
| 1065 | Ga0207654_10103305 | |||
| 1066 | Ga0207707_10001119 | |||
| 1067 | Ga0207707_10009404 | |||
| 1068 | Ga0207707_10056126 | |||
| 1069 | Ga0207695_10000136 | |||
| 1070 | Ga0207695_10047532 | |||
| 1071 | Ga0207695_10116825 | |||
| 1072 | Ga0207671_10015795 | |||
| 1073 | Ga0207693_10014092 | |||
| 1074 | Ga0207693_10031462 | |||
| 1075 | Ga0207693_10057497 | |||
| 1076 | Ga0207663_10029199 | |||
| 1077 | Ga0207660_10074503 | |||
| 1078 | Ga0207649_10061877 | |||
| 1079 | Ga0207649_10062221 | |||
| 1080 | Ga0207652_10008928 | |||
| 1081 | Ga0207652_10066764 | |||
| 1082 | Ga0207652_10070721 | |||
| 1083 | Ga0207652_10175078 | |||
| 1084 | Ga0207694_10021479 | |||
| 1085 | Ga0207694_10123521 | |||
| 1086 | Ga0207700_10118035 | |||
| 1087 | Ga0207664_10109515 | |||
| 1088 | Ga0207706_10044304 | |||
| 1089 | Ga0207686_10013907 | |||
| 1090 | Ga0207709_10008694 | |||
| 1091 | Ga0207670_10048617 | |||
| 1092 | Ga0207704_10097160 | |||
| 1093 | Ga0207665_10012662 | |||
| 1094 | Ga0207711_10084305 | |||
| 1095 | Ga0207689_10017899 | |||
| 1096 | Ga0207689_10023971 | |||
| 1097 | Ga0207661_10000190 | |||
| 1098 | Ga0207661_10062281 | |||
| 1099 | Ga0207661_10084952 | |||
| 1100 | Ga0207679_10112374 | |||
| 1101 | Ga0207679_10155920 | |||
| 1102 | Ga0207667_10065228 | |||
| 1103 | Ga0207667_10219916 | |||
| 1104 | Ga0207668_10041202 | |||
| 1105 | Ga0207668_10055435 | |||
| 1106 | Ga0207668_10093154 | |||
| 1107 | Ga0207658_10073091 | |||
| 1108 | Ga0207677_10044452 | |||
| 1109 | Ga0207703_10015770 | |||
| 1110 | Ga0207639_10134673 | |||
| 1111 | Ga0207639_10236907 | |||
| 1112 | Ga0207678_10016800 | |||
| 1113 | Ga0207678_10035083 | |||
| 1114 | Ga0207678_10061951 | |||
| 1115 | Ga0207678_10075144 | |||
| 1116 | Ga0207678_10076272 | |||
| 1117 | Ga0207678_10091313 | |||
| 1118 | Ga0207678_10139406 | |||
| 1119 | Ga0207708_10029928 | |||
| 1120 | Ga0207702_10000052 | |||
| 1121 | Ga0207702_10031891 | |||
| 1122 | Ga0207702_10058264 | |||
| 1123 | Ga0207641_10133326 | |||
| 1124 | Ga0207648_10027354 | |||
| 1125 | Ga0207674_10104491 | |||
| 1126 | Ga0207674_10114603 | |||
| 1127 | Ga0207675_100016461 | |||
| 1128 | Ga0207675_100112461 | |||
| 1129 | Ga0207675_100369869 | |||
| 1130 | Ga0207683_10032325 | |||
| 1131 | Ga0207683_10044240 | |||
| 1132 | Ga0207683_10062763 | |||
| 1133 | Ga0207683_10112080 | |||
| 1134 | Ga0207698_10030894 | |||
| 1135 | Ga0207698_10133561 | |||
| 1136 | Ga0207698_10140678 | |||
| 1137 | Ga0209389_1000028 | |||
| 1138 | Ga0209389_1000056 | |||
| 1139 | Ga0209589_1000007 | |||
| 1140 | Ga0209589_1000034 | |||
| 1141 | Ga0209489_100008 | |||
| 1142 | Ga0209489_100009 | |||
| 1143 | Ga0209489_102012 | |||
| 1144 | Ga0209700_100009 | |||
| 1145 | Ga0209700_100022 | |||
| 1146 | Ga0268266_10000519 | |||
| 1147 | Ga0268266_10003020 | |||
| 1148 | Ga0268266_10044108 | |||
| 1149 | Ga0268266_10090525 | |||
| 1150 | Ga0268265_10080618 | |||
| 1151 | Ga0268265_10180179 | |||
| 1152 | Ga0268265_10271288 | |||
| 1153 | Ga0268264_10103703 | |||
| 1154 | Ga0307517_10000248 | |||
| 1155 | Ga0307517_10136617 | |||
| 1156 | Ga0265330_10020141 | |||
| 1157 | Ga0265325_10067907 | |||
| 1158 | Ga0265329_10035515 | |||
| 1159 | Ga0265339_10013152 | |||
| 1160 | Ga0265339_10087431 | |||
| 1161 | Ga0265339_10088861 | |||
| 1162 | Ga0265339_10095190 | |||
| 1163 | Ga0265331_10030223 | |||
| 1164 | Ga0265316_10158753 | |||
| 1165 | Ga0307513_10040669 | |||
| 1166 | Ga0307509_10038225 | |||
| 1167 | Ga0307408_100067422 | |||
| 1168 | Ga0265313_10071475 | |||
| 1169 | Ga0307508_10072105 | |||
| 1170 | Ga0265314_10004420 | |||
| 1171 | Ga0265314_10053234 | |||
| 1172 | Ga0307407_10123247 | |||
| 1173 | Ga0307409_100212668 | |||
| 1174 | Ga0307510_10005609 | |||
| 1175 | Ga0307510_10012266 | |||
| 1176 | Ga0307510_10055497 | |||
| 1177 | Ga0307510_10056357 | |||
| 1178 | Ga0307510_10204549 | |||
| 1179 | Ga0373926_0039935 | |||
| 1180 | Ga0373944_0024045 | |||
| 1181 | Ga0373923_0027627 | |||
| 1182 | Ga0373936_0005553 | |||
| 1183 | Ga0373936_0032591 | |||
| 1184 | Ga0373945_0016860 | |||
| 1185 | Ga0373953_0002162 | |||
| 1186 | Ga0373954_0012905 | |||
| 1187 | Ga0373954_0018705 | |||
| 1188 | Ga0373956_0004523 | |||
| 1189 | Ga0373943_0008287 | |||
| 1190 | Ga0373946_0006757 | |||
| 1191 | Ga0373955_0000335 | |||
| 1192 | Ga0373955_0022709 | |||
| 1193 | Ga0373955_0126986 | |||
| 1194 | Ga0373924_0024544 | |||
| 1195 | Ga0373924_0036480 | |||
| 1196 | Ga0373935_0001283 | |||
| 1197 | Ga0373927_0000515 | |||
| 1198 | Ga0373933_0000106 | |||
| 1199 | Ga0373933_0034579 | |||
| 1200 | Ga0373947_0004303 | |||
| 1201 | Ga0373947_0026121 | |||
| 1202 | Ga0373947_0050799 | |||
| 1203 | Ga0373937_0042654 | |||
| 1204 | Ga0373937_0272472 | |||
| 1205 | Ga0373925_0001116 | |||
| 1206 | Ga0373925_0073594 | |||
| 1207 | Ga0373925_0186396 | |||
| 1208 | Ga0373925_0242119 | |||
| 1209 | Ga0395900_0019004 | |||
| 1210 | Ga0395900_0039621 | |||
| 1211 | Ga0395900_0081097 | |||
| 1212 | Ga0395898_0006007 | |||
| 1213 | Ga0395898_0040790 | |||
| 1214 | Ga0395898_0076659 | |||
| 1215 | Ga0395898_0184223 | |||
| 1216 | Ga0395905_0013314 | |||
| 1217 | Ga0436364_0336775 | |||
| 1218 | Ga0436364_0751694 | |||
| 1219 | Ga0395901_0082268 | |||
| 1220 | Ga0436365_0474195 | |||
| 1221 | Ga0436365_1060223 | |||
| 1222 | Ga0436365_1421557 | |||
| 1223 | Ga0436365_1919740 | |||
| 1224 | Ga0436360_1353130 | |||
| 1225 | Ga0436361_0895020 | |||
| 1226 | Ga0436362_0094313 | |||
| 1227 | Ga0436362_1189097 | |||
| 1228 | Ga0439458_0016549 | |||
| 1229 | Ga0466972_0000110 | |||
| 1230 | Ga0466972_0003331 | |||
| 1231 | Ga0466965_0008548 | |||
| 1232 | Ga0466966_0080251 | |||
| 1233 | Ga0466963_0003214 | |||
| 1234 | Ga0466957_0013617 | |||
| 1235 | Ga0466957_0016857 | |||
| 1236 | Ga0466957_0187640 | |||
| 1237 | Ga0466959_0053736 | |||
| 1238 | Ga0466967_0015425 | |||
| 1239 | Ga0466967_0062382 | |||
| 1240 | Ga0466967_0101911 | |||
| 1241 | Ga0495592_0006367 | |||
| 1242 | Ga0495592_0009951 | |||
| 1243 | Ga0495592_0036210 | |||
| 1244 | Ga0495603_0000156 | |||
| 1245 | Ga0495603_0022445 | |||
| 1246 | Ga0495603_0080171 | |||
| 1247 | Ga0495629_0000297 | |||
| 1248 | Ga0495629_0001966 | |||
| 1249 | Ga0495629_0002353 | |||
| 1250 | Ga0495629_0026149 | |||
| 1251 | Ga0495629_0106504 | |||
| 1252 | Ga0495638_0005955 | |||
| 1253 | Ga0495638_0080116 | |||
| 1254 | Ga0495641_0016704 | |||
| 1255 | Ga0495651_0003593 | |||
| 1256 | Ga0495651_0015887 | |||
| 1257 | Ga0495651_0073121 | |||
| 1258 | Ga0495580_0004564 | |||
| 1259 | Ga0495582_0000087 | |||
| 1260 | Ga0495639_0000153 | |||
| 1261 | Ga0495639_0007468 | |||
| 1262 | Ga0495639_0019704 | |||
| 1263 | Ga0495662_0004971 | |||
| 1264 | Ga0495664_0005395 | |||
| 1265 | Ga0495664_0017781 | |||
| 1266 | Ga0495664_0091357 | |||
| 1267 | Ga0495584_0101389 | |||
| 1268 | Ga0495594_0047103 | |||
| 1269 | Ga0495606_0001387 | |||
| 1270 | Ga0495606_0013271 | |||
| 1271 | Ga0495608_0025938 | |||
| 1272 | Ga0495608_0033974 | |||
| 1273 | Ga0495608_0087279 | |||
| 1274 | Ga0495610_0042140 | |||
| 1275 | Ga0495618_0037730 | |||
| 1276 | Ga0495618_0039213 | |||
| 1277 | Ga0495618_0053942 | |||
| 1278 | Ga0495620_0041331 | |||
| 1279 | Ga0495628_0039901 | |||
| 1280 | Ga0495628_0079926 | |||
| 1281 | Ga0495628_0104296 | |||
| 1282 | Ga0495628_0208444 | |||
| 1283 | Ga0495630_0000735 | |||
| 1284 | Ga0495630_0040595 | |||
| 1285 | Ga0495631_0019230 | |||
| 1286 | Ga0495632_0044841 | |||
| 1287 | Ga0495644_0028898 | |||
| 1288 | Ga0495648_0003807 | |||
| 1289 | Ga0495648_0014960 | |||
| 1290 | Ga0495648_0036506 | |||
| 1291 | Ga0495666_0017403 | |||
| 1292 | Ga0495652_0003411 | |||
| 1293 | Ga0495652_0023747 | |||
| 1294 | Ga0495652_0035587 | |||
| 1295 | Ga0495665_0000117 | |||
| 1296 | Ga0495665_0008372 | |||
| 1297 | Ga0495640_0002597 | |||
| 1298 | Ga0495640_0046425 | |||
| 1299 | Ga0495587_0001788 | |||
| 1300 | Ga0495645_0012372 | |||
| 1301 | Ga0495645_0056154 | |||
| 1302 | Ga0495622_0002118 | |||
| 1303 | Ga0495667_0022986 | |||
| 1304 | Ga0495667_0049104 | |||
| 1305 | Ga0495667_0078753 | |||
| 1306 | Ga0495667_0124882 | |||
| 1307 | Ga0495667_0175298 | |||
| 1308 | Ga0495656_0026908 | |||
| 1309 | Ga0495656_0034975 | |||
| 1310 | Ga0495668_0022219 | |||
| 1311 | Ga0495634_0009937 | |||
| 1312 | Ga0495634_0041078 | |||
| 1313 | Ga0495611_0018358 | |||
| 1314 | Ga0495611_0089746 | |||
| 1315 | Ga0495625_0029766 | |||
| 1316 | Ga0495625_0157597 | |||
| 1317 | Ga0495635_0011937 | |||
| 1318 | Ga0495635_0016105 | |||
| 1319 | Ga0495635_0054427 | |||
| 1320 | Ga0495635_0056628 | |||
| 1321 | Ga0495635_0117662 | |||
| 1322 | Ga0495657_0002601 | |||
| 1323 | Ga0495657_0008132 | |||
| 1324 | Ga0495623_0001847 | |||
| 1325 | Ga0495646_0004576 | |||
| 1326 | Ga0495646_0027733 | |||
| 1327 | Ga0495646_0087452 | |||
| 1328 | Ga0495647_0000365 | |||
| 1329 | Ga0495647_0005771 | |||
| 1330 | Ga0495658_0000644 | |||
| 1331 | Ga0495658_0086515 | |||
| 1332 | Ga0495669_0004390 | |||
| 1333 | Ga0495613_0009744 | |||
| 1334 | Ga0495613_0046869 | |||
| 1335 | Ga0495613_0059264 | |||
| 1336 | Ga0495624_0001012 | |||
| 1337 | Ga0495624_0028607 | |||
| 1338 | Ga0495624_0041473 | |||
| 1339 | Ga0495670_0070693 | |||
| 1340 | Ga0495649_0033464 | |||
| 1341 | Ga0495589_0043201 | |||
| 1342 | Ga0495600_0000869 | |||
| 1343 | Ga0495600_0006623 | |||
| 1344 | Ga0495581_0000543 | |||
| 1345 | Ga0495604_0000751 | |||
| 1346 | Ga0495604_0078967 | |||
| 1347 | Ga0495604_0127905 | |||
| 1348 | Ga0495674_0000177 | |||
| 1349 | Ga0495674_0004259 | |||
| 1350 | Ga0495674_0020467 | |||
| 1351 | Ga0495674_0064002 | |||
| 1352 | Ga0495674_0127546 | |||
| 1353 | Ga0495672_0057036 | |||
| 1354 | Ga0495676_0017162 | |||
| 1355 | Ga0495676_0117392 | |||
| 1356 | Ga0495680_0001530 | |||
| 1357 | Ga0495683_0073021 | |||
| 1358 | Ga0495675_0025225 | |||
| 1359 | Ga0495685_015376 | |||
| 1360 | Ga0495673_0011890 | |||
| 1361 | Ga0495684_0002187 | |||
| 1362 | Ga0495684_0013598 | |||
| 1363 | Ga0495684_0023802 | |||
| 1364 | Ga0495684_0035668 | |||
| 1365 | Ga0495686_0021609 | |||
| 1366 | Ga0495686_0090603 | |||
| 1367 | Ga0495593_0000156 | |||
| 1368 | Ga0495593_0013164 | |||
| 1369 | Ga0495602_0046473 | |||
| 1370 | Ga0495602_0081730 | |||
| 1371 | Ga0495602_0235101 | |||
| 1372 | Ga0495614_0012177 | |||
| 1373 | Ga0495626_0073230 | |||
| 1374 | Ga0496100_0021481 | |||
| 1375 | Ga0496100_0069060 | |||
| 1376 | Ga0496100_0072789 | |||
| 1377 | Ga0496101_0007180 | |||
| 1378 | Ga0496101_0227745 | |||
| 1379 | Ga0496102_0010384 | |||
| 1380 | Ga0496102_0029354 | |||
| 1381 | Ga0496102_0070377 | |||
| 1382 | Ga0496102_0074351 | |||
| 1383 | Ga0496103_0050663 | |||
| 1384 | Ga0496104_0010798 | |||
| 1385 | Ga0496104_0032296 | |||
| 1386 | Ga0496104_0060567 | |||
| 1387 | Ga0496105_0001079 | |||
| 1388 | Ga0496105_0026645 | |||
| 1389 | Ga0496105_0124205 | |||
| 1390 | Ga0496106_0006989 | |||
| 1391 | Ga0496106_0033779 | |||
| 1392 | Ga0496106_0049553 | |||
| 1393 | Ga0496106_0065373 | |||
| 1394 | Ga0496107_0056443 | |||
| 1395 | Ga0496107_0163708 | |||
| 1396 | Ga0496108_0013601 | |||
| 1397 | Ga0496108_0016621 | |||
| 1398 | Ga0496108_0060904 | |||
| 1399 | Ga0496108_0086966 | |||
| 1400 | Ga0496108_0125987 | |||
| 1401 | Ga0496109_0035982 | |||
| 1402 | Ga0496110_0006206 | |||
| 1403 | Ga0496110_0067614 | |||
| 1404 | Ga0496110_0146203 | |||
| 1405 | Ga0496111_0035227 | |||
| 1406 | Ga0496111_0037826 | |||
| 1407 | Ga0496111_0084233 | |||
| 1408 | Ga0496112_0000057 | |||
| 1409 | Ga0496112_0051942 | |||
| 1410 | Ga0496113_0021724 | |||
| 1411 | Ga0496113_0021863 | |||
| 1412 | Ga0496113_0048355 | |||
| 1413 | Ga0496114_0010492 | |||
| 1414 | Ga0496114_0054300 | |||
| 1415 | Ga0496114_0317929 | |||
| 1416 | Ga0496115_0003709 | |||
| 1417 | Ga0496115_0010430 | |||
| 1418 | Ga0496115_0023069 | |||
| 1419 | Ga0496115_0045050 | |||
| 1420 | Ga0496115_0062901 | |||
| 1421 | Ga0496115_0187762 | |||
| 1422 | Ga0496116_0059844 | |||
| 1423 | Ga0496118_0054933 | |||
| 1424 | Ga0496118_0072960 | |||
| 1425 | Ga0496118_0073569 | |||
| 1426 | Ga0496120_0019659 | |||
| 1427 | Ga0496121_0000287 | |||
| 1428 | Ga0496121_0011016 | |||
| 1429 | Ga0496121_0036889 | |||
| 1430 | Ga0496121_0063418 | |||
| 1431 | Ga0496121_0080134 | |||
| 1432 | Ga0496124_0051160 | |||
| 1433 | Ga0496124_0094198 | |||
| 1434 | Ga0496125_0000654 | |||
| 1435 | Ga0496125_0039845 | |||
| 1436 | Ga0496125_0083438 | |||
| 1437 | Ga0496126_0001378 | |||
| 1438 | Ga0496126_0023389 | |||
| 1439 | Ga0496126_0028392 | |||
| 1440 | Ga0496126_0028525 | |||
| 1441 | Ga0496126_0034253 | |||
| 1442 | Ga0496126_0050313 | |||
| 1443 | Ga0496126_0079318 | |||
| 1444 | Ga0496126_0129558 | |||
| 1445 | Ga0496126_0193331 | |||
| 1446 | Ga0496126_0207872 | |||
| 1447 | Ga0496126_0233560 | |||
| 1448 | Ga0495678_030305 | |||
| 1449 | Ga0501032_0058911 | |||
| 1450 | Ga0501034_0139494 | |||
| 1451 | Ga0501037_0112815 | |||
| 1452 | Ga0501038_0029631 | |||
| 1453 | Ga0501038_0203292 | |||
| 1454 | Ga0501042_0091096 | |||
| 1455 | Ga0501043_0159584 | |||
| 1456 | Ga0501046_0084995 | |||
| 1457 | Ga0501047_0041969 | |||
| 1458 | Ga0501067_0096608 | |||
| 1459 | Ga0501070_0019833 | |||
| 1460 | Ga0501073_0029828 | |||
| 1461 | Ga0501073_0055687 | |||
| 1462 | Ga0501074_0053891 | |||
| 1463 | Ga0501076_0203126 | |||
| 1464 | Ga0501080_0006437 | |||
| 1465 | Ga0501080_0027935 | |||
| 1466 | Ga0501044_0075584 | |||
| 1467 | Ga0501045_0037272 | |||
| 1468 | nmdc:mga03n38_569_c1 | |||
| 1469 | nmdc:mga0yw44_136181_c1 | |||
| 1470 | nmdc:mga0yw44_4755_c1 | |||
| 1471 | nmdc:mga0k408_132838_c1 | |||
| 1472 | nmdc:mga06z11_20219_c1 | |||
| 1473 | nmdc:mga07m45_12920_c1 | |||
| 1474 | nmdc:mga07m45_27846_c1 | |||
| 1475 | Ga0495601_0034886 | |||
| 1476 | Ga0495601_0057604 | |||
| 1477 | Ga0495601_0105705 | |||
| 1478 | Ga0495612_0023956 | |||
| 1479 | Ga0500635_0008657 | |||
| 1480 | Ga0500635_0015857 | |||
| 1481 | Ga0495595_0009305 | |||
| 1482 | Ga0495595_0051750 | |||
| 1483 | Ga0495619_0014155 | |||
| 1484 | Ga0500578_0094824 | |||
| 1485 | Ga0500643_000095 | |||
| 1486 | Ga0500651_0001950 | |||
| 1487 | Ga0500651_0079684 | |||
| 1488 | Ga0500566_0000035 | |||
| 1489 | Ga0500566_0000228 | |||
| 1490 | Ga0500640_000054 | |||
| 1491 | Ga0500641_0006106 | |||
| 1492 | Ga0500555_001063 | |||
| 1493 | Ga0500557_000117 | |||
| 1494 | Ga0500569_000782 | |||
| 1495 | Ga0500572_000122 | |||
| 1496 | Ga0500572_001570 | |||
| 1497 | Ga0500595_000651 | |||
| 1498 | Ga0500595_000743 | |||
| 1499 | Ga0500595_009830 | |||
| 1500 | Ga0500595_011238 | |||
| 1501 | Ga0500595_015038 | |||
| 1502 | Ga0500595_024553 | |||
| 1503 | Ga0500642_0002741 | |||
| 1504 | Ga0500642_0013901 | |||
| 1505 | Ga0500642_0043444 | |||
| 1506 | Ga0500655_005578 | |||
| 1507 | Ga0500559_0001632 | |||
| 1508 | Ga0500559_0001963 | |||
| 1509 | Ga0500559_0011974 | |||
| 1510 | Ga0500564_046065 | |||
| 1511 | Ga0500568_0004068 | |||
| 1512 | Ga0500568_0053547 | |||
| 1513 | Ga0500577_0010289 | |||
| 1514 | Ga0500590_009170 | |||
| 1515 | Ga0500603_001828 | |||
| 1516 | Ga0500620_002550 | |||
| 1517 | Ga0500622_0007366 | |||
| 1518 | Ga0500627_0050356 | |||
| 1519 | Ga0500630_000187 | |||
| 1520 | Ga0500634_0058506 | |||
| 1521 | Ga0500638_000347 | |||
| 1522 | Ga0500638_018935 | |||
| 1523 | Ga0500639_000038 | |||
| 1524 | Ga0500639_046351 | |||
| 1525 | Ga0500636_0000157 | |||
| 1526 | Ga0500636_0086178 | |||
| 1527 | Ga0500637_0000502 | |||
| 1528 | Ga0500637_0000714 | |||
| 1529 | Ga0500576_028447 | |||
| 1530 | Ga0500625_022516 | |||
| 1531 | Ga0500645_002932 | |||
| 1532 | Ga0500609_001193 | |||
| 1533 | Ga0500596_008841 | |||
| 1534 | Ga0500601_000133 | |||
| 1535 | Ga0500661_001633 | |||
| 1536 | Ga0501082_0052818 | |||
| 1537 | 2928538337 | |||
| 1538 | 2507506859 | |||
| 1539 | 2508540894 | |||
| 1540 | 2508696823 | |||
| 1541 | 2509154162 | |||
| 1542 | 2511399239 | |||
| 1543 | 2513623816 | |||
| 1544 | 2513641489 | |||
| 1545 | 2513650496 | |||
| 1546 | 2513654894 | |||
| 1547 | 2513676652 | |||
| 1548 | 2513693431 | |||
| 1549 | 2513705239 | |||
| 1550 | 2513720114 | |||
| 1551 | 2513861309 | |||
| 1552 | 2513877412 | |||
| 1553 | 2513892269 | |||
| 1554 | 2513916083 | |||
| 1555 | 2514013091 | |||
| 1556 | 2515629681 | |||
| 1557 | 2517106375 | |||
| 1558 | 2517894618 | |||
| 1559 | 2524439395 | |||
| 1560 | 2524471274 | |||
| 1561 | 2524534716 | |||
| 1562 | 2528853120 | |||
| 1563 | 2599738105 | |||
| 1564 | 2599742523 | |||
| 1565 | 2617348202 | |||
| 1566 | 2617377585 | |||
| 1567 | 2644287487 | |||
| 1568 | 2671119044 | |||
| 1569 | 2723848324 | |||
| 1570 | 2728748821 | |||
| 1571 | 2739353332 | |||
| 1572 | 2745078107 | |||
| 1573 | 2793064264 | |||
| 1574 | 2793072294 | |||
| 1575 | 2793079575 | |||
| 1576 | 2805918937 | |||
| 1577 | 2818242093 | |||
| 1578 | 2824603118 | |||
| 1579 | 2824613610 | |||
| 1580 | 2824620524 | |||
| 1581 | 2824634140 | |||
| 1582 | 2824641496 | |||
| 1583 | 2824652271 | |||
| 1584 | 2824658151 | |||
| 1585 | 2824664339 | |||
| 1586 | 2824686785 | |||
| 1587 | 2824711714 | |||
| 1588 | 2824722698 | |||
| 1589 | 2824729320 | |||
| 1590 | 2824752040 | |||
| 1591 | 2824757524 | |||
| 1592 | 2824768044 | |||
| 1593 | 2824779650 | |||
| 1594 | 2838126825 | |||
| 1595 | 2841945703 | |||
| 1596 | 2841954895 | |||
| 1597 | 2841963261 | |||
| 1598 | 2841972302 | |||
| 1599 | 2841980385 | |||
| 1600 | 2841988550 | |||
| 1601 | 2842044849 | |||
| 1602 | 2842052965 | |||
| 1603 | 2847938280 | |||
| 1604 | 2847940198 | |||
| 1605 | 2851182991 | |||
| 1606 | 2857510834 | |||
| 1607 | 2857529781 | |||
| 1608 | 2863421932 | |||
| 1609 | 2874593994 | |||
| 1610 | 2874607453 | |||
| 1611 | 2874618854 | |||
| 1612 | 2874626005 | |||
| 1613 | 2874630758 | |||
| 1614 | 2874647925 | |||
| 1615 | 2876761943 | |||
| 1616 | 2876774140 | |||
| 1617 | 2876821092 | |||
| 1618 | 2879078917 | |||
| 1619 | 2879086133 | |||
| 1620 | 2879104828 | |||
| 1621 | 2879127924 | |||
| 1622 | 2879147648 | |||
| 1623 | 2881364341 | |||
| 1624 | 2881666752 | |||
| 1625 | 2885367916 | |||
| 1626 | 2885378103 | |||
| 1627 | 2885388799 | |||
| 1628 | 2885414694 | |||
| 1629 | 2888386155 | |||
| 1630 | 2888392116 | |||
| 1631 | 2888426301 | |||
| 1632 | 2889037132 | |||
| 1633 | 2903769802 | |||
| 1634 | 2904566097 | |||
| 1635 | 2904672487 | |||
| 1636 | 2904698024 | |||
| 1637 | 2904700141 | |||
| 1638 | 2904712911 | |||
| 1639 | 2906611346 | |||
| 1640 | 2906643454 | |||
| 1641 | 2906645275 | |||
| 1642 | 2906661322 | |||
| 1643 | 2908744926 | |||
| 1644 | 2908763062 | |||
| 1645 | 2908782379 | |||
| 1646 | 2922361279 | |||
| 1647 | 2922370398 | |||
| 1648 | 2922392907 | |||
| 1649 | 2922399730 | |||
| 1650 | 2922428026 | |||
| 1651 | 2929621410 | |||
| 1652 | 2929631776 | |||
| 1653 | 2932792553 | |||
| 1654 | 2932798659 | |||
| 1655 | 2932806529 | |||
| 1656 | 2932815361 | |||
| 1657 | 2932824360 | |||
| 1658 | 2932832240 | |||
| 1659 | 2933583565 | |||
| 1660 | 2935615859 | |||
| 1661 | 2935622178 | |||
| 1662 | 2935632048 | |||
| 1663 | 2935646436 | |||
| 1664 | 2935653875 | |||
| 1665 | 2935662624 | |||
| 1666 | 2935669273 | |||
| 1667 | 2935683168 | |||
| 1668 | 2935692110 | |||
| 1669 | 2935702485 | |||
| 1670 | 2935708651 | |||
| 1671 | 2935720651 | |||
| 1672 | 2935729932 | |||
| 1673 | 2935739085 | |||
| 1674 | 2935748374 | |||
| 1675 | 2935758576 | |||
| 1676 | 2935765996 | |||
| 1677 | 2935772255 | |||
| 1678 | 2935783791 | |||
| 1679 | 2935787705 | |||
| 1680 | 2935793738 | |||
| 1681 | 2935805989 | |||
| 1682 | 2935815451 | |||
| 1683 | 2935826806 | |||
| 1684 | 2935835589 | |||
| 1685 | 2935843367 | |||
| 1686 | 2935853986 | |||
| 1687 | 2935860425 | |||
| 1688 | 2935867823 | |||
| 1689 | 2935878368 | |||
| 1690 | 2935888632 | |||
| 1691 | 2935914924 | |||
| 1692 | 2935923121 | |||
| 1693 | 2935932397 | |||
| 1694 | 2935940995 | |||
| 1695 | 2935949112 | |||
| 1696 | 2935957807 | |||
| 1697 | 2935964807 | |||
| 1698 | 2935974072 | |||
| 1699 | 2935981363 | |||
| 1700 | 2935990271 | |||
| 1701 | 2935998749 | |||
| 1702 | 2936007054 | |||
| 1703 | 2936015375 | |||
| 1704 | 2936024009 | |||
| 1705 | 2936033024 | |||
| 1706 | 2936040689 | |||
| 1707 | 2936051117 | |||
| 1708 | 2936058494 | |||
| 1709 | 2940564480 | |||
| 1710 | 2941507996 | |||
| 1711 | 2941515499 | |||
| 1712 | 2941523926 | |||
| 1713 | 2941536575 | |||
| 1714 | 2941544913 | |||
| 1715 | 3005477727 | |||
| 1716 | 3005485331 | |||
| 1717 | 3005507670 | |||
| 1718 | 3005593901 | |||
| 1719 | 3005601072 | |||
| 1720 | 3005716539 | |||
| 1721 | 8006933848 | |||
| 1722 | 8006969637 | |||
| 1723 | 8006983520 | |||
| 1724 | 8006990646 | |||
| 1725 | 8006998713 | |||
| 1726 | 8016519912 | |||
| 1727 | 8016527823 | |||
| 1728 | 8016532933 | |||
| 1729 | 8016546169 | |||
| 1730 | 8016564309 | |||
| 1731 | 8016583728 | |||
| 1732 | 8016601995 | |||
| 1733 | 8016608228 | |||
| 1734 | 8016624513 | |||
| 1735 | 8016633975 | |||
| 1736 | 8017065632 | |||
| 1737 | 8019532734 | |||
| 1738 | 8019547117 | |||
| 1739 | 8019551544 | |||
| 1740 | 8019559401 | |||
| 1741 | 8019569497 | |||
| 1742 | 8019598459 | |||
| 1743 | 8019609918 | |||
| 1744 | 8019632472 | |||
| 1745 | 8019647413 | |||
| 1746 | 8019655251 | |||
| 1747 | 8019660389 | |||
| 1748 | 8019669808 | |||
| 1749 | 8019686285 | |||
| 1750 | 8019692442 | |||
| 1751 | 8055744387 | |||
| 1752 | 8056676652 | |||
| 1753 | 8056689648 | |||
| 1754 | 8056691050 | |||
| 1755 | 8056969239 | |||
| 1756 | 8057534326 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nqm-assembly1.cif.gz_A | moea t100a mutant | 0.8182 | 15 | 390 |
| 2nqq-assembly1.cif.gz_B | moea r137q | 0.8123 | 15 | 390 |
| 2nqm-assembly1.cif.gz_A | moea t100a mutant | 0.8111 | 15 | 390 |
| 2nqq-assembly1.cif.gz_B | moea r137q | 0.7824 | 15 | 390 |
| 2nqr-assembly1.cif.gz_B | moea d142n | 0.7809 | 15 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P12281_176_326_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9492 | 164 | 314 | 3.40.980.10 |
| af_P12281_176_326_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9432 | 164 | 314 | 3.40.980.10 |
| 1fc5A01 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9196 | 164 | 314 | 3.40.980.10 |
| af_Q2FVY0_182_332_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9082 | 168 | 312 | 3.40.980.10 |
| af_P9WJQ5_178_322_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9081 | 169 | 304 | 3.40.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S6T8Y4-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9615 | 164 | 310 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A2T4DAF4-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9525 | 164 | 302 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A4U9HQF8-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9497 | 164 | 314 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A2V2T639-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.932 | 164 | 390 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-S6T8Y4-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9306 | 164 | 310 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |