F484386

General Info

Members Datasets Scaffolds Average Seq Length
877 354 1754 91

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10318937|Ga0099794_103189372
Length 105
Sequence MPQFRIPGPLRRLSEGEITVAVEATDLGSAIDALDRRYPGFKDRLLDPTGQLRQFVNVYLNDEDVRLGAGLKAKVSEKDEISIVPAVAGGKAHLDFASWRGGVSS

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
313 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
314 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
315 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
333 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
334 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
335 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 3.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 8.67
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10318937 3300007265 Bacteria 806
2 JGI24752J21851_1028784 3300001976 Bacteria 731
3 Ga0058862_10042774 3300004803 Bacteria 1997
4 Ga0070658_10099237 3300005327 Unclassified 2406
5 Ga0070683_100000145 3300005329 Bacteria 45857
6 Ga0070683_100771117 3300005329 Bacteria 921
7 Ga0070683_101792121 3300005329 Bacteria 590
8 Ga0070690_100063484 3300005330 Bacteria 2383
9 Ga0070690_100409855 3300005330 Bacteria 997
10 Ga0070690_100817625 3300005330 Bacteria 724
11 Ga0068869_100015992 3300005334 Bacteria 5050
12 Ga0068869_100049932 3300005334 Bacteria 3031
13 Ga0070666_10445078 3300005335 Bacteria 935
14 Ga0070680_100075511 3300005336 Bacteria 2774
15 Ga0070680_100246639 3300005336 Bacteria 1510
16 Ga0070680_101198730 3300005336 Bacteria 657
17 Ga0070682_100206318 3300005337 Bacteria 1390
18 Ga0070682_101981592 3300005337 Bacteria 512
19 Ga0068868_100010664 3300005338 Bacteria 6659
20 Ga0068868_100021428 3300005338 Bacteria 4866
21 Ga0068868_100415803 3300005338 Unclassified 1163
22 Ga0068868_101402646 3300005338 Bacteria 652
23 Ga0070660_100109878 3300005339 Bacteria 2192
24 Ga0070660_100134366 3300005339 Bacteria 1981
25 Ga0070689_100037329 3300005340 Bacteria 3714
26 Ga0070689_100547556 3300005340 Bacteria 997
27 Ga0070689_102041662 3300005340 Bacteria 525
28 Ga0070691_10405779 3300005341 Bacteria 769
29 Ga0070687_100098485 3300005343 Bacteria 1632
30 Ga0070661_100922854 3300005344 Bacteria 722
31 Ga0070661_101405250 3300005344 Bacteria 587
32 Ga0070668_100522926 3300005347 Bacteria 1030
33 Ga0070675_100231225 3300005354 Bacteria 1613
34 Ga0070675_100892140 3300005354 Bacteria 815
35 Ga0070671_100379159 3300005355 Bacteria 1208
36 Ga0070674_101731477 3300005356 Bacteria 566
37 Ga0070674_102092586 3300005356 Bacteria 516
38 Ga0070673_100105091 3300005364 Bacteria 2332
39 Ga0070673_102167237 3300005364 Bacteria 528
40 Ga0070688_100046652 3300005365 Bacteria 2684
41 Ga0070688_100453001 3300005365 Bacteria 960
42 Ga0070688_101101960 3300005365 Bacteria 635
43 Ga0070659_100356538 3300005366 Bacteria 1228
44 Ga0070667_100815921 3300005367 Unclassified 866
45 Ga0070703_10030376 3300005406 Bacteria 1627
46 Ga0070703_10152741 3300005406 Bacteria 869
47 Ga0070709_10179755 3300005434 Bacteria 1485
48 Ga0070709_10440703 3300005434 Bacteria 980
49 Ga0070714_100005372 3300005435 Bacteria 9777
50 Ga0070714_100094634 3300005435 Bacteria 2622
51 Ga0070714_100199463 3300005435 Bacteria 1830
52 Ga0070714_100278354 3300005435 Bacteria 1554
53 Ga0070714_100502316 3300005435 Bacteria 1157
54 Ga0070714_100756551 3300005435 Bacteria 939
55 Ga0070714_100837482 3300005435 Bacteria 892
56 Ga0070714_101574405 3300005435 Bacteria 642
57 Ga0070714_101678734 3300005435 Bacteria 620
58 Ga0070714_101694205 3300005435 Bacteria 617
59 Ga0070714_101698361 3300005435 Bacteria 617
60 Ga0070713_100044271 3300005436 Bacteria 3643
61 Ga0070713_100127573 3300005436 Bacteria 2240
62 Ga0070713_100261166 3300005436 Bacteria 1582
63 Ga0070713_100841619 3300005436 Bacteria 881
64 Ga0070713_101140878 3300005436 Bacteria 754
65 Ga0070713_102057853 3300005436 Bacteria 554
66 Ga0070710_10017193 3300005437 Bacteria 3697
67 Ga0070710_10151286 3300005437 Bacteria 1431
68 Ga0070710_10163116 3300005437 Bacteria 1384
69 Ga0070710_10327516 3300005437 Bacteria 1007
70 Ga0070710_10572403 3300005437 Bacteria 783
71 Ga0070701_10217461 3300005438 Bacteria 1138
72 Ga0070701_11063627 3300005438 Bacteria 568
73 Ga0070701_11185315 3300005438 Bacteria 541
74 Ga0070711_100006062 3300005439 Bacteria 7264
75 Ga0070711_100243374 3300005439 Bacteria 1407
76 Ga0070711_100325871 3300005439 Bacteria 1228
77 Ga0070711_100418304 3300005439 Bacteria 1092
78 Ga0070711_100966455 3300005439 Bacteria 729
79 Ga0070705_100023265 3300005440 Bacteria 3325
80 Ga0070705_100422128 3300005440 Bacteria 993
81 Ga0070705_100791049 3300005440 Bacteria 754
82 Ga0070700_100068106 3300005441 Bacteria 2263
83 Ga0070700_100076159 3300005441 Bacteria 2154
84 Ga0070694_100228477 3300005444 Bacteria 1399
85 Ga0070694_101635751 3300005444 Bacteria 547
86 Ga0070708_100000031 3300005445 Bacteria 94496
87 Ga0070708_100002120 3300005445 Bacteria 15315
88 Ga0070708_100002457 3300005445 Bacteria 14347
89 Ga0070708_100021466 3300005445 Bacteria 5460
90 Ga0070708_100136137 3300005445 Bacteria 2275
91 Ga0070708_100214404 3300005445 Bacteria 1804
92 Ga0070708_100243535 3300005445 Unclassified 1688
93 Ga0070708_100371618 3300005445 Bacteria 1348
94 Ga0070708_100413007 3300005445 Bacteria 1273
95 Ga0070708_100450938 3300005445 Bacteria 1214
96 Ga0070708_100804725 3300005445 Bacteria 883
97 Ga0070708_100858925 3300005445 Bacteria 852
98 Ga0070708_101561496 3300005445 Bacteria 614
99 Ga0070708_101599364 3300005445 Unclassified 606
100 Ga0070663_100188256 3300005455 Bacteria 1605
101 Ga0070663_100492115 3300005455 Bacteria 1017
102 Ga0070662_100078848 3300005457 Bacteria 2448
103 Ga0070662_101631875 3300005457 Bacteria 557
104 Ga0070681_10019540 3300005458 Bacteria 6784
105 Ga0068867_102390779 3300005459 Bacteria 503
106 Ga0070685_10463769 3300005466 Bacteria 890
107 Ga0070706_100000699 3300005467 Bacteria 38002
108 Ga0070706_100000863 3300005467 Bacteria 33340
109 Ga0070706_100002294 3300005467 Bacteria 19334
110 Ga0070706_100002302 3300005467 Bacteria 19296
111 Ga0070706_100052995 3300005467 Bacteria 3744
112 Ga0070706_100142822 3300005467 Bacteria 2235
113 Ga0070706_100507123 3300005467 Bacteria 1122
114 Ga0070706_100712664 3300005467 Bacteria 930
115 Ga0070706_101113783 3300005467 Bacteria 727
116 Ga0070706_101205033 3300005467 Bacteria 695
117 Ga0070706_101294086 3300005467 Bacteria 669
118 Ga0070706_101599524 3300005467 Bacteria 594
119 Ga0070706_101634277 3300005467 Bacteria 587
120 Ga0070707_100000010 3300005468 Bacteria 165044
121 Ga0070707_100005260 3300005468 Bacteria 12112
122 Ga0070707_100006733 3300005468 Bacteria 10650
123 Ga0070707_100007900 3300005468 Bacteria 9875
124 Ga0070707_100056146 3300005468 Bacteria 3776
125 Ga0070707_100082180 3300005468 Bacteria 3111
126 Ga0070707_100093478 3300005468 Bacteria 2911
127 Ga0070707_100485909 3300005468 Bacteria 1196
128 Ga0070707_100658905 3300005468 Bacteria 1009
129 Ga0070707_100861145 3300005468 Bacteria 870
130 Ga0070707_101216436 3300005468 Bacteria 719
131 Ga0070707_101770936 3300005468 Bacteria 585
132 Ga0070707_102143298 3300005468 Unclassified 526
133 Ga0070698_100000752 3300005471 Bacteria 34988
134 Ga0070698_100003856 3300005471 Bacteria 16495
135 Ga0070698_100040917 3300005471 Bacteria 4760
136 Ga0070698_100072477 3300005471 Bacteria 3452
137 Ga0070698_100083736 3300005471 Bacteria 3179
138 Ga0070698_100131570 3300005471 Bacteria 2457
139 Ga0070698_100156119 3300005471 Bacteria 2227
140 Ga0070698_100159244 3300005471 Bacteria 2202
141 Ga0070698_100195031 3300005471 Bacteria 1962
142 Ga0070698_100258122 3300005471 Bacteria 1675
143 Ga0070698_100330067 3300005471 Bacteria 1456
144 Ga0070698_101643863 3300005471 Bacteria 594
145 Ga0070699_100000179 3300005518 Bacteria 61333
146 Ga0070699_100000816 3300005518 Bacteria 28838
147 Ga0070699_100014129 3300005518 Bacteria 6869
148 Ga0070699_100035751 3300005518 Bacteria 4294
149 Ga0070699_100289494 3300005518 Bacteria 1468
150 Ga0070699_100357845 3300005518 Bacteria 1316
151 Ga0070699_100914718 3300005518 Bacteria 804
152 Ga0070699_101054872 3300005518 Bacteria 745
153 Ga0070699_101510402 3300005518 Unclassified 616
154 Ga0070699_101691496 3300005518 Bacteria 579
155 Ga0070679_100068374 3300005530 Bacteria 3543
156 Ga0070684_100014905 3300005535 Bacteria 6309
157 Ga0070684_100548735 3300005535 Bacteria 1072
158 Ga0070684_100721666 3300005535 Bacteria 930
159 Ga0070684_102037240 3300005535 Bacteria 542
160 Ga0070697_100000159 3300005536 Bacteria 55138
161 Ga0070697_100005707 3300005536 Bacteria 9587
162 Ga0070697_100023981 3300005536 Bacteria 4855
163 Ga0070697_100031986 3300005536 Bacteria 4233
164 Ga0070697_100096078 3300005536 Bacteria 2458
165 Ga0070697_100135754 3300005536 Bacteria 2066
166 Ga0070697_100180394 3300005536 Bacteria 1790
167 Ga0070697_100337523 3300005536 Bacteria 1300
168 Ga0070697_100399705 3300005536 Unclassified 1192
169 Ga0070697_101437361 3300005536 Bacteria 616
170 Ga0070697_101649010 3300005536 Bacteria 573
171 Ga0070697_101958096 3300005536 Unclassified 524
172 Ga0068853_100285627 3300005539 Bacteria 1522
173 Ga0068853_100894107 3300005539 Bacteria 853
174 Ga0068853_101883597 3300005539 Bacteria 580
175 Ga0070672_100357428 3300005543 Bacteria 1246
176 Ga0070672_100358003 3300005543 Bacteria 1245
177 Ga0070686_100040680 3300005544 Bacteria 2901
178 Ga0070686_100996948 3300005544 Bacteria 687
179 Ga0070695_100127866 3300005545 Bacteria 1747
180 Ga0070695_100237643 3300005545 Bacteria 1320
181 Ga0070695_100250196 3300005545 Bacteria 1289
182 Ga0070695_100423092 3300005545 Bacteria 1014
183 Ga0070695_100747823 3300005545 Bacteria 780
184 Ga0070695_100821801 3300005545 Bacteria 746
185 Ga0070695_100930145 3300005545 Bacteria 704
186 Ga0070696_100140005 3300005546 Bacteria 1768
187 Ga0070696_100440006 3300005546 Bacteria 1027
188 Ga0070696_100783156 3300005546 Bacteria 784
189 Ga0070696_101584625 3300005546 Bacteria 562
190 Ga0070693_100041821 3300005547 Bacteria 2580
191 Ga0070693_100288024 3300005547 Bacteria 1102
192 Ga0070693_101042596 3300005547 Unclassified 621
193 Ga0070693_101643215 3300005547 Bacteria 505
194 Ga0070665_100044096 3300005548 Bacteria 4480
195 Ga0070665_102193175 3300005548 Bacteria 556
196 Ga0070665_102612579 3300005548 Bacteria 506
197 Ga0070704_100055006 3300005549 Bacteria 2820
198 Ga0070704_100057150 3300005549 Bacteria 2773
199 Ga0070704_100120415 3300005549 Bacteria 2015
200 Ga0070704_100775173 3300005549 Bacteria 855
201 Ga0070704_100896975 3300005549 Bacteria 797
202 Ga0070704_102285880 3300005549 Bacteria 503
203 Ga0068855_100023469 3300005563 Bacteria 7388
204 Ga0068855_100031584 3300005563 Bacteria 6324
205 Ga0070664_100140135 3300005564 Bacteria 2129
206 Ga0070664_100261681 3300005564 Bacteria 1557
207 Ga0068857_100128003 3300005577 Bacteria 2289
208 Ga0068857_100327778 3300005577 Bacteria 1415
209 Ga0068854_100174965 3300005578 Bacteria 1672
210 Ga0068854_100267696 3300005578 Bacteria 1371
211 Ga0068856_100011575 3300005614 Bacteria 8556
212 Ga0068856_100141077 3300005614 Bacteria 2417
213 Ga0068856_101184684 3300005614 Bacteria 780
214 Ga0068856_101362881 3300005614 Bacteria 724
215 Ga0070702_100083130 3300005615 Bacteria 1922
216 Ga0068852_100356950 3300005616 Bacteria 1429
217 Ga0068852_100916730 3300005616 Bacteria 893
218 Ga0068859_100040364 3300005617 Bacteria 4684
219 Ga0068859_101541712 3300005617 Bacteria 734
220 Ga0068859_101960453 3300005617 Bacteria 647
221 Ga0068864_100236466 3300005618 Bacteria 1691
222 Ga0068864_100368534 3300005618 Bacteria 1359
223 Ga0068864_101634295 3300005618 Bacteria 648
224 Ga0068866_10099044 3300005718 Bacteria 1604
225 Ga0068866_10335484 3300005718 Bacteria 956
226 Ga0068866_10670245 3300005718 Bacteria 708
227 Ga0068861_101538056 3300005719 Bacteria 654
228 Ga0068870_10051538 3300005840 Bacteria 2179
229 Ga0068870_10539373 3300005840 Bacteria 784
230 Ga0068863_100108042 3300005841 Bacteria 2648
231 Ga0068863_101131502 3300005841 Bacteria 788
232 Ga0068863_101616837 3300005841 Bacteria 657
233 Ga0068858_100050839 3300005842 Bacteria 3836
234 Ga0068858_101140178 3300005842 Bacteria 766
235 Ga0068860_100304475 3300005843 Bacteria 1562
236 Ga0068860_100401612 3300005843 Bacteria 1356
237 Ga0068862_100818048 3300005844 Bacteria 911
238 Ga0070717_10000007 3300006028 Bacteria 304340
239 Ga0070717_10000311 3300006028 Bacteria 32062
240 Ga0070717_10052768 3300006028 Bacteria 3350
241 Ga0070717_10058665 3300006028 Bacteria 3183
242 Ga0070717_10220566 3300006028 Bacteria 1666
243 Ga0070717_10336519 3300006028 Bacteria 1347
244 Ga0070717_10513325 3300006028 Bacteria 1084
245 Ga0070717_11567636 3300006028 Bacteria 597
246 Ga0070715_10220002 3300006163 Bacteria 976
247 Ga0070716_100041838 3300006173 Bacteria 2555
248 Ga0070716_100635056 3300006173 Bacteria 808
249 Ga0070716_100794271 3300006173 Bacteria 732
250 Ga0070712_100064299 3300006175 Bacteria 2601
251 Ga0070712_100095688 3300006175 Bacteria 2185
252 Ga0070712_100130812 3300006175 Bacteria 1902
253 Ga0070712_100461332 3300006175 Bacteria 1059
254 Ga0070712_100496674 3300006175 Bacteria 1022
255 Ga0070712_100692763 3300006175 Bacteria 868
256 Ga0070712_100729511 3300006175 Bacteria 847
257 Ga0070712_100785004 3300006175 Bacteria 816
258 Ga0070712_101189777 3300006175 Bacteria 663
259 Ga0070712_101836911 3300006175 Bacteria 531
260 Ga0097621_100145343 3300006237 Bacteria 2030
261 Ga0068871_101005362 3300006358 Bacteria 777
262 Ga0075428_100257133 3300006844 Bacteria 1881
263 Ga0075433_10062602 3300006852 Bacteria 3258
264 Ga0075433_10921590 3300006852 Bacteria 762
265 Ga0075434_100003014 3300006871 Bacteria 14974
266 Ga0075434_100030172 3300006871 Bacteria 5339
267 Ga0075434_100444047 3300006871 Bacteria 1318
268 Ga0068865_100011095 3300006881 Bacteria 5628
269 Ga0068865_100312475 3300006881 Bacteria 1261
270 Ga0068865_101235531 3300006881 Bacteria 662
271 Ga0075436_100001762 3300006914 Bacteria 14820
272 Ga0075436_100027889 3300006914 Bacteria 3887
273 Ga0075436_100055733 3300006914 Bacteria 2730
274 Ga0075436_100079505 3300006914 Bacteria 2271
275 Ga0075436_100112114 3300006914 Bacteria 1904
276 Ga0075436_100139810 3300006914 Bacteria 1701
277 Ga0075436_100210389 3300006914 Bacteria 1378
278 Ga0075436_100214670 3300006914 Bacteria 1364
279 Ga0075436_100463824 3300006914 Bacteria 923
280 Ga0075436_100740605 3300006914 Bacteria 730
281 Ga0097620_100040360 3300006931 Bacteria 4684
282 Ga0097620_101541635 3300006931 Bacteria 734
283 Ga0097620_101960284 3300006931 Bacteria 647
284 Ga0075435_100001856 3300007076 Bacteria 13719
285 Ga0075435_100012054 3300007076 Bacteria 6388
286 Ga0075435_100086854 3300007076 Bacteria 2576
287 Ga0075435_100174918 3300007076 Bacteria 1812
288 Ga0075435_100201319 3300007076 Bacteria 1687
289 Ga0075435_101779753 3300007076 Bacteria 541
290 Ga0099794_10001891 3300007265 Bacteria 7504
291 Ga0099794_10184311 3300007265 Bacteria 1066
292 Ga0099794_10202434 3300007265 Bacteria 1017
293 Ga0099795_10027923 3300007788 Bacteria 1914
294 Ga0105244_10520672 3300009036 Bacteria 548
295 Ga0105240_10018348 3300009093 Bacteria 9399
296 Ga0105240_11275897 3300009093 Bacteria 775
297 Ga0105240_11486871 3300009093 Bacteria 710
298 Ga0111539_10093630 3300009094 Bacteria 3529
299 Ga0105245_10012760 3300009098 Bacteria 7318
300 Ga0105245_10041252 3300009098 Bacteria 4114
301 Ga0105245_10477224 3300009098 Bacteria 1260
302 Ga0105245_10538331 3300009098 Unclassified 1189
303 Ga0105247_10162895 3300009101 Bacteria 1478
304 Ga0114129_10813078 3300009147 Bacteria 1191
305 Ga0114129_13317042 3300009147 Unclassified 520
306 Ga0105243_10880280 3300009148 Bacteria 889
307 Ga0105243_11853126 3300009148 Bacteria 635
308 Ga0105243_12768105 3300009148 Bacteria 531
309 Ga0105241_10224829 3300009174 Bacteria 1579
310 Ga0105241_10521963 3300009174 Bacteria 1062
311 Ga0105241_10631426 3300009174 Bacteria 971
312 Ga0105241_11580911 3300009174 Bacteria 633
313 Ga0105242_10309225 3300009176 Bacteria 1445
314 Ga0105242_10367984 3300009176 Bacteria 1332
315 Ga0105242_10644756 3300009176 Bacteria 1029
316 Ga0105242_10763801 3300009176 Bacteria 953
317 Ga0105242_13012563 3300009176 Archaea 521
318 Ga0105248_10016871 3300009177 Bacteria 8038
319 Ga0105248_10573262 3300009177 Bacteria 1273
320 Ga0105248_12123046 3300009177 Bacteria 639
321 Ga0105237_10448367 3300009545 Bacteria 1296
322 Ga0105237_10781886 3300009545 Bacteria 961
323 Ga0105238_10025609 3300009551 Bacteria 6013
324 Ga0105238_10080271 3300009551 Bacteria 3252
325 Ga0105238_11536297 3300009551 Bacteria 695
326 Ga0105249_11773064 3300009553 Bacteria 690
327 Ga0099796_10033957 3300010159 Bacteria 1682
328 Ga0105239_10052486 3300010375 Bacteria 4471
329 Ga0105239_10059691 3300010375 Bacteria 4186
330 Ga0105239_10283372 3300010375 Bacteria 1866
331 Ga0105239_10371343 3300010375 Bacteria 1616
332 Ga0105239_10682272 3300010375 Bacteria 1174
333 Ga0105246_10019611 3300011119 Bacteria 4325
334 Ga0105246_10546083 3300011119 Bacteria 992
335 Ga0105246_10903097 3300011119 Bacteria 792
336 Ga0105246_10946996 3300011119 Bacteria 776
337 Ga0157373_10179991 3300013100 Bacteria 1488
338 Ga0157370_10310846 3300013104 Bacteria 1454
339 Ga0157369_10279923 3300013105 Bacteria 1737
340 Ga0157374_10123027 3300013296 Bacteria 2506
341 Ga0157374_10248725 3300013296 Bacteria 1749
342 Ga0157374_10481096 3300013296 Bacteria 1245
343 Ga0157378_10457646 3300013297 Bacteria 1267
344 Ga0157378_11228772 3300013297 Bacteria 789
345 Ga0163162_10076816 3300013306 Bacteria 3402
346 Ga0163162_10116789 3300013306 Bacteria 2769
347 Ga0157372_10379896 3300013307 Bacteria 1646
348 Ga0157372_10676418 3300013307 Bacteria 1201
349 Ga0157372_10895764 3300013307 Bacteria 1029
350 Ga0157372_11136463 3300013307 Bacteria 903
351 Ga0157372_12029283 3300013307 Bacteria 661
352 Ga0157375_10016633 3300013308 Bacteria 6614
353 Ga0157375_11681551 3300013308 Bacteria 751
354 Ga0157375_12584359 3300013308 Bacteria 607
355 Ga0163163_11765513 3300014325 Bacteria 679
356 Ga0163163_13075774 3300014325 Bacteria 520
357 Ga0157380_11152086 3300014326 Bacteria 817
358 Ga0157380_13082640 3300014326 Bacteria 531
359 Ga0157377_10205938 3300014745 Bacteria 1252
360 Ga0157377_10262439 3300014745 Bacteria 1124
361 Ga0157379_10039521 3300014968 Bacteria 4209
362 Ga0197907_11294871 3300020069 Bacteria 937
363 Ga0206356_10462906 3300020070 Bacteria 514
364 Ga0206356_10992488 3300020070 Bacteria 2247
365 Ga0206356_11248207 3300020070 Bacteria 774
366 Ga0206349_1305439 3300020075 Bacteria 864
367 Ga0206349_1447221 3300020075 Bacteria 961
368 Ga0206355_1023961 3300020076 Bacteria 609
369 Ga0206355_1466628 3300020076 Bacteria 541
370 Ga0206355_1692344 3300020076 Bacteria 1247
371 Ga0206351_10231326 3300020077 Bacteria 1837
372 Ga0206351_10321937 3300020077 Bacteria 848
373 Ga0206352_10102281 3300020078 Bacteria 968
374 Ga0206350_10313600 3300020080 Bacteria 928
375 Ga0206350_10675730 3300020080 Bacteria 1354
376 Ga0206350_11325530 3300020080 Unclassified 661
377 Ga0206350_11392879 3300020080 Bacteria 546
378 Ga0206354_10371185 3300020081 Bacteria 1312
379 Ga0206353_10299757 3300020082 Bacteria 831
380 Ga0206353_10332790 3300020082 Bacteria 1362
381 Ga0206353_10980072 3300020082 Bacteria 743
382 Ga0154015_1283434 3300020610 Bacteria 604
383 Ga0213874_10385613 3300021377 Bacteria 543
384 Ga0224712_10014892 3300022467 Bacteria 2518
385 Ga0224712_10018971 3300022467 Bacteria 2309
386 Ga0224712_10028745 3300022467 Bacteria 1990
387 Ga0207656_10155770 3300025321 Bacteria 1084
388 Ga0207656_10286447 3300025321 Bacteria 813
389 Ga0207653_10033360 3300025885 Bacteria 1670
390 Ga0207692_10606015 3300025898 Bacteria 704
391 Ga0207692_10676850 3300025898 Bacteria 668
392 Ga0207692_11187083 3300025898 Bacteria 507
393 Ga0207642_10158251 3300025899 Bacteria 1213
394 Ga0207642_10536617 3300025899 Bacteria 721
395 Ga0207710_10309194 3300025900 Bacteria 800
396 Ga0207688_10262179 3300025901 Bacteria 1049
397 Ga0207643_10099040 3300025908 Bacteria 1708
398 Ga0207643_10119606 3300025908 Bacteria 1559
399 Ga0207643_10217868 3300025908 Bacteria 1167
400 Ga0207705_10121335 3300025909 Unclassified 1940
401 Ga0207684_10000026 3300025910 Bacteria 316711
402 Ga0207684_10000051 3300025910 Bacteria 230737
403 Ga0207684_10000060 3300025910 Bacteria 205816
404 Ga0207684_10000489 3300025910 Bacteria 50446
405 Ga0207684_10001336 3300025910 Bacteria 27075
406 Ga0207684_10016961 3300025910 Bacteria 6256
407 Ga0207684_10030271 3300025910 Bacteria 4609
408 Ga0207684_10051569 3300025910 Bacteria 3491
409 Ga0207684_10162747 3300025910 Bacteria 1922
410 Ga0207684_10634452 3300025910 Unclassified 911
411 Ga0207684_11518501 3300025910 Unclassified 545
412 Ga0207654_10010230 3300025911 Bacteria 4774
413 Ga0207707_10143991 3300025912 Bacteria 2083
414 Ga0207695_10020734 3300025913 Bacteria 7519
415 Ga0207695_10543663 3300025913 Bacteria 1043
416 Ga0207671_10167797 3300025914 Bacteria 1703
417 Ga0207671_10281407 3300025914 Bacteria 1312
418 Ga0207693_10020788 3300025915 Bacteria 5220
419 Ga0207693_10139859 3300025915 Bacteria 1904
420 Ga0207693_10239111 3300025915 Bacteria 1426
421 Ga0207693_10285492 3300025915 Bacteria 1293
422 Ga0207693_10325925 3300025915 Bacteria 1202
423 Ga0207663_10012049 3300025916 Bacteria 4662
424 Ga0207663_10102677 3300025916 Bacteria 1924
425 Ga0207663_10291726 3300025916 Bacteria 1215
426 Ga0207663_11508906 3300025916 Bacteria 541
427 Ga0207660_10985125 3300025917 Bacteria 688
428 Ga0207662_10098376 3300025918 Bacteria 1810
429 Ga0207657_10000760 3300025919 Bacteria 34201
430 Ga0207657_10615376 3300025919 Bacteria 847
431 Ga0207649_10591338 3300025920 Bacteria 853
432 Ga0207652_10045838 3300025921 Bacteria 3728
433 Ga0207652_10251808 3300025921 Bacteria 1593
434 Ga0207646_10000041 3300025922 Bacteria 187336
435 Ga0207646_10000083 3300025922 Bacteria 126076
436 Ga0207646_10000189 3300025922 Bacteria 83815
437 Ga0207646_10003811 3300025922 Bacteria 16765
438 Ga0207646_10006325 3300025922 Bacteria 12269
439 Ga0207646_10009524 3300025922 Bacteria 9591
440 Ga0207646_10013289 3300025922 Bacteria 7878
441 Ga0207646_10016696 3300025922 Bacteria 6886
442 Ga0207646_10026436 3300025922 Bacteria 5295
443 Ga0207646_10036342 3300025922 Bacteria 4446
444 Ga0207646_10061947 3300025922 Bacteria 3339
445 Ga0207646_10078969 3300025922 Bacteria 2942
446 Ga0207646_10438752 3300025922 Bacteria 1178
447 Ga0207646_10561637 3300025922 Bacteria 1026
448 Ga0207646_11526677 3300025922 Unclassified 578
449 Ga0207646_11767787 3300025922 Unclassified 529
450 Ga0207646_11888857 3300025922 Bacteria 509
451 Ga0207694_10101362 3300025924 Bacteria 2281
452 Ga0207650_10148219 3300025925 Bacteria 1850
453 Ga0207659_10168282 3300025926 Bacteria 1727
454 Ga0207659_10610516 3300025926 Bacteria 930
455 Ga0207687_10030219 3300025927 Bacteria 3651
456 Ga0207687_10069845 3300025927 Bacteria 2506
457 Ga0207687_10272172 3300025927 Unclassified 1354
458 Ga0207687_10736948 3300025927 Bacteria 838
459 Ga0207700_10080652 3300025928 Bacteria 2538
460 Ga0207700_10165879 3300025928 Bacteria 1838
461 Ga0207700_10304957 3300025928 Bacteria 1376
462 Ga0207700_10500102 3300025928 Bacteria 1076
463 Ga0207700_10554586 3300025928 Bacteria 1020
464 Ga0207700_11304524 3300025928 Bacteria 647
465 Ga0207700_11816044 3300025928 Bacteria 536
466 Ga0207664_10001934 3300025929 Bacteria 13612
467 Ga0207664_10061226 3300025929 Bacteria 3002
468 Ga0207664_10097477 3300025929 Bacteria 2422
469 Ga0207664_10110211 3300025929 Bacteria 2288
470 Ga0207664_10220672 3300025929 Bacteria 1644
471 Ga0207664_10351231 3300025929 Bacteria 1305
472 Ga0207664_10412904 3300025929 Bacteria 1202
473 Ga0207664_10486481 3300025929 Bacteria 1104
474 Ga0207664_10645870 3300025929 Bacteria 951
475 Ga0207664_11559573 3300025929 Bacteria 582
476 Ga0207644_10057611 3300025931 Bacteria 2806
477 Ga0207644_10103065 3300025931 Bacteria 2147
478 Ga0207690_10097176 3300025932 Bacteria 2095
479 Ga0207690_10645440 3300025932 Bacteria 867
480 Ga0207706_10020580 3300025933 Bacteria 5931
481 Ga0207706_10135212 3300025933 Bacteria 2169
482 Ga0207686_10388629 3300025934 Bacteria 1060
483 Ga0207686_10819761 3300025934 Archaea 747
484 Ga0207686_10909327 3300025934 Bacteria 710
485 Ga0207709_10663056 3300025935 Bacteria 832
486 Ga0207709_10796675 3300025935 Bacteria 762
487 Ga0207709_11093040 3300025935 Bacteria 654
488 Ga0207670_10308451 3300025936 Bacteria 1241
489 Ga0207669_11721860 3300025937 Bacteria 535
490 Ga0207704_10473617 3300025938 Bacteria 1004
491 Ga0207704_11254191 3300025938 Bacteria 633
492 Ga0207665_10009434 3300025939 Bacteria 6404
493 Ga0207665_10268519 3300025939 Bacteria 1266
494 Ga0207665_10366555 3300025939 Bacteria 1090
495 Ga0207665_10627942 3300025939 Bacteria 841
496 Ga0207691_10259786 3300025940 Bacteria 1497
497 Ga0207691_10357588 3300025940 Bacteria 1249
498 Ga0207711_10220848 3300025941 Bacteria 1733
499 Ga0207711_10512931 3300025941 Bacteria 1118
500 Ga0207689_10031037 3300025942 Bacteria 4451
501 Ga0207689_10065969 3300025942 Bacteria 2977
502 Ga0207689_11086235 3300025942 Bacteria 674
503 Ga0207661_10001823 3300025944 Bacteria 14563
504 Ga0207679_10135594 3300025945 Bacteria 1982
505 Ga0207679_10147773 3300025945 Bacteria 1909
506 Ga0207667_10043289 3300025949 Bacteria 4779
507 Ga0207667_10166359 3300025949 Bacteria 2267
508 Ga0207651_10524639 3300025960 Bacteria 1027
509 Ga0207651_11180305 3300025960 Bacteria 687
510 Ga0207651_11376673 3300025960 Bacteria 635
511 Ga0207712_11525094 3300025961 Bacteria 599
512 Ga0207668_10312637 3300025972 Bacteria 1301
513 Ga0207668_10611073 3300025972 Bacteria 951
514 Ga0207640_10056161 3300025981 Bacteria 2582
515 Ga0207640_10225138 3300025981 Bacteria 1439
516 Ga0207640_10557888 3300025981 Bacteria 963
517 Ga0207658_10460998 3300025986 Bacteria 1127
518 Ga0207658_10777848 3300025986 Unclassified 868
519 Ga0207677_10285718 3300026023 Bacteria 1356
520 Ga0207677_10849060 3300026023 Bacteria 820
521 Ga0207677_11271627 3300026023 Bacteria 675
522 Ga0207703_10643805 3300026035 Bacteria 1005
523 Ga0207639_10389514 3300026041 Bacteria 1253
524 Ga0207639_11435302 3300026041 Bacteria 648
525 Ga0207639_11481861 3300026041 Bacteria 637
526 Ga0207678_10249489 3300026067 Bacteria 1520
527 Ga0207708_10087451 3300026075 Bacteria 2400
528 Ga0207702_10002972 3300026078 Bacteria 15786
529 Ga0207702_10073797 3300026078 Bacteria 2943
530 Ga0207702_10483247 3300026078 Bacteria 1205
531 Ga0207702_11080926 3300026078 Bacteria 796
532 Ga0207641_10099776 3300026088 Bacteria 2556
533 Ga0207641_10161367 3300026088 Bacteria 2038
534 Ga0207641_10793084 3300026088 Bacteria 937
535 Ga0207648_10991644 3300026089 Bacteria 787
536 Ga0207676_10281913 3300026095 Bacteria 1509
537 Ga0207676_11213057 3300026095 Bacteria 748
538 Ga0207674_10011318 3300026116 Bacteria 10027
539 Ga0207674_10077557 3300026116 Bacteria 3328
540 Ga0207675_100463797 3300026118 Bacteria 1257
541 Ga0207683_10053974 3300026121 Bacteria 3524
542 Ga0207683_11245271 3300026121 Bacteria 689
543 Ga0207698_11846673 3300026142 Bacteria 619
544 Ga0207698_12349679 3300026142 Bacteria 545
545 Ga0209588_1000092 3300027671 Bacteria 28466
546 Ga0207428_10058235 3300027907 Bacteria 3066
547 Ga0268266_11203691 3300028379 Bacteria 732
548 Ga0268265_10509803 3300028380 Bacteria 1135
549 Ga0268264_10444871 3300028381 Bacteria 1254
550 Ga0268264_10580211 3300028381 Bacteria 1103
551 Ga0268264_11194204 3300028381 Bacteria 770
552 Ga0307517_10107822 3300028786 Unclassified 2142
553 Ga0265338_10037462 3300028800 Bacteria 4615
554 Ga0265331_10525125 3300031250 Bacteria 533
555 Ga0265327_10004254 3300031251 Bacteria 12837
556 Ga0265327_10335993 3300031251 Bacteria 661
557 Ga0307508_10010758 3300031616 Bacteria 8366
558 Ga0307516_10054760 3300031730 Bacteria 3897
559 Ga0307411_11857409 3300032005 Bacteria 560
560 Ga0373958_0076925 3300034819 Bacteria 750
561 Ga0373926_0014997 3300035083 Bacteria 2640
562 Ga0373926_0241347 3300035083 Bacteria 700
563 Ga0373934_0049096 3300035086 Bacteria 1671
564 Ga0373934_0184010 3300035086 Bacteria 859
565 Ga0373944_0005212 3300035089 Bacteria 3418
566 Ga0373949_0000025 3300035090 Bacteria 53582
567 Ga0373939_0421508 3300035114 Bacteria 557
568 Ga0373941_0007798 3300035115 Bacteria 2634
569 Ga0373945_0002355 3300035116 Bacteria 5930
570 Ga0373945_0434557 3300035116 Bacteria 579
571 Ga0373953_0141007 3300035117 Bacteria 1031
572 Ga0373953_0561334 3300035117 Bacteria 508
573 Ga0373954_0057417 3300035118 Bacteria 1833
574 Ga0373954_0145785 3300035118 Bacteria 1156
575 Ga0373956_0023960 3300035119 Bacteria 2625
576 Ga0373956_0386950 3300035119 Bacteria 667
577 Ga0373957_0085982 3300035120 Bacteria 1245
578 Ga0373957_0178210 3300035120 Bacteria 880
579 Ga0373960_0436104 3300035121 Bacteria 511
580 Ga0373943_0001762 3300035170 Bacteria 9793
581 Ga0373943_0478817 3300035170 Bacteria 726
582 Ga0373946_0035563 3300035171 Bacteria 2016
583 Ga0373955_0045293 3300035172 Bacteria 2374
584 Ga0373924_0129989 3300035410 Bacteria 1096
585 Ga0373935_0116661 3300035692 Bacteria 1778
586 Ga0373935_0479750 3300035692 Bacteria 901
587 Ga0373927_0477451 3300035695 Bacteria 824
588 Ga0373933_0625185 3300035724 Bacteria 707
589 Ga0373947_0025146 3300035725 Bacteria 3472
590 Ga0373947_0025343 3300035725 Bacteria 3458
591 Ga0373947_0114084 3300035725 Bacteria 1710
592 Ga0373947_0673233 3300035725 Bacteria 706
593 Ga0373937_0429856 3300036401 Bacteria 1253
594 Ga0373937_0617941 3300036401 Bacteria 1028
595 Ga0373925_0009592 3300037068 Bacteria 7053
596 Ga0373925_0362525 3300037068 Bacteria 1178
597 Ga0373925_0582741 3300037068 Bacteria 921
598 Ga0436363_1579912 3300039450 Bacteria 658
599 Ga0451789_1041019 3300041443 Bacteria 542
600 Ga0451795_1233397 3300041456 Unclassified 511
601 Ga0451802_0450762 3300041460 Unclassified 508
602 Ga0451807_0361109 3300041486 Bacteria 792
603 Ga0451853_1798004 3300041512 Bacteria 618
604 Ga0466972_0162782 3300044658 Bacteria 1048
605 Ga0466963_0006434 3300044694 Bacteria 6948
606 Ga0466963_0078458 3300044694 Bacteria 2232
607 Ga0466963_1072417 3300044694 Bacteria 567
608 Ga0466964_0449711 3300044706 Bacteria 683
609 Ga0466971_0102465 3300044719 Bacteria 1316
610 Ga0466971_0108777 3300044719 Bacteria 1278
611 Ga0466968_0132480 3300044735 Bacteria 1135
612 Ga0466970_0179441 3300044765 Bacteria 1175
613 Ga0466970_0570238 3300044765 Bacteria 655
614 Ga0466957_0041210 3300044842 Bacteria 2792
615 Ga0466957_1367300 3300044842 Unclassified 515
616 Ga0466960_0020788 3300044901 Bacteria 2913
617 Ga0466960_0085792 3300044901 Bacteria 1595
618 Ga0466959_0285216 3300045049 Bacteria 1133
619 Ga0466958_0060016 3300045836 Bacteria 2315
620 Ga0466958_0360565 3300045836 Bacteria 936
621 Ga0466958_0561936 3300045836 Bacteria 741
622 Ga0466967_0001586 3300045976 Bacteria 13370
623 Ga0466967_0005584 3300045976 Bacteria 8744
624 Ga0466967_0176674 3300045976 Bacteria 2011
625 Ga0466967_0379932 3300045976 Bacteria 1371
626 Ga0495592_0195550 3300046454 Bacteria 1368
627 Ga0495592_0926159 3300046454 Bacteria 511
628 Ga0495603_0146742 3300046455 Bacteria 1371
629 Ga0495603_0265200 3300046455 Bacteria 988
630 Ga0495590_0087502 3300046457 Bacteria 1101
631 Ga0495629_0008110 3300046459 Bacteria 7729
632 Ga0495629_0714774 3300046459 Bacteria 665
633 Ga0495641_0005113 3300046461 Bacteria 8987
634 Ga0495641_0022081 3300046461 Bacteria 3190
635 Ga0495641_0051642 3300046461 Bacteria 1876
636 Ga0495651_0091528 3300046462 Bacteria 2279
637 Ga0495651_0290162 3300046462 Bacteria 1101
638 Ga0495653_0028104 3300046463 Bacteria 4500
639 Ga0495653_0370132 3300046463 Bacteria 917
640 Ga0495580_0132771 3300046472 Bacteria 1726
641 Ga0495580_0564358 3300046472 Bacteria 755
642 Ga0495582_0005050 3300046473 Bacteria 7393
643 Ga0495582_0032521 3300046473 Bacteria 2868
644 Ga0495582_0240119 3300046473 Bacteria 1038
645 Ga0495582_0503242 3300046473 Bacteria 700
646 Ga0495639_0001768 3300046475 Bacteria 9563
647 Ga0495639_0363365 3300046475 Bacteria 728
648 Ga0495662_0107740 3300046476 Bacteria 1364
649 Ga0495664_0062824 3300046477 Bacteria 2212
650 Ga0495664_0891195 3300046477 Bacteria 520
651 Ga0495594_0022123 3300046499 Bacteria 3399
652 Ga0495608_0006702 3300046511 Bacteria 8165
653 Ga0495608_0565975 3300046511 Bacteria 684
654 Ga0495618_0072953 3300046514 Bacteria 2184
655 Ga0495618_0578074 3300046514 Bacteria 670
656 Ga0495628_0407216 3300046516 Bacteria 993
657 Ga0495630_0007370 3300046517 Bacteria 7858
658 Ga0495630_0128502 3300046517 Bacteria 1924
659 Ga0495630_0289155 3300046517 Bacteria 1252
660 Ga0495666_0003164 3300046526 Bacteria 8283
661 Ga0495666_0336827 3300046526 Bacteria 680
662 Ga0495652_0312746 3300046529 Bacteria 1137
663 Ga0495652_0387419 3300046529 Bacteria 993
664 Ga0495665_0002272 3300046531 Bacteria 10400
665 Ga0495665_0198980 3300046531 Bacteria 1039
666 Ga0495665_0537033 3300046531 Bacteria 587
667 Ga0495640_0036656 3300046533 Bacteria 3463
668 Ga0495640_0230580 3300046533 Bacteria 1165
669 Ga0495640_0757361 3300046533 Bacteria 580
670 Ga0495587_0272996 3300046536 Bacteria 948
671 Ga0495645_0255184 3300046543 Bacteria 1164
672 Ga0495645_0564081 3300046543 Bacteria 704
673 Ga0495622_0319308 3300046557 Bacteria 675
674 Ga0495667_0014109 3300046559 Bacteria 5392
675 Ga0495667_0539834 3300046559 Bacteria 729
676 Ga0495634_0008813 3300046642 Bacteria 7480
677 Ga0495634_0090750 3300046642 Bacteria 1984
678 Ga0495635_0010396 3300046663 Bacteria 6509
679 Ga0495635_0903115 3300046663 Bacteria 565
680 Ga0495588_0016413 3300046674 Bacteria 3578
681 Ga0495588_0045820 3300046674 Bacteria 2243
682 Ga0495657_0005778 3300046675 Bacteria 9745
683 Ga0495657_0131800 3300046675 Bacteria 1565
684 Ga0495599_0191704 3300046678 Bacteria 1257
685 Ga0495623_0331617 3300046679 Bacteria 833
686 Ga0495646_0054983 3300046680 Bacteria 2392
687 Ga0495647_0020782 3300046681 Bacteria 2359
688 Ga0495647_0080749 3300046681 Bacteria 1318
689 Ga0495647_0332017 3300046681 Bacteria 690
690 Ga0495647_0343136 3300046681 Bacteria 679
691 Ga0495658_0005307 3300046683 Bacteria 6338
692 Ga0495658_0015860 3300046683 Bacteria 3872
693 Ga0495613_0005000 3300046689 Bacteria 9957
694 Ga0495613_0320996 3300046689 Bacteria 1069
695 Ga0495624_0004301 3300046690 Bacteria 10453
696 Ga0495624_0304023 3300046690 Bacteria 961
697 Ga0495600_0008182 3300046809 Bacteria 6418
698 Ga0495581_0012611 3300047315 Bacteria 4897
699 Ga0495581_0089476 3300047315 Bacteria 1785
700 Ga0495581_0141193 3300047315 Bacteria 1405
701 Ga0495581_0331817 3300047315 Bacteria 888
702 Ga0495604_0353120 3300047317 Bacteria 976
703 Ga0495636_0437909 3300047318 Bacteria 627
704 Ga0495674_0031367 3300047319 Bacteria 4828
705 Ga0495674_0033812 3300047319 Bacteria 4627
706 Ga0495674_0278743 3300047319 Bacteria 1370
707 Ga0495676_0037729 3300047321 Bacteria 4018
708 Ga0495676_0046300 3300047321 Bacteria 3531
709 Ga0495676_0234965 3300047321 Bacteria 1257
710 Ga0495676_0356615 3300047321 Bacteria 977
711 Ga0495680_0061082 3300047322 Bacteria 2900
712 Ga0495680_0396538 3300047322 Bacteria 953
713 Ga0495675_0087426 3300047444 Bacteria 1958
714 Ga0495684_0056722 3300047471 Bacteria 2985
715 Ga0495684_0291432 3300047471 Bacteria 1175
716 Ga0495684_0930191 3300047471 Bacteria 558
717 Ga0495593_0004302 3300047673 Bacteria 8469
718 Ga0495602_0627654 3300048088 Bacteria 736
719 Ga0495614_0006653 3300048089 Bacteria 5175
720 Ga0496100_0005871 3300048903 Bacteria 6648
721 Ga0496100_0023707 3300048903 Bacteria 3733
722 Ga0496100_0392587 3300048903 Bacteria 1055
723 Ga0496100_1219421 3300048903 Bacteria 593
724 Ga0496101_0070326 3300048904 Bacteria 2563
725 Ga0496101_0078258 3300048904 Bacteria 2438
726 Ga0496101_0085488 3300048904 Bacteria 2337
727 Ga0496101_0197881 3300048904 Bacteria 1552
728 Ga0496101_0902932 3300048904 Bacteria 696
729 Ga0496101_0914188 3300048904 Bacteria 691
730 Ga0496102_0022942 3300048905 Bacteria 5536
731 Ga0496102_0501106 3300048905 Bacteria 1136
732 Ga0496102_0837659 3300048905 Bacteria 842
733 Ga0496102_1568962 3300048905 Bacteria 577
734 Ga0496102_1597272 3300048905 Bacteria 570
735 Ga0496103_0031939 3300048906 Bacteria 3211
736 Ga0496103_0863599 3300048906 Bacteria 568
737 Ga0496104_0024763 3300048907 Bacteria 5526
738 Ga0496104_0157444 3300048907 Bacteria 2180
739 Ga0496104_1453802 3300048907 Bacteria 588
740 Ga0496104_1558113 3300048907 Bacteria 563
741 Ga0496105_0014998 3300048908 Bacteria 6166
742 Ga0496105_0121313 3300048908 Bacteria 2155
743 Ga0496105_0165520 3300048908 Bacteria 1814
744 Ga0496105_0236697 3300048908 Bacteria 1483
745 Ga0496105_0561600 3300048908 Bacteria 890
746 Ga0496106_0004050 3300048909 Bacteria 10937
747 Ga0496106_0541376 3300048909 Bacteria 934
748 Ga0496106_0551757 3300048909 Bacteria 924
749 Ga0496106_1225505 3300048909 Bacteria 584
750 Ga0496106_1403124 3300048909 Bacteria 540
751 Ga0496107_0011834 3300048910 Bacteria 6093
752 Ga0496107_0013560 3300048910 Bacteria 5698
753 Ga0496107_0048402 3300048910 Bacteria 3062
754 Ga0496107_0168753 3300048910 Bacteria 1623
755 Ga0496108_0000678 3300048911 Bacteria 26347
756 Ga0496108_0004013 3300048911 Bacteria 11808
757 Ga0496108_0010272 3300048911 Bacteria 7600
758 Ga0496108_0699564 3300048911 Bacteria 879
759 Ga0496108_1535286 3300048911 Bacteria 553
760 Ga0496109_0015955 3300048912 Bacteria 6561
761 Ga0496109_0057787 3300048912 Bacteria 3542
762 Ga0496109_0067223 3300048912 Bacteria 3283
763 Ga0496109_0097462 3300048912 Bacteria 2725
764 Ga0496109_0342774 3300048912 Bacteria 1411
765 Ga0496110_0021851 3300048913 Bacteria 5425
766 Ga0496110_0115754 3300048913 Bacteria 2413
767 Ga0496110_0307343 3300048913 Bacteria 1444
768 Ga0496110_0553856 3300048913 Bacteria 1045
769 Ga0496111_0000959 3300048914 Bacteria 15758
770 Ga0496111_0031740 3300048914 Bacteria 3763
771 Ga0496111_0304153 3300048914 Bacteria 1182
772 Ga0496111_0457880 3300048914 Bacteria 941
773 Ga0496112_0002978 3300048915 Bacteria 13814
774 Ga0496112_0004620 3300048915 Bacteria 11710
775 Ga0496112_0088929 3300048915 Bacteria 3056
776 Ga0496112_0279310 3300048915 Bacteria 1617
777 Ga0496113_0000046 3300048916 Bacteria 51591
778 Ga0496113_0018393 3300048916 Bacteria 4866
779 Ga0496113_0189733 3300048916 Bacteria 1631
780 Ga0496113_0572077 3300048916 Bacteria 906
781 Ga0496113_1323757 3300048916 Bacteria 560
782 Ga0496113_1513282 3300048916 Bacteria 518
783 Ga0496114_0035786 3300048917 Bacteria 4101
784 Ga0496114_0062012 3300048917 Bacteria 3129
785 Ga0496114_0065767 3300048917 Bacteria 3038
786 Ga0496114_0587896 3300048917 Bacteria 982
787 Ga0496114_0736749 3300048917 Bacteria 862
788 Ga0496114_1121373 3300048917 Bacteria 672
789 Ga0496115_0000833 3300048918 Bacteria 22543
790 Ga0496115_0224321 3300048918 Bacteria 1550
791 Ga0496115_0640124 3300048918 Bacteria 841
792 Ga0496121_0486506 3300048924 Bacteria 787
793 Ga0501292_010497 3300049515 Bacteria 1388
794 Ga0501033_0574605 3300049570 Bacteria 775
795 Ga0501036_1464552 3300049572 Unclassified 553
796 Ga0501068_0155656 3300049584 Bacteria 1439
797 Ga0501069_0019963 3300049585 Bacteria 3626
798 Ga0501069_0037057 3300049585 Viruses 2691
799 Ga0501070_0030454 3300049586 Bacteria 4522
800 Ga0501070_0085439 3300049586 Bacteria 2612
801 Ga0501071_1410521 3300049587 Unclassified 538
802 Ga0501072_0546719 3300049588 Bacteria 915
803 Ga0501074_0398818 3300049590 Bacteria 976
804 Ga0501209_136662 3300049656 Unclassified 733
805 Ga0501216_010274 3300049660 Unclassified 1502
806 Ga0501227_006933 3300049665 Unclassified 2427
807 Ga0501225_0103843 3300049705 Bacteria 832
808 Ga0501081_0613795 3300049743 Bacteria 814
809 Ga0501083_0031557 3300049744 Bacteria 3636
810 Ga0501083_0040451 3300049744 Bacteria 3164
811 nmdc:mga05p37_698800_c1 3300050507 Bacteria 1127
812 nmdc:mga08y16_90242_c1 3300050511 Bacteria 3194
813 nmdc:mga0n895_2018323_c1 3300050512 Unclassified 534
814 nmdc:mga0n895_211317_c1 3300050512 Bacteria 1970
815 nmdc:mga0n895_277_c1 3300050512 Bacteria 33682
816 nmdc:mga0n895_42260_c1 3300050512 Bacteria 4435
817 nmdc:mga0n895_575213_c1 3300050512 Bacteria 1131
818 nmdc:mga0rr50_1502742_c1 3300050513 Bacteria 569
819 nmdc:mga0rr50_281963_c1 3300050513 Bacteria 1386
820 nmdc:mga0rr50_39497_c1 3300050513 Bacteria 3424
821 nmdc:mga0rr50_673634_c1 3300050513 Bacteria 883
822 nmdc:mga0rr50_7416_c1 3300050513 Bacteria 6764
823 nmdc:mga08x19_116652_c1 3300050514 Bacteria 1786
824 nmdc:mga08x19_156952_c1 3300050514 Bacteria 1544
825 nmdc:mga08x19_22494_c1 3300050514 Bacteria 3904
826 nmdc:mga08x19_240857_c1 3300050514 Bacteria 1247
827 nmdc:mga08x19_270645_c1 3300050514 Bacteria 1176
828 nmdc:mga08x19_553810_c1 3300050514 Bacteria 814
829 nmdc:mga08x19_76325_c1 3300050514 Bacteria 2193
830 nmdc:mga08x19_809640_c1 3300050514 Bacteria 665
831 nmdc:mga08x19_908213_c1 3300050514 Bacteria 626
832 nmdc:mga0a205_1188498_c1 3300050515 Bacteria 610
833 Ga0495601_0021309 3300053077 Bacteria 3968
834 Ga0495601_0159623 3300053077 Bacteria 1473
835 Ga0495601_0507752 3300053077 Bacteria 777
836 Ga0495601_0541347 3300053077 Bacteria 750
837 Ga0495612_0034388 3300053078 Bacteria 2052
838 Ga0495612_0120118 3300053078 Bacteria 1130
839 Ga0495612_0124999 3300053078 Bacteria 1108
840 Ga0495595_0219124 3300053084 Bacteria 949
841 Ga0495595_0319096 3300053084 Bacteria 782
842 Ga0495595_0398365 3300053084 Bacteria 697
843 Ga0495619_0066433 3300053085 Bacteria 2406
844 Ga0495619_0342479 3300053085 Bacteria 1034
845 Ga0495619_0555733 3300053085 Bacteria 787
846 Ga0495619_0572911 3300053085 Bacteria 773
847 Ga0500646_0000723 3300053090 Bacteria 9352
848 Ga0500646_0109974 3300053090 Bacteria 875
849 Ga0500647_0039324 3300053091 Bacteria 2267
850 Ga0500583_0073754 3300053092 Bacteria 1637
851 Ga0500566_0026235 3300053094 Bacteria 3411
852 Ga0500640_004702 3300053095 Bacteria 4992
853 Ga0500554_000898 3300053102 Bacteria 5820
854 Ga0500562_012335 3300053108 Unclassified 2174
855 Ga0500572_002020 3300053111 Bacteria 5054
856 Ga0500595_000622 3300053119 Bacteria 21199
857 Ga0500597_012221 3300053120 Bacteria 3140
858 Ga0500608_270695 3300053122 Bacteria 649
859 Ga0500614_001766 3300053123 Bacteria 5019
860 Ga0500559_0002996 3300053136 Bacteria 8464
861 Ga0500620_130452 3300053155 Bacteria 880
862 Ga0500622_0249669 3300053156 Bacteria 780
863 Ga0500639_357420 3300053163 Unclassified 513
864 Ga0500637_0183029 3300053178 Bacteria 1200
865 Ga0587066_120854 3300059490 Bacteria 618
866 Ga0587080_148986 3300059503 Bacteria 540
867 Ga0587088_055410 3300059508 Bacteria 789
868 Ga0587091_142880 3300059511 Bacteria 601
869 Ga0587115_025809 3300059626 Bacteria 846
870 Ga0587107_078939 3300059652 Bacteria 615
871 Ga0587107_092304 3300059652 Bacteria 587
872 Ga0587114_062755 3300059655 Bacteria 656
873 Ga0501082_0038179 3300060353 Bacteria 4143
874 Ga0466962_0013044 3300061719 Bacteria 3997
875 Ga0466962_0034001 3300061719 Bacteria 2439
876 Ga0466962_0437679 3300061719 Bacteria 657
877 Ga0530510_0046767 3300061734 Bacteria 3126
878 Ga0099794_10318937
879 JGI24752J21851_1028784
880 Ga0058862_10042774
881 Ga0070658_10099237
882 Ga0070683_100000145
883 Ga0070683_100771117
884 Ga0070683_101792121
885 Ga0070690_100063484
886 Ga0070690_100409855
887 Ga0070690_100817625
888 Ga0068869_100015992
889 Ga0068869_100049932
890 Ga0070666_10445078
891 Ga0070680_100075511
892 Ga0070680_100246639
893 Ga0070680_101198730
894 Ga0070682_100206318
895 Ga0070682_101981592
896 Ga0068868_100010664
897 Ga0068868_100021428
898 Ga0068868_100415803
899 Ga0068868_101402646
900 Ga0070660_100109878
901 Ga0070660_100134366
902 Ga0070689_100037329
903 Ga0070689_100547556
904 Ga0070689_102041662
905 Ga0070691_10405779
906 Ga0070687_100098485
907 Ga0070661_100922854
908 Ga0070661_101405250
909 Ga0070668_100522926
910 Ga0070675_100231225
911 Ga0070675_100892140
912 Ga0070671_100379159
913 Ga0070674_101731477
914 Ga0070674_102092586
915 Ga0070673_100105091
916 Ga0070673_102167237
917 Ga0070688_100046652
918 Ga0070688_100453001
919 Ga0070688_101101960
920 Ga0070659_100356538
921 Ga0070667_100815921
922 Ga0070703_10030376
923 Ga0070703_10152741
924 Ga0070709_10179755
925 Ga0070709_10440703
926 Ga0070714_100005372
927 Ga0070714_100094634
928 Ga0070714_100199463
929 Ga0070714_100278354
930 Ga0070714_100502316
931 Ga0070714_100756551
932 Ga0070714_100837482
933 Ga0070714_101574405
934 Ga0070714_101678734
935 Ga0070714_101694205
936 Ga0070714_101698361
937 Ga0070713_100044271
938 Ga0070713_100127573
939 Ga0070713_100261166
940 Ga0070713_100841619
941 Ga0070713_101140878
942 Ga0070713_102057853
943 Ga0070710_10017193
944 Ga0070710_10151286
945 Ga0070710_10163116
946 Ga0070710_10327516
947 Ga0070710_10572403
948 Ga0070701_10217461
949 Ga0070701_11063627
950 Ga0070701_11185315
951 Ga0070711_100006062
952 Ga0070711_100243374
953 Ga0070711_100325871
954 Ga0070711_100418304
955 Ga0070711_100966455
956 Ga0070705_100023265
957 Ga0070705_100422128
958 Ga0070705_100791049
959 Ga0070700_100068106
960 Ga0070700_100076159
961 Ga0070694_100228477
962 Ga0070694_101635751
963 Ga0070708_100000031
964 Ga0070708_100002120
965 Ga0070708_100002457
966 Ga0070708_100021466
967 Ga0070708_100136137
968 Ga0070708_100214404
969 Ga0070708_100243535
970 Ga0070708_100371618
971 Ga0070708_100413007
972 Ga0070708_100450938
973 Ga0070708_100804725
974 Ga0070708_100858925
975 Ga0070708_101561496
976 Ga0070708_101599364
977 Ga0070663_100188256
978 Ga0070663_100492115
979 Ga0070662_100078848
980 Ga0070662_101631875
981 Ga0070681_10019540
982 Ga0068867_102390779
983 Ga0070685_10463769
984 Ga0070706_100000699
985 Ga0070706_100000863
986 Ga0070706_100002294
987 Ga0070706_100002302
988 Ga0070706_100052995
989 Ga0070706_100142822
990 Ga0070706_100507123
991 Ga0070706_100712664
992 Ga0070706_101113783
993 Ga0070706_101205033
994 Ga0070706_101294086
995 Ga0070706_101599524
996 Ga0070706_101634277
997 Ga0070707_100000010
998 Ga0070707_100005260
999 Ga0070707_100006733
1000 Ga0070707_100007900
1001 Ga0070707_100056146
1002 Ga0070707_100082180
1003 Ga0070707_100093478
1004 Ga0070707_100485909
1005 Ga0070707_100658905
1006 Ga0070707_100861145
1007 Ga0070707_101216436
1008 Ga0070707_101770936
1009 Ga0070707_102143298
1010 Ga0070698_100000752
1011 Ga0070698_100003856
1012 Ga0070698_100040917
1013 Ga0070698_100072477
1014 Ga0070698_100083736
1015 Ga0070698_100131570
1016 Ga0070698_100156119
1017 Ga0070698_100159244
1018 Ga0070698_100195031
1019 Ga0070698_100258122
1020 Ga0070698_100330067
1021 Ga0070698_101643863
1022 Ga0070699_100000179
1023 Ga0070699_100000816
1024 Ga0070699_100014129
1025 Ga0070699_100035751
1026 Ga0070699_100289494
1027 Ga0070699_100357845
1028 Ga0070699_100914718
1029 Ga0070699_101054872
1030 Ga0070699_101510402
1031 Ga0070699_101691496
1032 Ga0070679_100068374
1033 Ga0070684_100014905
1034 Ga0070684_100548735
1035 Ga0070684_100721666
1036 Ga0070684_102037240
1037 Ga0070697_100000159
1038 Ga0070697_100005707
1039 Ga0070697_100023981
1040 Ga0070697_100031986
1041 Ga0070697_100096078
1042 Ga0070697_100135754
1043 Ga0070697_100180394
1044 Ga0070697_100337523
1045 Ga0070697_100399705
1046 Ga0070697_101437361
1047 Ga0070697_101649010
1048 Ga0070697_101958096
1049 Ga0068853_100285627
1050 Ga0068853_100894107
1051 Ga0068853_101883597
1052 Ga0070672_100357428
1053 Ga0070672_100358003
1054 Ga0070686_100040680
1055 Ga0070686_100996948
1056 Ga0070695_100127866
1057 Ga0070695_100237643
1058 Ga0070695_100250196
1059 Ga0070695_100423092
1060 Ga0070695_100747823
1061 Ga0070695_100821801
1062 Ga0070695_100930145
1063 Ga0070696_100140005
1064 Ga0070696_100440006
1065 Ga0070696_100783156
1066 Ga0070696_101584625
1067 Ga0070693_100041821
1068 Ga0070693_100288024
1069 Ga0070693_101042596
1070 Ga0070693_101643215
1071 Ga0070665_100044096
1072 Ga0070665_102193175
1073 Ga0070665_102612579
1074 Ga0070704_100055006
1075 Ga0070704_100057150
1076 Ga0070704_100120415
1077 Ga0070704_100775173
1078 Ga0070704_100896975
1079 Ga0070704_102285880
1080 Ga0068855_100023469
1081 Ga0068855_100031584
1082 Ga0070664_100140135
1083 Ga0070664_100261681
1084 Ga0068857_100128003
1085 Ga0068857_100327778
1086 Ga0068854_100174965
1087 Ga0068854_100267696
1088 Ga0068856_100011575
1089 Ga0068856_100141077
1090 Ga0068856_101184684
1091 Ga0068856_101362881
1092 Ga0070702_100083130
1093 Ga0068852_100356950
1094 Ga0068852_100916730
1095 Ga0068859_100040364
1096 Ga0068859_101541712
1097 Ga0068859_101960453
1098 Ga0068864_100236466
1099 Ga0068864_100368534
1100 Ga0068864_101634295
1101 Ga0068866_10099044
1102 Ga0068866_10335484
1103 Ga0068866_10670245
1104 Ga0068861_101538056
1105 Ga0068870_10051538
1106 Ga0068870_10539373
1107 Ga0068863_100108042
1108 Ga0068863_101131502
1109 Ga0068863_101616837
1110 Ga0068858_100050839
1111 Ga0068858_101140178
1112 Ga0068860_100304475
1113 Ga0068860_100401612
1114 Ga0068862_100818048
1115 Ga0070717_10000007
1116 Ga0070717_10000311
1117 Ga0070717_10052768
1118 Ga0070717_10058665
1119 Ga0070717_10220566
1120 Ga0070717_10336519
1121 Ga0070717_10513325
1122 Ga0070717_11567636
1123 Ga0070715_10220002
1124 Ga0070716_100041838
1125 Ga0070716_100635056
1126 Ga0070716_100794271
1127 Ga0070712_100064299
1128 Ga0070712_100095688
1129 Ga0070712_100130812
1130 Ga0070712_100461332
1131 Ga0070712_100496674
1132 Ga0070712_100692763
1133 Ga0070712_100729511
1134 Ga0070712_100785004
1135 Ga0070712_101189777
1136 Ga0070712_101836911
1137 Ga0097621_100145343
1138 Ga0068871_101005362
1139 Ga0075428_100257133
1140 Ga0075433_10062602
1141 Ga0075433_10921590
1142 Ga0075434_100003014
1143 Ga0075434_100030172
1144 Ga0075434_100444047
1145 Ga0068865_100011095
1146 Ga0068865_100312475
1147 Ga0068865_101235531
1148 Ga0075436_100001762
1149 Ga0075436_100027889
1150 Ga0075436_100055733
1151 Ga0075436_100079505
1152 Ga0075436_100112114
1153 Ga0075436_100139810
1154 Ga0075436_100210389
1155 Ga0075436_100214670
1156 Ga0075436_100463824
1157 Ga0075436_100740605
1158 Ga0097620_100040360
1159 Ga0097620_101541635
1160 Ga0097620_101960284
1161 Ga0075435_100001856
1162 Ga0075435_100012054
1163 Ga0075435_100086854
1164 Ga0075435_100174918
1165 Ga0075435_100201319
1166 Ga0075435_101779753
1167 Ga0099794_10001891
1168 Ga0099794_10184311
1169 Ga0099794_10202434
1170 Ga0099795_10027923
1171 Ga0105244_10520672
1172 Ga0105240_10018348
1173 Ga0105240_11275897
1174 Ga0105240_11486871
1175 Ga0111539_10093630
1176 Ga0105245_10012760
1177 Ga0105245_10041252
1178 Ga0105245_10477224
1179 Ga0105245_10538331
1180 Ga0105247_10162895
1181 Ga0114129_10813078
1182 Ga0114129_13317042
1183 Ga0105243_10880280
1184 Ga0105243_11853126
1185 Ga0105243_12768105
1186 Ga0105241_10224829
1187 Ga0105241_10521963
1188 Ga0105241_10631426
1189 Ga0105241_11580911
1190 Ga0105242_10309225
1191 Ga0105242_10367984
1192 Ga0105242_10644756
1193 Ga0105242_10763801
1194 Ga0105242_13012563
1195 Ga0105248_10016871
1196 Ga0105248_10573262
1197 Ga0105248_12123046
1198 Ga0105237_10448367
1199 Ga0105237_10781886
1200 Ga0105238_10025609
1201 Ga0105238_10080271
1202 Ga0105238_11536297
1203 Ga0105249_11773064
1204 Ga0099796_10033957
1205 Ga0105239_10052486
1206 Ga0105239_10059691
1207 Ga0105239_10283372
1208 Ga0105239_10371343
1209 Ga0105239_10682272
1210 Ga0105246_10019611
1211 Ga0105246_10546083
1212 Ga0105246_10903097
1213 Ga0105246_10946996
1214 Ga0157373_10179991
1215 Ga0157370_10310846
1216 Ga0157369_10279923
1217 Ga0157374_10123027
1218 Ga0157374_10248725
1219 Ga0157374_10481096
1220 Ga0157378_10457646
1221 Ga0157378_11228772
1222 Ga0163162_10076816
1223 Ga0163162_10116789
1224 Ga0157372_10379896
1225 Ga0157372_10676418
1226 Ga0157372_10895764
1227 Ga0157372_11136463
1228 Ga0157372_12029283
1229 Ga0157375_10016633
1230 Ga0157375_11681551
1231 Ga0157375_12584359
1232 Ga0163163_11765513
1233 Ga0163163_13075774
1234 Ga0157380_11152086
1235 Ga0157380_13082640
1236 Ga0157377_10205938
1237 Ga0157377_10262439
1238 Ga0157379_10039521
1239 Ga0197907_11294871
1240 Ga0206356_10462906
1241 Ga0206356_10992488
1242 Ga0206356_11248207
1243 Ga0206349_1305439
1244 Ga0206349_1447221
1245 Ga0206355_1023961
1246 Ga0206355_1466628
1247 Ga0206355_1692344
1248 Ga0206351_10231326
1249 Ga0206351_10321937
1250 Ga0206352_10102281
1251 Ga0206350_10313600
1252 Ga0206350_10675730
1253 Ga0206350_11325530
1254 Ga0206350_11392879
1255 Ga0206354_10371185
1256 Ga0206353_10299757
1257 Ga0206353_10332790
1258 Ga0206353_10980072
1259 Ga0154015_1283434
1260 Ga0213874_10385613
1261 Ga0224712_10014892
1262 Ga0224712_10018971
1263 Ga0224712_10028745
1264 Ga0207656_10155770
1265 Ga0207656_10286447
1266 Ga0207653_10033360
1267 Ga0207692_10606015
1268 Ga0207692_10676850
1269 Ga0207692_11187083
1270 Ga0207642_10158251
1271 Ga0207642_10536617
1272 Ga0207710_10309194
1273 Ga0207688_10262179
1274 Ga0207643_10099040
1275 Ga0207643_10119606
1276 Ga0207643_10217868
1277 Ga0207705_10121335
1278 Ga0207684_10000026
1279 Ga0207684_10000051
1280 Ga0207684_10000060
1281 Ga0207684_10000489
1282 Ga0207684_10001336
1283 Ga0207684_10016961
1284 Ga0207684_10030271
1285 Ga0207684_10051569
1286 Ga0207684_10162747
1287 Ga0207684_10634452
1288 Ga0207684_11518501
1289 Ga0207654_10010230
1290 Ga0207707_10143991
1291 Ga0207695_10020734
1292 Ga0207695_10543663
1293 Ga0207671_10167797
1294 Ga0207671_10281407
1295 Ga0207693_10020788
1296 Ga0207693_10139859
1297 Ga0207693_10239111
1298 Ga0207693_10285492
1299 Ga0207693_10325925
1300 Ga0207663_10012049
1301 Ga0207663_10102677
1302 Ga0207663_10291726
1303 Ga0207663_11508906
1304 Ga0207660_10985125
1305 Ga0207662_10098376
1306 Ga0207657_10000760
1307 Ga0207657_10615376
1308 Ga0207649_10591338
1309 Ga0207652_10045838
1310 Ga0207652_10251808
1311 Ga0207646_10000041
1312 Ga0207646_10000083
1313 Ga0207646_10000189
1314 Ga0207646_10003811
1315 Ga0207646_10006325
1316 Ga0207646_10009524
1317 Ga0207646_10013289
1318 Ga0207646_10016696
1319 Ga0207646_10026436
1320 Ga0207646_10036342
1321 Ga0207646_10061947
1322 Ga0207646_10078969
1323 Ga0207646_10438752
1324 Ga0207646_10561637
1325 Ga0207646_11526677
1326 Ga0207646_11767787
1327 Ga0207646_11888857
1328 Ga0207694_10101362
1329 Ga0207650_10148219
1330 Ga0207659_10168282
1331 Ga0207659_10610516
1332 Ga0207687_10030219
1333 Ga0207687_10069845
1334 Ga0207687_10272172
1335 Ga0207687_10736948
1336 Ga0207700_10080652
1337 Ga0207700_10165879
1338 Ga0207700_10304957
1339 Ga0207700_10500102
1340 Ga0207700_10554586
1341 Ga0207700_11304524
1342 Ga0207700_11816044
1343 Ga0207664_10001934
1344 Ga0207664_10061226
1345 Ga0207664_10097477
1346 Ga0207664_10110211
1347 Ga0207664_10220672
1348 Ga0207664_10351231
1349 Ga0207664_10412904
1350 Ga0207664_10486481
1351 Ga0207664_10645870
1352 Ga0207664_11559573
1353 Ga0207644_10057611
1354 Ga0207644_10103065
1355 Ga0207690_10097176
1356 Ga0207690_10645440
1357 Ga0207706_10020580
1358 Ga0207706_10135212
1359 Ga0207686_10388629
1360 Ga0207686_10819761
1361 Ga0207686_10909327
1362 Ga0207709_10663056
1363 Ga0207709_10796675
1364 Ga0207709_11093040
1365 Ga0207670_10308451
1366 Ga0207669_11721860
1367 Ga0207704_10473617
1368 Ga0207704_11254191
1369 Ga0207665_10009434
1370 Ga0207665_10268519
1371 Ga0207665_10366555
1372 Ga0207665_10627942
1373 Ga0207691_10259786
1374 Ga0207691_10357588
1375 Ga0207711_10220848
1376 Ga0207711_10512931
1377 Ga0207689_10031037
1378 Ga0207689_10065969
1379 Ga0207689_11086235
1380 Ga0207661_10001823
1381 Ga0207679_10135594
1382 Ga0207679_10147773
1383 Ga0207667_10043289
1384 Ga0207667_10166359
1385 Ga0207651_10524639
1386 Ga0207651_11180305
1387 Ga0207651_11376673
1388 Ga0207712_11525094
1389 Ga0207668_10312637
1390 Ga0207668_10611073
1391 Ga0207640_10056161
1392 Ga0207640_10225138
1393 Ga0207640_10557888
1394 Ga0207658_10460998
1395 Ga0207658_10777848
1396 Ga0207677_10285718
1397 Ga0207677_10849060
1398 Ga0207677_11271627
1399 Ga0207703_10643805
1400 Ga0207639_10389514
1401 Ga0207639_11435302
1402 Ga0207639_11481861
1403 Ga0207678_10249489
1404 Ga0207708_10087451
1405 Ga0207702_10002972
1406 Ga0207702_10073797
1407 Ga0207702_10483247
1408 Ga0207702_11080926
1409 Ga0207641_10099776
1410 Ga0207641_10161367
1411 Ga0207641_10793084
1412 Ga0207648_10991644
1413 Ga0207676_10281913
1414 Ga0207676_11213057
1415 Ga0207674_10011318
1416 Ga0207674_10077557
1417 Ga0207675_100463797
1418 Ga0207683_10053974
1419 Ga0207683_11245271
1420 Ga0207698_11846673
1421 Ga0207698_12349679
1422 Ga0209588_1000092
1423 Ga0207428_10058235
1424 Ga0268266_11203691
1425 Ga0268265_10509803
1426 Ga0268264_10444871
1427 Ga0268264_10580211
1428 Ga0268264_11194204
1429 Ga0307517_10107822
1430 Ga0265338_10037462
1431 Ga0265331_10525125
1432 Ga0265327_10004254
1433 Ga0265327_10335993
1434 Ga0307508_10010758
1435 Ga0307516_10054760
1436 Ga0307411_11857409
1437 Ga0373958_0076925
1438 Ga0373926_0014997
1439 Ga0373926_0241347
1440 Ga0373934_0049096
1441 Ga0373934_0184010
1442 Ga0373944_0005212
1443 Ga0373949_0000025
1444 Ga0373939_0421508
1445 Ga0373941_0007798
1446 Ga0373945_0002355
1447 Ga0373945_0434557
1448 Ga0373953_0141007
1449 Ga0373953_0561334
1450 Ga0373954_0057417
1451 Ga0373954_0145785
1452 Ga0373956_0023960
1453 Ga0373956_0386950
1454 Ga0373957_0085982
1455 Ga0373957_0178210
1456 Ga0373960_0436104
1457 Ga0373943_0001762
1458 Ga0373943_0478817
1459 Ga0373946_0035563
1460 Ga0373955_0045293
1461 Ga0373924_0129989
1462 Ga0373935_0116661
1463 Ga0373935_0479750
1464 Ga0373927_0477451
1465 Ga0373933_0625185
1466 Ga0373947_0025146
1467 Ga0373947_0025343
1468 Ga0373947_0114084
1469 Ga0373947_0673233
1470 Ga0373937_0429856
1471 Ga0373937_0617941
1472 Ga0373925_0009592
1473 Ga0373925_0362525
1474 Ga0373925_0582741
1475 Ga0436363_1579912
1476 Ga0451789_1041019
1477 Ga0451795_1233397
1478 Ga0451802_0450762
1479 Ga0451807_0361109
1480 Ga0451853_1798004
1481 Ga0466972_0162782
1482 Ga0466963_0006434
1483 Ga0466963_0078458
1484 Ga0466963_1072417
1485 Ga0466964_0449711
1486 Ga0466971_0102465
1487 Ga0466971_0108777
1488 Ga0466968_0132480
1489 Ga0466970_0179441
1490 Ga0466970_0570238
1491 Ga0466957_0041210
1492 Ga0466957_1367300
1493 Ga0466960_0020788
1494 Ga0466960_0085792
1495 Ga0466959_0285216
1496 Ga0466958_0060016
1497 Ga0466958_0360565
1498 Ga0466958_0561936
1499 Ga0466967_0001586
1500 Ga0466967_0005584
1501 Ga0466967_0176674
1502 Ga0466967_0379932
1503 Ga0495592_0195550
1504 Ga0495592_0926159
1505 Ga0495603_0146742
1506 Ga0495603_0265200
1507 Ga0495590_0087502
1508 Ga0495629_0008110
1509 Ga0495629_0714774
1510 Ga0495641_0005113
1511 Ga0495641_0022081
1512 Ga0495641_0051642
1513 Ga0495651_0091528
1514 Ga0495651_0290162
1515 Ga0495653_0028104
1516 Ga0495653_0370132
1517 Ga0495580_0132771
1518 Ga0495580_0564358
1519 Ga0495582_0005050
1520 Ga0495582_0032521
1521 Ga0495582_0240119
1522 Ga0495582_0503242
1523 Ga0495639_0001768
1524 Ga0495639_0363365
1525 Ga0495662_0107740
1526 Ga0495664_0062824
1527 Ga0495664_0891195
1528 Ga0495594_0022123
1529 Ga0495608_0006702
1530 Ga0495608_0565975
1531 Ga0495618_0072953
1532 Ga0495618_0578074
1533 Ga0495628_0407216
1534 Ga0495630_0007370
1535 Ga0495630_0128502
1536 Ga0495630_0289155
1537 Ga0495666_0003164
1538 Ga0495666_0336827
1539 Ga0495652_0312746
1540 Ga0495652_0387419
1541 Ga0495665_0002272
1542 Ga0495665_0198980
1543 Ga0495665_0537033
1544 Ga0495640_0036656
1545 Ga0495640_0230580
1546 Ga0495640_0757361
1547 Ga0495587_0272996
1548 Ga0495645_0255184
1549 Ga0495645_0564081
1550 Ga0495622_0319308
1551 Ga0495667_0014109
1552 Ga0495667_0539834
1553 Ga0495634_0008813
1554 Ga0495634_0090750
1555 Ga0495635_0010396
1556 Ga0495635_0903115
1557 Ga0495588_0016413
1558 Ga0495588_0045820
1559 Ga0495657_0005778
1560 Ga0495657_0131800
1561 Ga0495599_0191704
1562 Ga0495623_0331617
1563 Ga0495646_0054983
1564 Ga0495647_0020782
1565 Ga0495647_0080749
1566 Ga0495647_0332017
1567 Ga0495647_0343136
1568 Ga0495658_0005307
1569 Ga0495658_0015860
1570 Ga0495613_0005000
1571 Ga0495613_0320996
1572 Ga0495624_0004301
1573 Ga0495624_0304023
1574 Ga0495600_0008182
1575 Ga0495581_0012611
1576 Ga0495581_0089476
1577 Ga0495581_0141193
1578 Ga0495581_0331817
1579 Ga0495604_0353120
1580 Ga0495636_0437909
1581 Ga0495674_0031367
1582 Ga0495674_0033812
1583 Ga0495674_0278743
1584 Ga0495676_0037729
1585 Ga0495676_0046300
1586 Ga0495676_0234965
1587 Ga0495676_0356615
1588 Ga0495680_0061082
1589 Ga0495680_0396538
1590 Ga0495675_0087426
1591 Ga0495684_0056722
1592 Ga0495684_0291432
1593 Ga0495684_0930191
1594 Ga0495593_0004302
1595 Ga0495602_0627654
1596 Ga0495614_0006653
1597 Ga0496100_0005871
1598 Ga0496100_0023707
1599 Ga0496100_0392587
1600 Ga0496100_1219421
1601 Ga0496101_0070326
1602 Ga0496101_0078258
1603 Ga0496101_0085488
1604 Ga0496101_0197881
1605 Ga0496101_0902932
1606 Ga0496101_0914188
1607 Ga0496102_0022942
1608 Ga0496102_0501106
1609 Ga0496102_0837659
1610 Ga0496102_1568962
1611 Ga0496102_1597272
1612 Ga0496103_0031939
1613 Ga0496103_0863599
1614 Ga0496104_0024763
1615 Ga0496104_0157444
1616 Ga0496104_1453802
1617 Ga0496104_1558113
1618 Ga0496105_0014998
1619 Ga0496105_0121313
1620 Ga0496105_0165520
1621 Ga0496105_0236697
1622 Ga0496105_0561600
1623 Ga0496106_0004050
1624 Ga0496106_0541376
1625 Ga0496106_0551757
1626 Ga0496106_1225505
1627 Ga0496106_1403124
1628 Ga0496107_0011834
1629 Ga0496107_0013560
1630 Ga0496107_0048402
1631 Ga0496107_0168753
1632 Ga0496108_0000678
1633 Ga0496108_0004013
1634 Ga0496108_0010272
1635 Ga0496108_0699564
1636 Ga0496108_1535286
1637 Ga0496109_0015955
1638 Ga0496109_0057787
1639 Ga0496109_0067223
1640 Ga0496109_0097462
1641 Ga0496109_0342774
1642 Ga0496110_0021851
1643 Ga0496110_0115754
1644 Ga0496110_0307343
1645 Ga0496110_0553856
1646 Ga0496111_0000959
1647 Ga0496111_0031740
1648 Ga0496111_0304153
1649 Ga0496111_0457880
1650 Ga0496112_0002978
1651 Ga0496112_0004620
1652 Ga0496112_0088929
1653 Ga0496112_0279310
1654 Ga0496113_0000046
1655 Ga0496113_0018393
1656 Ga0496113_0189733
1657 Ga0496113_0572077
1658 Ga0496113_1323757
1659 Ga0496113_1513282
1660 Ga0496114_0035786
1661 Ga0496114_0062012
1662 Ga0496114_0065767
1663 Ga0496114_0587896
1664 Ga0496114_0736749
1665 Ga0496114_1121373
1666 Ga0496115_0000833
1667 Ga0496115_0224321
1668 Ga0496115_0640124
1669 Ga0496121_0486506
1670 Ga0501292_010497
1671 Ga0501033_0574605
1672 Ga0501036_1464552
1673 Ga0501068_0155656
1674 Ga0501069_0019963
1675 Ga0501069_0037057
1676 Ga0501070_0030454
1677 Ga0501070_0085439
1678 Ga0501071_1410521
1679 Ga0501072_0546719
1680 Ga0501074_0398818
1681 Ga0501209_136662
1682 Ga0501216_010274
1683 Ga0501227_006933
1684 Ga0501225_0103843
1685 Ga0501081_0613795
1686 Ga0501083_0031557
1687 Ga0501083_0040451
1688 nmdc:mga05p37_698800_c1
1689 nmdc:mga08y16_90242_c1
1690 nmdc:mga0n895_2018323_c1
1691 nmdc:mga0n895_211317_c1
1692 nmdc:mga0n895_277_c1
1693 nmdc:mga0n895_42260_c1
1694 nmdc:mga0n895_575213_c1
1695 nmdc:mga0rr50_1502742_c1
1696 nmdc:mga0rr50_281963_c1
1697 nmdc:mga0rr50_39497_c1
1698 nmdc:mga0rr50_673634_c1
1699 nmdc:mga0rr50_7416_c1
1700 nmdc:mga08x19_116652_c1
1701 nmdc:mga08x19_156952_c1
1702 nmdc:mga08x19_22494_c1
1703 nmdc:mga08x19_240857_c1
1704 nmdc:mga08x19_270645_c1
1705 nmdc:mga08x19_553810_c1
1706 nmdc:mga08x19_76325_c1
1707 nmdc:mga08x19_809640_c1
1708 nmdc:mga08x19_908213_c1
1709 nmdc:mga0a205_1188498_c1
1710 Ga0495601_0021309
1711 Ga0495601_0159623
1712 Ga0495601_0507752
1713 Ga0495601_0541347
1714 Ga0495612_0034388
1715 Ga0495612_0120118
1716 Ga0495612_0124999
1717 Ga0495595_0219124
1718 Ga0495595_0319096
1719 Ga0495595_0398365
1720 Ga0495619_0066433
1721 Ga0495619_0342479
1722 Ga0495619_0555733
1723 Ga0495619_0572911
1724 Ga0500646_0000723
1725 Ga0500646_0109974
1726 Ga0500647_0039324
1727 Ga0500583_0073754
1728 Ga0500566_0026235
1729 Ga0500640_004702
1730 Ga0500554_000898
1731 Ga0500562_012335
1732 Ga0500572_002020
1733 Ga0500595_000622
1734 Ga0500597_012221
1735 Ga0500608_270695
1736 Ga0500614_001766
1737 Ga0500559_0002996
1738 Ga0500620_130452
1739 Ga0500622_0249669
1740 Ga0500639_357420
1741 Ga0500637_0183029
1742 Ga0587066_120854
1743 Ga0587080_148986
1744 Ga0587088_055410
1745 Ga0587091_142880
1746 Ga0587115_025809
1747 Ga0587107_078939
1748 Ga0587107_092304
1749 Ga0587114_062755
1750 Ga0501082_0038179
1751 Ga0466962_0013044
1752 Ga0466962_0034001
1753 Ga0466962_0437679
1754 Ga0530510_0046767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

4

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9287 1 90
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9268 1 87
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.92 3 90
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.919 1 90
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.9155 3 86
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9287 1 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9204 3 85 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.919 1 90 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8894 3 85 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8889 2 90 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535VU56-F1-model_v4 MoaD/ThiS family protein 0.9749 1 90
AF-A0A2M7CFQ3-F1-model_v4 NIL domain-containing protein 0.974 2 90
AF-A0A7K0LFT7-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.973 2 90
AF-A0A382J5P3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9722 2 81
AF-A0A2E7T426-F1-model_v4 deleted 0.9721 2 90

Map