F484269

General Info

Members Datasets Scaffolds Average Seq Length
873 443 856 120

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0570194|Ga0501074_0570194_15_425
Length 136
Sequence MQSLHEKAMYDHIGLKVKDLDTAVRFYKAALEPLGHVLASQEASYAGLGPRGAPALWLYRDPPSSGVHVAFRASSRAAVDRFHAAGLAAGGRDNGKPGVRSDYSPAYYAAFLIDPDGNNVEAVCLERGCGMALASS

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2643221672 Variovorax sp. Root434 Isolate Unclassified
6 2643221683 Variovorax sp. Root473 Isolate Unclassified
7 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
8 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
9 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
10 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
11 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
12 2885198086 Variovorax sp. 679 Isolate Unclassified
13 2885211737 Variovorax sp. 553 Isolate Unclassified
14 2928070936 Variovorax gossypii 1167 Isolate Unclassified
15 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
16 2929520902 Variovorax beijingensis 502 Isolate Unclassified
17 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
130 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
150 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
165 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
166 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
234 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
235 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
272 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
282 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
285 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
348 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
349 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
350 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
351 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
352 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
353 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
376 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
377 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
378 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
379 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
380 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
381 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
382 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
383 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
384 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
385 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
392 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
393 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
413 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
414 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
417 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
418 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
419 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
420 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
421 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
422 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
423 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
424 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
425 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
426 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
429 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
432 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
433 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
434 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
435 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
436 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
437 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
440 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
441 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
442 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.11
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0.69
Rhizoplane 2.75
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 3.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10066190 3300001979 Bacteria 981
2 JGI25152J39213_1004368 3300002773 Bacteria 4473
3 JGI25150J39212_1001139 3300002774 Bacteria 7993
4 JGI25150J39212_1040201 3300002774 Bacteria 606
5 JGI25159J45721_1004679 3300002987 Bacteria 4473
6 JGI25159J45721_1008367 3300002987 Bacteria 2848
7 JGI25151J46595_10000186 3300003187 Bacteria 77356
8 JGI25151J46595_10014710 3300003187 Bacteria 3475
9 JGI25151J46595_10015765 3300003187 Bacteria 3318
10 JGI25151J46595_10025387 3300003187 Bacteria 2412
11 JGI25406J46586_10006010 3300003203 Bacteria 5613
12 JGI25153J46596_10009593 3300003215 Bacteria 4473
13 JGI25153J46596_10016109 3300003215 Bacteria 3013
14 JGI25153J46596_10050016 3300003215 Bacteria 1208
15 rootH1_10344455 3300003323 Bacteria 2695
16 JGI25160J50197_1006918 3300003354 Bacteria 4515
17 JGI25160J50197_1011692 3300003354 Bacteria 3091
18 JGI25160J50197_1026419 3300003354 Bacteria 1601
19 JGI25161J50226_1001836 3300003374 Bacteria 5946
20 JGI25161J50226_1005169 3300003374 Bacteria 2586
21 Ga0006562J51391_1035342 3300003578 Bacteria 1520
22 Ga0055526_1005930 3300003771 Bacteria 6816
23 Ga0055526_1009084 3300003771 Bacteria 4850
24 Ga0055537_1003864 3300003773 Bacteria 4473
25 Ga0055537_1007003 3300003773 Bacteria 2779
26 Ga0055524_1004119 3300003775 Bacteria 6816
27 Ga0055524_1004131 3300003775 Bacteria 6800
28 Ga0055536_1007403 3300003781 Bacteria 4925
29 Ga0055536_1028442 3300003781 Bacteria 1523
30 Ga0055534_1001253 3300003784 Bacteria 10465
31 Ga0055534_1003948 3300003784 Bacteria 4473
32 Ga0055528_1008304 3300003790 Bacteria 4473
33 Ga0055528_1015303 3300003790 Bacteria 2779
34 Ga0055530_10000777 3300003791 Bacteria 26621
35 Ga0055530_10015810 3300003791 Bacteria 2442
36 Ga0055540_1001252 3300003792 Bacteria 15535
37 Ga0055540_1001662 3300003792 Bacteria 12890
38 Ga0055540_1002289 3300003792 Bacteria 10317
39 Ga0055540_1005120 3300003792 Bacteria 5641
40 Ga0055540_1029782 3300003792 Bacteria 1274
41 Ga0055531_10002682 3300003794 Bacteria 11725
42 Ga0055531_10010859 3300003794 Bacteria 4471
43 Ga0055531_10022715 3300003794 Bacteria 2379
44 Ga0055543_1000748 3300004625 Bacteria 16355
45 Ga0055543_1009383 3300004625 Bacteria 2105
46 Ga0065165_1003702 3300005262 Bacteria 10364
47 Ga0065165_1027238 3300005262 Bacteria 1866
48 Ga0065712_10000815 3300005290 Bacteria 9682
49 Ga0065707_10198505 3300005295 Bacteria 1322
50 Ga0070676_10196109 3300005328 Bacteria 1321
51 Ga0070690_100140370 3300005330 Bacteria 1640
52 Ga0070670_100015066 3300005331 Bacteria 6635
53 Ga0068869_100000367 3300005334 Bacteria 24337
54 Ga0068869_100002624 3300005334 Bacteria 10850
55 Ga0068869_101859052 3300005334 Bacteria 539
56 Ga0070666_10315094 3300005335 Bacteria 1115
57 Ga0070666_10874700 3300005335 Bacteria 664
58 Ga0070680_100000888 3300005336 Bacteria 21150
59 Ga0070680_100039045 3300005336 Bacteria 3841
60 Ga0070680_100586920 3300005336 Bacteria 956
61 Ga0070682_100003096 3300005337 Bacteria 9215
62 Ga0070682_100089007 3300005337 Bacteria 2016
63 Ga0070682_100902227 3300005337 Bacteria 726
64 Ga0068868_100007192 3300005338 Bacteria 7910
65 Ga0068868_100043292 3300005338 Bacteria 3517
66 Ga0070660_100723443 3300005339 Bacteria 835
67 Ga0070689_100000189 3300005340 Bacteria 37342
68 Ga0070689_100016031 3300005340 Bacteria 5478
69 Ga0070689_100162277 3300005340 Bacteria 1807
70 Ga0070689_101758300 3300005340 Bacteria 565
71 Ga0070691_10002470 3300005341 Bacteria 8217
72 Ga0070691_10217911 3300005341 Bacteria 1010
73 Ga0070687_100000020 3300005343 Bacteria 53469
74 Ga0070687_100001992 3300005343 Bacteria 7475
75 Ga0070687_100627524 3300005343 Bacteria 742
76 Ga0070661_100014675 3300005344 Bacteria 5524
77 Ga0070692_10001522 3300005345 Bacteria 8494
78 Ga0070692_10320342 3300005345 Bacteria 953
79 Ga0070692_10403843 3300005345 Bacteria 863
80 Ga0070668_100021359 3300005347 Bacteria 4890
81 Ga0070668_100024317 3300005347 Bacteria 4588
82 Ga0070669_100008827 3300005353 Bacteria 7193
83 Ga0070669_100024538 3300005353 Bacteria 4323
84 Ga0070669_100523307 3300005353 Bacteria 986
85 Ga0070675_100001749 3300005354 Bacteria 16028
86 Ga0070675_100092376 3300005354 Bacteria 2537
87 Ga0070671_100051978 3300005355 Bacteria 3408
88 Ga0070671_100473250 3300005355 Unclassified 1076
89 Ga0070671_100748608 3300005355 Bacteria 849
90 Ga0070674_100108570 3300005356 Bacteria 2034
91 Ga0070673_100012093 3300005364 Bacteria 5914
92 Ga0070673_100076051 3300005364 Bacteria 2710
93 Ga0070673_100105998 3300005364 Bacteria 2323
94 Ga0070688_100029510 3300005365 Bacteria 3285
95 Ga0070688_100406951 3300005365 Bacteria 1008
96 Ga0070688_101481061 3300005365 Bacteria 552
97 Ga0070667_100085784 3300005367 Bacteria 2701
98 Ga0070667_100361354 3300005367 Bacteria 1316
99 Ga0070703_10013240 3300005406 Bacteria 2341
100 Ga0070714_100790188 3300005435 Bacteria 919
101 Ga0070713_101448700 3300005436 Bacteria 666
102 Ga0070701_10000644 3300005438 Bacteria 12188
103 Ga0070711_100471100 3300005439 Bacteria 1031
104 Ga0070705_100000022 3300005440 Bacteria 83218
105 Ga0070705_100138636 3300005440 Bacteria 1598
106 Ga0070700_100004618 3300005441 Bacteria 7210
107 Ga0070694_100000049 3300005444 Bacteria 54670
108 Ga0070694_100175562 3300005444 Bacteria 1581
109 Ga0070694_100633444 3300005444 Bacteria 864
110 Ga0070694_101302122 3300005444 Unclassified 611
111 Ga0070694_101482143 3300005444 Bacteria 574
112 Ga0070708_100327937 3300005445 Bacteria 1442
113 Ga0070708_100353964 3300005445 Bacteria 1384
114 Ga0070678_100086709 3300005456 Bacteria 2389
115 Ga0070678_100234185 3300005456 Bacteria 1532
116 Ga0070662_100003991 3300005457 Bacteria 9248
117 Ga0070662_100459500 3300005457 Bacteria 1058
118 Ga0070681_10080367 3300005458 Bacteria 3216
119 Ga0070681_10824231 3300005458 Bacteria 845
120 Ga0070681_10996537 3300005458 Bacteria 757
121 Ga0068867_100000219 3300005459 Bacteria 37722
122 Ga0068867_100024520 3300005459 Bacteria 4323
123 Ga0068867_100206792 3300005459 Bacteria 1574
124 Ga0070685_10006027 3300005466 Bacteria 6178
125 Ga0070706_100319884 3300005467 Bacteria 1447
126 Ga0070707_100259427 3300005468 Bacteria 1691
127 Ga0070707_100457302 3300005468 Unclassified 1237
128 Ga0070707_100586643 3300005468 Bacteria 1077
129 Ga0070707_102198907 3300005468 Bacteria 519
130 Ga0070698_100001312 3300005471 Bacteria 27694
131 Ga0070698_100037444 3300005471 Bacteria 5001
132 Ga0070698_100788624 3300005471 Bacteria 894
133 Ga0070698_101803459 3300005471 Bacteria 565
134 Ga0070699_100589565 3300005518 Bacteria 1013
135 Ga0070699_100731308 3300005518 Bacteria 905
136 Ga0070679_100003913 3300005530 Bacteria 13697
137 Ga0070679_100234977 3300005530 Bacteria 1792
138 Ga0070679_101118035 3300005530 Bacteria 733
139 Ga0070679_101782651 3300005530 Bacteria 564
140 Ga0070684_100002199 3300005535 Bacteria 14380
141 Ga0070684_102258685 3300005535 Bacteria 513
142 Ga0068853_100068966 3300005539 Bacteria 3075
143 Ga0068853_100111865 3300005539 Bacteria 2427
144 Ga0068853_100115992 3300005539 Bacteria 2384
145 Ga0068853_100158257 3300005539 Bacteria 2042
146 Ga0068853_100572022 3300005539 Bacteria 1072
147 Ga0068853_102463745 3300005539 Bacteria 504
148 Ga0070672_100007788 3300005543 Bacteria 7307
149 Ga0070686_100002753 3300005544 Bacteria 9679
150 Ga0070686_101154439 3300005544 Unclassified 642
151 Ga0070686_101754093 3300005544 Bacteria 528
152 Ga0070695_100000030 3300005545 Bacteria 53190
153 Ga0070695_100218975 3300005545 Bacteria 1371
154 Ga0070695_100453774 3300005545 Bacteria 983
155 Ga0070695_100821811 3300005545 Bacteria 746
156 Ga0070695_101065821 3300005545 Bacteria 660
157 Ga0070696_100000501 3300005546 Bacteria 24715
158 Ga0070696_100125474 3300005546 Bacteria 1862
159 Ga0070696_101729470 3300005546 Bacteria 539
160 Ga0070693_100000472 3300005547 Bacteria 18052
161 Ga0070693_100040391 3300005547 Bacteria 2619
162 Ga0070693_100417512 3300005547 Bacteria 934
163 Ga0070665_100019238 3300005548 Bacteria 6851
164 Ga0070665_100139506 3300005548 Bacteria 2428
165 Ga0070704_100000009 3300005549 Bacteria 67191
166 Ga0070704_100050701 3300005549 Bacteria 2919
167 Ga0070704_100294373 3300005549 Bacteria 1350
168 Ga0070704_100700560 3300005549 Bacteria 898
169 Ga0068855_100000709 3300005563 Bacteria 40793
170 Ga0068855_100901147 3300005563 Bacteria 934
171 Ga0070664_100004802 3300005564 Bacteria 10832
172 Ga0068857_100019280 3300005577 Bacteria 5989
173 Ga0068857_100019513 3300005577 Bacteria 5955
174 Ga0068857_100773360 3300005577 Bacteria 916
175 Ga0068854_100006372 3300005578 Bacteria 7505
176 Ga0068854_100610932 3300005578 Bacteria 932
177 Ga0068854_101414131 3300005578 Bacteria 629
178 Ga0068856_100015976 3300005614 Bacteria 7258
179 Ga0068856_101160463 3300005614 Bacteria 789
180 Ga0068856_101774551 3300005614 Bacteria 629
181 Ga0070702_100000009 3300005615 Bacteria 60314
182 Ga0070702_100022015 3300005615 Bacteria 3363
183 Ga0068859_100000354 3300005617 Bacteria 45757
184 Ga0068859_100006511 3300005617 Bacteria 11857
185 Ga0068859_100007079 3300005617 Bacteria 11385
186 Ga0068859_100170502 3300005617 Bacteria 2257
187 Ga0068859_100357555 3300005617 Bacteria 1555
188 Ga0068859_100653935 3300005617 Bacteria 1143
189 Ga0068864_100009838 3300005618 Bacteria 7884
190 Ga0068864_100121238 3300005618 Bacteria 2338
191 Ga0068864_100795148 3300005618 Bacteria 929
192 Ga0068866_10000182 3300005718 Bacteria 29433
193 Ga0068861_100000138 3300005719 Bacteria 36853
194 Ga0068861_100002277 3300005719 Bacteria 12453
195 Ga0068861_100012075 3300005719 Bacteria 6019
196 Ga0068863_100003828 3300005841 Bacteria 14874
197 Ga0068863_100046755 3300005841 Bacteria 4108
198 Ga0068858_100004544 3300005842 Bacteria 13592
199 Ga0068858_100014628 3300005842 Bacteria 7390
200 Ga0068858_100058917 3300005842 Bacteria 3550
201 Ga0068858_100119554 3300005842 Bacteria 2463
202 Ga0068860_100000285 3300005843 Bacteria 72246
203 Ga0068860_100528256 3300005843 Bacteria 1180
204 Ga0068862_100000821 3300005844 Bacteria 30739
205 Ga0068862_100007749 3300005844 Bacteria 8880
206 Ga0068862_100017700 3300005844 Bacteria 5932
207 Ga0068862_100159276 3300005844 Bacteria 2014
208 Ga0068862_102540343 3300005844 Bacteria 524
209 Ga0081540_1167164 3300005983 Bacteria 844
210 Ga0081539_10000007 3300005985 Bacteria 532790
211 Ga0075365_11187868 3300006038 Bacteria 537
212 Ga0075368_10095063 3300006042 Bacteria 1221
213 Ga0075363_100441016 3300006048 Bacteria 768
214 Ga0075432_10339025 3300006058 Bacteria 634
215 Ga0070715_10038767 3300006163 Bacteria 1980
216 Ga0070712_100211389 3300006175 Bacteria 1530
217 Ga0075362_10144376 3300006177 Bacteria 1139
218 Ga0075367_10057436 3300006178 Bacteria 2314
219 Ga0075366_10019688 3300006195 Bacteria 3909
220 Ga0097621_100000392 3300006237 Bacteria 30517
221 Ga0097621_100435465 3300006237 Bacteria 1179
222 Ga0075370_10000200 3300006353 Bacteria 21094
223 Ga0075370_10106149 3300006353 Bacteria 1628
224 Ga0068871_100001351 3300006358 Bacteria 16425
225 Ga0068871_100063977 3300006358 Bacteria 3010
226 Ga0075428_100000297 3300006844 Bacteria 48607
227 Ga0075428_100027105 3300006844 Bacteria 6344
228 Ga0075428_100029005 3300006844 Bacteria 6123
229 Ga0075428_100044431 3300006844 Bacteria 4883
230 Ga0075430_100016325 3300006846 Bacteria 6321
231 Ga0075430_100134902 3300006846 Bacteria 2057
232 Ga0075430_100236932 3300006846 Bacteria 1512
233 Ga0075430_100613998 3300006846 Bacteria 897
234 Ga0075431_100000023 3300006847 Bacteria 81036
235 Ga0075431_100003434 3300006847 Bacteria 15370
236 Ga0075431_100017257 3300006847 Bacteria 7335
237 Ga0075431_100071115 3300006847 Bacteria 3589
238 Ga0075431_100246290 3300006847 Bacteria 1817
239 Ga0075431_100315828 3300006847 Bacteria 1576
240 Ga0075431_100332489 3300006847 Bacteria 1530
241 Ga0075431_100401891 3300006847 Bacteria 1371
242 Ga0075433_10665514 3300006852 Bacteria 913
243 Ga0075433_10706834 3300006852 Bacteria 883
244 Ga0075433_11249820 3300006852 Bacteria 644
245 Ga0075434_100235392 3300006871 Bacteria 1851
246 Ga0075434_100414688 3300006871 Bacteria 1368
247 Ga0075429_100000233 3300006880 Bacteria 38047
248 Ga0075429_100001157 3300006880 Bacteria 21266
249 Ga0075429_100001322 3300006880 Bacteria 20223
250 Ga0075429_100009505 3300006880 Bacteria 8437
251 Ga0075429_100041492 3300006880 Bacteria 4008
252 Ga0075429_100312446 3300006880 Bacteria 1376
253 Ga0068865_100000052 3300006881 Bacteria 63932
254 Ga0075436_100077074 3300006914 Bacteria 2309
255 Ga0075436_100162282 3300006914 Bacteria 1575
256 Ga0075436_100229594 3300006914 Bacteria 1318
257 Ga0075436_101138360 3300006914 Bacteria 588
258 Ga0075436_101258703 3300006914 Bacteria 559
259 Ga0075436_101412660 3300006914 Bacteria 528
260 Ga0097620_100000354 3300006931 Bacteria 45757
261 Ga0097620_100006512 3300006931 Bacteria 11857
262 Ga0097620_100007080 3300006931 Bacteria 11385
263 Ga0097620_100170510 3300006931 Bacteria 2257
264 Ga0097620_100357597 3300006931 Bacteria 1555
265 Ga0097620_100653899 3300006931 Bacteria 1143
266 Ga0099824_1014217 3300006942 Bacteria 7986
267 Ga0099822_1009768 3300006943 Bacteria 12016
268 Ga0075435_100037087 3300007076 Bacteria 3880
269 Ga0075435_100057951 3300007076 Bacteria 3135
270 Ga0099795_10251240 3300007788 Bacteria 763
271 Ga0105251_10054543 3300009011 Bacteria 1898
272 Ga0105244_10090379 3300009036 Bacteria 1506
273 Ga0105240_10202508 3300009093 Bacteria 2325
274 Ga0111539_10002140 3300009094 Bacteria 26432
275 Ga0111539_10002965 3300009094 Bacteria 22506
276 Ga0111539_10018787 3300009094 Bacteria 8554
277 Ga0111539_10129689 3300009094 Bacteria 2953
278 Ga0111539_10130778 3300009094 Bacteria 2939
279 Ga0111539_10139501 3300009094 Bacteria 2839
280 Ga0111539_10615008 3300009094 Bacteria 1265
281 Ga0111539_10643112 3300009094 Bacteria 1235
282 Ga0111539_11545216 3300009094 Bacteria 770
283 Ga0105245_10000086 3300009098 Bacteria 93019
284 Ga0105245_10076892 3300009098 Bacteria 3042
285 Ga0105245_11466006 3300009098 Bacteria 733
286 Ga0105247_10357846 3300009101 Bacteria 1028
287 Ga0114129_10000702 3300009147 Bacteria 42161
288 Ga0114129_10007028 3300009147 Bacteria 16025
289 Ga0114129_10029543 3300009147 Bacteria 7763
290 Ga0114129_10080988 3300009147 Bacteria 4513
291 Ga0114129_10444044 3300009147 Bacteria 1702
292 Ga0114129_10696674 3300009147 Bacteria 1306
293 Ga0114129_10751009 3300009147 Bacteria 1249
294 Ga0114129_12275023 3300009147 Bacteria 651
295 Ga0105243_10000360 3300009148 Bacteria 48717
296 Ga0105243_10004657 3300009148 Bacteria 10800
297 Ga0105243_10057153 3300009148 Bacteria 3105
298 Ga0105243_10111035 3300009148 Bacteria 2294
299 Ga0105243_10249950 3300009148 Bacteria 1582
300 Ga0105243_11342678 3300009148 Bacteria 734
301 Ga0105243_11691393 3300009148 Bacteria 661
302 Ga0105241_10013525 3300009174 Bacteria 5980
303 Ga0105241_10096282 3300009174 Bacteria 2344
304 Ga0105242_10001022 3300009176 Bacteria 22000
305 Ga0105242_10042252 3300009176 Bacteria 3680
306 Ga0105242_10071473 3300009176 Bacteria 2880
307 Ga0105242_10894446 3300009176 Bacteria 887
308 Ga0105242_12878664 3300009176 Bacteria 532
309 Ga0105248_10006127 3300009177 Bacteria 13195
310 Ga0105248_10676614 3300009177 Bacteria 1164
311 Ga0105237_10592764 3300009545 Bacteria 1115
312 Ga0105238_10012654 3300009551 Bacteria 8515
313 Ga0105249_10001949 3300009553 Bacteria 17907
314 Ga0105249_10008029 3300009553 Bacteria 9197
315 Ga0105249_10039521 3300009553 Bacteria 4284
316 Ga0105249_10842925 3300009553 Bacteria 982
317 Ga0105249_11258783 3300009553 Bacteria 811
318 Ga0105239_10765907 3300010375 Bacteria 1105
319 Ga0105239_13393618 3300010375 Bacteria 518
320 Ga0105246_10061349 3300011119 Bacteria 2616
321 Ga0105246_10277113 3300011119 Bacteria 1344
322 Ga0157347_1005237 3300012502 Bacteria 1233
323 Ga0157339_1018539 3300012505 Bacteria 717
324 Ga0157371_10852489 3300013102 Bacteria 689
325 Ga0157370_10317372 3300013104 Bacteria 1438
326 Ga0157374_11792230 3300013296 Bacteria 639
327 Ga0157378_10000332 3300013297 Bacteria 46615
328 Ga0157378_10074507 3300013297 Bacteria 3055
329 Ga0157378_10138887 3300013297 Unclassified 2255
330 Ga0157378_10251993 3300013297 Bacteria 1690
331 Ga0157378_10334897 3300013297 Bacteria 1474
332 Ga0157378_10844525 3300013297 Bacteria 944
333 Ga0163162_10154008 3300013306 Bacteria 2418
334 Ga0163162_10203539 3300013306 Bacteria 2109
335 Ga0157375_10012915 3300013308 Bacteria 7419
336 Ga0157375_11441006 3300013308 Bacteria 812
337 Ga0163163_10068226 3300014325 Bacteria 3538
338 Ga0163163_10075378 3300014325 Bacteria 3367
339 Ga0157380_10200027 3300014326 Bacteria 1772
340 Ga0157380_10626205 3300014326 Bacteria 1069
341 Ga0157380_12381803 3300014326 Bacteria 594
342 Ga0157377_10037420 3300014745 Bacteria 2673
343 Ga0157377_10339785 3300014745 Bacteria 1004
344 Ga0157379_10174748 3300014968 Bacteria 1939
345 Ga0157379_10329255 3300014968 Bacteria 1395
346 Ga0157379_10567852 3300014968 Bacteria 1057
347 Ga0157376_10053003 3300014969 Bacteria 3376
348 Ga0163161_10000193 3300017792 Bacteria 56074
349 Ga0209436_103446 3300025208 Bacteria 4211
350 Ga0207425_1000295 3300025245 Bacteria 36319
351 Ga0207425_1006691 3300025245 Bacteria 3125
352 Ga0209129_1000007 3300025258 Bacteria 771325
353 Ga0209129_1002839 3300025258 Bacteria 8016
354 Ga0209129_1004098 3300025258 Bacteria 5933
355 Ga0209129_1035902 3300025258 Bacteria 804
356 Ga0209565_1000937 3300025263 Bacteria 15341
357 Ga0209565_1004131 3300025263 Bacteria 4515
358 Ga0209565_1004138 3300025263 Bacteria 4508
359 Ga0209673_1000133 3300025273 Bacteria 161740
360 Ga0209673_1000304 3300025273 Bacteria 91151
361 Ga0209130_1000070 3300025284 Bacteria 179057
362 Ga0209130_1000126 3300025284 Bacteria 123694
363 Ga0209130_1000326 3300025284 Bacteria 54842
364 Ga0209675_1000498 3300025291 Bacteria 29455
365 Ga0209675_1000516 3300025291 Bacteria 28507
366 Ga0209675_1011016 3300025291 Bacteria 3033
367 Ga0209676_1000122 3300025292 Bacteria 195510
368 Ga0209676_1000268 3300025292 Bacteria 108430
369 Ga0209676_1001242 3300025292 Bacteria 26866
370 Ga0209676_1001471 3300025292 Bacteria 21884
371 Ga0209025_1000111 3300025294 Bacteria 218982
372 Ga0209025_1000432 3300025294 Bacteria 82875
373 Ga0209025_1000480 3300025294 Bacteria 77443
374 Ga0209025_1005232 3300025294 Bacteria 10693
375 Ga0209564_1000524 3300025295 Bacteria 62668
376 Ga0209564_1000594 3300025295 Bacteria 56686
377 Ga0209758_1000025 3300025297 Bacteria 586687
378 Ga0209758_1001305 3300025297 Bacteria 30465
379 Ga0209758_1002137 3300025297 Bacteria 20841
380 Ga0209758_1109639 3300025297 Bacteria 767
381 Ga0209050_1000002 3300025298 Bacteria 1792849
382 Ga0209050_1001024 3300025298 Bacteria 34874
383 Ga0209256_1000050 3300025299 Bacteria 308622
384 Ga0209256_1000063 3300025299 Bacteria 252716
385 Ga0207426_1000001 3300025302 Bacteria 1341301
386 Ga0207426_1000028 3300025302 Bacteria 483955
387 Ga0207426_1000046 3300025302 Bacteria 422271
388 Ga0207426_1056346 3300025302 Bacteria 1148
389 Ga0209051_1000002 3300025303 Bacteria 1631846
390 Ga0209051_1000343 3300025303 Bacteria 69952
391 Ga0209051_1000618 3300025303 Bacteria 40891
392 Ga0209051_1010933 3300025303 Bacteria 4529
393 Ga0209051_1031937 3300025303 Bacteria 2017
394 Ga0209257_1000002 3300025304 Bacteria 1767052
395 Ga0209257_1000333 3300025304 Bacteria 98599
396 Ga0209257_1001964 3300025304 Bacteria 22160
397 Ga0209257_1010999 3300025304 Bacteria 4445
398 Ga0209257_1016193 3300025304 Bacteria 3036
399 Ga0207655_1091965 3300025728 Bacteria 1065
400 Ga0207653_10012222 3300025885 Bacteria 2681
401 Ga0207642_10000468 3300025899 Bacteria 12355
402 Ga0207688_10039885 3300025901 Bacteria 2608
403 Ga0207688_10422809 3300025901 Bacteria 828
404 Ga0207680_10171904 3300025903 Bacteria 1460
405 Ga0207685_10026196 3300025905 Bacteria 2024
406 Ga0207645_10327377 3300025907 Bacteria 1023
407 Ga0207643_10040270 3300025908 Bacteria 2630
408 Ga0207705_10289537 3300025909 Bacteria 1255
409 Ga0207684_10993282 3300025910 Bacteria 702
410 Ga0207654_10122196 3300025911 Bacteria 1637
411 Ga0207707_10706647 3300025912 Bacteria 846
412 Ga0207693_10096087 3300025915 Bacteria 2323
413 Ga0207660_10001415 3300025917 Bacteria 16105
414 Ga0207660_10563692 3300025917 Bacteria 927
415 Ga0207662_10000321 3300025918 Bacteria 21775
416 Ga0207662_10006890 3300025918 Bacteria 6158
417 Ga0207662_10333895 3300025918 Bacteria 1014
418 Ga0207662_10749414 3300025918 Bacteria 686
419 Ga0207649_10776863 3300025920 Bacteria 747
420 Ga0207652_10020457 3300025921 Bacteria 5449
421 Ga0207652_10201294 3300025921 Bacteria 1792
422 Ga0207646_10259782 3300025922 Bacteria 1570
423 Ga0207646_10446469 3300025922 Bacteria 1167
424 Ga0207646_11635759 3300025922 Bacteria 555
425 Ga0207646_11776669 3300025922 Unclassified 528
426 Ga0207681_10006525 3300025923 Bacteria 7158
427 Ga0207681_10490739 3300025923 Bacteria 1004
428 Ga0207694_10003297 3300025924 Bacteria 12840
429 Ga0207694_10259732 3300025924 Bacteria 1423
430 Ga0207694_11264429 3300025924 Bacteria 624
431 Ga0207650_10117443 3300025925 Bacteria 2067
432 Ga0207659_10004378 3300025926 Bacteria 8532
433 Ga0207659_11242382 3300025926 Bacteria 640
434 Ga0207687_10006332 3300025927 Bacteria 7824
435 Ga0207687_10026769 3300025927 Bacteria 3864
436 Ga0207700_11285738 3300025928 Bacteria 652
437 Ga0207644_10095970 3300025931 Bacteria 2218
438 Ga0207644_10679868 3300025931 Bacteria 858
439 Ga0207706_10117274 3300025933 Bacteria 2341
440 Ga0207706_10121753 3300025933 Bacteria 2294
441 Ga0207686_10000270 3300025934 Bacteria 38522
442 Ga0207686_10132819 3300025934 Bacteria 1709
443 Ga0207709_10000425 3300025935 Bacteria 40645
444 Ga0207709_10001288 3300025935 Bacteria 17893
445 Ga0207709_10014698 3300025935 Bacteria 4326
446 Ga0207709_10273485 3300025935 Bacteria 1244
447 Ga0207709_11130977 3300025935 Bacteria 644
448 Ga0207670_10002400 3300025936 Bacteria 9816
449 Ga0207670_10022262 3300025936 Bacteria 3925
450 Ga0207670_11399229 3300025936 Bacteria 594
451 Ga0207669_10008844 3300025937 Bacteria 4754
452 Ga0207704_10000797 3300025938 Bacteria 13935
453 Ga0207704_10302164 3300025938 Bacteria 1226
454 Ga0207704_11226878 3300025938 Bacteria 640
455 Ga0207665_10408695 3300025939 Bacteria 1035
456 Ga0207691_10029622 3300025940 Bacteria 5120
457 Ga0207711_10060547 3300025941 Bacteria 3263
458 Ga0207711_10759993 3300025941 Bacteria 903
459 Ga0207689_10000691 3300025942 Bacteria 32302
460 Ga0207689_10223061 3300025942 Bacteria 1557
461 Ga0207679_10548749 3300025945 Bacteria 1037
462 Ga0207679_10553632 3300025945 Bacteria 1032
463 Ga0207667_10002649 3300025949 Bacteria 22123
464 Ga0207667_10729112 3300025949 Bacteria 992
465 Ga0207651_10017321 3300025960 Bacteria 4254
466 Ga0207651_10171069 3300025960 Bacteria 1713
467 Ga0207651_10842780 3300025960 Bacteria 814
468 Ga0207651_12065328 3300025960 Bacteria 512
469 Ga0207712_10007497 3300025961 Bacteria 6887
470 Ga0207712_10027019 3300025961 Bacteria 3830
471 Ga0207712_10045740 3300025961 Bacteria 3032
472 Ga0207668_10002266 3300025972 Bacteria 11224
473 Ga0207668_10140769 3300025972 Bacteria 1855
474 Ga0207668_10774644 3300025972 Bacteria 848
475 Ga0207640_10155833 3300025981 Bacteria 1683
476 Ga0207640_10447266 3300025981 Bacteria 1064
477 Ga0207658_10063781 3300025986 Bacteria 2762
478 Ga0207658_10323307 3300025986 Bacteria 1336
479 Ga0207677_10006235 3300026023 Bacteria 6523
480 Ga0207677_11156331 3300026023 Bacteria 707
481 Ga0207703_10011257 3300026035 Bacteria 6959
482 Ga0207703_10020856 3300026035 Bacteria 5127
483 Ga0207639_10009520 3300026041 Bacteria 6707
484 Ga0207639_10058142 3300026041 Bacteria 2972
485 Ga0207639_10105065 3300026041 Bacteria 2291
486 Ga0207639_10108699 3300026041 Bacteria 2255
487 Ga0207639_10768672 3300026041 Bacteria 896
488 Ga0207639_11687155 3300026041 Bacteria 594
489 Ga0207639_12005976 3300026041 Bacteria 540
490 Ga0207678_10654021 3300026067 Bacteria 923
491 Ga0207708_10000182 3300026075 Bacteria 49271
492 Ga0207708_10077899 3300026075 Bacteria 2545
493 Ga0207708_10507107 3300026075 Bacteria 1012
494 Ga0207708_10801077 3300026075 Bacteria 811
495 Ga0207702_10007177 3300026078 Bacteria 9535
496 Ga0207702_10702571 3300026078 Bacteria 996
497 Ga0207641_10068585 3300026088 Bacteria 3041
498 Ga0207641_10643021 3300026088 Bacteria 1041
499 Ga0207648_10000335 3300026089 Bacteria 51594
500 Ga0207648_10024037 3300026089 Bacteria 5447
501 Ga0207648_10482256 3300026089 Bacteria 1133
502 Ga0207676_10032953 3300026095 Bacteria 3910
503 Ga0207676_10181122 3300026095 Bacteria 1845
504 Ga0207676_10738987 3300026095 Bacteria 956
505 Ga0207674_10028441 3300026116 Bacteria 5900
506 Ga0207674_10527877 3300026116 Bacteria 1140
507 Ga0207674_10887388 3300026116 Bacteria 860
508 Ga0207675_100000142 3300026118 Bacteria 61826
509 Ga0207675_100001323 3300026118 Bacteria 24831
510 Ga0207675_100028037 3300026118 Bacteria 5243
511 Ga0207683_10039230 3300026121 Bacteria 4131
512 Ga0207683_10511843 3300026121 Bacteria 1109
513 Ga0209589_1000015 3300027357 Bacteria 225913
514 Ga0209489_100015 3300027361 Bacteria 225913
515 Ga0209700_100025 3300027363 Bacteria 225913
516 Ga0209967_1019733 3300027364 Bacteria 981
517 Ga0209968_1055410 3300027526 Bacteria 693
518 Ga0209971_1074451 3300027682 Bacteria 825
519 Ga0209966_1085378 3300027695 Bacteria 703
520 Ga0209813_10264236 3300027866 Bacteria 658
521 Ga0207428_10001362 3300027907 Bacteria 25965
522 Ga0207428_10006800 3300027907 Bacteria 10488
523 Ga0207428_10099073 3300027907 Bacteria 2254
524 Ga0207428_10202744 3300027907 Bacteria 1492
525 Ga0268266_10065692 3300028379 Bacteria 3136
526 Ga0268266_10823025 3300028379 Bacteria 897
527 Ga0268266_12242856 3300028379 Bacteria 518
528 Ga0268265_10000934 3300028380 Bacteria 26899
529 Ga0268265_10002870 3300028380 Bacteria 12667
530 Ga0268265_10003566 3300028380 Bacteria 11121
531 Ga0268265_10382513 3300028380 Bacteria 1295
532 Ga0268265_10410080 3300028380 Bacteria 1255
533 Ga0268265_11862065 3300028380 Bacteria 608
534 Ga0268264_10000446 3300028381 Bacteria 56436
535 Ga0268264_10552709 3300028381 Bacteria 1129
536 Ga0268264_10598319 3300028381 Bacteria 1086
537 Ga0268264_12453646 3300028381 Bacteria 527
538 Ga0307515_10497397 3300028794 Bacteria 830
539 Ga0265316_10910654 3300031344 Bacteria 614
540 Ga0307408_100007266 3300031548 Bacteria 7326
541 Ga0307408_100084637 3300031548 Bacteria 2379
542 Ga0307408_101001178 3300031548 Bacteria 770
543 Ga0307408_102348740 3300031548 Bacteria 517
544 Ga0307516_10025336 3300031730 Bacteria 6042
545 Ga0307516_10934119 3300031730 Bacteria 536
546 Ga0307405_10301564 3300031731 Bacteria 1215
547 Ga0307405_11177955 3300031731 Bacteria 662
548 Ga0307406_10000864 3300031901 Bacteria 17063
549 Ga0307406_10102838 3300031901 Bacteria 1950
550 Ga0307412_10011951 3300031911 Bacteria 5044
551 Ga0307412_11552046 3300031911 Bacteria 603
552 Ga0307409_100598867 3300031995 Bacteria 1089
553 Ga0307409_101391232 3300031995 Bacteria 728
554 Ga0307409_101431766 3300031995 Bacteria 718
555 Ga0307409_101644150 3300031995 Bacteria 671
556 Ga0307416_100074967 3300032002 Bacteria 2829
557 Ga0307416_100463475 3300032002 Bacteria 1323
558 Ga0307416_101047192 3300032002 Bacteria 920
559 Ga0307416_101392562 3300032002 Bacteria 807
560 Ga0307416_103242876 3300032002 Bacteria 544
561 Ga0307411_10554270 3300032005 Bacteria 981
562 Ga0307411_10669711 3300032005 Bacteria 900
563 Ga0307415_100196605 3300032126 Bacteria 1596
564 Ga0307415_100601000 3300032126 Bacteria 979
565 Ga0307510_10465125 3300033180 Bacteria 706
566 Ga0373926_0000157 3300035083 Bacteria 14837
567 Ga0373940_0134852 3300035088 Bacteria 776
568 Ga0373944_0323882 3300035089 Bacteria 582
569 Ga0373949_0047119 3300035090 Bacteria 1076
570 Ga0373936_0085866 3300035113 Bacteria 1314
571 Ga0373939_0060192 3300035114 Bacteria 1206
572 Ga0373939_0206704 3300035114 Bacteria 745
573 Ga0373939_0492350 3300035114 Bacteria 522
574 Ga0373941_0037244 3300035115 Bacteria 1483
575 Ga0373945_0202334 3300035116 Bacteria 825
576 Ga0373956_0101854 3300035119 Bacteria 1333
577 Ga0373960_0199732 3300035121 Bacteria 706
578 Ga0373943_0262399 3300035170 Bacteria 973
579 Ga0373962_0002777 3300035242 Bacteria 4174
580 Ga0373931_0004707 3300035691 Bacteria 6249
581 Ga0373931_0344407 3300035691 Bacteria 931
582 Ga0373935_0176088 3300035692 Bacteria 1466
583 Ga0373935_0932350 3300035692 Bacteria 644
584 Ga0373927_0276097 3300035695 Bacteria 1105
585 Ga0373933_0433824 3300035724 Bacteria 859
586 Ga0373937_1243140 3300036401 Bacteria 693
587 Ga0373937_1591613 3300036401 Bacteria 601
588 Ga0373925_0027752 3300037068 Bacteria 4144
589 Ga0373925_0314085 3300037068 Bacteria 1267
590 Ga0373925_0627873 3300037068 Bacteria 885
591 Ga0395899_0606705 3300037312 Bacteria 696
592 Ga0395900_1558168 3300037418 Bacteria 572
593 Ga0395898_1373559 3300037466 Bacteria 634
594 Ga0436364_1056250 3300037853 Bacteria 3277
595 Ga0395901_1083647 3300038443 Bacteria 772
596 Ga0436365_0984935 3300039437 Bacteria 1563
597 Ga0436365_1258172 3300039437 Bacteria 747
598 Ga0439439_0106361 3300041406 Bacteria 775
599 Ga0439453_0034710 3300041408 Bacteria 969
600 Ga0439465_0261949 3300041413 Bacteria 641
601 Ga0451791_1242738 3300041451 Bacteria 780
602 Ga0451798_0391002 3300041458 Bacteria 861
603 Ga0451853_0286293 3300041512 Bacteria 761
604 Ga0439431_0221383 3300041997 Bacteria 556
605 Ga0450888_039674 3300042126 Bacteria 652
606 Ga0439434_0063850 3300042435 Bacteria 1154
607 Ga0451577_0375143 3300042876 Bacteria 1291
608 Ga0451577_0647980 3300042876 Bacteria 958
609 Ga0466972_0114099 3300044658 Bacteria 1276
610 Ga0466972_0359088 3300044658 Bacteria 682
611 Ga0466965_0026346 3300044683 Bacteria 2818
612 Ga0466965_0496351 3300044683 Bacteria 684
613 Ga0466964_0010808 3300044706 Bacteria 3447
614 Ga0451576_0040510 3300045051 Bacteria 4929
615 Ga0451576_0046981 3300045051 Bacteria 4541
616 Ga0451576_0064154 3300045051 Bacteria 3826
617 Ga0451576_0429688 3300045051 Bacteria 1386
618 Ga0451576_1096805 3300045051 Unclassified 833
619 Ga0451576_2063758 3300045051 Bacteria 587
620 Ga0466967_0007238 3300045976 Bacteria 7978
621 Ga0495627_006801 3300046453 Bacteria 4450
622 Ga0495638_0127269 3300046460 Bacteria 1500
623 Ga0495650_0289448 3300046471 Bacteria 550
624 Ga0495639_0092882 3300046475 Bacteria 1418
625 Ga0495585_0313774 3300046492 Bacteria 768
626 Ga0495610_0020716 3300046512 Bacteria 3643
627 Ga0495610_0049408 3300046512 Bacteria 2060
628 Ga0495610_0085333 3300046512 Bacteria 1441
629 Ga0495610_0309964 3300046512 Bacteria 606
630 Ga0495616_0030852 3300046513 Bacteria 2811
631 Ga0495620_0110834 3300046515 Bacteria 1088
632 Ga0495631_0000228 3300046518 Bacteria 38440
633 Ga0495637_0003270 3300046520 Bacteria 8620
634 Ga0495637_0017432 3300046520 Bacteria 3347
635 Ga0495648_0486764 3300046524 Bacteria 532
636 Ga0495654_0008482 3300046530 Bacteria 5672
637 Ga0495654_0198380 3300046530 Bacteria 860
638 Ga0495586_0001910 3300046535 Bacteria 11347
639 Ga0495621_0025662 3300046539 Bacteria 1982
640 Ga0495621_0034177 3300046539 Bacteria 1756
641 Ga0495633_0374170 3300046558 Bacteria 645
642 Ga0495668_0085111 3300046616 Bacteria 1734
643 Ga0495668_0299807 3300046616 Bacteria 881
644 Ga0495611_0034497 3300046648 Bacteria 2237
645 Ga0495625_0043979 3300046660 Bacteria 3235
646 Ga0495625_0158703 3300046660 Bacteria 1516
647 Ga0495659_0466040 3300046664 Bacteria 551
648 Ga0495661_0081910 3300046665 Bacteria 1859
649 Ga0495588_0033283 3300046674 Bacteria 2602
650 Ga0495588_0037595 3300046674 Bacteria 2460
651 Ga0495658_0067510 3300046683 Bacteria 2068
652 Ga0495658_0136418 3300046683 Bacteria 1497
653 Ga0495670_0017426 3300046691 Bacteria 3534
654 Ga0495670_0310459 3300046691 Bacteria 846
655 Ga0495671_0016975 3300046692 Bacteria 3878
656 Ga0495600_0896140 3300046809 Bacteria 524
657 Ga0495581_0344213 3300047315 Bacteria 870
658 Ga0495604_0911006 3300047317 Bacteria 549
659 Ga0495676_0016422 3300047321 Bacteria 6571
660 Ga0495676_0032519 3300047321 Bacteria 4402
661 Ga0495676_0954017 3300047321 Bacteria 548
662 Ga0495673_0053813 3300047469 Bacteria 1753
663 Ga0495686_0302814 3300047472 Bacteria 882
664 Ga0495593_0007756 3300047673 Bacteria 6256
665 Ga0495614_0004411 3300048089 Bacteria 6345
666 Ga0496100_0032873 3300048903 Bacteria 3240
667 Ga0496100_0426347 3300048903 Bacteria 1014
668 Ga0496101_0063210 3300048904 Bacteria 2694
669 Ga0496104_0007351 3300048907 Bacteria 9725
670 Ga0496105_0002518 3300048908 Bacteria 13288
671 Ga0496106_0108520 3300048909 Bacteria 2159
672 Ga0496107_0392174 3300048910 Bacteria 1033
673 Ga0496108_0000416 3300048911 Bacteria 34834
674 Ga0496109_0001317 3300048912 Bacteria 20486
675 Ga0496109_0144616 3300048912 Bacteria 2224
676 Ga0496110_0004470 3300048913 Bacteria 10838
677 Ga0496110_0289343 3300048913 Bacteria 1492
678 Ga0496111_0015024 3300048914 Bacteria 5303
679 Ga0496111_0672538 3300048914 Bacteria 754
680 Ga0496112_0007446 3300048915 Bacteria 9715
681 Ga0496113_0001503 3300048916 Bacteria 13056
682 Ga0496113_0513156 3300048916 Bacteria 962
683 Ga0496114_0109856 3300048917 Bacteria 2361
684 Ga0496115_0001063 3300048918 Bacteria 19879
685 Ga0496118_0047253 3300048921 Bacteria 3338
686 Ga0496118_0552753 3300048921 Bacteria 561
687 Ga0496121_0191741 3300048924 Bacteria 1464
688 Ga0496124_0146552 3300048927 Bacteria 1857
689 Ga0496125_0030971 3300048928 Bacteria 4776
690 Ga0496125_0142168 3300048928 Bacteria 1666
691 Ga0496125_0182201 3300048928 Bacteria 1398
692 Ga0496126_0146230 3300048929 Bacteria 2030
693 Ga0501290_038401 3300049513 Bacteria 709
694 Ga0501291_015509 3300049514 Bacteria 1152
695 Ga0501298_012971 3300049521 Bacteria 1468
696 Ga0501299_039254 3300049522 Bacteria 944
697 Ga0501299_043836 3300049522 Bacteria 905
698 Ga0501300_007930 3300049523 Bacteria 1557
699 Ga0501300_021066 3300049523 Bacteria 952
700 Ga0501301_004281 3300049524 Bacteria 1009
701 Ga0501303_015012 3300049526 Bacteria 770
702 Ga0501031_0552354 3300049568 Bacteria 742
703 Ga0501031_0584065 3300049568 Bacteria 719
704 Ga0501032_0131584 3300049569 Bacteria 1651
705 Ga0501033_0041065 3300049570 Bacteria 3453
706 Ga0501033_0214561 3300049570 Bacteria 1372
707 Ga0501033_0426682 3300049570 Bacteria 923
708 Ga0501033_0574894 3300049570 Bacteria 774
709 Ga0501034_0000730 3300049571 Bacteria 49754
710 Ga0501034_0086279 3300049571 Bacteria 3140
711 Ga0501036_0285435 3300049572 Bacteria 1381
712 Ga0501036_0385468 3300049572 Bacteria 1170
713 Ga0501037_1033453 3300049573 Bacteria 534
714 Ga0501038_0265701 3300049574 Bacteria 1354
715 Ga0501038_0798995 3300049574 Bacteria 701
716 Ga0501038_0839378 3300049574 Bacteria 681
717 Ga0501039_0228504 3300049575 Bacteria 1463
718 Ga0501042_0753860 3300049578 Bacteria 708
719 Ga0501043_0044068 3300049579 Bacteria 3507
720 Ga0501043_0146762 3300049579 Bacteria 1847
721 Ga0501043_0628128 3300049579 Bacteria 791
722 Ga0501047_0042513 3300049581 Bacteria 4391
723 Ga0501047_0134767 3300049581 Bacteria 2350
724 Ga0501047_0419993 3300049581 Bacteria 1169
725 Ga0501048_1020764 3300049582 Bacteria 595
726 Ga0501067_0340210 3300049583 Bacteria 836
727 Ga0501068_0001132 3300049584 Bacteria 14129
728 Ga0501070_0195616 3300049586 Bacteria 1661
729 Ga0501070_0235628 3300049586 Bacteria 1499
730 Ga0501070_0919083 3300049586 Bacteria 682
731 Ga0501071_0360181 3300049587 Bacteria 1108
732 Ga0501072_0479868 3300049588 Bacteria 984
733 Ga0501073_0014430 3300049589 Bacteria 5740
734 Ga0501073_0063886 3300049589 Bacteria 2567
735 Ga0501074_0500443 3300049590 Bacteria 861
736 Ga0501074_0570194 3300049590 Bacteria 801
737 Ga0501076_0898939 3300049592 Bacteria 730
738 Ga0501077_0640044 3300049593 Bacteria 683
739 Ga0501077_1081064 3300049593 Bacteria 516
740 Ga0501217_028643 3300049661 Bacteria 1358
741 Ga0501222_085773 3300049662 Bacteria 507
742 Ga0501228_009623 3300049666 Bacteria 947
743 Ga0501233_098885 3300049668 Bacteria 769
744 Ga0501235_110828 3300049669 Bacteria 679
745 Ga0501239_024681 3300049672 Bacteria 758
746 Ga0501243_063823 3300049675 Bacteria 688
747 Ga0501249_005412 3300049679 Bacteria 2610
748 Ga0501253_026319 3300049683 Bacteria 1071
749 Ga0501255_035596 3300049684 Bacteria 711
750 Ga0501257_074952 3300049686 Bacteria 868
751 Ga0501225_0050068 3300049705 Bacteria 1162
752 Ga0501234_037477 3300049707 Bacteria 789
753 Ga0501234_093641 3300049707 Bacteria 541
754 Ga0501079_1004698 3300049741 Bacteria 657
755 Ga0501079_1187223 3300049741 Bacteria 601
756 Ga0501080_0089685 3300049742 Bacteria 2856
757 Ga0501080_0111349 3300049742 Bacteria 2537
758 Ga0501083_0039536 3300049744 Bacteria 3204
759 Ga0501083_0057120 3300049744 Bacteria 2613
760 Ga0501268_021864 3300049765 Bacteria 1100
761 Ga0501273_024961 3300049770 Bacteria 827
762 Ga0501283_016634 3300049779 Bacteria 1143
763 Ga0501035_0099387 3300049822 Bacteria 2554
764 Ga0501035_0229301 3300049822 Bacteria 1583
765 Ga0501035_1571069 3300049822 Bacteria 500
766 Ga0501044_0020908 3300049823 Bacteria 6987
767 Ga0501044_0043051 3300049823 Bacteria 4692
768 Ga0501044_0078100 3300049823 Bacteria 3355
769 Ga0501045_0536489 3300049824 Bacteria 868
770 Ga0501045_0574202 3300049824 Bacteria 836
771 Ga0501226_010258 3300049853 Bacteria 1039
772 nmdc:mga03n38_295779_c1 3300050490 Bacteria 868
773 nmdc:mga03n38_307011_c1 3300050490 Bacteria 853
774 nmdc:mga0k408_52439_c1 3300050493 Bacteria 2364
775 nmdc:mga07m45_19644_c1 3300050496 Bacteria 3662
776 nmdc:mga07m45_7294_c1 3300050496 Bacteria 5641
777 nmdc:mga05p37_1249654_c1 3300050507 Bacteria 762
778 nmdc:mga05p37_1520_c1 3300050507 Bacteria 27010
779 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
780 nmdc:mga05p37_374128_c1 3300050507 Bacteria 1671
781 nmdc:mga05p37_63921_c1 3300050507 Bacteria 4529
782 nmdc:mga05p37_9043_c1 3300050507 Bacteria 11777
783 nmdc:mga09592_1601_c1 3300050508 Bacteria 18249
784 nmdc:mga09592_3010_c1 3300050508 Bacteria 13665
785 nmdc:mga09592_3996_c1 3300050508 Bacteria 11887
786 nmdc:mga09592_487_c1 3300050508 Bacteria 29737
787 nmdc:mga09592_73735_c1 3300050508 Bacteria 2900
788 nmdc:mga0qj67_37729_c1 3300050509 Bacteria 3788
789 nmdc:mga0qj67_415810_c1 3300050509 Unclassified 1084
790 nmdc:mga0qj67_54926_c2 3300050509 Bacteria 1255
791 nmdc:mga06r32_142565_c1 3300050510 Bacteria 2373
792 nmdc:mga06r32_1976653_c1 3300050510 Bacteria 517
793 nmdc:mga06r32_247202_c1 3300050510 Bacteria 1771
794 nmdc:mga06r32_26444_c1 3300050510 Bacteria 5410
795 nmdc:mga06r32_265728_c1 3300050510 Bacteria 1703
796 nmdc:mga06r32_699_c1 3300050510 Bacteria 29308
797 nmdc:mga06r32_77534_c1 3300050510 Bacteria 3229
798 nmdc:mga08y16_1050398_c1 3300050511 Bacteria 792
799 nmdc:mga08y16_2117_c1 3300050511 Bacteria 20347
800 nmdc:mga08y16_2380_c1 3300050511 Bacteria 19295
801 nmdc:mga08y16_334077_c1 3300050511 Bacteria 1558
802 nmdc:mga08y16_502_c1 3300050511 Bacteria 36044
803 nmdc:mga08y16_61819_c1 3300050511 Bacteria 3911
804 nmdc:mga0n895_228066_c1 3300050512 Bacteria 1891
805 nmdc:mga0n895_335547_c1 3300050512 Bacteria 1532
806 nmdc:mga0n895_762708_c1 3300050512 Bacteria 960
807 nmdc:mga0rr50_2784_c2 3300050513 Bacteria 3880
808 nmdc:mga0rr50_343494_c1 3300050513 Bacteria 1254
809 nmdc:mga08x19_1244921_c1 3300050514 Bacteria 527
810 nmdc:mga08x19_200250_c1 3300050514 Bacteria 1368
811 nmdc:mga08x19_251957_c1 3300050514 Bacteria 1219
812 nmdc:mga08x19_404938_c1 3300050514 Bacteria 957
813 nmdc:mga0a205_1103182_c1 3300050515 Bacteria 641
814 nmdc:mga0a205_177147_c1 3300050515 Bacteria 2027
815 Ga0500610_0000863 3300053079 Bacteria 9710
816 Ga0500610_0002219 3300053079 Bacteria 7031
817 Ga0495619_0341420 3300053085 Bacteria 1036
818 Ga0500643_004104 3300053087 Bacteria 6712
819 Ga0500651_0000097 3300053093 Bacteria 53876
820 Ga0500566_0221797 3300053094 Bacteria 939
821 Ga0500641_0210319 3300053096 Bacteria 828
822 Ga0500555_076491 3300053103 Bacteria 876
823 Ga0500569_022372 3300053109 Bacteria 1683
824 Ga0500571_000190 3300053110 Bacteria 22258
825 Ga0500572_277645 3300053111 Bacteria 542
826 Ga0500592_001100 3300053116 Bacteria 4411
827 Ga0500593_000202 3300053117 Bacteria 24296
828 Ga0500595_051415 3300053119 Bacteria 1276
829 Ga0500607_002610 3300053121 Bacteria 14302
830 Ga0500608_061882 3300053122 Bacteria 1788
831 Ga0500608_255247 3300053122 Bacteria 681
832 Ga0500617_100156 3300053124 Bacteria 1226
833 Ga0500642_0400374 3300053130 Bacteria 599
834 Ga0500658_0000521 3300053134 Bacteria 16260
835 Ga0500658_0000753 3300053134 Bacteria 13371
836 Ga0500559_0008548 3300053136 Bacteria 4480
837 Ga0500564_078987 3300053138 Bacteria 1476
838 Ga0500568_0002122 3300053139 Bacteria 11970
839 Ga0500574_000630 3300053141 Bacteria 4568
840 Ga0500588_0001478 3300053146 Bacteria 4479
841 Ga0500616_0207487 3300053153 Bacteria 863
842 Ga0500619_233122 3300053154 Bacteria 610
843 Ga0500627_0004369 3300053158 Bacteria 4530
844 Ga0500634_0040681 3300053161 Bacteria 2526
845 Ga0500634_0048954 3300053161 Bacteria 2280
846 Ga0500638_085098 3300053162 Bacteria 1497
847 Ga0500636_0037156 3300053177 Bacteria 2882
848 Ga0500645_073596 3300053730 Bacteria 979
849 Ga0500565_028227 3300053734 Bacteria 722
850 Ga0501084_0228889 3300054114 Bacteria 1569
851 Ga0501084_1520306 3300054114 Bacteria 560
852 Ga0500661_019643 3300055283 Bacteria 1203
853 Ga0501082_0101653 3300060353 Bacteria 2487
854 Ga0501082_0412693 3300060353 Bacteria 1179
855 Ga0501082_1028035 3300060353 Bacteria 720
856 Ga0501082_1994931 3300060353 Bacteria 506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_1558168 Ga0395900_1558168_146_454 102
2 3300048914 Ga0496111_0672538 Ga0496111_0672538_21_338 104
3 3300046512 Ga0495610_0049408 Ga0495610_0049408_333_692 105
4 3300027695 Ga0209966_1085378 Ga0209966_10853781 111
5 3300032002 Ga0307416_101047192 Ga0307416_1010471923 111
6 3300006852 Ga0075433_11249820 Ga0075433_112498202 113
7 3300009094 Ga0111539_10643112 Ga0111539_106431122 113
8 3300049590 Ga0501074_0500443 Ga0501074_0500443_31_390 113
9 3300050511 nmdc:mga08y16_1050398_c1 nmdc:mga08y16_1050398_c1_150_494 113
10 iso_pu_bacteria 2821443989 2821447080 114
11 iso_pu_bacteria 2844533157 2844539854 114
12 3300025291 Ga0209675_1000498 Ga0209675_100049814 115
13 3300031995 Ga0307409_101644150 Ga0307409_1016441502 115
14 iso_pu_bacteria 2599185214 2599623547 115
15 iso_pu_bacteria 2599185226 2599671835 115
16 iso_pu_bacteria 2599185227 2599681152 115
17 iso_pu_bacteria 2599185229 2599693444 115
18 iso_pu_bacteria 2643221672 2644401565 115
19 iso_pu_bacteria 2643221683 2644468074 115
20 iso_pu_bacteria 2831265667 2831266233 115
21 iso_pu_bacteria 2838054893 2838057657 115
22 iso_pu_bacteria 2883354860 2883359224 115
23 iso_pu_bacteria 2885198086 2885204349 115
24 iso_pu_bacteria 2885211737 2885218002 115
25 iso_pu_bacteria 2928070936 2928071840 115
26 iso_pu_bacteria 2928084124 2928084224 115
27 iso_pu_bacteria 2929520902 2929527224 115
28 iso_pu_bacteria 2945984333 2945986237 115
29 3300005334 Ga0068869_100000367 Ga0068869_1000003674 117
30 3300005335 Ga0070666_10315094 Ga0070666_103150942 117
31 3300005336 Ga0070680_100000888 Ga0070680_1000008883 117
32 3300005336 Ga0070680_100586920 Ga0070680_1005869202 117
33 3300005337 Ga0070682_100003096 Ga0070682_1000030963 117
34 3300005338 Ga0068868_100007192 Ga0068868_1000071925 117
35 3300005338 Ga0068868_100043292 Ga0068868_1000432923 117
36 3300005339 Ga0070660_100723443 Ga0070660_1007234432 117
37 3300005340 Ga0070689_100000189 Ga0070689_10000018936 117
38 3300005341 Ga0070691_10002470 Ga0070691_100024703 117
39 3300005343 Ga0070687_100000020 Ga0070687_10000002011 117
40 3300005343 Ga0070687_100627524 Ga0070687_1006275241 117
41 3300005345 Ga0070692_10001522 Ga0070692_100015229 117
42 3300005353 Ga0070669_100523307 Ga0070669_1005233072 117
43 3300005354 Ga0070675_100092376 Ga0070675_1000923763 117
44 3300005355 Ga0070671_100748608 Ga0070671_1007486081 117
45 3300005364 Ga0070673_100076051 Ga0070673_1000760513 117
46 3300005364 Ga0070673_100105998 Ga0070673_1001059983 117
47 3300005406 Ga0070703_10013240 Ga0070703_100132403 117
48 3300005438 Ga0070701_10000644 Ga0070701_100006449 117
49 3300005440 Ga0070705_100000022 Ga0070705_10000002212 117
50 3300005441 Ga0070700_100004618 Ga0070700_1000046188 117
51 3300005444 Ga0070694_100000049 Ga0070694_10000004924 117
52 3300005445 Ga0070708_100327937 Ga0070708_1003279373 117
53 3300005456 Ga0070678_100086709 Ga0070678_1000867094 117
54 3300005458 Ga0070681_10996537 Ga0070681_109965371 117
55 3300005459 Ga0068867_100000219 Ga0068867_10000021937 117
56 3300005468 Ga0070707_102198907 Ga0070707_1021989072 117
57 3300005518 Ga0070699_100589565 Ga0070699_1005895652 117
58 3300005530 Ga0070679_100003913 Ga0070679_1000039137 117
59 3300005530 Ga0070679_101118035 Ga0070679_1011180352 117
60 3300005539 Ga0068853_100068966 Ga0068853_1000689665 117
61 3300005539 Ga0068853_102463745 Ga0068853_1024637451 117
62 3300005544 Ga0070686_100002753 Ga0070686_1000027533 117
63 3300005545 Ga0070695_100000030 Ga0070695_10000003013 117
64 3300005546 Ga0070696_100000501 Ga0070696_10000050124 117
65 3300005547 Ga0070693_100000472 Ga0070693_10000047211 117
66 3300005549 Ga0070704_100000009 Ga0070704_10000000958 117
67 3300005563 Ga0068855_100000709 Ga0068855_10000070914 117
68 3300005563 Ga0068855_100901147 Ga0068855_1009011472 117
69 3300005578 Ga0068854_100006372 Ga0068854_1000063728 117
70 3300005578 Ga0068854_101414131 Ga0068854_1014141311 117
71 3300005614 Ga0068856_100015976 Ga0068856_1000159768 117
72 3300005615 Ga0070702_100000009 Ga0070702_10000000916 117
73 3300005617 Ga0068859_100000354 Ga0068859_10000035411 117
74 3300005617 Ga0068859_100357555 Ga0068859_1003575552 117
75 3300005618 Ga0068864_100795148 Ga0068864_1007951481 117
76 3300005718 Ga0068866_10000182 Ga0068866_1000018210 117
77 3300005719 Ga0068861_100000138 Ga0068861_10000013829 117
78 3300005841 Ga0068863_100046755 Ga0068863_1000467556 117
79 3300005842 Ga0068858_100004544 Ga0068858_1000045448 117
80 3300005842 Ga0068858_100058917 Ga0068858_1000589176 117
81 3300005843 Ga0068860_100000285 Ga0068860_10000028577 117
82 3300005843 Ga0068860_100528256 Ga0068860_1005282563 117
83 3300005844 Ga0068862_100000821 Ga0068862_10000082122 117
84 3300006163 Ga0070715_10038767 Ga0070715_100387672 117
85 3300006237 Ga0097621_100000392 Ga0097621_10000039211 117
86 3300006237 Ga0097621_100435465 Ga0097621_1004354653 117
87 3300006358 Ga0068871_100001351 Ga0068871_10000135112 117
88 3300006846 Ga0075430_100613998 Ga0075430_1006139982 117
89 3300006847 Ga0075431_100315828 Ga0075431_1003158282 117
90 3300006852 Ga0075433_10706834 Ga0075433_107068342 117
91 3300006871 Ga0075434_100414688 Ga0075434_1004146883 117
92 3300006880 Ga0075429_100001322 Ga0075429_10000132215 117
93 3300006881 Ga0068865_100000052 Ga0068865_10000005212 117
94 3300006914 Ga0075436_100162282 Ga0075436_1001622822 117
95 3300006914 Ga0075436_101412660 Ga0075436_1014126602 117
96 3300006931 Ga0097620_100000354 Ga0097620_10000035436 117
97 3300006931 Ga0097620_100357597 Ga0097620_1003575972 117
98 3300007076 Ga0075435_100057951 Ga0075435_1000579512 117
99 3300009094 Ga0111539_10130778 Ga0111539_101307784 117
100 3300009098 Ga0105245_10000086 Ga0105245_10000086101 117
101 3300009098 Ga0105245_10076892 Ga0105245_100768924 117
102 3300009147 Ga0114129_10000702 Ga0114129_1000070222 117
103 3300009147 Ga0114129_10444044 Ga0114129_104440442 117
104 3300009148 Ga0105243_10000360 Ga0105243_1000036047 117
105 3300009174 Ga0105241_10013525 Ga0105241_100135258 117
106 3300009176 Ga0105242_10001022 Ga0105242_1000102214 117
107 3300009176 Ga0105242_10071473 Ga0105242_100714733 117
108 3300009176 Ga0105242_10894446 Ga0105242_108944461 117
109 3300009553 Ga0105249_10001949 Ga0105249_1000194917 117
110 3300010375 Ga0105239_13393618 Ga0105239_133936181 117
111 3300013102 Ga0157371_10852489 Ga0157371_108524892 117
112 3300013297 Ga0157378_10000332 Ga0157378_1000033236 117
113 3300013297 Ga0157378_10334897 Ga0157378_103348972 117
114 3300014326 Ga0157380_10200027 Ga0157380_102000272 117
115 3300014745 Ga0157377_10037420 Ga0157377_100374202 117
116 3300014968 Ga0157379_10329255 Ga0157379_103292552 117
117 3300014969 Ga0157376_10053003 Ga0157376_100530034 117
118 3300025304 Ga0209257_1010999 Ga0209257_10109992 117
119 3300025885 Ga0207653_10012222 Ga0207653_100122223 117
120 3300025899 Ga0207642_10000468 Ga0207642_100004684 117
121 3300025901 Ga0207688_10039885 Ga0207688_100398853 117
122 3300025903 Ga0207680_10171904 Ga0207680_101719042 117
123 3300025905 Ga0207685_10026196 Ga0207685_100261962 117
124 3300025909 Ga0207705_10289537 Ga0207705_102895373 117
125 3300025911 Ga0207654_10122196 Ga0207654_101221963 117
126 3300025917 Ga0207660_10001415 Ga0207660_100014153 117
127 3300025917 Ga0207660_10563692 Ga0207660_105636921 117
128 3300025918 Ga0207662_10000321 Ga0207662_100003219 117
129 3300025921 Ga0207652_10020457 Ga0207652_100204577 117
130 3300025922 Ga0207646_11635759 Ga0207646_116357591 117
131 3300025923 Ga0207681_10490739 Ga0207681_104907392 117
132 3300025924 Ga0207694_11264429 Ga0207694_112644292 117
133 3300025926 Ga0207659_11242382 Ga0207659_112423822 117
134 3300025927 Ga0207687_10006332 Ga0207687_100063328 117
135 3300025927 Ga0207687_10026769 Ga0207687_100267694 117
136 3300025931 Ga0207644_10679868 Ga0207644_106798682 117
137 3300025933 Ga0207706_10117274 Ga0207706_101172742 117
138 3300025934 Ga0207686_10000270 Ga0207686_100002704 117
139 3300025934 Ga0207686_10132819 Ga0207686_101328192 117
140 3300025935 Ga0207709_10001288 Ga0207709_1000128812 117
141 3300025936 Ga0207670_10002400 Ga0207670_1000240011 117
142 3300025938 Ga0207704_10000797 Ga0207704_1000079714 117
143 3300025942 Ga0207689_10000691 Ga0207689_1000069111 117
144 3300025949 Ga0207667_10002649 Ga0207667_1000264924 117
145 3300025949 Ga0207667_10729112 Ga0207667_107291122 117
146 3300025960 Ga0207651_10171069 Ga0207651_101710693 117
147 3300025960 Ga0207651_10842780 Ga0207651_108427802 117
148 3300025960 Ga0207651_12065328 Ga0207651_120653282 117
149 3300025961 Ga0207712_10007497 Ga0207712_100074973 117
150 3300025981 Ga0207640_10155833 Ga0207640_101558333 117
151 3300026023 Ga0207677_10006235 Ga0207677_100062358 117
152 3300026035 Ga0207703_10011257 Ga0207703_100112573 117
153 3300026041 Ga0207639_10009520 Ga0207639_100095205 117
154 3300026041 Ga0207639_12005976 Ga0207639_120059761 117
155 3300026075 Ga0207708_10000182 Ga0207708_1000018230 117
156 3300026078 Ga0207702_10007177 Ga0207702_100071774 117
157 3300026088 Ga0207641_10643021 Ga0207641_106430212 117
158 3300026089 Ga0207648_10000335 Ga0207648_1000033534 117
159 3300026095 Ga0207676_10738987 Ga0207676_107389871 117
160 3300026118 Ga0207675_100000142 Ga0207675_10000014225 117
161 3300026121 Ga0207683_10511843 Ga0207683_105118432 117
162 3300027907 Ga0207428_10001362 Ga0207428_1000136224 117
163 3300028379 Ga0268266_12242856 Ga0268266_122428562 117
164 3300028380 Ga0268265_10003566 Ga0268265_100035661 117
165 3300028381 Ga0268264_10000446 Ga0268264_1000044611 117
166 3300028381 Ga0268264_10598319 Ga0268264_105983191 117
167 3300035083 Ga0373926_0000157 Ga0373926_0000157_7125_7481 117
168 3300035090 Ga0373949_0047119 Ga0373949_0047119_215_571 117
169 3300035114 Ga0373939_0060192 Ga0373939_0060192_118_483 117
170 3300035115 Ga0373941_0037244 Ga0373941_0037244_927_1292 117
171 3300035121 Ga0373960_0199732 Ga0373960_0199732_52_417 117
172 3300035242 Ga0373962_0002777 Ga0373962_0002777_2956_3321 117
173 3300035691 Ga0373931_0004707 Ga0373931_0004707_1913_2269 117
174 3300035691 Ga0373931_0344407 Ga0373931_0344407_82_447 117
175 3300042876 Ga0451577_0375143 Ga0451577_0375143_912_1277 117
176 3300044706 Ga0466964_0010808 Ga0466964_0010808_2081_2437 117
177 3300045051 Ga0451576_0046981 Ga0451576_0046981_703_1068 117
178 3300045051 Ga0451576_0064154 Ga0451576_0064154_3321_3686 117
179 3300045051 Ga0451576_2063758 Ga0451576_2063758_196_576 117
180 3300045976 Ga0466967_0007238 Ga0466967_0007238_1955_2311 117
181 3300046471 Ga0495650_0289448 Ga0495650_0289448_14_370 117
182 3300046475 Ga0495639_0092882 Ga0495639_0092882_795_1151 117
183 3300046535 Ga0495586_0001910 Ga0495586_0001910_3903_4259 117
184 3300046683 Ga0495658_0067510 Ga0495658_0067510_598_954 117
185 3300047321 Ga0495676_0032519 Ga0495676_0032519_2000_2356 117
186 3300049578 Ga0501042_0753860 Ga0501042_0753860_304_660 117
187 3300049588 Ga0501072_0479868 Ga0501072_0479868_484_864 117
188 3300049590 Ga0501074_0570194 Ga0501074_0570194_15_425 117
189 3300049593 Ga0501077_1081064 Ga0501077_1081064_138_494 117
190 3300049741 Ga0501079_1004698 Ga0501079_1004698_216_596 117
191 3300049824 Ga0501045_0574202 Ga0501045_0574202_153_533 117
192 3300050507 nmdc:mga05p37_185_c1 nmdc:mga05p37_185_c1_52190_52555 117
193 3300050508 nmdc:mga09592_3010_c1 nmdc:mga09592_3010_c1_5385_5750 117
194 3300050510 nmdc:mga06r32_265728_c1 nmdc:mga06r32_265728_c1_482_847 117
195 3300050511 nmdc:mga08y16_2117_c1 nmdc:mga08y16_2117_c1_10597_10962 117
196 3300050512 nmdc:mga0n895_335547_c1 nmdc:mga0n895_335547_c1_136_492 117
197 3300050512 nmdc:mga0n895_762708_c1 nmdc:mga0n895_762708_c1_11_376 117
198 3300050514 nmdc:mga08x19_1244921_c1 nmdc:mga08x19_1244921_c1_113_472 117
199 3300050514 nmdc:mga08x19_404938_c1 nmdc:mga08x19_404938_c1_90_446 117
200 3300060353 Ga0501082_0412693 Ga0501082_0412693_292_672 117
201 3300003187 JGI25151J46595_10000186 JGI25151J46595_1000018636 118
202 3300003215 JGI25153J46596_10050016 JGI25153J46596_100500162 118
203 3300003354 JGI25160J50197_1026419 JGI25160J50197_10264193 118
204 3300005468 Ga0070707_100457302 Ga0070707_1004573022 118
205 3300005471 Ga0070698_100001312 Ga0070698_10000131210 118
206 3300005539 Ga0068853_100158257 Ga0068853_1001582572 118
207 3300005983 Ga0081540_1167164 Ga0081540_11671641 118
208 3300014326 Ga0157380_12381803 Ga0157380_123818031 118
209 3300025284 Ga0209130_1000126 Ga0209130_100012640 118
210 3300025294 Ga0209025_1000480 Ga0209025_100048041 118
211 3300025297 Ga0209758_1001305 Ga0209758_10013053 118
212 3300025302 Ga0207426_1000046 Ga0207426_1000046112 118
213 3300025922 Ga0207646_11776669 Ga0207646_117766691 118
214 3300025972 Ga0207668_10774644 Ga0207668_107746441 118
215 3300026041 Ga0207639_10105065 Ga0207639_101050653 118
216 3300031730 Ga0307516_10025336 Ga0307516_100253365 118
217 3300031995 Ga0307409_101431766 Ga0307409_1014317662 118
218 3300041413 Ga0439465_0261949 Ga0439465_0261949_248_607 118
219 3300046512 Ga0495610_0020716 Ga0495610_0020716_1029_1388 118
220 3300049569 Ga0501032_0131584 Ga0501032_0131584_1058_1456 118
221 3300049571 Ga0501034_0000730 Ga0501034_0000730_11984_12343 118
222 3300049571 Ga0501034_0086279 Ga0501034_0086279_174_533 118
223 3300049573 Ga0501037_1033453 Ga0501037_1033453_98_457 118
224 3300049574 Ga0501038_0798995 Ga0501038_0798995_92_451 118
225 3300049584 Ga0501068_0001132 Ga0501068_0001132_6938_7297 118
226 3300049586 Ga0501070_0919083 Ga0501070_0919083_44_403 118
227 3300049589 Ga0501073_0014430 Ga0501073_0014430_2739_3098 118
228 3300049592 Ga0501076_0898939 Ga0501076_0898939_328_687 118
229 3300049593 Ga0501077_0640044 Ga0501077_0640044_127_486 118
230 3300049742 Ga0501080_0111349 Ga0501080_0111349_103_462 118
231 3300049744 Ga0501083_0039536 Ga0501083_0039536_446_805 118
232 3300054114 Ga0501084_0228889 Ga0501084_0228889_215_574 118
233 3300060353 Ga0501082_1028035 Ga0501082_1028035_105_464 118
234 3300001979 JGI24740J21852_10066190 JGI24740J21852_100661902 119
235 3300002773 JGI25152J39213_1004368 JGI25152J39213_10043684 119
236 3300002774 JGI25150J39212_1001139 JGI25150J39212_10011392 119
237 3300002774 JGI25150J39212_1040201 JGI25150J39212_10402011 119
238 3300002987 JGI25159J45721_1004679 JGI25159J45721_10046794 119
239 3300002987 JGI25159J45721_1008367 JGI25159J45721_10083674 119
240 3300003187 JGI25151J46595_10014710 JGI25151J46595_100147102 119
241 3300003187 JGI25151J46595_10015765 JGI25151J46595_100157653 119
242 3300003187 JGI25151J46595_10025387 JGI25151J46595_100253873 119
243 3300003203 JGI25406J46586_10006010 JGI25406J46586_100060106 119
244 3300003215 JGI25153J46596_10009593 JGI25153J46596_100095934 119
245 3300003215 JGI25153J46596_10016109 JGI25153J46596_100161094 119
246 3300003323 rootH1_10344455 rootH1_103444553 119
247 3300003354 JGI25160J50197_1006918 JGI25160J50197_10069185 119
248 3300003354 JGI25160J50197_1011692 JGI25160J50197_10116923 119
249 3300003374 JGI25161J50226_1001836 JGI25161J50226_10018367 119
250 3300003374 JGI25161J50226_1005169 JGI25161J50226_10051693 119
251 3300003578 Ga0006562J51391_1035342 Ga0006562J51391_10353422 119
252 3300003771 Ga0055526_1005930 Ga0055526_10059307 119
253 3300003771 Ga0055526_1009084 Ga0055526_10090845 119
254 3300003773 Ga0055537_1003864 Ga0055537_10038644 119
255 3300003773 Ga0055537_1007003 Ga0055537_10070034 119
256 3300003775 Ga0055524_1004119 Ga0055524_10041197 119
257 3300003775 Ga0055524_1004131 Ga0055524_10041317 119
258 3300003781 Ga0055536_1007403 Ga0055536_10074033 119
259 3300003781 Ga0055536_1028442 Ga0055536_10284421 119
260 3300003784 Ga0055534_1001253 Ga0055534_10012535 119
261 3300003784 Ga0055534_1003948 Ga0055534_10039484 119
262 3300003790 Ga0055528_1008304 Ga0055528_10083044 119
263 3300003790 Ga0055528_1015303 Ga0055528_10153034 119
264 3300003791 Ga0055530_10000777 Ga0055530_1000077710 119
265 3300003791 Ga0055530_10015810 Ga0055530_100158104 119
266 3300003792 Ga0055540_1001252 Ga0055540_10012525 119
267 3300003792 Ga0055540_1001662 Ga0055540_100166210 119
268 3300003792 Ga0055540_1002289 Ga0055540_10022897 119
269 3300003792 Ga0055540_1005120 Ga0055540_10051202 119
270 3300003792 Ga0055540_1029782 Ga0055540_10297823 119
271 3300003794 Ga0055531_10002682 Ga0055531_100026829 119
272 3300003794 Ga0055531_10010859 Ga0055531_100108595 119
273 3300003794 Ga0055531_10022715 Ga0055531_100227153 119
274 3300004625 Ga0055543_1000748 Ga0055543_10007489 119
275 3300004625 Ga0055543_1009383 Ga0055543_10093833 119
276 3300005262 Ga0065165_1003702 Ga0065165_10037025 119
277 3300005262 Ga0065165_1027238 Ga0065165_10272382 119
278 3300005290 Ga0065712_10000815 Ga0065712_1000081510 119
279 3300005295 Ga0065707_10198505 Ga0065707_101985052 119
280 3300005328 Ga0070676_10196109 Ga0070676_101961092 119
281 3300005330 Ga0070690_100140370 Ga0070690_1001403703 119
282 3300005331 Ga0070670_100015066 Ga0070670_1000150664 119
283 3300005334 Ga0068869_100002624 Ga0068869_10000262410 119
284 3300005334 Ga0068869_101859052 Ga0068869_1018590522 119
285 3300005335 Ga0070666_10874700 Ga0070666_108747001 119
286 3300005336 Ga0070680_100039045 Ga0070680_1000390454 119
287 3300005337 Ga0070682_100089007 Ga0070682_1000890072 119
288 3300005337 Ga0070682_100902227 Ga0070682_1009022272 119
289 3300005340 Ga0070689_100016031 Ga0070689_1000160316 119
290 3300005340 Ga0070689_100162277 Ga0070689_1001622773 119
291 3300005340 Ga0070689_101758300 Ga0070689_1017583001 119
292 3300005341 Ga0070691_10217911 Ga0070691_102179112 119
293 3300005343 Ga0070687_100001992 Ga0070687_1000019923 119
294 3300005344 Ga0070661_100014675 Ga0070661_1000146753 119
295 3300005345 Ga0070692_10320342 Ga0070692_103203422 119
296 3300005345 Ga0070692_10403843 Ga0070692_104038432 119
297 3300005347 Ga0070668_100021359 Ga0070668_1000213594 119
298 3300005347 Ga0070668_100024317 Ga0070668_1000243173 119
299 3300005353 Ga0070669_100008827 Ga0070669_1000088273 119
300 3300005353 Ga0070669_100024538 Ga0070669_1000245382 119
301 3300005354 Ga0070675_100001749 Ga0070675_10000174913 119
302 3300005355 Ga0070671_100051978 Ga0070671_1000519784 119
303 3300005355 Ga0070671_100473250 Ga0070671_1004732501 119
304 3300005356 Ga0070674_100108570 Ga0070674_1001085702 119
305 3300005364 Ga0070673_100012093 Ga0070673_1000120937 119
306 3300005365 Ga0070688_100029510 Ga0070688_1000295101 119
307 3300005365 Ga0070688_100406951 Ga0070688_1004069512 119
308 3300005365 Ga0070688_101481061 Ga0070688_1014810611 119
309 3300005367 Ga0070667_100085784 Ga0070667_1000857842 119
310 3300005367 Ga0070667_100361354 Ga0070667_1003613542 119
311 3300005435 Ga0070714_100790188 Ga0070714_1007901882 119
312 3300005436 Ga0070713_101448700 Ga0070713_1014487001 119
313 3300005439 Ga0070711_100471100 Ga0070711_1004711001 119
314 3300005440 Ga0070705_100138636 Ga0070705_1001386362 119
315 3300005444 Ga0070694_100175562 Ga0070694_1001755623 119
316 3300005444 Ga0070694_100633444 Ga0070694_1006334442 119
317 3300005444 Ga0070694_101302122 Ga0070694_1013021221 119
318 3300005444 Ga0070694_101482143 Ga0070694_1014821432 119
319 3300005445 Ga0070708_100353964 Ga0070708_1003539643 119
320 3300005456 Ga0070678_100234185 Ga0070678_1002341852 119
321 3300005457 Ga0070662_100003991 Ga0070662_1000039913 119
322 3300005457 Ga0070662_100459500 Ga0070662_1004595002 119
323 3300005458 Ga0070681_10080367 Ga0070681_100803673 119
324 3300005458 Ga0070681_10824231 Ga0070681_108242312 119
325 3300005459 Ga0068867_100024520 Ga0068867_1000245202 119
326 3300005459 Ga0068867_100206792 Ga0068867_1002067922 119
327 3300005466 Ga0070685_10006027 Ga0070685_100060276 119
328 3300005467 Ga0070706_100319884 Ga0070706_1003198842 119
329 3300005468 Ga0070707_100259427 Ga0070707_1002594272 119
330 3300005468 Ga0070707_100586643 Ga0070707_1005866431 119
331 3300005471 Ga0070698_100037444 Ga0070698_1000374444 119
332 3300005471 Ga0070698_100788624 Ga0070698_1007886242 119
333 3300005471 Ga0070698_101803459 Ga0070698_1018034592 119
334 3300005518 Ga0070699_100731308 Ga0070699_1007313081 119
335 3300005530 Ga0070679_100234977 Ga0070679_1002349772 119
336 3300005530 Ga0070679_101782651 Ga0070679_1017826512 119
337 3300005535 Ga0070684_100002199 Ga0070684_1000021994 119
338 3300005535 Ga0070684_102258685 Ga0070684_1022586851 119
339 3300005539 Ga0068853_100111865 Ga0068853_1001118653 119
340 3300005539 Ga0068853_100115992 Ga0068853_1001159923 119
341 3300005539 Ga0068853_100572022 Ga0068853_1005720222 119
342 3300005543 Ga0070672_100007788 Ga0070672_1000077885 119
343 3300005544 Ga0070686_101154439 Ga0070686_1011544391 119
344 3300005544 Ga0070686_101754093 Ga0070686_1017540931 119
345 3300005545 Ga0070695_100218975 Ga0070695_1002189752 119
346 3300005545 Ga0070695_100453774 Ga0070695_1004537742 119
347 3300005545 Ga0070695_100821811 Ga0070695_1008218112 119
348 3300005545 Ga0070695_101065821 Ga0070695_1010658211 119
349 3300005546 Ga0070696_100125474 Ga0070696_1001254743 119
350 3300005546 Ga0070696_101729470 Ga0070696_1017294701 119
351 3300005547 Ga0070693_100040391 Ga0070693_1000403912 119
352 3300005547 Ga0070693_100417512 Ga0070693_1004175121 119
353 3300005548 Ga0070665_100019238 Ga0070665_1000192386 119
354 3300005548 Ga0070665_100139506 Ga0070665_1001395064 119
355 3300005549 Ga0070704_100050701 Ga0070704_1000507014 119
356 3300005549 Ga0070704_100294373 Ga0070704_1002943732 119
357 3300005549 Ga0070704_100700560 Ga0070704_1007005602 119
358 3300005564 Ga0070664_100004802 Ga0070664_1000048027 119
359 3300005577 Ga0068857_100019280 Ga0068857_1000192805 119
360 3300005577 Ga0068857_100019513 Ga0068857_1000195132 119
361 3300005577 Ga0068857_100773360 Ga0068857_1007733602 119
362 3300005578 Ga0068854_100610932 Ga0068854_1006109322 119
363 3300005614 Ga0068856_101160463 Ga0068856_1011604632 119
364 3300005614 Ga0068856_101774551 Ga0068856_1017745512 119
365 3300005615 Ga0070702_100022015 Ga0070702_1000220153 119
366 3300005617 Ga0068859_100006511 Ga0068859_1000065116 119
367 3300005617 Ga0068859_100007079 Ga0068859_1000070794 119
368 3300005617 Ga0068859_100170502 Ga0068859_1001705023 119
369 3300005617 Ga0068859_100653935 Ga0068859_1006539352 119
370 3300005618 Ga0068864_100009838 Ga0068864_1000098389 119
371 3300005618 Ga0068864_100121238 Ga0068864_1001212382 119
372 3300005719 Ga0068861_100002277 Ga0068861_1000022774 119
373 3300005719 Ga0068861_100012075 Ga0068861_1000120753 119
374 3300005841 Ga0068863_100003828 Ga0068863_10000382811 119
375 3300005842 Ga0068858_100014628 Ga0068858_1000146284 119
376 3300005842 Ga0068858_100119554 Ga0068858_1001195542 119
377 3300005844 Ga0068862_100007749 Ga0068862_1000077495 119
378 3300005844 Ga0068862_100017700 Ga0068862_1000177005 119
379 3300005844 Ga0068862_100159276 Ga0068862_1001592763 119
380 3300005844 Ga0068862_102540343 Ga0068862_1025403432 119
381 3300005985 Ga0081539_10000007 Ga0081539_10000007448 119
382 3300006038 Ga0075365_11187868 Ga0075365_111878681 119
383 3300006042 Ga0075368_10095063 Ga0075368_100950632 119
384 3300006048 Ga0075363_100441016 Ga0075363_1004410162 119
385 3300006058 Ga0075432_10339025 Ga0075432_103390251 119
386 3300006175 Ga0070712_100211389 Ga0070712_1002113893 119
387 3300006177 Ga0075362_10144376 Ga0075362_101443762 119
388 3300006178 Ga0075367_10057436 Ga0075367_100574361 119
389 3300006195 Ga0075366_10019688 Ga0075366_100196884 119
390 3300006353 Ga0075370_10000200 Ga0075370_100002009 119
391 3300006353 Ga0075370_10106149 Ga0075370_101061493 119
392 3300006358 Ga0068871_100063977 Ga0068871_1000639772 119
393 3300006844 Ga0075428_100000297 Ga0075428_10000029723 119
394 3300006844 Ga0075428_100027105 Ga0075428_1000271053 119
395 3300006844 Ga0075428_100029005 Ga0075428_1000290053 119
396 3300006844 Ga0075428_100044431 Ga0075428_1000444313 119
397 3300006846 Ga0075430_100016325 Ga0075430_1000163253 119
398 3300006846 Ga0075430_100134902 Ga0075430_1001349022 119
399 3300006846 Ga0075430_100236932 Ga0075430_1002369322 119
400 3300006847 Ga0075431_100000023 Ga0075431_10000002323 119
401 3300006847 Ga0075431_100003434 Ga0075431_1000034342 119
402 3300006847 Ga0075431_100017257 Ga0075431_1000172579 119
403 3300006847 Ga0075431_100071115 Ga0075431_1000711153 119
404 3300006847 Ga0075431_100246290 Ga0075431_1002462902 119
405 3300006847 Ga0075431_100332489 Ga0075431_1003324893 119
406 3300006847 Ga0075431_100401891 Ga0075431_1004018912 119
407 3300006852 Ga0075433_10665514 Ga0075433_106655141 119
408 3300006871 Ga0075434_100235392 Ga0075434_1002353922 119
409 3300006880 Ga0075429_100000233 Ga0075429_10000023321 119
410 3300006880 Ga0075429_100001157 Ga0075429_10000115723 119
411 3300006880 Ga0075429_100009505 Ga0075429_1000095053 119
412 3300006880 Ga0075429_100041492 Ga0075429_1000414922 119
413 3300006880 Ga0075429_100312446 Ga0075429_1003124462 119
414 3300006914 Ga0075436_100077074 Ga0075436_1000770744 119
415 3300006914 Ga0075436_100229594 Ga0075436_1002295942 119
416 3300006914 Ga0075436_101138360 Ga0075436_1011383602 119
417 3300006914 Ga0075436_101258703 Ga0075436_1012587032 119
418 3300006931 Ga0097620_100006512 Ga0097620_1000065126 119
419 3300006931 Ga0097620_100007080 Ga0097620_1000070804 119
420 3300006931 Ga0097620_100170510 Ga0097620_1001705103 119
421 3300006931 Ga0097620_100653899 Ga0097620_1006538992 119
422 3300006942 Ga0099824_1014217 Ga0099824_10142173 119
423 3300006943 Ga0099822_1009768 Ga0099822_100976811 119
424 3300007076 Ga0075435_100037087 Ga0075435_1000370873 119
425 3300007788 Ga0099795_10251240 Ga0099795_102512401 119
426 3300009011 Ga0105251_10054543 Ga0105251_100545431 119
427 3300009036 Ga0105244_10090379 Ga0105244_100903792 119
428 3300009093 Ga0105240_10202508 Ga0105240_102025081 119
429 3300009094 Ga0111539_10002140 Ga0111539_1000214022 119
430 3300009094 Ga0111539_10002965 Ga0111539_100029656 119
431 3300009094 Ga0111539_10018787 Ga0111539_100187873 119
432 3300009094 Ga0111539_10129689 Ga0111539_101296892 119
433 3300009094 Ga0111539_10139501 Ga0111539_101395014 119
434 3300009094 Ga0111539_10615008 Ga0111539_106150082 119
435 3300009094 Ga0111539_11545216 Ga0111539_115452161 119
436 3300009098 Ga0105245_11466006 Ga0105245_114660062 119
437 3300009101 Ga0105247_10357846 Ga0105247_103578462 119
438 3300009147 Ga0114129_10007028 Ga0114129_1000702815 119
439 3300009147 Ga0114129_10029543 Ga0114129_100295436 119
440 3300009147 Ga0114129_10080988 Ga0114129_100809884 119
441 3300009147 Ga0114129_10696674 Ga0114129_106966742 119
442 3300009147 Ga0114129_10751009 Ga0114129_107510092 119
443 3300009147 Ga0114129_12275023 Ga0114129_122750231 119
444 3300009148 Ga0105243_10004657 Ga0105243_100046575 119
445 3300009148 Ga0105243_10057153 Ga0105243_100571532 119
446 3300009148 Ga0105243_10111035 Ga0105243_101110352 119
447 3300009148 Ga0105243_10249950 Ga0105243_102499503 119
448 3300009148 Ga0105243_11342678 Ga0105243_113426782 119
449 3300009148 Ga0105243_11691393 Ga0105243_116913931 119
450 3300009174 Ga0105241_10096282 Ga0105241_100962823 119
451 3300009176 Ga0105242_10042252 Ga0105242_100422521 119
452 3300009176 Ga0105242_12878664 Ga0105242_128786641 119
453 3300009177 Ga0105248_10006127 Ga0105248_100061277 119
454 3300009177 Ga0105248_10676614 Ga0105248_106766143 119
455 3300009545 Ga0105237_10592764 Ga0105237_105927642 119
456 3300009551 Ga0105238_10012654 Ga0105238_100126546 119
457 3300009553 Ga0105249_10008029 Ga0105249_100080294 119
458 3300009553 Ga0105249_10039521 Ga0105249_100395214 119
459 3300009553 Ga0105249_10842925 Ga0105249_108429252 119
460 3300009553 Ga0105249_11258783 Ga0105249_112587831 119
461 3300010375 Ga0105239_10765907 Ga0105239_107659072 119
462 3300011119 Ga0105246_10061349 Ga0105246_100613492 119
463 3300011119 Ga0105246_10277113 Ga0105246_102771132 119
464 3300012502 Ga0157347_1005237 Ga0157347_10052372 119
465 3300012505 Ga0157339_1018539 Ga0157339_10185391 119
466 3300013104 Ga0157370_10317372 Ga0157370_103173722 119
467 3300013296 Ga0157374_11792230 Ga0157374_117922301 119
468 3300013297 Ga0157378_10074507 Ga0157378_100745073 119
469 3300013297 Ga0157378_10138887 Ga0157378_101388872 119
470 3300013297 Ga0157378_10251993 Ga0157378_102519932 119
471 3300013297 Ga0157378_10844525 Ga0157378_108445252 119
472 3300013306 Ga0163162_10154008 Ga0163162_101540082 119
473 3300013306 Ga0163162_10203539 Ga0163162_102035392 119
474 3300013308 Ga0157375_10012915 Ga0157375_100129152 119
475 3300013308 Ga0157375_11441006 Ga0157375_114410061 119
476 3300014325 Ga0163163_10068226 Ga0163163_100682262 119
477 3300014325 Ga0163163_10075378 Ga0163163_100753784 119
478 3300014326 Ga0157380_10626205 Ga0157380_106262052 119
479 3300014745 Ga0157377_10339785 Ga0157377_103397852 119
480 3300014968 Ga0157379_10174748 Ga0157379_101747483 119
481 3300014968 Ga0157379_10567852 Ga0157379_105678522 119
482 3300017792 Ga0163161_10000193 Ga0163161_1000019351 119
483 3300025208 Ga0209436_103446 Ga0209436_1034461 119
484 3300025245 Ga0207425_1000295 Ga0207425_100029521 119
485 3300025245 Ga0207425_1006691 Ga0207425_10066915 119
486 3300025258 Ga0209129_1000007 Ga0209129_1000007354 119
487 3300025258 Ga0209129_1002839 Ga0209129_10028397 119
488 3300025258 Ga0209129_1004098 Ga0209129_10040983 119
489 3300025258 Ga0209129_1035902 Ga0209129_10359021 119
490 3300025263 Ga0209565_1000937 Ga0209565_10009379 119
491 3300025263 Ga0209565_1004131 Ga0209565_10041313 119
492 3300025263 Ga0209565_1004138 Ga0209565_10041385 119
493 3300025273 Ga0209673_1000133 Ga0209673_1000133109 119
494 3300025273 Ga0209673_1000304 Ga0209673_100030488 119
495 3300025284 Ga0209130_1000070 Ga0209130_1000070191 119
496 3300025284 Ga0209130_1000326 Ga0209130_100032615 119
497 3300025291 Ga0209675_1000516 Ga0209675_100051614 119
498 3300025291 Ga0209675_1011016 Ga0209675_10110164 119
499 3300025292 Ga0209676_1000122 Ga0209676_1000122168 119
500 3300025292 Ga0209676_1000268 Ga0209676_100026852 119
501 3300025292 Ga0209676_1001242 Ga0209676_10012425 119
502 3300025292 Ga0209676_1001471 Ga0209676_10014713 119
503 3300025294 Ga0209025_1000111 Ga0209025_1000111190 119
504 3300025294 Ga0209025_1000432 Ga0209025_100043273 119
505 3300025294 Ga0209025_1005232 Ga0209025_10052323 119
506 3300025295 Ga0209564_1000524 Ga0209564_100052414 119
507 3300025295 Ga0209564_1000594 Ga0209564_100059414 119
508 3300025297 Ga0209758_1000025 Ga0209758_1000025172 119
509 3300025297 Ga0209758_1002137 Ga0209758_10021377 119
510 3300025297 Ga0209758_1109639 Ga0209758_11096391 119
511 3300025298 Ga0209050_1000002 Ga0209050_10000021601 119
512 3300025298 Ga0209050_1001024 Ga0209050_100102411 119
513 3300025299 Ga0209256_1000050 Ga0209256_1000050238 119
514 3300025299 Ga0209256_1000063 Ga0209256_100006365 119
515 3300025302 Ga0207426_1000001 Ga0207426_1000001465 119
516 3300025302 Ga0207426_1000028 Ga0207426_1000028283 119
517 3300025302 Ga0207426_1056346 Ga0207426_10563461 119
518 3300025303 Ga0209051_1000002 Ga0209051_10000021371 119
519 3300025303 Ga0209051_1000343 Ga0209051_100034352 119
520 3300025303 Ga0209051_1000618 Ga0209051_100061814 119
521 3300025303 Ga0209051_1010933 Ga0209051_10109333 119
522 3300025303 Ga0209051_1031937 Ga0209051_10319373 119
523 3300025304 Ga0209257_1000002 Ga0209257_10000021512 119
524 3300025304 Ga0209257_1000333 Ga0209257_100033329 119
525 3300025304 Ga0209257_1001964 Ga0209257_100196410 119
526 3300025304 Ga0209257_1016193 Ga0209257_10161933 119
527 3300025728 Ga0207655_1091965 Ga0207655_10919653 119
528 3300025901 Ga0207688_10422809 Ga0207688_104228092 119
529 3300025907 Ga0207645_10327377 Ga0207645_103273772 119
530 3300025908 Ga0207643_10040270 Ga0207643_100402704 119
531 3300025910 Ga0207684_10993282 Ga0207684_109932821 119
532 3300025912 Ga0207707_10706647 Ga0207707_107066472 119
533 3300025915 Ga0207693_10096087 Ga0207693_100960872 119
534 3300025918 Ga0207662_10006890 Ga0207662_100068903 119
535 3300025918 Ga0207662_10333895 Ga0207662_103338952 119
536 3300025918 Ga0207662_10749414 Ga0207662_107494141 119
537 3300025920 Ga0207649_10776863 Ga0207649_107768632 119
538 3300025921 Ga0207652_10201294 Ga0207652_102012942 119
539 3300025922 Ga0207646_10259782 Ga0207646_102597822 119
540 3300025922 Ga0207646_10446469 Ga0207646_104464693 119
541 3300025923 Ga0207681_10006525 Ga0207681_100065255 119
542 3300025924 Ga0207694_10003297 Ga0207694_100032972 119
543 3300025924 Ga0207694_10259732 Ga0207694_102597322 119
544 3300025925 Ga0207650_10117443 Ga0207650_101174433 119
545 3300025926 Ga0207659_10004378 Ga0207659_100043784 119
546 3300025928 Ga0207700_11285738 Ga0207700_112857382 119
547 3300025931 Ga0207644_10095970 Ga0207644_100959702 119
548 3300025933 Ga0207706_10121753 Ga0207706_101217532 119
549 3300025935 Ga0207709_10000425 Ga0207709_1000042526 119
550 3300025935 Ga0207709_10014698 Ga0207709_100146985 119
551 3300025935 Ga0207709_10273485 Ga0207709_102734853 119
552 3300025935 Ga0207709_11130977 Ga0207709_111309771 119
553 3300025936 Ga0207670_10022262 Ga0207670_100222623 119
554 3300025936 Ga0207670_11399229 Ga0207670_113992291 119
555 3300025937 Ga0207669_10008844 Ga0207669_100088441 119
556 3300025938 Ga0207704_10302164 Ga0207704_103021642 119
557 3300025938 Ga0207704_11226878 Ga0207704_112268781 119
558 3300025939 Ga0207665_10408695 Ga0207665_104086952 119
559 3300025940 Ga0207691_10029622 Ga0207691_100296222 119
560 3300025941 Ga0207711_10060547 Ga0207711_100605471 119
561 3300025941 Ga0207711_10759993 Ga0207711_107599932 119
562 3300025942 Ga0207689_10223061 Ga0207689_102230612 119
563 3300025945 Ga0207679_10548749 Ga0207679_105487491 119
564 3300025945 Ga0207679_10553632 Ga0207679_105536321 119
565 3300025960 Ga0207651_10017321 Ga0207651_100173216 119
566 3300025961 Ga0207712_10027019 Ga0207712_100270194 119
567 3300025961 Ga0207712_10045740 Ga0207712_100457404 119
568 3300025972 Ga0207668_10002266 Ga0207668_100022666 119
569 3300025972 Ga0207668_10140769 Ga0207668_101407693 119
570 3300025981 Ga0207640_10447266 Ga0207640_104472662 119
571 3300025986 Ga0207658_10063781 Ga0207658_100637812 119
572 3300025986 Ga0207658_10323307 Ga0207658_103233072 119
573 3300026023 Ga0207677_11156331 Ga0207677_111563312 119
574 3300026035 Ga0207703_10020856 Ga0207703_100208566 119
575 3300026041 Ga0207639_10058142 Ga0207639_100581423 119
576 3300026041 Ga0207639_10108699 Ga0207639_101086992 119
577 3300026041 Ga0207639_10768672 Ga0207639_107686722 119
578 3300026041 Ga0207639_11687155 Ga0207639_116871552 119
579 3300026067 Ga0207678_10654021 Ga0207678_106540212 119
580 3300026075 Ga0207708_10077899 Ga0207708_100778993 119
581 3300026075 Ga0207708_10507107 Ga0207708_105071072 119
582 3300026075 Ga0207708_10801077 Ga0207708_108010771 119
583 3300026078 Ga0207702_10702571 Ga0207702_107025713 119
584 3300026088 Ga0207641_10068585 Ga0207641_100685852 119
585 3300026089 Ga0207648_10024037 Ga0207648_100240373 119
586 3300026089 Ga0207648_10482256 Ga0207648_104822562 119
587 3300026095 Ga0207676_10032953 Ga0207676_100329532 119
588 3300026095 Ga0207676_10181122 Ga0207676_101811222 119
589 3300026116 Ga0207674_10028441 Ga0207674_100284416 119
590 3300026116 Ga0207674_10527877 Ga0207674_105278772 119
591 3300026116 Ga0207674_10887388 Ga0207674_108873882 119
592 3300026118 Ga0207675_100001323 Ga0207675_10000132310 119
593 3300026118 Ga0207675_100028037 Ga0207675_1000280375 119
594 3300026121 Ga0207683_10039230 Ga0207683_100392304 119
595 3300027357 Ga0209589_1000015 Ga0209589_1000015179 119
596 3300027361 Ga0209489_100015 Ga0209489_100015179 119
597 3300027363 Ga0209700_100025 Ga0209700_100025179 119
598 3300027364 Ga0209967_1019733 Ga0209967_10197332 119
599 3300027526 Ga0209968_1055410 Ga0209968_10554101 119
600 3300027682 Ga0209971_1074451 Ga0209971_10744512 119
601 3300027866 Ga0209813_10264236 Ga0209813_102642361 119
602 3300027907 Ga0207428_10006800 Ga0207428_100068003 119
603 3300027907 Ga0207428_10099073 Ga0207428_100990733 119
604 3300027907 Ga0207428_10202744 Ga0207428_102027442 119
605 3300028379 Ga0268266_10065692 Ga0268266_100656923 119
606 3300028379 Ga0268266_10823025 Ga0268266_108230252 119
607 3300028380 Ga0268265_10000934 Ga0268265_100009346 119
608 3300028380 Ga0268265_10002870 Ga0268265_100028707 119
609 3300028380 Ga0268265_10382513 Ga0268265_103825131 119
610 3300028380 Ga0268265_10410080 Ga0268265_104100802 119
611 3300028380 Ga0268265_11862065 Ga0268265_118620652 119
612 3300028381 Ga0268264_10552709 Ga0268264_105527092 119
613 3300028381 Ga0268264_12453646 Ga0268264_124536461 119
614 3300028794 Ga0307515_10497397 Ga0307515_104973972 119
615 3300031344 Ga0265316_10910654 Ga0265316_109106542 119
616 3300031548 Ga0307408_100007266 Ga0307408_1000072664 119
617 3300031548 Ga0307408_100084637 Ga0307408_1000846373 119
618 3300031548 Ga0307408_101001178 Ga0307408_1010011782 119
619 3300031548 Ga0307408_102348740 Ga0307408_1023487401 119
620 3300031730 Ga0307516_10934119 Ga0307516_109341192 119
621 3300031731 Ga0307405_10301564 Ga0307405_103015643 119
622 3300031731 Ga0307405_11177955 Ga0307405_111779551 119
623 3300031901 Ga0307406_10000864 Ga0307406_100008647 119
624 3300031901 Ga0307406_10102838 Ga0307406_101028382 119
625 3300031911 Ga0307412_10011951 Ga0307412_100119513 119
626 3300031911 Ga0307412_11552046 Ga0307412_115520461 119
627 3300031995 Ga0307409_100598867 Ga0307409_1005988672 119
628 3300031995 Ga0307409_101391232 Ga0307409_1013912321 119
629 3300032002 Ga0307416_100074967 Ga0307416_1000749672 119
630 3300032002 Ga0307416_100463475 Ga0307416_1004634752 119
631 3300032002 Ga0307416_101392562 Ga0307416_1013925622 119
632 3300032002 Ga0307416_103242876 Ga0307416_1032428761 119
633 3300032005 Ga0307411_10554270 Ga0307411_105542702 119
634 3300032005 Ga0307411_10669711 Ga0307411_106697112 119
635 3300032126 Ga0307415_100196605 Ga0307415_1001966052 119
636 3300032126 Ga0307415_100601000 Ga0307415_1006010002 119
637 3300033180 Ga0307510_10465125 Ga0307510_104651252 119
638 3300035088 Ga0373940_0134852 Ga0373940_0134852_389_754 119
639 3300035089 Ga0373944_0323882 Ga0373944_0323882_127_489 119
640 3300035113 Ga0373936_0085866 Ga0373936_0085866_885_1256 119
641 3300035114 Ga0373939_0206704 Ga0373939_0206704_365_727 119
642 3300035114 Ga0373939_0492350 Ga0373939_0492350_60_422 119
643 3300035116 Ga0373945_0202334 Ga0373945_0202334_261_650 119
644 3300035119 Ga0373956_0101854 Ga0373956_0101854_763_1155 119
645 3300035170 Ga0373943_0262399 Ga0373943_0262399_136_498 119
646 3300035692 Ga0373935_0176088 Ga0373935_0176088_692_1060 119
647 3300035692 Ga0373935_0932350 Ga0373935_0932350_70_432 119
648 3300035695 Ga0373927_0276097 Ga0373927_0276097_707_1075 119
649 3300035724 Ga0373933_0433824 Ga0373933_0433824_426_815 119
650 3300036401 Ga0373937_1243140 Ga0373937_1243140_249_611 119
651 3300036401 Ga0373937_1591613 Ga0373937_1591613_79_471 119
652 3300037068 Ga0373925_0027752 Ga0373925_0027752_1702_2064 119
653 3300037068 Ga0373925_0314085 Ga0373925_0314085_258_626 119
654 3300037068 Ga0373925_0627873 Ga0373925_0627873_69_458 119
655 3300037312 Ga0395899_0606705 Ga0395899_0606705_289_648 119
656 3300037466 Ga0395898_1373559 Ga0395898_1373559_133_492 119
657 3300037853 Ga0436364_1056250 Ga0436364_1056250_2085_2453 119
658 3300038443 Ga0395901_1083647 Ga0395901_1083647_382_741 119
659 3300039437 Ga0436365_0984935 Ga0436365_0984935_169_531 119
660 3300039437 Ga0436365_1258172 Ga0436365_1258172_333_695 119
661 3300041406 Ga0439439_0106361 Ga0439439_0106361_268_630 119
662 3300041408 Ga0439453_0034710 Ga0439453_0034710_445_807 119
663 3300041451 Ga0451791_1242738 Ga0451791_1242738_249_611 119
664 3300041458 Ga0451798_0391002 Ga0451798_0391002_311_673 119
665 3300041512 Ga0451853_0286293 Ga0451853_0286293_130_489 119
666 3300041997 Ga0439431_0221383 Ga0439431_0221383_16_378 119
667 3300042126 Ga0450888_039674 Ga0450888_039674_74_436 119
668 3300042435 Ga0439434_0063850 Ga0439434_0063850_327_689 119
669 3300042876 Ga0451577_0647980 Ga0451577_0647980_165_527 119
670 3300044658 Ga0466972_0114099 Ga0466972_0114099_463_834 119
671 3300044658 Ga0466972_0359088 Ga0466972_0359088_52_423 119
672 3300044683 Ga0466965_0026346 Ga0466965_0026346_2057_2428 119
673 3300044683 Ga0466965_0496351 Ga0466965_0496351_302_673 119
674 3300045051 Ga0451576_0040510 Ga0451576_0040510_438_803 119
675 3300045051 Ga0451576_0429688 Ga0451576_0429688_869_1231 119
676 3300045051 Ga0451576_1096805 Ga0451576_1096805_294_656 119
677 3300046453 Ga0495627_006801 Ga0495627_006801_2738_3097 119
678 3300046460 Ga0495638_0127269 Ga0495638_0127269_117_476 119
679 3300046492 Ga0495585_0313774 Ga0495585_0313774_130_489 119
680 3300046512 Ga0495610_0085333 Ga0495610_0085333_678_1037 119
681 3300046512 Ga0495610_0309964 Ga0495610_0309964_203_562 119
682 3300046513 Ga0495616_0030852 Ga0495616_0030852_1645_2004 119
683 3300046515 Ga0495620_0110834 Ga0495620_0110834_101_460 119
684 3300046518 Ga0495631_0000228 Ga0495631_0000228_13850_14209 119
685 3300046520 Ga0495637_0003270 Ga0495637_0003270_900_1259 119
686 3300046520 Ga0495637_0017432 Ga0495637_0017432_885_1244 119
687 3300046524 Ga0495648_0486764 Ga0495648_0486764_43_402 119
688 3300046530 Ga0495654_0008482 Ga0495654_0008482_1679_2038 119
689 3300046530 Ga0495654_0198380 Ga0495654_0198380_199_558 119
690 3300046539 Ga0495621_0025662 Ga0495621_0025662_100_459 119
691 3300046539 Ga0495621_0034177 Ga0495621_0034177_967_1329 119
692 3300046558 Ga0495633_0374170 Ga0495633_0374170_109_468 119
693 3300046616 Ga0495668_0085111 Ga0495668_0085111_395_760 119
694 3300046616 Ga0495668_0299807 Ga0495668_0299807_434_793 119
695 3300046648 Ga0495611_0034497 Ga0495611_0034497_823_1197 119
696 3300046660 Ga0495625_0043979 Ga0495625_0043979_1000_1359 119
697 3300046660 Ga0495625_0158703 Ga0495625_0158703_766_1125 119
698 3300046664 Ga0495659_0466040 Ga0495659_0466040_84_443 119
699 3300046665 Ga0495661_0081910 Ga0495661_0081910_1350_1709 119
700 3300046674 Ga0495588_0033283 Ga0495588_0033283_76_435 119
701 3300046674 Ga0495588_0037595 Ga0495588_0037595_582_941 119
702 3300046683 Ga0495658_0136418 Ga0495658_0136418_428_787 119
703 3300046691 Ga0495670_0017426 Ga0495670_0017426_1414_1773 119
704 3300046691 Ga0495670_0310459 Ga0495670_0310459_381_740 119
705 3300046692 Ga0495671_0016975 Ga0495671_0016975_2172_2531 119
706 3300046809 Ga0495600_0896140 Ga0495600_0896140_109_471 119
707 3300047315 Ga0495581_0344213 Ga0495581_0344213_354_722 119
708 3300047317 Ga0495604_0911006 Ga0495604_0911006_109_471 119
709 3300047321 Ga0495676_0016422 Ga0495676_0016422_2116_2475 119
710 3300047321 Ga0495676_0954017 Ga0495676_0954017_51_419 119
711 3300047469 Ga0495673_0053813 Ga0495673_0053813_555_929 119
712 3300047472 Ga0495686_0302814 Ga0495686_0302814_264_623 119
713 3300047673 Ga0495593_0007756 Ga0495593_0007756_3277_3636 119
714 3300048089 Ga0495614_0004411 Ga0495614_0004411_5228_5587 119
715 3300048903 Ga0496100_0032873 Ga0496100_0032873_1639_2007 119
716 3300048903 Ga0496100_0426347 Ga0496100_0426347_430_792 119
717 3300048904 Ga0496101_0063210 Ga0496101_0063210_1722_2090 119
718 3300048907 Ga0496104_0007351 Ga0496104_0007351_4388_4756 119
719 3300048908 Ga0496105_0002518 Ga0496105_0002518_4352_4720 119
720 3300048909 Ga0496106_0108520 Ga0496106_0108520_988_1350 119
721 3300048910 Ga0496107_0392174 Ga0496107_0392174_383_742 119
722 3300048911 Ga0496108_0000416 Ga0496108_0000416_22262_22630 119
723 3300048912 Ga0496109_0001317 Ga0496109_0001317_2388_2756 119
724 3300048912 Ga0496109_0144616 Ga0496109_0144616_402_764 119
725 3300048913 Ga0496110_0004470 Ga0496110_0004470_3361_3729 119
726 3300048913 Ga0496110_0289343 Ga0496110_0289343_1113_1475 119
727 3300048914 Ga0496111_0015024 Ga0496111_0015024_1367_1735 119
728 3300048915 Ga0496112_0007446 Ga0496112_0007446_2238_2606 119
729 3300048916 Ga0496113_0001503 Ga0496113_0001503_5707_6075 119
730 3300048916 Ga0496113_0513156 Ga0496113_0513156_257_619 119
731 3300048917 Ga0496114_0109856 Ga0496114_0109856_1429_1797 119
732 3300048918 Ga0496115_0001063 Ga0496115_0001063_5096_5464 119
733 3300048921 Ga0496118_0047253 Ga0496118_0047253_1785_2144 119
734 3300048921 Ga0496118_0552753 Ga0496118_0552753_99_458 119
735 3300048924 Ga0496121_0191741 Ga0496121_0191741_254_613 119
736 3300048927 Ga0496124_0146552 Ga0496124_0146552_1030_1389 119
737 3300048928 Ga0496125_0030971 Ga0496125_0030971_1691_2050 119
738 3300048928 Ga0496125_0142168 Ga0496125_0142168_190_549 119
739 3300048928 Ga0496125_0182201 Ga0496125_0182201_333_692 119
740 3300048929 Ga0496126_0146230 Ga0496126_0146230_454_813 119
741 3300049513 Ga0501290_038401 Ga0501290_038401_23_385 119
742 3300049514 Ga0501291_015509 Ga0501291_015509_444_806 119
743 3300049521 Ga0501298_012971 Ga0501298_012971_432_794 119
744 3300049522 Ga0501299_039254 Ga0501299_039254_450_812 119
745 3300049522 Ga0501299_043836 Ga0501299_043836_13_375 119
746 3300049523 Ga0501300_007930 Ga0501300_007930_208_570 119
747 3300049523 Ga0501300_021066 Ga0501300_021066_431_793 119
748 3300049524 Ga0501301_004281 Ga0501301_004281_478_840 119
749 3300049526 Ga0501303_015012 Ga0501303_015012_371_733 119
750 3300049568 Ga0501031_0552354 Ga0501031_0552354_198_560 119
751 3300049568 Ga0501031_0584065 Ga0501031_0584065_180_539 119
752 3300049570 Ga0501033_0041065 Ga0501033_0041065_965_1339 119
753 3300049570 Ga0501033_0214561 Ga0501033_0214561_966_1325 119
754 3300049570 Ga0501033_0426682 Ga0501033_0426682_396_755 119
755 3300049570 Ga0501033_0574894 Ga0501033_0574894_273_647 119
756 3300049572 Ga0501036_0285435 Ga0501036_0285435_652_1011 119
757 3300049572 Ga0501036_0385468 Ga0501036_0385468_551_913 119
758 3300049574 Ga0501038_0265701 Ga0501038_0265701_764_1123 119
759 3300049574 Ga0501038_0839378 Ga0501038_0839378_225_599 119
760 3300049575 Ga0501039_0228504 Ga0501039_0228504_477_851 119
761 3300049579 Ga0501043_0044068 Ga0501043_0044068_1466_1840 119
762 3300049579 Ga0501043_0146762 Ga0501043_0146762_569_943 119
763 3300049579 Ga0501043_0628128 Ga0501043_0628128_54_413 119
764 3300049581 Ga0501047_0042513 Ga0501047_0042513_185_544 119
765 3300049581 Ga0501047_0134767 Ga0501047_0134767_1361_1735 119
766 3300049581 Ga0501047_0419993 Ga0501047_0419993_542_901 119
767 3300049582 Ga0501048_1020764 Ga0501048_1020764_166_525 119
768 3300049583 Ga0501067_0340210 Ga0501067_0340210_49_423 119
769 3300049586 Ga0501070_0195616 Ga0501070_0195616_552_911 119
770 3300049586 Ga0501070_0235628 Ga0501070_0235628_340_714 119
771 3300049587 Ga0501071_0360181 Ga0501071_0360181_46_408 119
772 3300049589 Ga0501073_0063886 Ga0501073_0063886_432_806 119
773 3300049661 Ga0501217_028643 Ga0501217_028643_667_1029 119
774 3300049662 Ga0501222_085773 Ga0501222_085773_100_462 119
775 3300049666 Ga0501228_009623 Ga0501228_009623_211_573 119
776 3300049668 Ga0501233_098885 Ga0501233_098885_51_413 119
777 3300049669 Ga0501235_110828 Ga0501235_110828_261_623 119
778 3300049672 Ga0501239_024681 Ga0501239_024681_95_457 119
779 3300049675 Ga0501243_063823 Ga0501243_063823_229_591 119
780 3300049679 Ga0501249_005412 Ga0501249_005412_1900_2262 119
781 3300049683 Ga0501253_026319 Ga0501253_026319_470_832 119
782 3300049684 Ga0501255_035596 Ga0501255_035596_236_598 119
783 3300049686 Ga0501257_074952 Ga0501257_074952_377_739 119
784 3300049705 Ga0501225_0050068 Ga0501225_0050068_297_659 119
785 3300049707 Ga0501234_037477 Ga0501234_037477_330_692 119
786 3300049707 Ga0501234_093641 Ga0501234_093641_19_381 119
787 3300049741 Ga0501079_1187223 Ga0501079_1187223_56_418 119
788 3300049742 Ga0501080_0089685 Ga0501080_0089685_1867_2241 119
789 3300049744 Ga0501083_0057120 Ga0501083_0057120_591_965 119
790 3300049765 Ga0501268_021864 Ga0501268_021864_321_683 119
791 3300049770 Ga0501273_024961 Ga0501273_024961_80_442 119
792 3300049779 Ga0501283_016634 Ga0501283_016634_372_734 119
793 3300049822 Ga0501035_0099387 Ga0501035_0099387_245_619 119
794 3300049822 Ga0501035_0229301 Ga0501035_0229301_792_1151 119
795 3300049822 Ga0501035_1571069 Ga0501035_1571069_69_428 119
796 3300049823 Ga0501044_0020908 Ga0501044_0020908_6306_6680 119
797 3300049823 Ga0501044_0043051 Ga0501044_0043051_1804_2178 119
798 3300049823 Ga0501044_0078100 Ga0501044_0078100_1556_1915 119
799 3300049824 Ga0501045_0536489 Ga0501045_0536489_474_836 119
800 3300049853 Ga0501226_010258 Ga0501226_010258_127_489 119
801 3300050490 nmdc:mga03n38_295779_c1 nmdc:mga03n38_295779_c1_371_730 119
802 3300050490 nmdc:mga03n38_307011_c1 nmdc:mga03n38_307011_c1_146_511 119
803 3300050493 nmdc:mga0k408_52439_c1 nmdc:mga0k408_52439_c1_1900_2259 119
804 3300050496 nmdc:mga07m45_19644_c1 nmdc:mga07m45_19644_c1_3108_3467 119
805 3300050496 nmdc:mga07m45_7294_c1 nmdc:mga07m45_7294_c1_4214_4573 119
806 3300050507 nmdc:mga05p37_1249654_c1 nmdc:mga05p37_1249654_c1_82_444 119
807 3300050507 nmdc:mga05p37_1520_c1 nmdc:mga05p37_1520_c1_14212_14574 119
808 3300050507 nmdc:mga05p37_374128_c1 nmdc:mga05p37_374128_c1_1110_1472 119
809 3300050507 nmdc:mga05p37_63921_c1 nmdc:mga05p37_63921_c1_3737_4099 119
810 3300050507 nmdc:mga05p37_9043_c1 nmdc:mga05p37_9043_c1_7232_7594 119
811 3300050508 nmdc:mga09592_1601_c1 nmdc:mga09592_1601_c1_582_944 119
812 3300050508 nmdc:mga09592_3996_c1 nmdc:mga09592_3996_c1_5136_5498 119
813 3300050508 nmdc:mga09592_487_c1 nmdc:mga09592_487_c1_22075_22437 119
814 3300050508 nmdc:mga09592_73735_c1 nmdc:mga09592_73735_c1_2439_2801 119
815 3300050509 nmdc:mga0qj67_37729_c1 nmdc:mga0qj67_37729_c1_937_1299 119
816 3300050509 nmdc:mga0qj67_415810_c1 nmdc:mga0qj67_415810_c1_376_741 119
817 3300050509 nmdc:mga0qj67_54926_c2 nmdc:mga0qj67_54926_c2_627_989 119
818 3300050510 nmdc:mga06r32_142565_c1 nmdc:mga06r32_142565_c1_1891_2253 119
819 3300050510 nmdc:mga06r32_1976653_c1 nmdc:mga06r32_1976653_c1_78_440 119
820 3300050510 nmdc:mga06r32_247202_c1 nmdc:mga06r32_247202_c1_394_756 119
821 3300050510 nmdc:mga06r32_26444_c1 nmdc:mga06r32_26444_c1_3813_4175 119
822 3300050510 nmdc:mga06r32_699_c1 nmdc:mga06r32_699_c1_14748_15110 119
823 3300050510 nmdc:mga06r32_77534_c1 nmdc:mga06r32_77534_c1_1587_1949 119
824 3300050511 nmdc:mga08y16_2380_c1 nmdc:mga08y16_2380_c1_16401_16763 119
825 3300050511 nmdc:mga08y16_334077_c1 nmdc:mga08y16_334077_c1_663_1025 119
826 3300050511 nmdc:mga08y16_502_c1 nmdc:mga08y16_502_c1_32084_32446 119
827 3300050511 nmdc:mga08y16_61819_c1 nmdc:mga08y16_61819_c1_2102_2464 119
828 3300050512 nmdc:mga0n895_228066_c1 nmdc:mga0n895_228066_c1_1298_1660 119
829 3300050513 nmdc:mga0rr50_2784_c2 nmdc:mga0rr50_2784_c2_2048_2410 119
830 3300050513 nmdc:mga0rr50_343494_c1 nmdc:mga0rr50_343494_c1_576_941 119
831 3300050514 nmdc:mga08x19_200250_c1 nmdc:mga08x19_200250_c1_925_1287 119
832 3300050514 nmdc:mga08x19_251957_c1 nmdc:mga08x19_251957_c1_548_910 119
833 3300050515 nmdc:mga0a205_1103182_c1 nmdc:mga0a205_1103182_c1_173_535 119
834 3300050515 nmdc:mga0a205_177147_c1 nmdc:mga0a205_177147_c1_829_1194 119
835 3300053079 Ga0500610_0000863 Ga0500610_0000863_4356_4715 119
836 3300053079 Ga0500610_0002219 Ga0500610_0002219_2272_2631 119
837 3300053085 Ga0495619_0341420 Ga0495619_0341420_558_920 119
838 3300053087 Ga0500643_004104 Ga0500643_004104_2107_2466 119
839 3300053093 Ga0500651_0000097 Ga0500651_0000097_25444_25803 119
840 3300053094 Ga0500566_0221797 Ga0500566_0221797_505_864 119
841 3300053096 Ga0500641_0210319 Ga0500641_0210319_421_780 119
842 3300053103 Ga0500555_076491 Ga0500555_076491_459_818 119
843 3300053109 Ga0500569_022372 Ga0500569_022372_163_522 119
844 3300053110 Ga0500571_000190 Ga0500571_000190_8057_8416 119
845 3300053111 Ga0500572_277645 Ga0500572_277645_138_497 119
846 3300053116 Ga0500592_001100 Ga0500592_001100_3159_3518 119
847 3300053117 Ga0500593_000202 Ga0500593_000202_19316_19675 119
848 3300053119 Ga0500595_051415 Ga0500595_051415_872_1231 119
849 3300053121 Ga0500607_002610 Ga0500607_002610_1947_2306 119
850 3300053122 Ga0500608_061882 Ga0500608_061882_708_1067 119
851 3300053122 Ga0500608_255247 Ga0500608_255247_140_499 119
852 3300053124 Ga0500617_100156 Ga0500617_100156_79_441 119
853 3300053130 Ga0500642_0400374 Ga0500642_0400374_101_460 119
854 3300053134 Ga0500658_0000521 Ga0500658_0000521_11180_11539 119
855 3300053134 Ga0500658_0000753 Ga0500658_0000753_8325_8684 119
856 3300053136 Ga0500559_0008548 Ga0500559_0008548_826_1185 119
857 3300053138 Ga0500564_078987 Ga0500564_078987_537_896 119
858 3300053139 Ga0500568_0002122 Ga0500568_0002122_2936_3295 119
859 3300053141 Ga0500574_000630 Ga0500574_000630_2075_2434 119
860 3300053146 Ga0500588_0001478 Ga0500588_0001478_1641_2003 119
861 3300053153 Ga0500616_0207487 Ga0500616_0207487_441_800 119
862 3300053154 Ga0500619_233122 Ga0500619_233122_162_521 119
863 3300053158 Ga0500627_0004369 Ga0500627_0004369_3864_4223 119
864 3300053161 Ga0500634_0040681 Ga0500634_0040681_817_1176 119
865 3300053161 Ga0500634_0048954 Ga0500634_0048954_1876_2235 119
866 3300053162 Ga0500638_085098 Ga0500638_085098_980_1339 119
867 3300053177 Ga0500636_0037156 Ga0500636_0037156_1392_1751 119
868 3300053730 Ga0500645_073596 Ga0500645_073596_82_441 119
869 3300053734 Ga0500565_028227 Ga0500565_028227_14_373 119
870 3300054114 Ga0501084_1520306 Ga0501084_1520306_77_439 119
871 3300055283 Ga0500661_019643 Ga0500661_019643_253_615 119
872 3300060353 Ga0501082_0101653 Ga0501082_0101653_83_457 119
873 3300060353 Ga0501082_1994931 Ga0501082_1994931_48_410 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

122

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

12

123

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9163 1 118
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9018 1 118
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8243 1 119
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.818 1 119
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8027 1 119
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9163 1 118 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 1 118 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8484 60 119 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8072 61 117 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7997 1 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V1CTG9-F1-model_v4 VOC domain-containing protein 1 62 118
AF-A0A436RGB7-F1-model_v4 VOC family protein 0.9979 62 117
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 0.9953 60 118
AF-A0A4U9Z0D5-F1-model_v4 deleted 0.9937 62 117
AF-M5CMF1-F1-model_v4 deleted 0.992 61 118

Feature Viewer

pLDDT pTM Quality
94.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map