F484233

General Info

Members Datasets Scaffolds Average Seq Length
872 543 1744 107

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0162762|Ga0495648_0162762_18_389
Length 123
Sequence MAAELGLGPAKGYMTTMEETSPIDLSTCCQSCGACCGYSENWPRFSIESDEELAAIPEALVNARQSGMRCEGDRCSALQGEIGKQTACGIYDVRPEVCRTCMPGDAECAMARRKFGLPVIEAV

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
62 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
143 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
327 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
328 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
331 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
332 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
333 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
336 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
337 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
338 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
347 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
348 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
351 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
354 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
355 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
356 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
357 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
362 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
363 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
364 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
365 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
366 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
367 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
368 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
369 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
370 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
371 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
372 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
373 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
374 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
375 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
376 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
377 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
378 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
379 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
380 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
381 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
382 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
383 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
384 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
385 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
386 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
387 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
388 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
389 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
390 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
391 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
392 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
393 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
394 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
395 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
396 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
397 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
398 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
399 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
400 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
401 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
402 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
403 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
404 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
405 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
406 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
407 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
408 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
409 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
410 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
411 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
412 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
413 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
414 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
415 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
416 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
417 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
418 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
419 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
420 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
421 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
422 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
423 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
424 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
425 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
426 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
427 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
428 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
429 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
430 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
431 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
432 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
433 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
434 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
435 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
436 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
437 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
438 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
439 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
440 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
441 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
442 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
443 2922368715
444 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
445 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
446 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
447 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
448 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
449 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
450 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
451 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
452 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
453 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
454 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
455 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
456 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
457 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
458 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
459 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
460 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
461 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
462 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
463 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
464 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
465 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
466 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
467 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
468 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
469 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
470 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
471 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
472 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
473 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
474 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
475 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
476 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
477 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
478 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
479 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
480 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
481 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
482 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
483 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
484 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
485 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
486 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
487 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
488 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
489 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
490 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
491 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
492 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
493 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
494 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
495 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
496 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
497 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
498 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
499 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
500 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
501 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
502 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
503 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
504 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
505 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
506 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
507 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
508 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
509 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
510 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
511 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
512 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
513 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
514 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
515 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
516 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
517 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
518 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
519 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
520 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
521 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
522 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
523 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
524 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
525 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
526 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
527 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
528 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
529 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
530 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
531 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
532 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
533 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
534 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
535 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
536 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
537 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
538 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
539 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
540 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
541 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
542 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
543 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.56
Metatranscriptomes 0.11
Isolates 20.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18
Nodule 16.74
Rhizoplane 5.96
Rhizosphere 46.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0162762 3300046524 Bacteria 1152
2 RicEn_C1411 2010549000 Bacteria 923
3 JGI24737J22298_10049932 3300001990 Bacteria 1272
4 JGI25165J46597_1004722 3300003214 Bacteria 2827
5 JGI25165J46597_1020742 3300003214 Bacteria 860
6 JGI25153J46596_10000301 3300003215 Bacteria 36933
7 JGI25153J46596_10009239 3300003215 Bacteria 4612
8 JGI25153J46596_10049944 3300003215 Bacteria 1210
9 JGI25153J46596_10069419 3300003215 Bacteria 919
10 JGI25153J46596_10113656 3300003215 Bacteria 619
11 JGI25160J50197_1000761 3300003354 Bacteria 17408
12 JGI25160J50197_1002871 3300003354 Bacteria 7885
13 Ga0055542_1017316 3300003762 Bacteria 1117
14 Ga0055529_1032967 3300003763 Bacteria 633
15 Ga0055524_1040781 3300003775 Bacteria 1178
16 Ga0055531_10009160 3300003794 Bacteria 5102
17 Ga0055543_1003027 3300004625 Bacteria 5190
18 Ga0055543_1017528 3300004625 Bacteria 1347
19 Ga0065165_1000917 3300005262 Bacteria 37935
20 Ga0065165_1001167 3300005262 Bacteria 30545
21 Ga0065165_1032813 3300005262 Bacteria 1623
22 Ga0065165_1038894 3300005262 Bacteria 1429
23 Ga0070676_10689916 3300005328 Bacteria 745
24 Ga0070683_100011764 3300005329 Bacteria 7577
25 Ga0068869_100342042 3300005334 Bacteria 1218
26 Ga0070680_100287875 3300005336 Bacteria 1392
27 Ga0070682_100713405 3300005337 Bacteria 805
28 Ga0070660_100138557 3300005339 Bacteria 1950
29 Ga0070660_100591089 3300005339 Bacteria 928
30 Ga0070661_100213521 3300005344 Bacteria 1478
31 Ga0070661_100976559 3300005344 Bacteria 702
32 Ga0070668_100052294 3300005347 Bacteria 3148
33 Ga0070688_101821578 3300005365 Bacteria 500
34 Ga0070659_100300426 3300005366 Bacteria 1339
35 Ga0070667_100407878 3300005367 Bacteria 1238
36 Ga0070713_102002815 3300005436 Bacteria 562
37 Ga0070663_100056037 3300005455 Bacteria 2823
38 Ga0070663_100128552 3300005455 Bacteria 1921
39 Ga0070678_100492265 3300005456 Bacteria 1081
40 Ga0070681_10224288 3300005458 Bacteria 1794
41 Ga0068867_100072739 3300005459 Bacteria 2574
42 Ga0068867_101222100 3300005459 Bacteria 691
43 Ga0070706_101119322 3300005467 Bacteria 725
44 Ga0070679_100285758 3300005530 Bacteria 1601
45 Ga0070684_100003951 3300005535 Bacteria 11230
46 Ga0070684_100790640 3300005535 Bacteria 887
47 Ga0068853_100112298 3300005539 Bacteria 2422
48 Ga0068853_100124111 3300005539 Bacteria 2306
49 Ga0068853_100278198 3300005539 Bacteria 1543
50 Ga0068853_100648595 3300005539 Bacteria 1005
51 Ga0068853_100902425 3300005539 Bacteria 849
52 Ga0070696_100877758 3300005546 Bacteria 743
53 Ga0070693_100410178 3300005547 Bacteria 941
54 Ga0070693_100441069 3300005547 Bacteria 912
55 Ga0070665_100059928 3300005548 Bacteria 3815
56 Ga0070665_100264516 3300005548 Bacteria 1721
57 Ga0070665_100834674 3300005548 Bacteria 935
58 Ga0068855_100090289 3300005563 Bacteria 3536
59 Ga0068855_100212522 3300005563 Bacteria 2173
60 Ga0068855_100984847 3300005563 Bacteria 887
61 Ga0070664_100794392 3300005564 Bacteria 885
62 Ga0068857_100019162 3300005577 Bacteria 6006
63 Ga0068857_101247282 3300005577 Bacteria 721
64 Ga0068857_101581667 3300005577 Bacteria 640
65 Ga0068856_100178567 3300005614 Bacteria 2136
66 Ga0068856_100521223 3300005614 Bacteria 1210
67 Ga0068852_100045438 3300005616 Bacteria 3735
68 Ga0068852_101669851 3300005616 Bacteria 659
69 Ga0068859_100656318 3300005617 Bacteria 1141
70 Ga0068864_100427668 3300005618 Bacteria 1263
71 Ga0068864_100902645 3300005618 Bacteria 873
72 Ga0068851_10463439 3300005834 Bacteria 755
73 Ga0081540_1028527 3300005983 Bacteria 3132
74 Ga0081539_10024999 3300005985 Bacteria 3859
75 Ga0075365_10025255 3300006038 Bacteria 3759
76 Ga0075365_10025948 3300006038 Bacteria 3714
77 Ga0075365_10029994 3300006038 Bacteria 3480
78 Ga0075365_10033733 3300006038 Bacteria 3301
79 Ga0075365_10055263 3300006038 Bacteria 2634
80 Ga0075368_10007215 3300006042 Bacteria 3917
81 Ga0075368_10423375 3300006042 Bacteria 587
82 Ga0075363_100037622 3300006048 Bacteria 2542
83 Ga0075364_10022922 3300006051 Bacteria 3948
84 Ga0070715_10300335 3300006163 Bacteria 859
85 Ga0070712_100404806 3300006175 Bacteria 1128
86 Ga0070712_100845617 3300006175 Bacteria 787
87 Ga0075362_10494492 3300006177 Bacteria 625
88 Ga0075367_10044441 3300006178 Bacteria 2604
89 Ga0075367_10089603 3300006178 Bacteria 1870
90 Ga0075369_10038747 3300006186 Bacteria 2034
91 Ga0075369_10061178 3300006186 Bacteria 1643
92 Ga0075369_10347090 3300006186 Bacteria 696
93 Ga0075369_10463088 3300006186 Bacteria 601
94 Ga0075366_10003779 3300006195 Bacteria 8050
95 Ga0075370_10011212 3300006353 Bacteria 4704
96 Ga0068871_100682784 3300006358 Bacteria 940
97 Ga0068871_100925575 3300006358 Bacteria 809
98 Ga0097620_100656289 3300006931 Bacteria 1141
99 Ga0099825_1031826 3300006941 Bacteria 2197
100 Ga0099824_1009019 3300006942 Bacteria 12482
101 Ga0099822_1080485 3300006943 Bacteria 803
102 Ga0099823_1036587 3300006944 Bacteria 3760
103 Ga0105240_10002492 3300009093 Bacteria 29572
104 Ga0105245_10180091 3300009098 Bacteria 2019
105 Ga0105245_10215176 3300009098 Bacteria 1851
106 Ga0105247_10035205 3300009101 Bacteria 3051
107 Ga0105247_10809868 3300009101 Bacteria 715
108 Ga0105247_10956466 3300009101 Bacteria 665
109 Ga0105243_10666874 3300009148 Bacteria 1010
110 Ga0105243_10856867 3300009148 Bacteria 900
111 Ga0105241_10007857 3300009174 Bacteria 7844
112 Ga0105241_10080522 3300009174 Bacteria 2549
113 Ga0105241_10387225 3300009174 Bacteria 1223
114 Ga0105241_11856759 3300009174 Bacteria 589
115 Ga0105242_10232838 3300009176 Bacteria 1652
116 Ga0105242_10608565 3300009176 Bacteria 1056
117 Ga0105242_11566037 3300009176 Bacteria 692
118 Ga0105248_10042051 3300009177 Bacteria 5125
119 Ga0105248_10162431 3300009177 Bacteria 2519
120 Ga0105248_12970978 3300009177 Bacteria 540
121 Ga0105237_10019314 3300009545 Bacteria 7040
122 Ga0105237_10040545 3300009545 Bacteria 4695
123 Ga0105237_10484288 3300009545 Bacteria 1243
124 Ga0105237_11095728 3300009545 Bacteria 803
125 Ga0105238_10007999 3300009551 Bacteria 10578
126 Ga0105238_10611755 3300009551 Bacteria 1098
127 Ga0105238_11185381 3300009551 Bacteria 788
128 Ga0105238_11615667 3300009551 Bacteria 678
129 Ga0105238_11852459 3300009551 Bacteria 636
130 Ga0105238_12675305 3300009551 Bacteria 535
131 Ga0105238_12744899 3300009551 Bacteria 529
132 Ga0105249_10835257 3300009553 Bacteria 986
133 Ga0105239_10070346 3300010375 Bacteria 3844
134 Ga0105239_10246616 3300010375 Bacteria 2005
135 Ga0105239_10336116 3300010375 Bacteria 1704
136 Ga0105239_11210541 3300010375 Bacteria 870
137 Ga0105239_11423823 3300010375 Bacteria 800
138 Ga0105239_12384877 3300010375 Bacteria 616
139 Ga0105246_10279012 3300011119 Bacteria 1339
140 Ga0157370_10103002 3300013104 Bacteria 2672
141 Ga0157369_10053822 3300013105 Bacteria 4348
142 Ga0157369_10207784 3300013105 Bacteria 2053
143 Ga0157374_10027912 3300013296 Bacteria 5095
144 Ga0157374_11118333 3300013296 Bacteria 808
145 Ga0157374_11456155 3300013296 Bacteria 708
146 Ga0157374_11878766 3300013296 Bacteria 625
147 Ga0163162_10057235 3300013306 Bacteria 3926
148 Ga0163162_10235578 3300013306 Bacteria 1961
149 Ga0157372_10574589 3300013307 Bacteria 1314
150 Ga0157375_10456528 3300013308 Bacteria 1443
151 Ga0157375_12053625 3300013308 Bacteria 680
152 Ga0157375_13066077 3300013308 Bacteria 558
153 Ga0163163_10059842 3300014325 Bacteria 3769
154 Ga0163163_10794297 3300014325 Bacteria 1010
155 Ga0157379_10033261 3300014968 Bacteria 4598
156 Ga0157379_10861279 3300014968 Bacteria 858
157 Ga0157376_10745308 3300014969 Bacteria 988
158 Ga0157376_11227112 3300014969 Bacteria 778
159 Ga0157376_12524984 3300014969 Bacteria 554
160 Ga0206356_10258528 3300020070 Bacteria 753
161 Ga0214544_1000003 3300021320 Bacteria 643752
162 Ga0214542_1000022 3300021321 Bacteria 193578
163 Ga0214545_1000010 3300021324 Bacteria 193578
164 Ga0214543_1000035 3300021327 Bacteria 183100
165 Ga0213874_10025281 3300021377 Bacteria 1673
166 Ga0213875_10173207 3300021388 Bacteria 1014
167 Ga0209563_112266 3300025230 Bacteria 1181
168 Ga0209026_1012305 3300025250 Bacteria 1498
169 Ga0209677_106686 3300025253 Bacteria 2661
170 Ga0209148_1000267 3300025254 Bacteria 81839
171 Ga0209233_1002344 3300025261 Bacteria 7057
172 Ga0209233_1003034 3300025261 Bacteria 5978
173 Ga0209233_1063686 3300025261 Bacteria 703
174 Ga0209455_1005262 3300025272 Bacteria 4039
175 Ga0209455_1007946 3300025272 Bacteria 2937
176 Ga0209455_1016958 3300025272 Bacteria 1545
177 Ga0209673_1016536 3300025273 Bacteria 2753
178 Ga0209130_1029615 3300025284 Bacteria 1139
179 Ga0209564_1003160 3300025295 Bacteria 11595
180 Ga0209564_1006871 3300025295 Bacteria 6001
181 Ga0209758_1000015 3300025297 Bacteria 851943
182 Ga0209758_1000711 3300025297 Bacteria 49164
183 Ga0209758_1004632 3300025297 Bacteria 11268
184 Ga0209758_1006280 3300025297 Bacteria 8638
185 Ga0209758_1011473 3300025297 Bacteria 5124
186 Ga0209758_1022902 3300025297 Bacteria 2844
187 Ga0209758_1047167 3300025297 Bacteria 1545
188 Ga0209758_1125691 3300025297 Bacteria 686
189 Ga0209256_1002592 3300025299 Bacteria 14393
190 Ga0209256_1049583 3300025299 Bacteria 1022
191 Ga0207426_1000217 3300025302 Bacteria 136180
192 Ga0207426_1000368 3300025302 Bacteria 79715
193 Ga0207426_1006125 3300025302 Bacteria 5297
194 Ga0207426_1014398 3300025302 Bacteria 2898
195 Ga0207426_1016643 3300025302 Bacteria 2633
196 Ga0207426_1051623 3300025302 Bacteria 1221
197 Ga0209257_1002989 3300025304 Bacteria 15349
198 Ga0209257_1026125 3300025304 Bacteria 1977
199 Ga0207688_10031544 3300025901 Bacteria 2926
200 Ga0207647_10037522 3300025904 Bacteria 3071
201 Ga0207647_10488641 3300025904 Bacteria 687
202 Ga0207699_10174206 3300025906 Bacteria 1442
203 Ga0207705_10260834 3300025909 Bacteria 1323
204 Ga0207705_11547569 3300025909 Bacteria 501
205 Ga0207684_10845000 3300025910 Bacteria 772
206 Ga0207654_10091559 3300025911 Bacteria 1855
207 Ga0207654_10975743 3300025911 Bacteria 616
208 Ga0207707_10008151 3300025912 Bacteria 9091
209 Ga0207695_10000059 3300025913 Bacteria 363920
210 Ga0207671_10013578 3300025914 Bacteria 6481
211 Ga0207671_10069017 3300025914 Bacteria 2635
212 Ga0207671_10707993 3300025914 Bacteria 801
213 Ga0207671_11465849 3300025914 Bacteria 528
214 Ga0207693_10384454 3300025915 Bacteria 1098
215 Ga0207657_10141389 3300025919 Bacteria 1966
216 Ga0207657_10359727 3300025919 Bacteria 1147
217 Ga0207657_10741290 3300025919 Bacteria 761
218 Ga0207652_10065253 3300025921 Bacteria 3152
219 Ga0207694_10027217 3300025924 Bacteria 4353
220 Ga0207694_10598194 3300025924 Bacteria 927
221 Ga0207694_11410124 3300025924 Bacteria 589
222 Ga0207687_10104612 3300025927 Bacteria 2090
223 Ga0207687_10165880 3300025927 Bacteria 1699
224 Ga0207644_10025584 3300025931 Bacteria 4059
225 Ga0207644_10118545 3300025931 Bacteria 2011
226 Ga0207644_11028423 3300025931 Bacteria 692
227 Ga0207690_10584584 3300025932 Bacteria 910
228 Ga0207706_10291765 3300025933 Bacteria 1422
229 Ga0207686_11505392 3300025934 Bacteria 555
230 Ga0207686_11581339 3300025934 Bacteria 541
231 Ga0207704_10181741 3300025938 Bacteria 1520
232 Ga0207665_10128015 3300025939 Bacteria 1799
233 Ga0207711_10030129 3300025941 Bacteria 4577
234 Ga0207711_11916581 3300025941 Bacteria 535
235 Ga0207689_10151195 3300025942 Bacteria 1913
236 Ga0207661_10115913 3300025944 Bacteria 2273
237 Ga0207679_10185660 3300025945 Bacteria 1724
238 Ga0207679_11216411 3300025945 Bacteria 691
239 Ga0207667_10328957 3300025949 Bacteria 1560
240 Ga0207667_10586449 3300025949 Bacteria 1125
241 Ga0207667_11236449 3300025949 Bacteria 725
242 Ga0207651_11233639 3300025960 Bacteria 672
243 Ga0207668_10747966 3300025972 Bacteria 862
244 Ga0207640_10695364 3300025981 Bacteria 871
245 Ga0207658_10242638 3300025986 Bacteria 1527
246 Ga0207639_10043716 3300026041 Bacteria 3365
247 Ga0207639_10071599 3300026041 Bacteria 2712
248 Ga0207639_10695841 3300026041 Bacteria 943
249 Ga0207639_10891550 3300026041 Bacteria 831
250 Ga0207678_10007182 3300026067 Bacteria 9877
251 Ga0207678_10064182 3300026067 Bacteria 3155
252 Ga0207678_10513031 3300026067 Bacteria 1046
253 Ga0207702_10159411 3300026078 Bacteria 2060
254 Ga0207702_11083840 3300026078 Bacteria 795
255 Ga0207641_11636702 3300026088 Bacteria 646
256 Ga0207648_10061522 3300026089 Bacteria 3274
257 Ga0207648_11112723 3300026089 Bacteria 741
258 Ga0207676_10382908 3300026095 Bacteria 1310
259 Ga0207676_10566260 3300026095 Bacteria 1087
260 Ga0207674_10027211 3300026116 Bacteria 6054
261 Ga0207674_10078405 3300026116 Bacteria 3308
262 Ga0207683_10396320 3300026121 Bacteria 1270
263 Ga0207698_10068132 3300026142 Bacteria 2809
264 Ga0207698_10468827 3300026142 Bacteria 1219
265 Ga0207698_10557312 3300026142 Bacteria 1124
266 Ga0209389_1000012 3300027296 Bacteria 213243
267 Ga0209389_1000069 3300027296 Bacteria 98063
268 Ga0209589_1000077 3300027357 Bacteria 98063
269 Ga0209489_100019 3300027361 Bacteria 213243
270 Ga0209489_100020 3300027361 Bacteria 207541
271 Ga0209700_100018 3300027363 Bacteria 238200
272 Ga0209813_10016527 3300027866 Bacteria 2015
273 Ga0268266_10104787 3300028379 Bacteria 2498
274 Ga0268266_10126859 3300028379 Bacteria 2278
275 Ga0268266_10698962 3300028379 Bacteria 977
276 Ga0268265_10451327 3300028380 Bacteria 1201
277 Ga0268265_10463953 3300028380 Bacteria 1186
278 Ga0307517_10497948 3300028786 Bacteria 621
279 Ga0307509_10798073 3300031507 Bacteria 609
280 Ga0307508_10671818 3300031616 Bacteria 643
281 Ga0307510_10103437 3300033180 Bacteria 2625
282 Ga0307510_10183643 3300033180 Bacteria 1650
283 Ga0373923_0036939 3300035111 Bacteria 1996
284 Ga0373955_0052005 3300035172 Bacteria 2233
285 Ga0373935_0024407 3300035692 Bacteria 3721
286 Ga0373947_0004448 3300035725 Bacteria 8219
287 Ga0373925_0022185 3300037068 Bacteria 4629
288 Ga0395900_0001756 3300037418 Bacteria 24872
289 Ga0395900_0503721 3300037418 Bacteria 1161
290 Ga0395898_0005957 3300037466 Bacteria 13087
291 Ga0395898_0058714 3300037466 Bacteria 3745
292 Ga0395898_0897760 3300037466 Bacteria 824
293 Ga0395898_1260764 3300037466 Bacteria 669
294 Ga0395905_0085998 3300037471 Bacteria 2946
295 Ga0436364_1105843 3300037853 Bacteria 514
296 Ga0395901_0029430 3300038443 Bacteria 5656
297 Ga0395901_0265395 3300038443 Bacteria 1786
298 Ga0395901_0271188 3300038443 Bacteria 1765
299 Ga0395901_0805692 3300038443 Bacteria 928
300 Ga0436365_1602753 3300039437 Bacteria 4159
301 Ga0436361_0681592 3300039447 Bacteria 2168
302 Ga0436363_0076942 3300039450 Bacteria 533
303 Ga0436363_1239221 3300039450 Bacteria 2240
304 Ga0436362_0476645 3300039453 Bacteria 735
305 Ga0439465_0139927 3300041413 Bacteria 859
306 Ga0451789_1368091 3300041443 Bacteria 643
307 Ga0451793_0004869 3300041452 Bacteria 559
308 Ga0451797_0598845 3300041453 Bacteria 2876
309 Ga0451798_0263746 3300041458 Bacteria 941
310 Ga0451802_0981618 3300041460 Bacteria 1024
311 Ga0451807_1952152 3300041486 Bacteria 689
312 Ga0451835_0295644 3300041492 Bacteria 895
313 Ga0451839_0035569 3300041496 Bacteria 549
314 Ga0451841_0776791 3300041498 Bacteria 1458
315 Ga0451851_0781653 3300041507 Bacteria 855
316 Ga0451853_0978545 3300041512 Bacteria 507
317 Ga0451853_2614112 3300041512 Bacteria 509
318 Ga0466972_0116271 3300044658 Bacteria 1262
319 Ga0466965_0231001 3300044683 Bacteria 988
320 Ga0466965_0362858 3300044683 Bacteria 795
321 Ga0466963_0075321 3300044694 Bacteria 2277
322 Ga0466964_0072974 3300044706 Bacteria 1456
323 Ga0466964_0085777 3300044706 Bacteria 1360
324 Ga0466964_0298761 3300044706 Bacteria 811
325 Ga0466964_0912949 3300044706 Bacteria 503
326 Ga0466971_0142005 3300044719 Bacteria 1118
327 Ga0466968_0003565 3300044735 Bacteria 5756
328 Ga0466968_0025710 3300044735 Bacteria 2413
329 Ga0466968_0353895 3300044735 Bacteria 714
330 Ga0466957_0251936 3300044842 Bacteria 1174
331 Ga0466960_0103494 3300044901 Bacteria 1470
332 Ga0466960_0396667 3300044901 Bacteria 794
333 Ga0466959_0433474 3300045049 Bacteria 892
334 Ga0466959_1197263 3300045049 Bacteria 505
335 Ga0466967_0054112 3300045976 Bacteria 3530
336 Ga0466967_0414255 3300045976 Bacteria 1312
337 Ga0466967_0693650 3300045976 Bacteria 1008
338 Ga0495617_239911 3300046452 Bacteria 560
339 Ga0495592_0099161 3300046454 Bacteria 2078
340 Ga0495592_0114431 3300046454 Bacteria 1905
341 Ga0495629_0031673 3300046459 Bacteria 3743
342 Ga0495638_0048119 3300046460 Bacteria 2670
343 Ga0495638_0564987 3300046460 Bacteria 563
344 Ga0495641_0161288 3300046461 Bacteria 1003
345 Ga0495651_0018866 3300046462 Bacteria 5343
346 Ga0495651_0026536 3300046462 Bacteria 4512
347 Ga0495653_0261307 3300046463 Bacteria 1144
348 Ga0495650_0031088 3300046471 Bacteria 2408
349 Ga0495650_0150432 3300046471 Bacteria 836
350 Ga0495580_0005864 3300046472 Bacteria 10082
351 Ga0495582_0473687 3300046473 Bacteria 723
352 Ga0495605_0056158 3300046474 Bacteria 1900
353 Ga0495605_0100526 3300046474 Bacteria 1330
354 Ga0495639_0212065 3300046475 Bacteria 950
355 Ga0495639_0263220 3300046475 Bacteria 854
356 Ga0495662_0113272 3300046476 Bacteria 1330
357 Ga0495664_0007034 3300046477 Bacteria 6232
358 Ga0495664_0040911 3300046477 Bacteria 2741
359 Ga0495664_0070928 3300046477 Bacteria 2081
360 Ga0495664_0088422 3300046477 Bacteria 1862
361 Ga0495584_0054787 3300046491 Bacteria 2007
362 Ga0495585_0369762 3300046492 Bacteria 694
363 Ga0495607_0091008 3300046501 Bacteria 1653
364 Ga0495583_0089487 3300046506 Bacteria 1327
365 Ga0495606_0013516 3300046507 Bacteria 6440
366 Ga0495606_0083251 3300046507 Bacteria 1984
367 Ga0495606_0091719 3300046507 Bacteria 1867
368 Ga0495608_0009012 3300046511 Bacteria 6978
369 Ga0495608_0120826 3300046511 Bacteria 1680
370 Ga0495608_0173379 3300046511 Bacteria 1367
371 Ga0495610_0044456 3300046512 Bacteria 2204
372 Ga0495610_0100696 3300046512 Bacteria 1295
373 Ga0495610_0241121 3300046512 Bacteria 721
374 Ga0495610_0249970 3300046512 Bacteria 703
375 Ga0495616_0045894 3300046513 Bacteria 2209
376 Ga0495616_0056386 3300046513 Bacteria 1941
377 Ga0495616_0175716 3300046513 Bacteria 955
378 Ga0495618_0040942 3300046514 Bacteria 2917
379 Ga0495618_0479727 3300046514 Bacteria 752
380 Ga0495620_0047396 3300046515 Bacteria 1850
381 Ga0495620_0305514 3300046515 Bacteria 604
382 Ga0495628_0014226 3300046516 Bacteria 6678
383 Ga0495628_0155768 3300046516 Bacteria 1738
384 Ga0495628_0165790 3300046516 Bacteria 1677
385 Ga0495628_0754756 3300046516 Bacteria 683
386 Ga0495630_0121912 3300046517 Bacteria 1978
387 Ga0495630_0496005 3300046517 Bacteria 936
388 Ga0495631_0377347 3300046518 Bacteria 603
389 Ga0495632_0035990 3300046519 Bacteria 2521
390 Ga0495632_0403929 3300046519 Bacteria 596
391 Ga0495643_0045256 3300046522 Bacteria 2389
392 Ga0495643_0098799 3300046522 Bacteria 1498
393 Ga0495648_0019778 3300046524 Bacteria 4718
394 Ga0495648_0053168 3300046524 Bacteria 2455
395 Ga0495648_0178166 3300046524 Bacteria 1083
396 Ga0495648_0262346 3300046524 Bacteria 828
397 Ga0495666_0181965 3300046526 Bacteria 970
398 Ga0495652_0026908 3300046529 Bacteria 5073
399 Ga0495652_0075663 3300046529 Bacteria 2795
400 Ga0495652_0096116 3300046529 Bacteria 2413
401 Ga0495652_0135398 3300046529 Bacteria 1944
402 Ga0495652_0804077 3300046529 Bacteria 626
403 Ga0495640_0050077 3300046533 Bacteria 2879
404 Ga0495586_0051878 3300046535 Bacteria 2220
405 Ga0495587_0008157 3300046536 Bacteria 6752
406 Ga0495587_0091322 3300046536 Bacteria 1759
407 Ga0495587_0189117 3300046536 Bacteria 1166
408 Ga0495609_0074561 3300046538 Bacteria 1488
409 Ga0495609_0111294 3300046538 Bacteria 1182
410 Ga0495609_0251251 3300046538 Bacteria 728
411 Ga0495597_0158248 3300046542 Bacteria 926
412 Ga0495645_0069536 3300046543 Bacteria 2542
413 Ga0495645_0108289 3300046543 Bacteria 1968
414 Ga0495645_0415865 3300046543 Bacteria 854
415 Ga0495622_0011952 3300046557 Bacteria 4015
416 Ga0495622_0041909 3300046557 Bacteria 2129
417 Ga0495622_0363889 3300046557 Bacteria 625
418 Ga0495667_0003075 3300046559 Bacteria 11195
419 Ga0495667_0107918 3300046559 Bacteria 1799
420 Ga0495667_0270840 3300046559 Bacteria 1079
421 Ga0495668_0072413 3300046616 Bacteria 1893
422 Ga0495634_0080981 3300046642 Bacteria 2124
423 Ga0495634_0082944 3300046642 Bacteria 2093
424 Ga0495634_0112768 3300046642 Bacteria 1747
425 Ga0495611_0211455 3300046648 Bacteria 903
426 Ga0495611_0538703 3300046648 Bacteria 529
427 Ga0495625_0030852 3300046660 Bacteria 3994
428 Ga0495625_0040774 3300046660 Bacteria 3383
429 Ga0495625_0424263 3300046660 Bacteria 826
430 Ga0495635_0018638 3300046663 Bacteria 4842
431 Ga0495635_0180358 3300046663 Bacteria 1435
432 Ga0495661_0229757 3300046665 Bacteria 957
433 Ga0495661_0265755 3300046665 Bacteria 870
434 Ga0495661_0543910 3300046665 Bacteria 550
435 Ga0495588_0040929 3300046674 Bacteria 2365
436 Ga0495588_0168699 3300046674 Bacteria 1157
437 Ga0495657_0005133 3300046675 Bacteria 10381
438 Ga0495657_0009727 3300046675 Bacteria 7262
439 Ga0495657_0335428 3300046675 Bacteria 897
440 Ga0495599_0049656 3300046678 Bacteria 2630
441 Ga0495599_0203900 3300046678 Bacteria 1214
442 Ga0495623_0010483 3300046679 Bacteria 5998
443 Ga0495623_0222102 3300046679 Bacteria 1076
444 Ga0495646_0003762 3300046680 Bacteria 9487
445 Ga0495646_0057567 3300046680 Bacteria 2326
446 Ga0495658_0075141 3300046683 Bacteria 1971
447 Ga0495669_0477846 3300046684 Bacteria 606
448 Ga0495613_0074469 3300046689 Bacteria 2472
449 Ga0495613_0085821 3300046689 Bacteria 2283
450 Ga0495624_0049964 3300046690 Bacteria 2651
451 Ga0495624_0062319 3300046690 Bacteria 2333
452 Ga0495624_0188898 3300046690 Bacteria 1253
453 Ga0495671_0202440 3300046692 Bacteria 963
454 Ga0495671_0402538 3300046692 Bacteria 655
455 Ga0495649_0032163 3300046694 Bacteria 2891
456 Ga0495649_0161057 3300046694 Bacteria 1176
457 Ga0495600_0006367 3300046809 Bacteria 7183
458 Ga0495600_0040888 3300046809 Bacteria 3021
459 Ga0495600_0307922 3300046809 Bacteria 998
460 Ga0495660_0339762 3300046810 Bacteria 670
461 Ga0495581_0048220 3300047315 Bacteria 2460
462 Ga0495581_0779669 3300047315 Bacteria 549
463 Ga0495604_0000678 3300047317 Bacteria 28877
464 Ga0495604_0017687 3300047317 Bacteria 5705
465 Ga0495604_0224547 3300047317 Bacteria 1291
466 Ga0495674_0016568 3300047319 Bacteria 6878
467 Ga0495672_0559582 3300047320 Bacteria 500
468 Ga0495676_0392161 3300047321 Bacteria 922
469 Ga0495680_0001164 3300047322 Bacteria 28965
470 Ga0495683_0050592 3300047323 Bacteria 2079
471 Ga0495683_0137317 3300047323 Bacteria 1148
472 Ga0495687_010280 3300047443 Bacteria 5141
473 Ga0495675_0004534 3300047444 Bacteria 8423
474 Ga0495673_0111987 3300047469 Bacteria 1090
475 Ga0495684_0134861 3300047471 Bacteria 1853
476 Ga0495684_0137762 3300047471 Bacteria 1831
477 Ga0495684_0263849 3300047471 Bacteria 1248
478 Ga0495686_0074651 3300047472 Bacteria 2080
479 Ga0495686_0169490 3300047472 Bacteria 1270
480 Ga0495686_0178344 3300047472 Bacteria 1232
481 Ga0495686_0202397 3300047472 Bacteria 1139
482 Ga0495686_0368473 3300047472 Bacteria 777
483 Ga0495593_0013965 3300047673 Bacteria 4575
484 Ga0495593_0213287 3300047673 Bacteria 969
485 Ga0495602_0007817 3300048088 Bacteria 11179
486 Ga0495602_0029415 3300048088 Bacteria 5231
487 Ga0495626_0114443 3300048091 Bacteria 1165
488 Ga0495626_0119194 3300048091 Bacteria 1136
489 Ga0496100_0310988 3300048903 Bacteria 1181
490 Ga0496102_0307366 3300048905 Bacteria 1494
491 Ga0496102_0541479 3300048905 Bacteria 1087
492 Ga0496102_0716583 3300048905 Bacteria 923
493 Ga0496103_0022210 3300048906 Bacteria 3820
494 Ga0496103_0877156 3300048906 Bacteria 563
495 Ga0496104_0014507 3300048907 Bacteria 7117
496 Ga0496104_0093736 3300048907 Bacteria 2872
497 Ga0496104_0346439 3300048907 Bacteria 1398
498 Ga0496104_0840831 3300048907 Bacteria 823
499 Ga0496104_1807566 3300048907 Bacteria 513
500 Ga0496105_0007733 3300048908 Bacteria 8340
501 Ga0496105_0098009 3300048908 Bacteria 2421
502 Ga0496105_0348854 3300048908 Bacteria 1182
503 Ga0496105_0826024 3300048908 Bacteria 703
504 Ga0496106_0052530 3300048909 Bacteria 3075
505 Ga0496106_0415275 3300048909 Bacteria 1081
506 Ga0496107_0247899 3300048910 Bacteria 1325
507 Ga0496107_0865685 3300048910 Bacteria 660
508 Ga0496108_0125454 3300048911 Bacteria 2204
509 Ga0496108_0204804 3300048911 Bacteria 1712
510 Ga0496108_0404337 3300048911 Bacteria 1192
511 Ga0496108_0626508 3300048911 Bacteria 936
512 Ga0496109_0167994 3300048912 Bacteria 2057
513 Ga0496109_0728468 3300048912 Bacteria 929
514 Ga0496110_0076750 3300048913 Bacteria 2971
515 Ga0496110_0216548 3300048913 Bacteria 1741
516 Ga0496110_0769807 3300048913 Bacteria 866
517 Ga0496110_0976402 3300048913 Bacteria 754
518 Ga0496111_0208564 3300048914 Bacteria 1452
519 Ga0496111_0506794 3300048914 Bacteria 888
520 Ga0496112_0044970 3300048915 Bacteria 4327
521 Ga0496112_0112630 3300048915 Bacteria 2691
522 Ga0496112_0184320 3300048915 Bacteria 2051
523 Ga0496113_0056643 3300048916 Bacteria 2943
524 Ga0496113_0132052 3300048916 Bacteria 1960
525 Ga0496113_0579763 3300048916 Bacteria 899
526 Ga0496113_1393533 3300048916 Bacteria 543
527 Ga0496113_1469212 3300048916 Bacteria 527
528 Ga0496114_0093463 3300048917 Bacteria 2557
529 Ga0496114_0273531 3300048917 Bacteria 1488
530 Ga0496114_0281214 3300048917 Bacteria 1467
531 Ga0496114_1739116 3300048917 Bacteria 512
532 Ga0496115_0009406 3300048918 Bacteria 7262
533 Ga0496115_0101425 3300048918 Bacteria 2360
534 Ga0496115_0965435 3300048918 Bacteria 653
535 Ga0496116_0075537 3300048919 Bacteria 2114
536 Ga0496116_0211911 3300048919 Bacteria 1003
537 Ga0496117_0069424 3300048920 Bacteria 2373
538 Ga0496117_0144340 3300048920 Bacteria 1420
539 Ga0496117_0175740 3300048920 Bacteria 1237
540 Ga0496117_0209793 3300048920 Bacteria 1093
541 Ga0496117_0229601 3300048920 Bacteria 1027
542 Ga0496118_0019475 3300048921 Bacteria 6064
543 Ga0496118_0028559 3300048921 Bacteria 4695
544 Ga0496118_0036684 3300048921 Bacteria 3959
545 Ga0496118_0084187 3300048921 Bacteria 2220
546 Ga0496118_0156562 3300048921 Bacteria 1416
547 Ga0496118_0188285 3300048921 Bacteria 1237
548 Ga0496119_0004042 3300048922 Bacteria 14816
549 Ga0496119_0044701 3300048922 Bacteria 2785
550 Ga0496119_0051808 3300048922 Bacteria 2519
551 Ga0496119_0064646 3300048922 Bacteria 2171
552 Ga0496119_0067769 3300048922 Bacteria 2103
553 Ga0496119_0191145 3300048922 Bacteria 1066
554 Ga0496120_0003365 3300048923 Bacteria 14668
555 Ga0496120_0136221 3300048923 Bacteria 1251
556 Ga0496120_0139346 3300048923 Bacteria 1233
557 Ga0496120_0140165 3300048923 Bacteria 1228
558 Ga0496120_0214442 3300048923 Bacteria 924
559 Ga0496121_0023325 3300048924 Bacteria 5964
560 Ga0496121_0043408 3300048924 Bacteria 3894
561 Ga0496121_0047888 3300048924 Bacteria 3642
562 Ga0496121_0126551 3300048924 Bacteria 1919
563 Ga0496121_0267346 3300048924 Bacteria 1177
564 Ga0496121_0592588 3300048924 Bacteria 685
565 Ga0496122_0152942 3300048925 Bacteria 1421
566 Ga0496123_0068015 3300048926 Bacteria 2246
567 Ga0496124_0071113 3300048927 Bacteria 2885
568 Ga0496124_0257071 3300048927 Bacteria 1288
569 Ga0496124_0383431 3300048927 Bacteria 982
570 Ga0496124_0531616 3300048927 Bacteria 781
571 Ga0496125_0091251 3300048928 Bacteria 2283
572 Ga0496125_0195768 3300048928 Bacteria 1329
573 Ga0496125_0502199 3300048928 Bacteria 682
574 Ga0496126_0047705 3300048929 Bacteria 3920
575 Ga0496126_0139372 3300048929 Bacteria 2089
576 Ga0496126_0475926 3300048929 Bacteria 1001
577 Ga0496126_0611757 3300048929 Bacteria 857
578 Ga0496126_0664678 3300048929 Bacteria 814
579 Ga0496126_0948205 3300048929 Bacteria 649
580 Ga0496126_1398857 3300048929 Bacteria 505
581 Ga0495682_0075744 3300049460 Bacteria 1210
582 Ga0495682_0288897 3300049460 Bacteria 579
583 Ga0501033_0743461 3300049570 Bacteria 665
584 Ga0501034_0134299 3300049571 Bacteria 2456
585 Ga0501038_0203480 3300049574 Bacteria 1588
586 Ga0501038_0223971 3300049574 Bacteria 1499
587 Ga0501043_0535865 3300049579 Bacteria 871
588 Ga0501046_0085928 3300049580 Bacteria 2425
589 Ga0501047_0009870 3300049581 Bacteria 9023
590 Ga0501047_0916658 3300049581 Bacteria 690
591 Ga0501067_0087210 3300049583 Bacteria 1732
592 Ga0501067_0195178 3300049583 Bacteria 1128
593 Ga0501070_0016072 3300049586 Bacteria 6291
594 Ga0501073_0101568 3300049589 Bacteria 1997
595 Ga0501074_0022542 3300049590 Bacteria 4576
596 Ga0501079_0622553 3300049741 Bacteria 850
597 Ga0501080_0019801 3300049742 Bacteria 6230
598 Ga0501080_1285580 3300049742 Bacteria 627
599 Ga0501035_0305682 3300049822 Bacteria 1339
600 Ga0501044_0088970 3300049823 Bacteria 3117
601 Ga0501045_0718846 3300049824 Bacteria 737
602 nmdc:mga03n38_154423_c1 3300050490 Bacteria 1157
603 nmdc:mga00v17_15210_c1 3300050491 Bacteria 4314
604 nmdc:mga0yw44_1180962_c1 3300050492 Bacteria 516
605 nmdc:mga0yw44_23287_c1 3300050492 Bacteria 3487
606 nmdc:mga0yw44_26173_c1 3300050492 Bacteria 3329
607 nmdc:mga0yw44_27213_c1 3300050492 Bacteria 3274
608 nmdc:mga0yw44_4551_c1 3300050492 Bacteria 6383
609 nmdc:mga0k408_16486_c1 3300050493 Bacteria 4101
610 nmdc:mga06z11_170134_c1 3300050494 Bacteria 1251
611 nmdc:mga06z11_291124_c1 3300050494 Bacteria 969
612 nmdc:mga04h51_82669_c1 3300050495 Bacteria 1143
613 nmdc:mga07m45_85151_c1 3300050496 Bacteria 1808
614 nmdc:mga0sz30_12992_c1 3300050516 Bacteria 3252
615 nmdc:mga0sz30_26226_c1 3300050516 Bacteria 2388
616 nmdc:mga0sz30_321863_c1 3300050516 Bacteria 690
617 nmdc:mga0sz30_55941_c2 3300050516 Bacteria 1126
618 nmdc:mga0sz30_75666_c1 3300050516 Bacteria 1453
619 Ga0495601_0051835 3300053077 Bacteria 2590
620 Ga0495612_0007133 3300053078 Bacteria 4575
621 Ga0495612_0024566 3300053078 Bacteria 2419
622 Ga0500610_0088878 3300053079 Bacteria 1606
623 Ga0500635_0023865 3300053080 Bacteria 1913
624 Ga0495655_0091062 3300053083 Bacteria 888
625 Ga0495655_0133400 3300053083 Bacteria 767
626 Ga0495619_0167014 3300053085 Bacteria 1521
627 Ga0500578_0170034 3300053086 Bacteria 1348
628 Ga0500578_0378461 3300053086 Bacteria 821
629 Ga0500643_000048 3300053087 Bacteria 147879
630 Ga0500644_0154020 3300053088 Bacteria 924
631 Ga0500644_0314823 3300053088 Bacteria 672
632 Ga0500583_0010766 3300053092 Bacteria 3412
633 Ga0500583_0060762 3300053092 Bacteria 1783
634 Ga0500651_0002004 3300053093 Bacteria 10570
635 Ga0500651_0339767 3300053093 Bacteria 854
636 Ga0500651_0576494 3300053093 Bacteria 613
637 Ga0500566_0061049 3300053094 Bacteria 2134
638 Ga0500640_040268 3300053095 Bacteria 2053
639 Ga0500641_0032761 3300053096 Bacteria 2058
640 Ga0500648_152082 3300053097 Bacteria 1229
641 Ga0500650_0382412 3300053098 Bacteria 611
642 Ga0500555_027405 3300053103 Bacteria 1625
643 Ga0500556_0202815 3300053104 Bacteria 784
644 Ga0500556_0216078 3300053104 Bacteria 756
645 Ga0500562_034076 3300053108 Bacteria 1346
646 Ga0500569_016178 3300053109 Bacteria 1884
647 Ga0500569_145921 3300053109 Bacteria 797
648 Ga0500592_041313 3300053116 Bacteria 747
649 Ga0500594_0002506 3300053118 Bacteria 3995
650 Ga0500594_0122244 3300053118 Bacteria 818
651 Ga0500595_000497 3300053119 Bacteria 23997
652 Ga0500595_002282 3300053119 Bacteria 9644
653 Ga0500595_013183 3300053119 Bacteria 3171
654 Ga0500595_036322 3300053119 Bacteria 1614
655 Ga0500597_191896 3300053120 Bacteria 862
656 Ga0500607_019806 3300053121 Bacteria 3804
657 Ga0500608_191306 3300053122 Bacteria 855
658 Ga0500614_142619 3300053123 Bacteria 717
659 Ga0500614_197083 3300053123 Bacteria 620
660 Ga0500642_0000143 3300053130 Bacteria 31709
661 Ga0500642_0001744 3300053130 Bacteria 6273
662 Ga0500642_0269162 3300053130 Bacteria 777
663 Ga0500655_016024 3300053133 Bacteria 1378
664 Ga0500658_0031805 3300053134 Bacteria 2066
665 Ga0500559_0005658 3300053136 Bacteria 5719
666 Ga0500559_0076758 3300053136 Bacteria 1512
667 Ga0500564_111741 3300053138 Bacteria 1198
668 Ga0500568_0037197 3300053139 Bacteria 1976
669 Ga0500568_0070271 3300053139 Bacteria 1341
670 Ga0500577_0353823 3300053142 Bacteria 642
671 Ga0500585_235996 3300053144 Bacteria 589
672 Ga0500589_157077 3300053147 Bacteria 918
673 Ga0500604_0218112 3300053151 Bacteria 657
674 Ga0500616_0000038 3300053153 Bacteria 386801
675 Ga0500616_0030013 3300053153 Bacteria 2988
676 Ga0500619_006592 3300053154 Bacteria 2685
677 Ga0500620_070761 3300053155 Bacteria 1199
678 Ga0500622_0026896 3300053156 Bacteria 3033
679 Ga0500624_046764 3300053157 Bacteria 794
680 Ga0500627_0034673 3300053158 Bacteria 2141
681 Ga0500627_0043782 3300053158 Bacteria 1931
682 Ga0500633_0085309 3300053160 Bacteria 1147
683 Ga0500638_229859 3300053162 Bacteria 762
684 Ga0500639_179519 3300053163 Bacteria 938
685 Ga0500636_0000148 3300053177 Bacteria 36338
686 Ga0500649_095292 3300053722 Bacteria 1186
687 Ga0500645_138489 3300053730 Bacteria 674
688 Ga0500645_147683 3300053730 Bacteria 648
689 Ga0500609_000768 3300053731 Bacteria 4806
690 Ga0500609_016041 3300053731 Bacteria 1016
691 Ga0500552_001279 3300053733 Bacteria 2387
692 Ga0500599_002351 3300053736 Bacteria 2264
693 Ga0500601_001009 3300053737 Bacteria 3258
694 Ga0500661_037352 3300055283 Bacteria 859
695 2507505886 2507262055 Bacteria 8048963
696 2508540077 2508501009 Bacteria 7784016
697 2508696147 2508501042 Bacteria 8719808
698 2511396629 2511231028 Bacteria 8046582
699 2513638790 2513237094 Bacteria 8789602
700 2513649860 2513237095 Bacteria 8976980
701 2513704343 2513237102 Bacteria 7703324
702 2513715424 2513237104 Bacteria 10034502
703 2513877278 2513237139 Bacteria 8737671
704 2514011235 2513237161 Bacteria 8871253
705 2515631361 2515154112 Bacteria 8294334
706 2517105701 2517093001 Bacteria 9002274
707 2524435445 2524023205 Bacteria 8918781
708 2528851312 2528768022 Bacteria 10457665
709 2617347770 2617270735 Bacteria 9163226
710 2617374498 2617270741 Bacteria 8201522
711 2745081391 2744054633 Bacteria 8678936
712 2793061574 2791355196 Bacteria 7323613
713 2793073875 2791355197 Bacteria 8420563
714 2805916122 2802429603 Bacteria 8777136
715 2818240860 2816332527 Bacteria 8933356
716 2824605535 2824600985 Bacteria 8488197
717 2824610833 2824609381 Bacteria 8672835
718 2824619369 2824617872 Bacteria 8814715
719 2824627824 2824626560 Bacteria 8813858
720 2824641884 2824635225 Bacteria 8785348
721 2824651282 2824644064 Bacteria 8743947
722 2824653885 2824653114 Bacteria 8493680
723 2824663762 2824661429 Bacteria 9877870
724 2824676119 2824671348 Bacteria 8369588
725 2824680233 2824679649 Bacteria 8248951
726 2824692472 2824687955 Bacteria 8360029
727 2824699894 2824696289 Bacteria 8335049
728 2824706076 2824704595 Bacteria 9667483
729 2824720076 2824714736 Bacteria 8717648
730 2824729438 2824723954 Bacteria 8758240
731 2824737485 2824732956 Bacteria 7810675
732 2824748040 2824746037 Bacteria 7911610
733 2824760291 2824753945 Bacteria 9787441
734 2824771530 2824763712 Bacteria 9792355
735 2824775750 2824773399 Bacteria 8360218
736 2838125123 2838122688 Bacteria 8803140
737 2841945862 2841941048 Bacteria 8688029
738 2841956812 2841949485 Bacteria 8680857
739 2841965296 2841957949 Bacteria 8652217
740 2841973328 2841966195 Bacteria 8673214
741 2841979508 2841974524 Bacteria 8931498
742 2841989367 2841983080 Bacteria 8395090
743 2844321494 2844315083 Bacteria 8138177
744 2847939479 2847930680 Bacteria 9342022
745 2847941227 2847939898 Bacteria 8606328
746 2857513305 2857509624 Bacteria 7472071
747 2874596376 2874590934 Bacteria 8299676
748 2874620210 2874612657 Bacteria 8252029
749 2874633348 2874628541 Bacteria 8630250
750 2874650364 2874645413 Bacteria 8214782
751 2876761701 2876761206 Bacteria 10111113
752 2876776841 2876771140 Bacteria 8287509
753 2876824631 2876818435 Bacteria 8274608
754 2879080978 2879074833 Bacteria 8279565
755 2879091079 2879083081 Bacteria 8587928
756 2879106644 2879099564 Bacteria 10442239
757 2879128209 2879127579 Bacteria 8294491
758 2879143548 2879142872 Bacteria 8267021
759 2881369638 2881364244 Bacteria 7710352
760 2881670161 2881665667 Bacteria 8175609
761 2885418253 2885409591 Bacteria 9235467
762 2888387749 2888378607 Bacteria 9652610
763 2888389968 2888388044 Bacteria 7304136
764 2888421132 2888419890 Bacteria 7857137
765 2903727927 2903727486 Bacteria 8281579
766 2904718103 2904711408 Bacteria 9771557
767 2906602589 2906602504 Bacteria 8295279
768 2906631914 2906626472 Bacteria 8826946
769 2906648655 2906643746 Bacteria 8722424
770 2908746724 2908739725 Bacteria 8628932
771 2908776977 2908775508 Bacteria 8092255
772 2922377453
773 2922393371 2922393267 Bacteria 8285685
774 2929622246 2929615660 Bacteria 9193770
775 2929630107 2929624759 Bacteria 9339455
776 2932787960 2932784394 Bacteria 9704911
777 2932799506 2932794094 Bacteria 7915132
778 2932805188 2932801729 Bacteria 7987968
779 2932813335 2932809354 Bacteria 9135765
780 2932820032 2932818245 Bacteria 9955613
781 2932832904 2932828146 Bacteria 9745859
782 2933584140 2933577622 Bacteria 9116884
783 2935614310 2935608549 Bacteria 8203142
784 2935620389 2935616580 Bacteria 9032984
785 2935632666 2935630451 Bacteria 8169952
786 2935640713 2935638405 Bacteria 10015038
787 2935649338 2935648319 Bacteria 8801166
788 2935657890 2935656913 Bacteria 8965014
789 2935668905 2935665750 Bacteria 9571747
790 2935681369 2935675223 Bacteria 9928132
791 2935687214 2935684952 Bacteria 9590419
792 2935696815 2935694250 Bacteria 9291695
793 2935709093 2935703347 Bacteria 10242284
794 2935716902 2935713505 Bacteria 9608509
795 2935722973 2935722832 Bacteria 9608746
796 2935734530 2935732158 Bacteria 9706831
797 2935744679 2935741537 Bacteria 9707219
798 2935753180 2935750917 Bacteria 9590372
799 2935767584 2935760218 Bacteria 9817913
800 2935770178 2935769743 Bacteria 7878163
801 2935777792 2935777560 Bacteria 8077691
802 2935786768 2935785616 Bacteria 7962367
803 2935794822 2935793552 Bacteria 8012592
804 2935804823 2935801545 Bacteria 9301974
805 2935815972 2935810662 Bacteria 9401221
806 2935826528 2935819856 Bacteria 8261050
807 2935832220 2935827899 Bacteria 10038562
808 2935840950 2935837841 Bacteria 9454360
809 2935851178 2935847175 Bacteria 8228321
810 2935859275 2935855204 Bacteria 9035059
811 2935864459 2935864058 Bacteria 9784707
812 2935875189 2935873716 Bacteria 9632195
813 2935887722 2935883170 Bacteria 7964738
814 2935913227 2935908558 Bacteria 8568796
815 2935922649 2935916978 Bacteria 9113783
816 2935930848 2935926038 Bacteria 8601059
817 2935939818 2935934488 Bacteria 8602579
818 2935946767 2935942939 Bacteria 8599779
819 2935956032 2935951376 Bacteria 8602333
820 2935963888 2935959822 Bacteria 7869783
821 2935972825 2935967501 Bacteria 8603075
822 2935978258 2935975950 Bacteria 8347125
823 2935985614 2935984226 Bacteria 8302647
824 2935995836 2935992306 Bacteria 9802711
825 2936005747 2936002035 Bacteria 9362176
826 2936012109 2936011229 Bacteria 8801034
827 2936020810 2936019824 Bacteria 8804134
828 2936029402 2936028420 Bacteria 8965941
829 2936041875 2936037263 Bacteria 9446081
830 2936048274 2936046547 Bacteria 8903709
831 2936056615 2936055302 Bacteria 8785755
832 2940559093 2940556831 Bacteria 9590747
833 2941508670 2941507105 Bacteria 8166816
834 2941516500 2941515067 Bacteria 8166720
835 2941524484 2941523033 Bacteria 8169134
836 2941532074 2941531003 Bacteria 7653939
837 2941541788 2941538514 Bacteria 9402094
838 3005485834 3005483717 Bacteria 7877331
839 3005510875 3005506211 Bacteria 6943378
840 3005588824 3005587118 Bacteria 7794411
841 3005601860 3005594810 Bacteria 8716512
842 3005717599 3005710791 Bacteria 7622528
843 3005724647 3005718088 Bacteria 8283608
844 8006928841 8006926726 Bacteria 6749210
845 8016517299 8016511872 Bacteria 9921665
846 8016526935 8016522445 Bacteria 8156687
847 8016532019 8016530956 Bacteria 8155261
848 8016545228 8016539877 Bacteria 8155419
849 8016556859 8016548790 Bacteria 8155074
850 8016565212 8016557553 Bacteria 8154380
851 8016582855 8016575299 Bacteria 8154085
852 8016585440 8016583857 Bacteria 10421953
853 8016602855 8016595262 Bacteria 8149947
854 8016617632 8016613128 Bacteria 8794220
855 8016623937 8016622563 Bacteria 7999408
856 8016634930 8016630954 Bacteria 9217207
857 8017059298 8017057580 Bacteria 10023680
858 8019531836 8019530166 Bacteria 8155624
859 8019539693 8019538911 Bacteria 7872763
860 8019550955 8019547302 Bacteria 7996444
861 8019576331 8019576017 Bacteria 10049540
862 8019607359 8019597564 Bacteria 10041141
863 8019611155 8019608314 Bacteria 10042931
864 8019622003 8019619141 Bacteria 9218857
865 8019631319 8019629233 Bacteria 8687553
866 8019639304 8019638758 Bacteria 9062356
867 8019651722 8019648815 Bacteria 10014479
868 8019668123 8019659431 Bacteria 8577854
869 8019677589 8019668869 Bacteria 8791617
870 8019687360 8019678201 Bacteria 8863603
871 8019693336 8019687851 Bacteria 8712826
872 8055743505 8055742211 Bacteria 9226248
873 Ga0495648_0162762
874 RicEn_C1411
875 JGI24737J22298_10049932
876 JGI25165J46597_1004722
877 JGI25165J46597_1020742
878 JGI25153J46596_10000301
879 JGI25153J46596_10009239
880 JGI25153J46596_10049944
881 JGI25153J46596_10069419
882 JGI25153J46596_10113656
883 JGI25160J50197_1000761
884 JGI25160J50197_1002871
885 Ga0055542_1017316
886 Ga0055529_1032967
887 Ga0055524_1040781
888 Ga0055531_10009160
889 Ga0055543_1003027
890 Ga0055543_1017528
891 Ga0065165_1000917
892 Ga0065165_1001167
893 Ga0065165_1032813
894 Ga0065165_1038894
895 Ga0070676_10689916
896 Ga0070683_100011764
897 Ga0068869_100342042
898 Ga0070680_100287875
899 Ga0070682_100713405
900 Ga0070660_100138557
901 Ga0070660_100591089
902 Ga0070661_100213521
903 Ga0070661_100976559
904 Ga0070668_100052294
905 Ga0070688_101821578
906 Ga0070659_100300426
907 Ga0070667_100407878
908 Ga0070713_102002815
909 Ga0070663_100056037
910 Ga0070663_100128552
911 Ga0070678_100492265
912 Ga0070681_10224288
913 Ga0068867_100072739
914 Ga0068867_101222100
915 Ga0070706_101119322
916 Ga0070679_100285758
917 Ga0070684_100003951
918 Ga0070684_100790640
919 Ga0068853_100112298
920 Ga0068853_100124111
921 Ga0068853_100278198
922 Ga0068853_100648595
923 Ga0068853_100902425
924 Ga0070696_100877758
925 Ga0070693_100410178
926 Ga0070693_100441069
927 Ga0070665_100059928
928 Ga0070665_100264516
929 Ga0070665_100834674
930 Ga0068855_100090289
931 Ga0068855_100212522
932 Ga0068855_100984847
933 Ga0070664_100794392
934 Ga0068857_100019162
935 Ga0068857_101247282
936 Ga0068857_101581667
937 Ga0068856_100178567
938 Ga0068856_100521223
939 Ga0068852_100045438
940 Ga0068852_101669851
941 Ga0068859_100656318
942 Ga0068864_100427668
943 Ga0068864_100902645
944 Ga0068851_10463439
945 Ga0081540_1028527
946 Ga0081539_10024999
947 Ga0075365_10025255
948 Ga0075365_10025948
949 Ga0075365_10029994
950 Ga0075365_10033733
951 Ga0075365_10055263
952 Ga0075368_10007215
953 Ga0075368_10423375
954 Ga0075363_100037622
955 Ga0075364_10022922
956 Ga0070715_10300335
957 Ga0070712_100404806
958 Ga0070712_100845617
959 Ga0075362_10494492
960 Ga0075367_10044441
961 Ga0075367_10089603
962 Ga0075369_10038747
963 Ga0075369_10061178
964 Ga0075369_10347090
965 Ga0075369_10463088
966 Ga0075366_10003779
967 Ga0075370_10011212
968 Ga0068871_100682784
969 Ga0068871_100925575
970 Ga0097620_100656289
971 Ga0099825_1031826
972 Ga0099824_1009019
973 Ga0099822_1080485
974 Ga0099823_1036587
975 Ga0105240_10002492
976 Ga0105245_10180091
977 Ga0105245_10215176
978 Ga0105247_10035205
979 Ga0105247_10809868
980 Ga0105247_10956466
981 Ga0105243_10666874
982 Ga0105243_10856867
983 Ga0105241_10007857
984 Ga0105241_10080522
985 Ga0105241_10387225
986 Ga0105241_11856759
987 Ga0105242_10232838
988 Ga0105242_10608565
989 Ga0105242_11566037
990 Ga0105248_10042051
991 Ga0105248_10162431
992 Ga0105248_12970978
993 Ga0105237_10019314
994 Ga0105237_10040545
995 Ga0105237_10484288
996 Ga0105237_11095728
997 Ga0105238_10007999
998 Ga0105238_10611755
999 Ga0105238_11185381
1000 Ga0105238_11615667
1001 Ga0105238_11852459
1002 Ga0105238_12675305
1003 Ga0105238_12744899
1004 Ga0105249_10835257
1005 Ga0105239_10070346
1006 Ga0105239_10246616
1007 Ga0105239_10336116
1008 Ga0105239_11210541
1009 Ga0105239_11423823
1010 Ga0105239_12384877
1011 Ga0105246_10279012
1012 Ga0157370_10103002
1013 Ga0157369_10053822
1014 Ga0157369_10207784
1015 Ga0157374_10027912
1016 Ga0157374_11118333
1017 Ga0157374_11456155
1018 Ga0157374_11878766
1019 Ga0163162_10057235
1020 Ga0163162_10235578
1021 Ga0157372_10574589
1022 Ga0157375_10456528
1023 Ga0157375_12053625
1024 Ga0157375_13066077
1025 Ga0163163_10059842
1026 Ga0163163_10794297
1027 Ga0157379_10033261
1028 Ga0157379_10861279
1029 Ga0157376_10745308
1030 Ga0157376_11227112
1031 Ga0157376_12524984
1032 Ga0206356_10258528
1033 Ga0214544_1000003
1034 Ga0214542_1000022
1035 Ga0214545_1000010
1036 Ga0214543_1000035
1037 Ga0213874_10025281
1038 Ga0213875_10173207
1039 Ga0209563_112266
1040 Ga0209026_1012305
1041 Ga0209677_106686
1042 Ga0209148_1000267
1043 Ga0209233_1002344
1044 Ga0209233_1003034
1045 Ga0209233_1063686
1046 Ga0209455_1005262
1047 Ga0209455_1007946
1048 Ga0209455_1016958
1049 Ga0209673_1016536
1050 Ga0209130_1029615
1051 Ga0209564_1003160
1052 Ga0209564_1006871
1053 Ga0209758_1000015
1054 Ga0209758_1000711
1055 Ga0209758_1004632
1056 Ga0209758_1006280
1057 Ga0209758_1011473
1058 Ga0209758_1022902
1059 Ga0209758_1047167
1060 Ga0209758_1125691
1061 Ga0209256_1002592
1062 Ga0209256_1049583
1063 Ga0207426_1000217
1064 Ga0207426_1000368
1065 Ga0207426_1006125
1066 Ga0207426_1014398
1067 Ga0207426_1016643
1068 Ga0207426_1051623
1069 Ga0209257_1002989
1070 Ga0209257_1026125
1071 Ga0207688_10031544
1072 Ga0207647_10037522
1073 Ga0207647_10488641
1074 Ga0207699_10174206
1075 Ga0207705_10260834
1076 Ga0207705_11547569
1077 Ga0207684_10845000
1078 Ga0207654_10091559
1079 Ga0207654_10975743
1080 Ga0207707_10008151
1081 Ga0207695_10000059
1082 Ga0207671_10013578
1083 Ga0207671_10069017
1084 Ga0207671_10707993
1085 Ga0207671_11465849
1086 Ga0207693_10384454
1087 Ga0207657_10141389
1088 Ga0207657_10359727
1089 Ga0207657_10741290
1090 Ga0207652_10065253
1091 Ga0207694_10027217
1092 Ga0207694_10598194
1093 Ga0207694_11410124
1094 Ga0207687_10104612
1095 Ga0207687_10165880
1096 Ga0207644_10025584
1097 Ga0207644_10118545
1098 Ga0207644_11028423
1099 Ga0207690_10584584
1100 Ga0207706_10291765
1101 Ga0207686_11505392
1102 Ga0207686_11581339
1103 Ga0207704_10181741
1104 Ga0207665_10128015
1105 Ga0207711_10030129
1106 Ga0207711_11916581
1107 Ga0207689_10151195
1108 Ga0207661_10115913
1109 Ga0207679_10185660
1110 Ga0207679_11216411
1111 Ga0207667_10328957
1112 Ga0207667_10586449
1113 Ga0207667_11236449
1114 Ga0207651_11233639
1115 Ga0207668_10747966
1116 Ga0207640_10695364
1117 Ga0207658_10242638
1118 Ga0207639_10043716
1119 Ga0207639_10071599
1120 Ga0207639_10695841
1121 Ga0207639_10891550
1122 Ga0207678_10007182
1123 Ga0207678_10064182
1124 Ga0207678_10513031
1125 Ga0207702_10159411
1126 Ga0207702_11083840
1127 Ga0207641_11636702
1128 Ga0207648_10061522
1129 Ga0207648_11112723
1130 Ga0207676_10382908
1131 Ga0207676_10566260
1132 Ga0207674_10027211
1133 Ga0207674_10078405
1134 Ga0207683_10396320
1135 Ga0207698_10068132
1136 Ga0207698_10468827
1137 Ga0207698_10557312
1138 Ga0209389_1000012
1139 Ga0209389_1000069
1140 Ga0209589_1000077
1141 Ga0209489_100019
1142 Ga0209489_100020
1143 Ga0209700_100018
1144 Ga0209813_10016527
1145 Ga0268266_10104787
1146 Ga0268266_10126859
1147 Ga0268266_10698962
1148 Ga0268265_10451327
1149 Ga0268265_10463953
1150 Ga0307517_10497948
1151 Ga0307509_10798073
1152 Ga0307508_10671818
1153 Ga0307510_10103437
1154 Ga0307510_10183643
1155 Ga0373923_0036939
1156 Ga0373955_0052005
1157 Ga0373935_0024407
1158 Ga0373947_0004448
1159 Ga0373925_0022185
1160 Ga0395900_0001756
1161 Ga0395900_0503721
1162 Ga0395898_0005957
1163 Ga0395898_0058714
1164 Ga0395898_0897760
1165 Ga0395898_1260764
1166 Ga0395905_0085998
1167 Ga0436364_1105843
1168 Ga0395901_0029430
1169 Ga0395901_0265395
1170 Ga0395901_0271188
1171 Ga0395901_0805692
1172 Ga0436365_1602753
1173 Ga0436361_0681592
1174 Ga0436363_0076942
1175 Ga0436363_1239221
1176 Ga0436362_0476645
1177 Ga0439465_0139927
1178 Ga0451789_1368091
1179 Ga0451793_0004869
1180 Ga0451797_0598845
1181 Ga0451798_0263746
1182 Ga0451802_0981618
1183 Ga0451807_1952152
1184 Ga0451835_0295644
1185 Ga0451839_0035569
1186 Ga0451841_0776791
1187 Ga0451851_0781653
1188 Ga0451853_0978545
1189 Ga0451853_2614112
1190 Ga0466972_0116271
1191 Ga0466965_0231001
1192 Ga0466965_0362858
1193 Ga0466963_0075321
1194 Ga0466964_0072974
1195 Ga0466964_0085777
1196 Ga0466964_0298761
1197 Ga0466964_0912949
1198 Ga0466971_0142005
1199 Ga0466968_0003565
1200 Ga0466968_0025710
1201 Ga0466968_0353895
1202 Ga0466957_0251936
1203 Ga0466960_0103494
1204 Ga0466960_0396667
1205 Ga0466959_0433474
1206 Ga0466959_1197263
1207 Ga0466967_0054112
1208 Ga0466967_0414255
1209 Ga0466967_0693650
1210 Ga0495617_239911
1211 Ga0495592_0099161
1212 Ga0495592_0114431
1213 Ga0495629_0031673
1214 Ga0495638_0048119
1215 Ga0495638_0564987
1216 Ga0495641_0161288
1217 Ga0495651_0018866
1218 Ga0495651_0026536
1219 Ga0495653_0261307
1220 Ga0495650_0031088
1221 Ga0495650_0150432
1222 Ga0495580_0005864
1223 Ga0495582_0473687
1224 Ga0495605_0056158
1225 Ga0495605_0100526
1226 Ga0495639_0212065
1227 Ga0495639_0263220
1228 Ga0495662_0113272
1229 Ga0495664_0007034
1230 Ga0495664_0040911
1231 Ga0495664_0070928
1232 Ga0495664_0088422
1233 Ga0495584_0054787
1234 Ga0495585_0369762
1235 Ga0495607_0091008
1236 Ga0495583_0089487
1237 Ga0495606_0013516
1238 Ga0495606_0083251
1239 Ga0495606_0091719
1240 Ga0495608_0009012
1241 Ga0495608_0120826
1242 Ga0495608_0173379
1243 Ga0495610_0044456
1244 Ga0495610_0100696
1245 Ga0495610_0241121
1246 Ga0495610_0249970
1247 Ga0495616_0045894
1248 Ga0495616_0056386
1249 Ga0495616_0175716
1250 Ga0495618_0040942
1251 Ga0495618_0479727
1252 Ga0495620_0047396
1253 Ga0495620_0305514
1254 Ga0495628_0014226
1255 Ga0495628_0155768
1256 Ga0495628_0165790
1257 Ga0495628_0754756
1258 Ga0495630_0121912
1259 Ga0495630_0496005
1260 Ga0495631_0377347
1261 Ga0495632_0035990
1262 Ga0495632_0403929
1263 Ga0495643_0045256
1264 Ga0495643_0098799
1265 Ga0495648_0019778
1266 Ga0495648_0053168
1267 Ga0495648_0178166
1268 Ga0495648_0262346
1269 Ga0495666_0181965
1270 Ga0495652_0026908
1271 Ga0495652_0075663
1272 Ga0495652_0096116
1273 Ga0495652_0135398
1274 Ga0495652_0804077
1275 Ga0495640_0050077
1276 Ga0495586_0051878
1277 Ga0495587_0008157
1278 Ga0495587_0091322
1279 Ga0495587_0189117
1280 Ga0495609_0074561
1281 Ga0495609_0111294
1282 Ga0495609_0251251
1283 Ga0495597_0158248
1284 Ga0495645_0069536
1285 Ga0495645_0108289
1286 Ga0495645_0415865
1287 Ga0495622_0011952
1288 Ga0495622_0041909
1289 Ga0495622_0363889
1290 Ga0495667_0003075
1291 Ga0495667_0107918
1292 Ga0495667_0270840
1293 Ga0495668_0072413
1294 Ga0495634_0080981
1295 Ga0495634_0082944
1296 Ga0495634_0112768
1297 Ga0495611_0211455
1298 Ga0495611_0538703
1299 Ga0495625_0030852
1300 Ga0495625_0040774
1301 Ga0495625_0424263
1302 Ga0495635_0018638
1303 Ga0495635_0180358
1304 Ga0495661_0229757
1305 Ga0495661_0265755
1306 Ga0495661_0543910
1307 Ga0495588_0040929
1308 Ga0495588_0168699
1309 Ga0495657_0005133
1310 Ga0495657_0009727
1311 Ga0495657_0335428
1312 Ga0495599_0049656
1313 Ga0495599_0203900
1314 Ga0495623_0010483
1315 Ga0495623_0222102
1316 Ga0495646_0003762
1317 Ga0495646_0057567
1318 Ga0495658_0075141
1319 Ga0495669_0477846
1320 Ga0495613_0074469
1321 Ga0495613_0085821
1322 Ga0495624_0049964
1323 Ga0495624_0062319
1324 Ga0495624_0188898
1325 Ga0495671_0202440
1326 Ga0495671_0402538
1327 Ga0495649_0032163
1328 Ga0495649_0161057
1329 Ga0495600_0006367
1330 Ga0495600_0040888
1331 Ga0495600_0307922
1332 Ga0495660_0339762
1333 Ga0495581_0048220
1334 Ga0495581_0779669
1335 Ga0495604_0000678
1336 Ga0495604_0017687
1337 Ga0495604_0224547
1338 Ga0495674_0016568
1339 Ga0495672_0559582
1340 Ga0495676_0392161
1341 Ga0495680_0001164
1342 Ga0495683_0050592
1343 Ga0495683_0137317
1344 Ga0495687_010280
1345 Ga0495675_0004534
1346 Ga0495673_0111987
1347 Ga0495684_0134861
1348 Ga0495684_0137762
1349 Ga0495684_0263849
1350 Ga0495686_0074651
1351 Ga0495686_0169490
1352 Ga0495686_0178344
1353 Ga0495686_0202397
1354 Ga0495686_0368473
1355 Ga0495593_0013965
1356 Ga0495593_0213287
1357 Ga0495602_0007817
1358 Ga0495602_0029415
1359 Ga0495626_0114443
1360 Ga0495626_0119194
1361 Ga0496100_0310988
1362 Ga0496102_0307366
1363 Ga0496102_0541479
1364 Ga0496102_0716583
1365 Ga0496103_0022210
1366 Ga0496103_0877156
1367 Ga0496104_0014507
1368 Ga0496104_0093736
1369 Ga0496104_0346439
1370 Ga0496104_0840831
1371 Ga0496104_1807566
1372 Ga0496105_0007733
1373 Ga0496105_0098009
1374 Ga0496105_0348854
1375 Ga0496105_0826024
1376 Ga0496106_0052530
1377 Ga0496106_0415275
1378 Ga0496107_0247899
1379 Ga0496107_0865685
1380 Ga0496108_0125454
1381 Ga0496108_0204804
1382 Ga0496108_0404337
1383 Ga0496108_0626508
1384 Ga0496109_0167994
1385 Ga0496109_0728468
1386 Ga0496110_0076750
1387 Ga0496110_0216548
1388 Ga0496110_0769807
1389 Ga0496110_0976402
1390 Ga0496111_0208564
1391 Ga0496111_0506794
1392 Ga0496112_0044970
1393 Ga0496112_0112630
1394 Ga0496112_0184320
1395 Ga0496113_0056643
1396 Ga0496113_0132052
1397 Ga0496113_0579763
1398 Ga0496113_1393533
1399 Ga0496113_1469212
1400 Ga0496114_0093463
1401 Ga0496114_0273531
1402 Ga0496114_0281214
1403 Ga0496114_1739116
1404 Ga0496115_0009406
1405 Ga0496115_0101425
1406 Ga0496115_0965435
1407 Ga0496116_0075537
1408 Ga0496116_0211911
1409 Ga0496117_0069424
1410 Ga0496117_0144340
1411 Ga0496117_0175740
1412 Ga0496117_0209793
1413 Ga0496117_0229601
1414 Ga0496118_0019475
1415 Ga0496118_0028559
1416 Ga0496118_0036684
1417 Ga0496118_0084187
1418 Ga0496118_0156562
1419 Ga0496118_0188285
1420 Ga0496119_0004042
1421 Ga0496119_0044701
1422 Ga0496119_0051808
1423 Ga0496119_0064646
1424 Ga0496119_0067769
1425 Ga0496119_0191145
1426 Ga0496120_0003365
1427 Ga0496120_0136221
1428 Ga0496120_0139346
1429 Ga0496120_0140165
1430 Ga0496120_0214442
1431 Ga0496121_0023325
1432 Ga0496121_0043408
1433 Ga0496121_0047888
1434 Ga0496121_0126551
1435 Ga0496121_0267346
1436 Ga0496121_0592588
1437 Ga0496122_0152942
1438 Ga0496123_0068015
1439 Ga0496124_0071113
1440 Ga0496124_0257071
1441 Ga0496124_0383431
1442 Ga0496124_0531616
1443 Ga0496125_0091251
1444 Ga0496125_0195768
1445 Ga0496125_0502199
1446 Ga0496126_0047705
1447 Ga0496126_0139372
1448 Ga0496126_0475926
1449 Ga0496126_0611757
1450 Ga0496126_0664678
1451 Ga0496126_0948205
1452 Ga0496126_1398857
1453 Ga0495682_0075744
1454 Ga0495682_0288897
1455 Ga0501033_0743461
1456 Ga0501034_0134299
1457 Ga0501038_0203480
1458 Ga0501038_0223971
1459 Ga0501043_0535865
1460 Ga0501046_0085928
1461 Ga0501047_0009870
1462 Ga0501047_0916658
1463 Ga0501067_0087210
1464 Ga0501067_0195178
1465 Ga0501070_0016072
1466 Ga0501073_0101568
1467 Ga0501074_0022542
1468 Ga0501079_0622553
1469 Ga0501080_0019801
1470 Ga0501080_1285580
1471 Ga0501035_0305682
1472 Ga0501044_0088970
1473 Ga0501045_0718846
1474 nmdc:mga03n38_154423_c1
1475 nmdc:mga00v17_15210_c1
1476 nmdc:mga0yw44_1180962_c1
1477 nmdc:mga0yw44_23287_c1
1478 nmdc:mga0yw44_26173_c1
1479 nmdc:mga0yw44_27213_c1
1480 nmdc:mga0yw44_4551_c1
1481 nmdc:mga0k408_16486_c1
1482 nmdc:mga06z11_170134_c1
1483 nmdc:mga06z11_291124_c1
1484 nmdc:mga04h51_82669_c1
1485 nmdc:mga07m45_85151_c1
1486 nmdc:mga0sz30_12992_c1
1487 nmdc:mga0sz30_26226_c1
1488 nmdc:mga0sz30_321863_c1
1489 nmdc:mga0sz30_55941_c2
1490 nmdc:mga0sz30_75666_c1
1491 Ga0495601_0051835
1492 Ga0495612_0007133
1493 Ga0495612_0024566
1494 Ga0500610_0088878
1495 Ga0500635_0023865
1496 Ga0495655_0091062
1497 Ga0495655_0133400
1498 Ga0495619_0167014
1499 Ga0500578_0170034
1500 Ga0500578_0378461
1501 Ga0500643_000048
1502 Ga0500644_0154020
1503 Ga0500644_0314823
1504 Ga0500583_0010766
1505 Ga0500583_0060762
1506 Ga0500651_0002004
1507 Ga0500651_0339767
1508 Ga0500651_0576494
1509 Ga0500566_0061049
1510 Ga0500640_040268
1511 Ga0500641_0032761
1512 Ga0500648_152082
1513 Ga0500650_0382412
1514 Ga0500555_027405
1515 Ga0500556_0202815
1516 Ga0500556_0216078
1517 Ga0500562_034076
1518 Ga0500569_016178
1519 Ga0500569_145921
1520 Ga0500592_041313
1521 Ga0500594_0002506
1522 Ga0500594_0122244
1523 Ga0500595_000497
1524 Ga0500595_002282
1525 Ga0500595_013183
1526 Ga0500595_036322
1527 Ga0500597_191896
1528 Ga0500607_019806
1529 Ga0500608_191306
1530 Ga0500614_142619
1531 Ga0500614_197083
1532 Ga0500642_0000143
1533 Ga0500642_0001744
1534 Ga0500642_0269162
1535 Ga0500655_016024
1536 Ga0500658_0031805
1537 Ga0500559_0005658
1538 Ga0500559_0076758
1539 Ga0500564_111741
1540 Ga0500568_0037197
1541 Ga0500568_0070271
1542 Ga0500577_0353823
1543 Ga0500585_235996
1544 Ga0500589_157077
1545 Ga0500604_0218112
1546 Ga0500616_0000038
1547 Ga0500616_0030013
1548 Ga0500619_006592
1549 Ga0500620_070761
1550 Ga0500622_0026896
1551 Ga0500624_046764
1552 Ga0500627_0034673
1553 Ga0500627_0043782
1554 Ga0500633_0085309
1555 Ga0500638_229859
1556 Ga0500639_179519
1557 Ga0500636_0000148
1558 Ga0500649_095292
1559 Ga0500645_138489
1560 Ga0500645_147683
1561 Ga0500609_000768
1562 Ga0500609_016041
1563 Ga0500552_001279
1564 Ga0500599_002351
1565 Ga0500601_001009
1566 Ga0500661_037352
1567 2507505886
1568 2508540077
1569 2508696147
1570 2511396629
1571 2513638790
1572 2513649860
1573 2513704343
1574 2513715424
1575 2513877278
1576 2514011235
1577 2515631361
1578 2517105701
1579 2524435445
1580 2528851312
1581 2617347770
1582 2617374498
1583 2745081391
1584 2793061574
1585 2793073875
1586 2805916122
1587 2818240860
1588 2824605535
1589 2824610833
1590 2824619369
1591 2824627824
1592 2824641884
1593 2824651282
1594 2824653885
1595 2824663762
1596 2824676119
1597 2824680233
1598 2824692472
1599 2824699894
1600 2824706076
1601 2824720076
1602 2824729438
1603 2824737485
1604 2824748040
1605 2824760291
1606 2824771530
1607 2824775750
1608 2838125123
1609 2841945862
1610 2841956812
1611 2841965296
1612 2841973328
1613 2841979508
1614 2841989367
1615 2844321494
1616 2847939479
1617 2847941227
1618 2857513305
1619 2874596376
1620 2874620210
1621 2874633348
1622 2874650364
1623 2876761701
1624 2876776841
1625 2876824631
1626 2879080978
1627 2879091079
1628 2879106644
1629 2879128209
1630 2879143548
1631 2881369638
1632 2881670161
1633 2885418253
1634 2888387749
1635 2888389968
1636 2888421132
1637 2903727927
1638 2904718103
1639 2906602589
1640 2906631914
1641 2906648655
1642 2908746724
1643 2908776977
1644 2922377453
1645 2922393371
1646 2929622246
1647 2929630107
1648 2932787960
1649 2932799506
1650 2932805188
1651 2932813335
1652 2932820032
1653 2932832904
1654 2933584140
1655 2935614310
1656 2935620389
1657 2935632666
1658 2935640713
1659 2935649338
1660 2935657890
1661 2935668905
1662 2935681369
1663 2935687214
1664 2935696815
1665 2935709093
1666 2935716902
1667 2935722973
1668 2935734530
1669 2935744679
1670 2935753180
1671 2935767584
1672 2935770178
1673 2935777792
1674 2935786768
1675 2935794822
1676 2935804823
1677 2935815972
1678 2935826528
1679 2935832220
1680 2935840950
1681 2935851178
1682 2935859275
1683 2935864459
1684 2935875189
1685 2935887722
1686 2935913227
1687 2935922649
1688 2935930848
1689 2935939818
1690 2935946767
1691 2935956032
1692 2935963888
1693 2935972825
1694 2935978258
1695 2935985614
1696 2935995836
1697 2936005747
1698 2936012109
1699 2936020810
1700 2936029402
1701 2936041875
1702 2936048274
1703 2936056615
1704 2940559093
1705 2941508670
1706 2941516500
1707 2941524484
1708 2941532074
1709 2941541788
1710 3005485834
1711 3005510875
1712 3005588824
1713 3005601860
1714 3005717599
1715 3005724647
1716 8006928841
1717 8016517299
1718 8016526935
1719 8016532019
1720 8016545228
1721 8016556859
1722 8016565212
1723 8016582855
1724 8016585440
1725 8016602855
1726 8016617632
1727 8016623937
1728 8016634930
1729 8017059298
1730 8019531836
1731 8019539693
1732 8019550955
1733 8019576331
1734 8019607359
1735 8019611155
1736 8019622003
1737 8019631319
1738 8019639304
1739 8019651722
1740 8019668123
1741 8019677589
1742 8019687360
1743 8019693336
1744 8055743505

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

28

114

0.74

Map