F484215

General Info

Members Datasets Scaffolds Average Seq Length
872 321 872 95

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_12041023|Ga0070681_120410231
Length 104
Sequence VGARRSGRSVIYEVFRQDRKGQPFEHAGSVVAPDVEFAEAWAREQYGRRGESVALWLVPRDAVHVIADWADEFDLKYRRVDGYSIKARLKEARERAGTAAAGDR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
71 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
72 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
73 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
74 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
203 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
204 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
311 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.06
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10003469 3300005327 Bacteria 12957
2 Ga0070658_10170777 3300005327 Bacteria 1826
3 Ga0070658_10383887 3300005327 Bacteria 1205
4 Ga0070658_10706052 3300005327 Unclassified 875
5 Ga0070683_100052446 3300005329 Bacteria 3778
6 Ga0070683_100323271 3300005329 Bacteria 1468
7 Ga0070683_101116101 3300005329 Bacteria 758
8 Ga0070683_101700906 3300005329 Unclassified 607
9 Ga0070683_101942035 3300005329 Bacteria 566
10 Ga0070680_100150818 3300005336 Bacteria 1951
11 Ga0070680_100239043 3300005336 Bacteria 1535
12 Ga0070680_100265238 3300005336 Unclassified 1453
13 Ga0070680_100266248 3300005336 Bacteria 1451
14 Ga0070680_100536159 3300005336 Bacteria 1002
15 Ga0070680_100573625 3300005336 Bacteria 968
16 Ga0070680_101315747 3300005336 Unclassified 625
17 Ga0070680_101632286 3300005336 Unclassified 559
18 Ga0070682_100013765 3300005337 Bacteria 4663
19 Ga0070682_100281338 3300005337 Unclassified 1213
20 Ga0070682_101385388 3300005337 Bacteria 601
21 Ga0070682_101956658 3300005337 Bacteria 515
22 Ga0068868_100159779 3300005338 Unclassified 1860
23 Ga0068868_101255791 3300005338 Unclassified 687
24 Ga0068868_102018356 3300005338 Unclassified 548
25 Ga0070660_100103906 3300005339 Bacteria 2253
26 Ga0070660_100611469 3300005339 Bacteria 912
27 Ga0070660_100935263 3300005339 Unclassified 731
28 Ga0070691_10071494 3300005341 Bacteria 1684
29 Ga0070661_100558665 3300005344 Unclassified 922
30 Ga0070661_100584652 3300005344 Unclassified 901
31 Ga0070661_101560580 3300005344 Unclassified 558
32 Ga0070692_10215121 3300005345 Bacteria 1133
33 Ga0070692_10961010 3300005345 Bacteria 595
34 Ga0070675_101617159 3300005354 Unclassified 598
35 Ga0070671_100034184 3300005355 Bacteria 4208
36 Ga0070671_101891308 3300005355 Unclassified 531
37 Ga0070659_100198333 3300005366 Bacteria 1651
38 Ga0070659_100555076 3300005366 Bacteria 983
39 Ga0070659_101043479 3300005366 Unclassified 719
40 Ga0070709_10034391 3300005434 Unclassified 3072
41 Ga0070709_10245795 3300005434 Unclassified 1287
42 Ga0070709_10769327 3300005434 Bacteria 754
43 Ga0070709_11246950 3300005434 Unclassified 599
44 Ga0070714_100040084 3300005435 Bacteria 3947
45 Ga0070714_100085136 3300005435 Unclassified 2760
46 Ga0070714_100277024 3300005435 Bacteria 1557
47 Ga0070714_100322262 3300005435 Unclassified 1445
48 Ga0070714_100340116 3300005435 Bacteria 1407
49 Ga0070714_100613220 3300005435 Unclassified 1046
50 Ga0070714_100716788 3300005435 Bacteria 966
51 Ga0070714_100945906 3300005435 Unclassified 837
52 Ga0070714_101599301 3300005435 Unclassified 637
53 Ga0070714_101740666 3300005435 Unclassified 609
54 Ga0070713_100050722 3300005436 Bacteria 3429
55 Ga0070713_100084771 3300005436 Bacteria 2712
56 Ga0070713_100134397 3300005436 Bacteria 2184
57 Ga0070713_101565409 3300005436 Bacteria 640
58 Ga0070710_10015854 3300005437 Bacteria 3822
59 Ga0070710_10017530 3300005437 Bacteria 3666
60 Ga0070710_10748958 3300005437 Unclassified 693
61 Ga0070710_10913076 3300005437 Unclassified 635
62 Ga0070711_100026065 3300005439 Bacteria 3829
63 Ga0070711_100034412 3300005439 Bacteria 3379
64 Ga0070711_101284536 3300005439 Bacteria 635
65 Ga0070711_101797281 3300005439 Archaea 538
66 Ga0070705_100958373 3300005440 Bacteria 692
67 Ga0070705_101078870 3300005440 Unclassified 656
68 Ga0070694_100209348 3300005444 Bacteria 1457
69 Ga0070694_101411123 3300005444 Unclassified 588
70 Ga0070708_100468967 3300005445 Bacteria 1188
71 Ga0070708_101502300 3300005445 Unclassified 628
72 Ga0070663_101355499 3300005455 Unclassified 629
73 Ga0070678_101835749 3300005456 Bacteria 572
74 Ga0070662_100726056 3300005457 Unclassified 841
75 Ga0070662_100728941 3300005457 Bacteria 840
76 Ga0070681_10177585 3300005458 Bacteria 2051
77 Ga0070681_10182685 3300005458 Bacteria 2018
78 Ga0070681_10197498 3300005458 Bacteria 1930
79 Ga0070681_10375886 3300005458 Unclassified 1331
80 Ga0070681_10639546 3300005458 Bacteria 978
81 Ga0070681_12041023 3300005458 Bacteria 502
82 Ga0070685_11227182 3300005466 Unclassified 571
83 Ga0070706_102014070 3300005467 Bacteria 523
84 Ga0070706_102022873 3300005467 Bacteria 522
85 Ga0070707_100061249 3300005468 Bacteria 3609
86 Ga0070707_100798702 3300005468 Unclassified 907
87 Ga0070698_100258548 3300005471 Bacteria 1673
88 Ga0070698_100290667 3300005471 Bacteria 1565
89 Ga0070698_100301966 3300005471 Bacteria 1532
90 Ga0070698_100973855 3300005471 Bacteria 795
91 Ga0070699_101054327 3300005518 Bacteria 746
92 Ga0070679_100114800 3300005530 Bacteria 2679
93 Ga0070679_100160799 3300005530 Bacteria 2220
94 Ga0070679_100317396 3300005530 Bacteria 1508
95 Ga0070679_100504805 3300005530 Bacteria 1153
96 Ga0070679_100903806 3300005530 Unclassified 826
97 Ga0070684_100252548 3300005535 Unclassified 1612
98 Ga0070684_100314314 3300005535 Bacteria 1438
99 Ga0070684_100773928 3300005535 Unclassified 896
100 Ga0070684_100774014 3300005535 Unclassified 896
101 Ga0068853_101093450 3300005539 Bacteria 769
102 Ga0070695_100000001 3300005545 Bacteria 150757
103 Ga0070693_100256844 3300005547 Bacteria 1160
104 Ga0070693_100507254 3300005547 Bacteria 857
105 Ga0070665_101625712 3300005548 Unclassified 654
106 Ga0070704_100278161 3300005549 Unclassified 1385
107 Ga0068855_100291723 3300005563 Bacteria 1808
108 Ga0068855_101096172 3300005563 Unclassified 832
109 Ga0068855_101248940 3300005563 Unclassified 771
110 Ga0070664_100428808 3300005564 Bacteria 1212
111 Ga0070664_100505956 3300005564 Bacteria 1114
112 Ga0068854_101948201 3300005578 Unclassified 541
113 Ga0068856_100437936 3300005614 Bacteria 1327
114 Ga0068852_100095164 3300005616 Bacteria 2674
115 Ga0068852_100147275 3300005616 Unclassified 2185
116 Ga0068852_100316029 3300005616 Bacteria 1515
117 Ga0068866_10354110 3300005718 Bacteria 934
118 Ga0068863_100591462 3300005841 Unclassified 1098
119 Ga0081455_10081052 3300005937 Bacteria 2659
120 Ga0070717_10001309 3300006028 Bacteria 17038
121 Ga0070717_10030492 3300006028 Bacteria 4333
122 Ga0070717_10101105 3300006028 Bacteria 2448
123 Ga0070717_10575896 3300006028 Unclassified 1020
124 Ga0075432_10116539 3300006058 Unclassified 1000
125 Ga0070715_10000128 3300006163 Bacteria 18010
126 Ga0070715_10413476 3300006163 Unclassified 753
127 Ga0070716_100053160 3300006173 Unclassified 2308
128 Ga0070716_101764908 3300006173 Unclassified 512
129 Ga0070712_100490266 3300006175 Bacteria 1029
130 Ga0070712_100823035 3300006175 Unclassified 797
131 Ga0097621_100447317 3300006237 Bacteria 1163
132 Ga0097621_101003848 3300006237 Unclassified 781
133 Ga0097621_101495899 3300006237 Bacteria 641
134 Ga0075431_100955925 3300006847 Bacteria 825
135 Ga0075433_10317353 3300006852 Bacteria 1379
136 Ga0075433_10784797 3300006852 Bacteria 833
137 Ga0075434_100068175 3300006871 Bacteria 3544
138 Ga0075434_100165162 3300006871 Unclassified 2234
139 Ga0075434_100958861 3300006871 Unclassified 870
140 Ga0068865_101221006 3300006881 Unclassified 666
141 Ga0075436_100545433 3300006914 Unclassified 851
142 Ga0075436_100983602 3300006914 Bacteria 633
143 Ga0075435_100018465 3300007076 Bacteria 5305
144 Ga0075435_100689428 3300007076 Bacteria 888
145 Ga0105251_10192717 3300009011 Unclassified 918
146 Ga0105244_10363702 3300009036 Unclassified 666
147 Ga0105240_10370482 3300009093 Bacteria 1619
148 Ga0111539_10303782 3300009094 Bacteria 1857
149 Ga0111539_10476269 3300009094 Bacteria 1454
150 Ga0105245_10106987 3300009098 Unclassified 2596
151 Ga0105245_10171862 3300009098 Bacteria 2064
152 Ga0105245_10572474 3300009098 Bacteria 1153
153 Ga0105247_10108687 3300009101 Unclassified 1782
154 Ga0105243_11348675 3300009148 Bacteria 732
155 Ga0105241_10997661 3300009174 Bacteria 783
156 Ga0105241_12688771 3300009174 Unclassified 501
157 Ga0105242_11191433 3300009176 Bacteria 780
158 Ga0105242_11976149 3300009176 Unclassified 625
159 Ga0105248_11045812 3300009177 Bacteria 922
160 Ga0105248_11051757 3300009177 Unclassified 920
161 Ga0105237_10540801 3300009545 Bacteria 1172
162 Ga0105237_10884010 3300009545 Unclassified 900
163 Ga0105237_12109908 3300009545 Unclassified 573
164 Ga0105237_12303676 3300009545 Unclassified 548
165 Ga0105238_11159050 3300009551 Bacteria 797
166 Ga0105238_12703763 3300009551 Unclassified 533
167 Ga0105249_11090214 3300009553 Bacteria 868
168 Ga0105249_12661074 3300009553 Unclassified 572
169 Ga0157325_1009929 3300012485 Bacteria 690
170 Ga0157343_1027074 3300012488 Bacteria 557
171 Ga0157342_1047625 3300012507 Unclassified 594
172 Ga0157327_1017263 3300012512 Bacteria 773
173 Ga0157338_1021715 3300012515 Bacteria 754
174 Ga0157371_10659940 3300013102 Bacteria 781
175 Ga0157371_11212729 3300013102 Unclassified 582
176 Ga0157370_11215828 3300013104 Unclassified 680
177 Ga0157369_10759161 3300013105 Bacteria 997
178 Ga0157369_10835163 3300013105 Unclassified 946
179 Ga0157369_10840299 3300013105 Unclassified 943
180 Ga0157369_11013114 3300013105 Unclassified 850
181 Ga0157374_11806434 3300013296 Bacteria 637
182 Ga0157374_12931549 3300013296 Bacteria 504
183 Ga0157378_10280808 3300013297 Bacteria 1605
184 Ga0163162_10853232 3300013306 Unclassified 1026
185 Ga0163162_11664315 3300013306 Bacteria 728
186 Ga0157372_10028900 3300013307 Bacteria 6050
187 Ga0157372_10345161 3300013307 Bacteria 1734
188 Ga0157372_10869734 3300013307 Bacteria 1046
189 Ga0157372_11515200 3300013307 Unclassified 772
190 Ga0157375_10056241 3300013308 Bacteria 3883
191 Ga0163163_10936059 3300014325 Unclassified 930
192 Ga0182008_10236797 3300014497 Unclassified 938
193 Ga0157377_11149008 3300014745 Unclassified 598
194 Ga0157379_10519000 3300014968 Unclassified 1106
195 Ga0157376_10546351 3300014969 Bacteria 1146
196 Ga0157376_11238392 3300014969 Unclassified 775
197 Ga0182006_1099328 3300015261 Unclassified 1035
198 Ga0182007_10227678 3300015262 Bacteria 661
199 Ga0182007_10238154 3300015262 Unclassified 649
200 Ga0182005_1206880 3300015265 Bacteria 592
201 Ga0182005_1287864 3300015265 Bacteria 516
202 Ga0197907_11460375 3300020069 Unclassified 969
203 Ga0197907_11462768 3300020069 Bacteria 1115
204 Ga0206356_10254714 3300020070 Unclassified 894
205 Ga0206356_10506411 3300020070 Unclassified 611
206 Ga0206349_1954900 3300020075 Unclassified 746
207 Ga0206354_10042482 3300020081 Bacteria 515
208 Ga0206354_10301111 3300020081 Bacteria 5364
209 Ga0206354_11109484 3300020081 Unclassified 801
210 Ga0206354_11702124 3300020081 Unclassified 2032
211 Ga0206353_11136966 3300020082 Bacteria 785
212 Ga0206353_11189789 3300020082 Bacteria 1123
213 Ga0206353_11253177 3300020082 Bacteria 1807
214 Ga0206353_11462915 3300020082 Unclassified 658
215 Ga0206353_11574996 3300020082 Unclassified 619
216 Ga0224712_10094948 3300022467 Bacteria 1255
217 Ga0207653_10336738 3300025885 Unclassified 588
218 Ga0207692_10009582 3300025898 Bacteria 4052
219 Ga0207692_10027645 3300025898 Unclassified 2674
220 Ga0207692_11075321 3300025898 Unclassified 532
221 Ga0207710_10175205 3300025900 Bacteria 1050
222 Ga0207685_10094627 3300025905 Unclassified 1266
223 Ga0207685_10290775 3300025905 Unclassified 805
224 Ga0207699_10016080 3300025906 Bacteria 3904
225 Ga0207705_10072226 3300025909 Bacteria 2502
226 Ga0207705_10138541 3300025909 Unclassified 1816
227 Ga0207705_10271211 3300025909 Archaea 1297
228 Ga0207705_10537376 3300025909 Bacteria 909
229 Ga0207705_10551023 3300025909 Bacteria 896
230 Ga0207654_10330308 3300025911 Unclassified 1045
231 Ga0207707_10131937 3300025912 Bacteria 2185
232 Ga0207707_10151294 3300025912 Bacteria 2029
233 Ga0207707_10439253 3300025912 Bacteria 1117
234 Ga0207707_10527390 3300025912 Unclassified 1005
235 Ga0207695_10043452 3300025913 Bacteria 4789
236 Ga0207671_10786221 3300025914 Unclassified 755
237 Ga0207693_10002202 3300025915 Bacteria 16996
238 Ga0207693_10135217 3300025915 Bacteria 1938
239 Ga0207693_11470024 3300025915 Bacteria 504
240 Ga0207663_10003571 3300025916 Bacteria 7630
241 Ga0207663_10019761 3300025916 Bacteria 3802
242 Ga0207663_10597325 3300025916 Bacteria 867
243 Ga0207660_10033381 3300025917 Bacteria 3560
244 Ga0207660_10056430 3300025917 Bacteria 2810
245 Ga0207660_10286588 3300025917 Bacteria 1308
246 Ga0207660_10380568 3300025917 Bacteria 1134
247 Ga0207660_10842822 3300025917 Bacteria 748
248 Ga0207660_11401922 3300025917 Bacteria 566
249 Ga0207662_10494781 3300025918 Unclassified 841
250 Ga0207657_10044826 3300025919 Bacteria 3885
251 Ga0207657_10137356 3300025919 Bacteria 1999
252 Ga0207657_10201819 3300025919 Bacteria 1599
253 Ga0207649_11287647 3300025920 Bacteria 578
254 Ga0207652_10101655 3300025921 Bacteria 2539
255 Ga0207652_10291925 3300025921 Bacteria 1471
256 Ga0207652_10528923 3300025921 Bacteria 1061
257 Ga0207652_10806233 3300025921 Unclassified 833
258 Ga0207652_10846460 3300025921 Bacteria 810
259 Ga0207652_10896633 3300025921 Unclassified 783
260 Ga0207652_11188861 3300025921 Bacteria 664
261 Ga0207646_10356640 3300025922 Unclassified 1321
262 Ga0207694_10033763 3300025924 Bacteria 3920
263 Ga0207659_11471315 3300025926 Bacteria 583
264 Ga0207687_10146153 3300025927 Unclassified 1799
265 Ga0207687_10505718 3300025927 Bacteria 1009
266 Ga0207687_11226320 3300025927 Unclassified 645
267 Ga0207687_11962266 3300025927 Unclassified 500
268 Ga0207700_10036475 3300025928 Bacteria 3552
269 Ga0207700_10420219 3300025928 Unclassified 1174
270 Ga0207664_10001609 3300025929 Bacteria 14849
271 Ga0207664_10004974 3300025929 Bacteria 9035
272 Ga0207664_10460075 3300025929 Bacteria 1136
273 Ga0207664_10477977 3300025929 Unclassified 1114
274 Ga0207664_11040651 3300025929 Bacteria 733
275 Ga0207664_11752494 3300025929 Unclassified 543
276 Ga0207664_11809616 3300025929 Unclassified 533
277 Ga0207644_10308682 3300025931 Unclassified 1277
278 Ga0207644_11724278 3300025931 Unclassified 525
279 Ga0207644_11743499 3300025931 Unclassified 521
280 Ga0207690_10102201 3300025932 Bacteria 2049
281 Ga0207690_10816024 3300025932 Bacteria 771
282 Ga0207690_11033481 3300025932 Unclassified 684
283 Ga0207706_10803108 3300025933 Unclassified 799
284 Ga0207706_10978598 3300025933 Bacteria 712
285 Ga0207704_10229245 3300025938 Bacteria 1380
286 Ga0207665_10001140 3300025939 Bacteria 17874
287 Ga0207665_10347307 3300025939 Bacteria 1119
288 Ga0207711_10716038 3300025941 Bacteria 933
289 Ga0207711_11483967 3300025941 Archaea 621
290 Ga0207711_11576274 3300025941 Archaea 600
291 Ga0207661_10116140 3300025944 Bacteria 2271
292 Ga0207661_10139196 3300025944 Bacteria 2087
293 Ga0207661_10354710 3300025944 Bacteria 1324
294 Ga0207661_10916739 3300025944 Unclassified 807
295 Ga0207661_11537765 3300025944 Unclassified 609
296 Ga0207661_11602907 3300025944 Unclassified 596
297 Ga0207661_12170801 3300025944 Bacteria 501
298 Ga0207679_10514788 3300025945 Bacteria 1069
299 Ga0207667_10396537 3300025949 Bacteria 1405
300 Ga0207651_10464865 3300025960 Unclassified 1088
301 Ga0207712_11785080 3300025961 Bacteria 551
302 Ga0207640_10636946 3300025981 Unclassified 907
303 Ga0207677_10560669 3300026023 Unclassified 997
304 Ga0207703_11828374 3300026035 Unclassified 584
305 Ga0207639_11025116 3300026041 Bacteria 773
306 Ga0207678_10741938 3300026067 Bacteria 865
307 Ga0207678_11335814 3300026067 Unclassified 634
308 Ga0207702_10066346 3300026078 Bacteria 3093
309 Ga0207702_10137271 3300026078 Bacteria 2208
310 Ga0207702_11033479 3300026078 Bacteria 815
311 Ga0207648_11571287 3300026089 Unclassified 618
312 Ga0207676_10459705 3300026095 Unclassified 1202
313 Ga0207683_11349474 3300026121 Bacteria 660
314 Ga0207698_10959231 3300026142 Unclassified 864
315 Ga0207698_11051181 3300026142 Bacteria 826
316 Ga0207428_10156120 3300027907 Unclassified 1735
317 Ga0268266_11254832 3300028379 Unclassified 716
318 Ga0265337_1060553 3300028556 Bacteria 1050
319 Ga0265334_10025424 3300028573 Bacteria 2396
320 Ga0265334_10114417 3300028573 Bacteria 968
321 Ga0265318_10032382 3300028577 Bacteria 2023
322 Ga0265322_10034572 3300028654 Bacteria 1440
323 Ga0265336_10017841 3300028666 Bacteria 2306
324 Ga0265336_10075832 3300028666 Unclassified 1004
325 Ga0265338_10003515 3300028800 Bacteria 21949
326 Ga0265338_10009802 3300028800 Bacteria 11356
327 Ga0265338_10044099 3300028800 Bacteria 4123
328 Ga0265338_10047409 3300028800 Bacteria 3924
329 Ga0265330_10099369 3300031235 Bacteria 1246
330 Ga0265332_10028012 3300031238 Bacteria 2467
331 Ga0265325_10018923 3300031241 Bacteria 3815
332 Ga0265329_10090670 3300031242 Bacteria 970
333 Ga0265340_10490417 3300031247 Bacteria 541
334 Ga0265327_10004489 3300031251 Bacteria 12329
335 Ga0265327_10027140 3300031251 Bacteria 3301
336 Ga0265327_10354442 3300031251 Bacteria 640
337 Ga0265316_10105558 3300031344 Bacteria 2137
338 Ga0265313_10007235 3300031595 Bacteria 7635
339 Ga0265313_10066148 3300031595 Bacteria 1676
340 Ga0265314_10086718 3300031711 Bacteria 2048
341 Ga0265342_10384072 3300031712 Unclassified 727
342 Ga0307405_10713404 3300031731 Unclassified 832
343 Ga0307407_11353387 3300031903 Unclassified 560
344 Ga0307409_100230655 3300031995 Unclassified 1678
345 Ga0307416_100576903 3300032002 Unclassified 1201
346 Ga0307415_100361217 3300032126 Unclassified 1226
347 Ga0316583_10157755 3300032133 Bacteria 790
348 Ga0316583_10244609 3300032133 Bacteria 621
349 Ga0373948_0105794 3300034817 Unclassified 667
350 Ga0373948_0107953 3300034817 Bacteria 662
351 Ga0373958_0194308 3300034819 Unclassified 529
352 Ga0373959_0062929 3300034820 Bacteria 825
353 Ga0373938_0032742 3300034957 Unclassified 1121
354 Ga0373926_0047449 3300035083 Bacteria 1543
355 Ga0373926_0049612 3300035083 Bacteria 1512
356 Ga0373928_0020857 3300035084 Bacteria 1377
357 Ga0373929_0061945 3300035085 Unclassified 878
358 Ga0373934_0359379 3300035086 Bacteria 607
359 Ga0373940_0053404 3300035088 Unclassified 1140
360 Ga0373944_0410587 3300035089 Unclassified 523
361 Ga0373952_0290234 3300035092 Unclassified 507
362 Ga0373945_0014009 3300035116 Bacteria 2682
363 Ga0373945_0029445 3300035116 Bacteria 1930
364 Ga0373945_0569445 3300035116 Unclassified 510
365 Ga0373953_0491730 3300035117 Unclassified 543
366 Ga0373956_0149673 3300035119 Unclassified 1098
367 Ga0373960_0137675 3300035121 Bacteria 824
368 Ga0373943_0015268 3300035170 Bacteria 3487
369 Ga0373943_0686444 3300035170 Bacteria 606
370 Ga0373946_0020493 3300035171 Bacteria 2556
371 Ga0373946_0026705 3300035171 Bacteria 2280
372 Ga0373955_0577222 3300035172 Bacteria 688
373 Ga0373955_0730131 3300035172 Bacteria 608
374 Ga0373924_0211246 3300035410 Unclassified 857
375 Ga0373924_0425623 3300035410 Unclassified 594
376 Ga0373924_0522235 3300035410 Bacteria 534
377 Ga0373931_0068548 3300035691 Unclassified 1931
378 Ga0373931_0421327 3300035691 Unclassified 849
379 Ga0373935_0067291 3300035692 Bacteria 2303
380 Ga0373935_0381878 3300035692 Unclassified 1009
381 Ga0373927_0046932 3300035695 Bacteria 2794
382 Ga0373933_0079441 3300035724 Bacteria 2009
383 Ga0373947_0012958 3300035725 Bacteria 4780
384 Ga0373947_0082679 3300035725 Bacteria 1990
385 Ga0373947_0696405 3300035725 Unclassified 693
386 Ga0373937_0038431 3300036401 Bacteria 4360
387 Ga0373937_0882978 3300036401 Unclassified 843
388 Ga0373925_0009943 3300037068 Bacteria 6909
389 Ga0373925_0029959 3300037068 Bacteria 3992
390 Ga0395899_0020914 3300037312 Bacteria 4963
391 Ga0395899_0070021 3300037312 Bacteria 2567
392 Ga0395899_0215897 3300037312 Bacteria 1331
393 Ga0395899_0936207 3300037312 Unclassified 526
394 Ga0395900_0076531 3300037418 Bacteria 3439
395 Ga0395900_0112617 3300037418 Bacteria 2794
396 Ga0395900_0319831 3300037418 Bacteria 1532
397 Ga0395900_0340838 3300037418 Bacteria 1474
398 Ga0395900_0727276 3300037418 Unclassified 924
399 Ga0395900_0879655 3300037418 Bacteria 820
400 Ga0395900_0896768 3300037418 Bacteria 810
401 Ga0395900_1010427 3300037418 Bacteria 751
402 Ga0395900_1352527 3300037418 Bacteria 626
403 Ga0395898_0038648 3300037466 Bacteria 4728
404 Ga0395898_0096858 3300037466 Bacteria 2834
405 Ga0395898_0274595 3300037466 Unclassified 1607
406 Ga0395898_0581555 3300037466 Bacteria 1062
407 Ga0395898_0973258 3300037466 Bacteria 785
408 Ga0395898_1269438 3300037466 Unclassified 666
409 Ga0395905_0043423 3300037471 Bacteria 4217
410 Ga0395905_0354707 3300037471 Bacteria 1359
411 Ga0395905_0678769 3300037471 Unclassified 932
412 Ga0395905_1206246 3300037471 Bacteria 660
413 Ga0395901_0048637 3300038443 Bacteria 4404
414 Ga0395901_0440504 3300038443 Bacteria 1334
415 Ga0395901_0691525 3300038443 Unclassified 1018
416 Ga0395901_0696359 3300038443 Bacteria 1014
417 Ga0395901_0822598 3300038443 Bacteria 916
418 Ga0395901_0954329 3300038443 Unclassified 836
419 Ga0395901_0969441 3300038443 Bacteria 828
420 Ga0395901_1228699 3300038443 Bacteria 714
421 Ga0436365_1190190 3300039437 Unclassified 620
422 Ga0436365_1505933 3300039437 Bacteria 831
423 Ga0436360_0797120 3300039438 Bacteria 1240
424 Ga0436363_0947939 3300039450 Unclassified 613
425 Ga0436363_1605281 3300039450 Bacteria 1278
426 Ga0436362_0023355 3300039453 Bacteria 965
427 Ga0451793_1601599 3300041452 Unclassified 571
428 Ga0451800_0468417 3300041459 Unclassified 575
429 Ga0451835_0395632 3300041492 Unclassified 641
430 Ga0451845_0708858 3300041501 Unclassified 821
431 Ga0451851_1210558 3300041507 Unclassified 549
432 Ga0439448_0108015 3300042005 Bacteria 949
433 Ga0466969_0019346 3300044656 Unclassified 3541
434 Ga0466969_0023023 3300044656 Bacteria 3212
435 Ga0466969_0219409 3300044656 Unclassified 865
436 Ga0453683_0392787 3300044673 Unclassified 894
437 Ga0466965_0149736 3300044683 Bacteria 1219
438 Ga0466965_0243892 3300044683 Unclassified 962
439 Ga0466966_0090406 3300044684 Bacteria 1901
440 Ga0466966_0119824 3300044684 Bacteria 1617
441 Ga0466966_0216779 3300044684 Unclassified 1156
442 Ga0466966_0706156 3300044684 Bacteria 608
443 Ga0466966_0909745 3300044684 Bacteria 530
444 Ga0466961_0012971 3300044693 Bacteria 5331
445 Ga0466961_0020838 3300044693 Bacteria 4219
446 Ga0466961_0059397 3300044693 Bacteria 2432
447 Ga0466961_0080403 3300044693 Bacteria 2063
448 Ga0466961_0209881 3300044693 Unclassified 1202
449 Ga0466961_0215387 3300044693 Bacteria 1185
450 Ga0466961_0269262 3300044693 Unclassified 1044
451 Ga0466961_0638924 3300044693 Bacteria 639
452 Ga0466961_0679850 3300044693 Bacteria 617
453 Ga0466961_0744289 3300044693 Bacteria 586
454 Ga0466961_0826467 3300044693 Unclassified 553
455 Ga0466963_0002677 3300044694 Bacteria 10032
456 Ga0466963_0003889 3300044694 Bacteria 8623
457 Ga0466963_0006203 3300044694 Bacteria 7061
458 Ga0466963_0008754 3300044694 Bacteria 6078
459 Ga0466963_0015154 3300044694 Bacteria 4767
460 Ga0466963_0021769 3300044694 Bacteria 4049
461 Ga0466963_0033491 3300044694 Bacteria 3336
462 Ga0466963_0038785 3300044694 Bacteria 3117
463 Ga0466963_0079127 3300044694 Bacteria 2224
464 Ga0466963_0089585 3300044694 Bacteria 2093
465 Ga0466963_0124090 3300044694 Bacteria 1779
466 Ga0466963_0151220 3300044694 Bacteria 1612
467 Ga0466963_0385080 3300044694 Unclassified 988
468 Ga0466963_0431417 3300044694 Unclassified 929
469 Ga0466963_0504215 3300044694 Bacteria 854
470 Ga0466963_0547778 3300044694 Unclassified 817
471 Ga0466963_1320784 3300044694 Bacteria 506
472 Ga0466964_0000606 3300044706 Bacteria 11362
473 Ga0466964_0078933 3300044706 Archaea 1408
474 Ga0466964_0163420 3300044706 Bacteria 1042
475 Ga0466964_0174304 3300044706 Unclassified 1015
476 Ga0466964_0233796 3300044706 Bacteria 898
477 Ga0466964_0239476 3300044706 Unclassified 889
478 Ga0466964_0749754 3300044706 Unclassified 548
479 Ga0466964_0771182 3300044706 Bacteria 541
480 Ga0466971_0006232 3300044719 Bacteria 5184
481 Ga0466971_0010936 3300044719 Bacteria 3970
482 Ga0466971_0046865 3300044719 Unclassified 1942
483 Ga0466971_0163313 3300044719 Bacteria 1043
484 Ga0466968_0002271 3300044735 Bacteria 7025
485 Ga0466968_0004485 3300044735 Bacteria 5220
486 Ga0466968_0005377 3300044735 Bacteria 4792
487 Ga0466968_0074794 3300044735 Bacteria 1480
488 Ga0466968_0291978 3300044735 Unclassified 782
489 Ga0466968_0337404 3300044735 Unclassified 730
490 Ga0466968_0565715 3300044735 Bacteria 571
491 Ga0466970_0005237 3300044765 Bacteria 6419
492 Ga0466970_0176783 3300044765 Unclassified 1184
493 Ga0466970_0727246 3300044765 Bacteria 579
494 Ga0466970_0934276 3300044765 Bacteria 511
495 Ga0466957_0005092 3300044842 Bacteria 7351
496 Ga0466957_0090892 3300044842 Bacteria 1912
497 Ga0466957_0214946 3300044842 Unclassified 1267
498 Ga0466957_0219858 3300044842 Unclassified 1254
499 Ga0466957_0270103 3300044842 Bacteria 1135
500 Ga0466957_0280783 3300044842 Bacteria 1114
501 Ga0466957_0376391 3300044842 Bacteria 967
502 Ga0466957_0469353 3300044842 Unclassified 869
503 Ga0466957_0488315 3300044842 Bacteria 852
504 Ga0466957_0770629 3300044842 Bacteria 682
505 Ga0466957_0929110 3300044842 Bacteria 623
506 Ga0466960_0080835 3300044901 Unclassified 1637
507 Ga0466960_0095494 3300044901 Bacteria 1522
508 Ga0466960_0309226 3300044901 Unclassified 892
509 Ga0466960_0343511 3300044901 Bacteria 850
510 Ga0466959_0001430 3300045049 Bacteria 14615
511 Ga0466959_0014657 3300045049 Bacteria 5703
512 Ga0466959_0050671 3300045049 Bacteria 3047
513 Ga0466959_0099997 3300045049 Bacteria 2076
514 Ga0466959_0166867 3300045049 Bacteria 1546
515 Ga0466959_0278007 3300045049 Bacteria 1149
516 Ga0466959_0319057 3300045049 Bacteria 1062
517 Ga0466959_0494639 3300045049 Bacteria 827
518 Ga0466959_0599116 3300045049 Bacteria 741
519 Ga0466959_0710541 3300045049 Unclassified 673
520 Ga0466958_0018517 3300045836 Bacteria 4042
521 Ga0466958_0035358 3300045836 Bacteria 2984
522 Ga0466958_0037941 3300045836 Bacteria 2888
523 Ga0466958_0057958 3300045836 Bacteria 2354
524 Ga0466958_0065609 3300045836 Bacteria 2215
525 Ga0466958_0083367 3300045836 Bacteria 1970
526 Ga0466958_0129652 3300045836 Bacteria 1583
527 Ga0466958_0248838 3300045836 Bacteria 1136
528 Ga0466958_0459286 3300045836 Bacteria 825
529 Ga0466958_0487546 3300045836 Bacteria 799
530 Ga0466958_0567733 3300045836 Bacteria 737
531 Ga0466958_0730568 3300045836 Bacteria 645
532 Ga0466958_0772406 3300045836 Unclassified 626
533 Ga0466967_0006945 3300045976 Bacteria 8097
534 Ga0466967_0016687 3300045976 Bacteria 5800
535 Ga0466967_0018925 3300045976 Bacteria 5523
536 Ga0466967_0045118 3300045976 Bacteria 3828
537 Ga0466967_0054010 3300045976 Unclassified 3533
538 Ga0466967_0072616 3300045976 Bacteria 3084
539 Ga0466967_0138966 3300045976 Bacteria 2261
540 Ga0466967_0250297 3300045976 Bacteria 1692
541 Ga0466967_0301568 3300045976 Bacteria 1541
542 Ga0466967_0438368 3300045976 Bacteria 1275
543 Ga0466967_0593718 3300045976 Bacteria 1092
544 Ga0466967_0627841 3300045976 Unclassified 1061
545 Ga0466967_0727559 3300045976 Archaea 983
546 Ga0466967_0742037 3300045976 Bacteria 973
547 Ga0466967_0821205 3300045976 Bacteria 923
548 Ga0466967_0894264 3300045976 Bacteria 883
549 Ga0466967_0956132 3300045976 Bacteria 852
550 Ga0466967_1011715 3300045976 Bacteria 827
551 Ga0466967_1588114 3300045976 Unclassified 651
552 Ga0466967_1726847 3300045976 Unclassified 623
553 Ga0466967_1923499 3300045976 Bacteria 588
554 Ga0466967_2154927 3300045976 Unclassified 553
555 Ga0495617_190785 3300046452 Unclassified 643
556 Ga0495592_0001526 3300046454 Bacteria 16137
557 Ga0495592_0069096 3300046454 Bacteria 2576
558 Ga0495592_0111239 3300046454 Bacteria 1938
559 Ga0495592_0633826 3300046454 Unclassified 649
560 Ga0495603_0349596 3300046455 Unclassified 848
561 Ga0495629_0079401 3300046459 Bacteria 2291
562 Ga0495629_0093246 3300046459 Bacteria 2101
563 Ga0495629_0145491 3300046459 Bacteria 1648
564 Ga0495629_0169497 3300046459 Bacteria 1515
565 Ga0495629_0839677 3300046459 Unclassified 604
566 Ga0495641_0046020 3300046461 Bacteria 2007
567 Ga0495641_0069451 3300046461 Bacteria 1583
568 Ga0495641_0102256 3300046461 Bacteria 1278
569 Ga0495641_0221787 3300046461 Unclassified 848
570 Ga0495651_0001467 3300046462 Bacteria 18231
571 Ga0495651_0094352 3300046462 Unclassified 2239
572 Ga0495653_0000781 3300046463 Bacteria 24458
573 Ga0495653_0264193 3300046463 Unclassified 1136
574 Ga0495582_0096863 3300046473 Unclassified 1650
575 Ga0495582_0133510 3300046473 Bacteria 1403
576 Ga0495582_0149856 3300046473 Bacteria 1324
577 Ga0495582_0564415 3300046473 Unclassified 659
578 Ga0495582_0617203 3300046473 Archaea 627
579 Ga0495605_0118834 3300046474 Bacteria 1200
580 Ga0495639_0249618 3300046475 Bacteria 877
581 Ga0495639_0659167 3300046475 Unclassified 540
582 Ga0495662_0034643 3300046476 Bacteria 2436
583 Ga0495662_0343754 3300046476 Unclassified 733
584 Ga0495664_0312755 3300046477 Bacteria 948
585 Ga0495664_0484269 3300046477 Unclassified 739
586 Ga0495594_0588010 3300046499 Bacteria 631
587 Ga0495608_0009146 3300046511 Bacteria 6925
588 Ga0495608_0372557 3300046511 Unclassified 876
589 Ga0495608_0389823 3300046511 Unclassified 853
590 Ga0495618_0000680 3300046514 Bacteria 23842
591 Ga0495618_0059715 3300046514 Bacteria 2417
592 Ga0495618_0112890 3300046514 Bacteria 1739
593 Ga0495618_0308767 3300046514 Bacteria 981
594 Ga0495618_0658808 3300046514 Bacteria 618
595 Ga0495618_0847597 3300046514 Unclassified 530
596 Ga0495628_0002347 3300046516 Bacteria 17097
597 Ga0495628_0027710 3300046516 Bacteria 4605
598 Ga0495628_0735417 3300046516 Unclassified 694
599 Ga0495628_0936071 3300046516 Unclassified 599
600 Ga0495630_0003475 3300046517 Bacteria 10948
601 Ga0495630_0023872 3300046517 Bacteria 4520
602 Ga0495630_0108360 3300046517 Bacteria 2104
603 Ga0495630_0124145 3300046517 Bacteria 1959
604 Ga0495630_0273116 3300046517 Bacteria 1291
605 Ga0495630_0660431 3300046517 Bacteria 800
606 Ga0495630_0667828 3300046517 Unclassified 795
607 Ga0495630_0675444 3300046517 Unclassified 790
608 Ga0495630_0765747 3300046517 Bacteria 737
609 Ga0495630_0803942 3300046517 Unclassified 718
610 Ga0495630_0978372 3300046517 Unclassified 643
611 Ga0495630_1003238 3300046517 Unclassified 634
612 Ga0495630_1361752 3300046517 Bacteria 534
613 Ga0495666_0035611 3300046526 Bacteria 2426
614 Ga0495642_0107054 3300046528 Bacteria 1193
615 Ga0495652_0002978 3300046529 Bacteria 17019
616 Ga0495652_0117810 3300046529 Bacteria 2123
617 Ga0495652_0283324 3300046529 Bacteria 1212
618 Ga0495652_0313182 3300046529 Bacteria 1136
619 Ga0495652_0356584 3300046529 Bacteria 1046
620 Ga0495665_0013588 3300046531 Bacteria 4400
621 Ga0495665_0297262 3300046531 Bacteria 827
622 Ga0495665_0331054 3300046531 Bacteria 777
623 Ga0495640_0058821 3300046533 Bacteria 2620
624 Ga0495640_0099935 3300046533 Bacteria 1905
625 Ga0495640_0253664 3300046533 Bacteria 1101
626 Ga0495640_0835962 3300046533 Bacteria 547
627 Ga0495586_0016645 3300046535 Bacteria 3909
628 Ga0495586_0283341 3300046535 Bacteria 948
629 Ga0495586_0396117 3300046535 Bacteria 794
630 Ga0495586_0425846 3300046535 Unclassified 764
631 Ga0495586_0439234 3300046535 Unclassified 752
632 Ga0495587_0001454 3300046536 Bacteria 15799
633 Ga0495587_0239347 3300046536 Bacteria 1021
634 Ga0495587_0685182 3300046536 Bacteria 562
635 Ga0495621_0483628 3300046539 Unclassified 533
636 Ga0495645_0000988 3300046543 Bacteria 19388
637 Ga0495645_0119020 3300046543 Bacteria 1861
638 Ga0495645_0120708 3300046543 Bacteria 1845
639 Ga0495667_0113340 3300046559 Bacteria 1752
640 Ga0495667_0254939 3300046559 Bacteria 1116
641 Ga0495667_0295996 3300046559 Bacteria 1026
642 Ga0495667_0402523 3300046559 Bacteria 862
643 Ga0495667_0485417 3300046559 Unclassified 774
644 Ga0495656_0135436 3300046615 Bacteria 1176
645 Ga0495634_0036902 3300046642 Bacteria 3340
646 Ga0495634_0056615 3300046642 Bacteria 2619
647 Ga0495634_0061935 3300046642 Bacteria 2485
648 Ga0495634_0070141 3300046642 Bacteria 2310
649 Ga0495634_0383535 3300046642 Unclassified 837
650 Ga0495634_0678370 3300046642 Unclassified 594
651 Ga0495635_0017484 3300046663 Bacteria 5008
652 Ga0495635_0304861 3300046663 Bacteria 1067
653 Ga0495635_0638355 3300046663 Bacteria 693
654 Ga0495659_0141467 3300046664 Bacteria 961
655 Ga0495657_0010367 3300046675 Bacteria 7013
656 Ga0495657_0018183 3300046675 Bacteria 5092
657 Ga0495657_0408757 3300046675 Unclassified 798
658 Ga0495657_0648035 3300046675 Unclassified 609
659 Ga0495657_0854781 3300046675 Bacteria 518
660 Ga0495599_0001277 3300046678 Bacteria 14305
661 Ga0495599_0002970 3300046678 Bacteria 9872
662 Ga0495623_0004124 3300046679 Bacteria 9576
663 Ga0495646_0010511 3300046680 Bacteria 5880
664 Ga0495646_0010885 3300046680 Bacteria 5777
665 Ga0495646_0323741 3300046680 Bacteria 811
666 Ga0495647_0228303 3300046681 Unclassified 824
667 Ga0495647_0261465 3300046681 Unclassified 772
668 Ga0495647_0310184 3300046681 Bacteria 712
669 Ga0495647_0356351 3300046681 Unclassified 666
670 Ga0495658_0024133 3300046683 Bacteria 3235
671 Ga0495658_0147251 3300046683 Unclassified 1444
672 Ga0495658_0213883 3300046683 Bacteria 1205
673 Ga0495658_0526691 3300046683 Unclassified 756
674 Ga0495613_0097374 3300046689 Bacteria 2126
675 Ga0495613_0362797 3300046689 Bacteria 993
676 Ga0495613_0431194 3300046689 Bacteria 895
677 Ga0495613_0580393 3300046689 Unclassified 747
678 Ga0495624_0009082 3300046690 Bacteria 6897
679 Ga0495624_0324851 3300046690 Bacteria 926
680 Ga0495670_0820989 3300046691 Unclassified 508
681 Ga0495671_0326370 3300046692 Bacteria 737
682 Ga0495600_0006726 3300046809 Bacteria 7008
683 Ga0495581_0073484 3300047315 Bacteria 1978
684 Ga0495581_0529566 3300047315 Unclassified 684
685 Ga0495604_0012690 3300047317 Bacteria 6703
686 Ga0495636_0297975 3300047318 Bacteria 754
687 Ga0495674_0161940 3300047319 Bacteria 1871
688 Ga0495674_0168263 3300047319 Bacteria 1830
689 Ga0495674_0224628 3300047319 Bacteria 1551
690 Ga0495674_0235661 3300047319 Bacteria 1509
691 Ga0495674_0587486 3300047319 Bacteria 883
692 Ga0495674_0706930 3300047319 Unclassified 790
693 Ga0495674_1049500 3300047319 Unclassified 622
694 Ga0495674_1420164 3300047319 Bacteria 516
695 Ga0495676_0060498 3300047321 Bacteria 2967
696 Ga0495676_0158235 3300047321 Bacteria 1605
697 Ga0495676_0209132 3300047321 Bacteria 1351
698 Ga0495676_0307635 3300047321 Bacteria 1067
699 Ga0495676_0597960 3300047321 Unclassified 718
700 Ga0495676_0944601 3300047321 Unclassified 551
701 Ga0495680_0006100 3300047322 Bacteria 11252
702 Ga0495680_0194644 3300047322 Bacteria 1457
703 Ga0495680_0252107 3300047322 Unclassified 1251
704 Ga0495680_0477257 3300047322 Bacteria 850
705 Ga0495680_0694648 3300047322 Unclassified 672
706 Ga0495675_0000809 3300047444 Bacteria 19282
707 Ga0495675_0243922 3300047444 Bacteria 1081
708 Ga0495677_0121939 3300047445 Unclassified 995
709 Ga0495684_0046785 3300047471 Bacteria 3309
710 Ga0495684_0082589 3300047471 Bacteria 2437
711 Ga0495684_0269746 3300047471 Bacteria 1232
712 Ga0495684_0369064 3300047471 Bacteria 1015
713 Ga0495593_0068368 3300047673 Bacteria 1848
714 Ga0495593_0163249 3300047673 Bacteria 1124
715 Ga0495602_0001857 3300048088 Bacteria 21151
716 Ga0495602_0091252 3300048088 Bacteria 2527
717 Ga0495614_0009099 3300048089 Bacteria 4402
718 Ga0496100_0105858 3300048903 Bacteria 1946
719 Ga0496100_0115702 3300048903 Bacteria 1870
720 Ga0496100_0117641 3300048903 Unclassified 1855
721 Ga0496100_0253528 3300048903 Unclassified 1302
722 Ga0496100_0792777 3300048903 Bacteria 742
723 Ga0496100_0863746 3300048903 Unclassified 710
724 Ga0496100_1009048 3300048903 Unclassified 655
725 Ga0496100_1269124 3300048903 Bacteria 581
726 Ga0496101_0024104 3300048904 Bacteria 4209
727 Ga0496101_0088218 3300048904 Bacteria 2303
728 Ga0496101_0206192 3300048904 Bacteria 1521
729 Ga0496101_0307002 3300048904 Bacteria 1243
730 Ga0496101_0459659 3300048904 Unclassified 1004
731 Ga0496101_0811977 3300048904 Bacteria 737
732 Ga0496101_1547787 3300048904 Bacteria 516
733 Ga0496102_0017242 3300048905 Bacteria 6324
734 Ga0496102_0226077 3300048905 Unclassified 1764
735 Ga0496102_0290048 3300048905 Bacteria 1542
736 Ga0496102_0479947 3300048905 Unclassified 1164
737 Ga0496102_1367577 3300048905 Unclassified 627
738 Ga0496103_0012805 3300048906 Bacteria 4974
739 Ga0496103_1050631 3300048906 Unclassified 505
740 Ga0496104_0064535 3300048907 Bacteria 3473
741 Ga0496104_0150006 3300048907 Unclassified 2238
742 Ga0496104_0423921 3300048907 Bacteria 1242
743 Ga0496104_0595201 3300048907 Archaea 1016
744 Ga0496104_0736702 3300048907 Unclassified 893
745 Ga0496104_1030380 3300048907 Unclassified 727
746 Ga0496105_0031205 3300048908 Bacteria 4368
747 Ga0496105_0199502 3300048908 Bacteria 1633
748 Ga0496105_0257819 3300048908 Unclassified 1411
749 Ga0496105_0619102 3300048908 Bacteria 838
750 Ga0496106_0012999 3300048909 Bacteria 6141
751 Ga0496106_0338864 3300048909 Archaea 1207
752 Ga0496106_1341844 3300048909 Bacteria 554
753 Ga0496107_0005142 3300048910 Bacteria 8928
754 Ga0496107_0385608 3300048910 Bacteria 1042
755 Ga0496108_0012844 3300048911 Bacteria 6821
756 Ga0496108_0061399 3300048911 Bacteria 3162
757 Ga0496108_0078793 3300048911 Bacteria 2789
758 Ga0496108_0133200 3300048911 Bacteria 2136
759 Ga0496108_0694735 3300048911 Unclassified 882
760 Ga0496108_0730804 3300048911 Bacteria 857
761 Ga0496108_0801673 3300048911 Bacteria 812
762 Ga0496109_0034832 3300048912 Unclassified 4538
763 Ga0496109_0073842 3300048912 Bacteria 3134
764 Ga0496109_0155672 3300048912 Bacteria 2140
765 Ga0496109_0201436 3300048912 Bacteria 1871
766 Ga0496109_0241351 3300048912 Unclassified 1700
767 Ga0496109_0302125 3300048912 Unclassified 1509
768 Ga0496110_0039901 3300048913 Bacteria 4090
769 Ga0496110_0326317 3300048913 Bacteria 1398
770 Ga0496110_0526511 3300048913 Bacteria 1075
771 Ga0496110_0665963 3300048913 Bacteria 941
772 Ga0496111_0002119 3300048914 Bacteria 11851
773 Ga0496111_0121645 3300048914 Unclassified 1928
774 Ga0496111_0382679 3300048914 Bacteria 1040
775 Ga0496111_0598673 3300048914 Bacteria 807
776 Ga0496112_0015040 3300048915 Bacteria 7203
777 Ga0496112_0043585 3300048915 Bacteria 4393
778 Ga0496112_0059102 3300048915 Bacteria 3777
779 Ga0496112_0082100 3300048915 Unclassified 3188
780 Ga0496112_0123442 3300048915 Bacteria 2561
781 Ga0496112_0196892 3300048915 Unclassified 1975
782 Ga0496112_0207476 3300048915 Bacteria 1917
783 Ga0496112_0652248 3300048915 Unclassified 982
784 Ga0496112_1055089 3300048915 Bacteria 731
785 Ga0496113_0643510 3300048916 Unclassified 848
786 Ga0496113_0738146 3300048916 Bacteria 784
787 Ga0496113_0875561 3300048916 Unclassified 711
788 Ga0496114_0012447 3300048917 Bacteria 6811
789 Ga0496114_0030886 3300048917 Bacteria 4407
790 Ga0496114_0085324 3300048917 Bacteria 2674
791 Ga0496114_0112319 3300048917 Unclassified 2335
792 Ga0496115_0056169 3300048918 Archaea 3164
793 Ga0496115_0161337 3300048918 Bacteria 1852
794 Ga0496115_0197635 3300048918 Unclassified 1661
795 Ga0501032_0511454 3300049569 Bacteria 767
796 Ga0501033_1058100 3300049570 Archaea 541
797 Ga0501034_0877154 3300049571 Unclassified 786
798 Ga0501034_1366071 3300049571 Unclassified 584
799 Ga0501046_0433765 3300049580 Bacteria 946
800 Ga0501047_0258008 3300049581 Bacteria 1591
801 Ga0501047_0325760 3300049581 Bacteria 1375
802 Ga0501047_0470892 3300049581 Bacteria 1084
803 Ga0501047_0987508 3300049581 Unclassified 655
804 Ga0501067_0032576 3300049583 Bacteria 2893
805 Ga0501067_0283683 3300049583 Archaea 922
806 Ga0501067_0359540 3300049583 Bacteria 812
807 Ga0501068_0648445 3300049584 Unclassified 689
808 Ga0501069_0030953 3300049585 Bacteria 2941
809 Ga0501070_0011133 3300049586 Bacteria 7592
810 Ga0501070_0247307 3300049586 Bacteria 1459
811 Ga0501070_0758133 3300049586 Bacteria 764
812 Ga0501070_1158104 3300049586 Bacteria 595
813 Ga0501073_0028986 3300049589 Bacteria 3955
814 Ga0501074_0015662 3300049590 Bacteria 5512
815 Ga0501074_0144568 3300049590 Bacteria 1701
816 Ga0501079_0179805 3300049741 Bacteria 1650
817 Ga0501079_0436811 3300049741 Unclassified 1028
818 Ga0501080_0061138 3300049742 Bacteria 3507
819 Ga0501080_0125186 3300049742 Bacteria 2380
820 Ga0501083_0001476 3300049744 Bacteria 16080
821 Ga0501083_0230237 3300049744 Unclassified 1207
822 Ga0501035_0784477 3300049822 Unclassified 762
823 Ga0501044_0713900 3300049823 Bacteria 887
824 Ga0501044_0763693 3300049823 Unclassified 848
825 Ga0501044_1362192 3300049823 Archaea 575
826 nmdc:mga05p37_469579_c1 3300050507 Unclassified 1452
827 nmdc:mga06r32_1113076_c1 3300050510 Bacteria 738
828 nmdc:mga0n895_1305584_c1 3300050512 Unclassified 696
829 nmdc:mga0n895_64924_c1 3300050512 Unclassified 3612
830 nmdc:mga0n895_75033_c1 3300050512 Bacteria 3361
831 nmdc:mga0rr50_40345_c1 3300050513 Bacteria 3393
832 nmdc:mga0rr50_6584_c1 3300050513 Bacteria 7095
833 nmdc:mga08x19_1064596_c1 3300050514 Archaea 574
834 nmdc:mga08x19_213418_c1 3300050514 Bacteria 1325
835 nmdc:mga0a205_1201227_c1 3300050515 Unclassified 606
836 nmdc:mga0a205_90384_c2 3300050515 Bacteria 1382
837 Ga0495601_0008246 3300053077 Bacteria 6148
838 Ga0495601_0091489 3300053077 Bacteria 1958
839 Ga0495601_0108336 3300053077 Bacteria 1797
840 Ga0495601_0110314 3300053077 Bacteria 1781
841 Ga0495601_0309736 3300053077 Bacteria 1028
842 Ga0495601_0451511 3300053077 Unclassified 831
843 Ga0495601_0459690 3300053077 Unclassified 823
844 Ga0495601_0567748 3300053077 Bacteria 729
845 Ga0495601_0574178 3300053077 Bacteria 725
846 Ga0495601_0633578 3300053077 Unclassified 685
847 Ga0495612_0080389 3300053078 Bacteria 1369
848 Ga0495612_0177212 3300053078 Bacteria 935
849 Ga0495612_0407262 3300053078 Unclassified 618
850 Ga0495595_0049857 3300053084 Bacteria 1937
851 Ga0495595_0273718 3300053084 Unclassified 847
852 Ga0495595_0446177 3300053084 Unclassified 657
853 Ga0495595_0639412 3300053084 Unclassified 544
854 Ga0495619_0000340 3300053085 Bacteria 32830
855 Ga0495619_0023672 3300053085 Bacteria 3939
856 Ga0495619_0178580 3300053085 Bacteria 1469
857 Ga0495619_0242655 3300053085 Bacteria 1248
858 Ga0495619_0362260 3300053085 Bacteria 1002
859 Ga0495619_0555247 3300053085 Bacteria 787
860 Ga0501084_0465079 3300054114 Archaea 1069
861 Ga0587075_054501 3300059644 Bacteria 706
862 Ga0501082_1580540 3300060353 Bacteria 573
863 Ga0501082_1600315 3300060353 Unclassified 569
864 Ga0466962_0000620 3300061719 Bacteria 15733
865 Ga0466962_0000842 3300061719 Bacteria 13849
866 Ga0466962_0028444 3300061719 Bacteria 2678
867 Ga0466962_0044594 3300061719 Bacteria 2121
868 Ga0466962_0236792 3300061719 Bacteria 895
869 Ga0466962_0277150 3300061719 Unclassified 827
870 Ga0466962_0729393 3300061719 Unclassified 509
871 Ga0530510_0289349 3300061734 Bacteria 1225
872 Ga0530510_0820471 3300061734 Bacteria 710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10047409 Ga0265338_100474098 87
2 3300009177 Ga0105248_11051757 Ga0105248_110517572 88
3 3300025941 Ga0207711_11483967 Ga0207711_114839671 88
4 3300028556 Ga0265337_1060553 Ga0265337_10605532 90
5 3300028666 Ga0265336_10017841 Ga0265336_100178414 90
6 3300034820 Ga0373959_0062929 Ga0373959_0062929_393_689 90
7 3300039453 Ga0436362_0023355 Ga0436362_0023355_668_940 90
8 3300044842 Ga0466957_0219858 Ga0466957_0219858_957_1238 90
9 3300046454 Ga0495592_0069096 Ga0495592_0069096_1058_1339 90
10 3300046462 Ga0495651_0094352 Ga0495651_0094352_1819_2100 90
11 3300046516 Ga0495628_0027710 Ga0495628_0027710_2505_2786 90
12 3300046529 Ga0495652_0117810 Ga0495652_0117810_1771_2052 90
13 3300046536 Ga0495587_0239347 Ga0495587_0239347_406_687 90
14 3300046678 Ga0495599_0001277 Ga0495599_0001277_12787_13068 90
15 3300046680 Ga0495646_0010885 Ga0495646_0010885_1238_1519 90
16 3300047319 Ga0495674_0168263 Ga0495674_0168263_1067_1348 90
17 3300047444 Ga0495675_0243922 Ga0495675_0243922_655_936 90
18 3300047471 Ga0495684_0269746 Ga0495684_0269746_163_444 90
19 3300048088 Ga0495602_0091252 Ga0495602_0091252_889_1170 90
20 3300053077 Ga0495601_0108336 Ga0495601_0108336_284_565 90
21 3300053078 Ga0495612_0080389 Ga0495612_0080389_894_1175 90
22 3300005327 Ga0070658_10383887 Ga0070658_103838871 91
23 3300005329 Ga0070683_101700906 Ga0070683_1017009062 91
24 3300005435 Ga0070714_101740666 Ga0070714_1017406661 91
25 3300005458 Ga0070681_10182685 Ga0070681_101826851 91
26 3300005468 Ga0070707_100798702 Ga0070707_1007987022 91
27 3300005471 Ga0070698_100301966 Ga0070698_1003019662 91
28 3300005471 Ga0070698_100973855 Ga0070698_1009738551 91
29 3300005530 Ga0070679_100504805 Ga0070679_1005048052 91
30 3300005535 Ga0070684_100774014 Ga0070684_1007740142 91
31 3300009553 Ga0105249_12661074 Ga0105249_126610742 91
32 3300013105 Ga0157369_11013114 Ga0157369_110131141 91
33 3300013306 Ga0163162_10853232 Ga0163162_108532322 91
34 3300014969 Ga0157376_11238392 Ga0157376_112383922 91
35 3300020069 Ga0197907_11462768 Ga0197907_114627682 91
36 3300020081 Ga0206354_10301111 Ga0206354_103011116 91
37 3300020082 Ga0206353_11253177 Ga0206353_112531772 91
38 3300025909 Ga0207705_10551023 Ga0207705_105510232 91
39 3300025917 Ga0207660_11401922 Ga0207660_114019222 91
40 3300025921 Ga0207652_10528923 Ga0207652_105289232 91
41 3300025926 Ga0207659_11471315 Ga0207659_114713152 91
42 3300025929 Ga0207664_11809616 Ga0207664_118096162 91
43 3300025944 Ga0207661_10116140 Ga0207661_101161402 91
44 3300025944 Ga0207661_10354710 Ga0207661_103547102 91
45 3300026089 Ga0207648_11571287 Ga0207648_115712872 91
46 3300028573 Ga0265334_10114417 Ga0265334_101144172 91
47 3300028577 Ga0265318_10032382 Ga0265318_100323822 91
48 3300028800 Ga0265338_10003515 Ga0265338_1000351513 91
49 3300028800 Ga0265338_10009802 Ga0265338_100098029 91
50 3300028800 Ga0265338_10044099 Ga0265338_100440998 91
51 3300031235 Ga0265330_10099369 Ga0265330_100993692 91
52 3300031238 Ga0265332_10028012 Ga0265332_100280124 91
53 3300031241 Ga0265325_10018923 Ga0265325_100189236 91
54 3300031242 Ga0265329_10090670 Ga0265329_100906702 91
55 3300031247 Ga0265340_10490417 Ga0265340_104904172 91
56 3300031251 Ga0265327_10004489 Ga0265327_100044896 91
57 3300031251 Ga0265327_10354442 Ga0265327_103544422 91
58 3300031344 Ga0265316_10105558 Ga0265316_101055582 91
59 3300031595 Ga0265313_10066148 Ga0265313_100661482 91
60 3300031711 Ga0265314_10086718 Ga0265314_100867182 91
61 3300031712 Ga0265342_10384072 Ga0265342_103840722 91
62 3300032133 Ga0316583_10157755 Ga0316583_101577552 91
63 3300037418 Ga0395900_0896768 Ga0395900_0896768_469_747 91
64 3300037418 Ga0395900_1352527 Ga0395900_1352527_21_302 91
65 3300038443 Ga0395901_0440504 Ga0395901_0440504_520_801 91
66 3300038443 Ga0395901_0696359 Ga0395901_0696359_254_532 91
67 3300038443 Ga0395901_0954329 Ga0395901_0954329_79_354 91
68 3300039437 Ga0436365_1190190 Ga0436365_1190190_218_493 91
69 3300039437 Ga0436365_1505933 Ga0436365_1505933_31_306 91
70 3300044693 Ga0466961_0826467 Ga0466961_0826467_138_413 91
71 3300044694 Ga0466963_0008754 Ga0466963_0008754_591_866 91
72 3300044842 Ga0466957_0469353 Ga0466957_0469353_166_441 91
73 3300045976 Ga0466967_1923499 Ga0466967_1923499_32_307 91
74 3300053077 Ga0495601_0633578 Ga0495601_0633578_126_413 91
75 3300005327 Ga0070658_10170777 Ga0070658_101707771 92
76 3300005327 Ga0070658_10706052 Ga0070658_107060522 92
77 3300005329 Ga0070683_101116101 Ga0070683_1011161012 92
78 3300005336 Ga0070680_100150818 Ga0070680_1001508183 92
79 3300005336 Ga0070680_100536159 Ga0070680_1005361592 92
80 3300005336 Ga0070680_101315747 Ga0070680_1013157472 92
81 3300005337 Ga0070682_100013765 Ga0070682_1000137652 92
82 3300005339 Ga0070660_100935263 Ga0070660_1009352632 92
83 3300005344 Ga0070661_100558665 Ga0070661_1005586651 92
84 3300005345 Ga0070692_10961010 Ga0070692_109610102 92
85 3300005355 Ga0070671_100034184 Ga0070671_1000341845 92
86 3300005366 Ga0070659_100555076 Ga0070659_1005550762 92
87 3300005366 Ga0070659_101043479 Ga0070659_1010434792 92
88 3300005434 Ga0070709_10245795 Ga0070709_102457952 92
89 3300005435 Ga0070714_100340116 Ga0070714_1003401162 92
90 3300005436 Ga0070713_101565409 Ga0070713_1015654092 92
91 3300005439 Ga0070711_101284536 Ga0070711_1012845361 92
92 3300005445 Ga0070708_100468967 Ga0070708_1004689672 92
93 3300005455 Ga0070663_101355499 Ga0070663_1013554992 92
94 3300005458 Ga0070681_10177585 Ga0070681_101775853 92
95 3300005458 Ga0070681_10197498 Ga0070681_101974983 92
96 3300005467 Ga0070706_102014070 Ga0070706_1020140702 92
97 3300005467 Ga0070706_102022873 Ga0070706_1020228732 92
98 3300005468 Ga0070707_100061249 Ga0070707_1000612492 92
99 3300005471 Ga0070698_100290667 Ga0070698_1002906672 92
100 3300005518 Ga0070699_101054327 Ga0070699_1010543272 92
101 3300005530 Ga0070679_100317396 Ga0070679_1003173962 92
102 3300005530 Ga0070679_100903806 Ga0070679_1009038062 92
103 3300005535 Ga0070684_100252548 Ga0070684_1002525482 92
104 3300005563 Ga0068855_101096172 Ga0068855_1010961722 92
105 3300005578 Ga0068854_101948201 Ga0068854_1019482012 92
106 3300005616 Ga0068852_100095164 Ga0068852_1000951644 92
107 3300005718 Ga0068866_10354110 Ga0068866_103541102 92
108 3300005841 Ga0068863_100591462 Ga0068863_1005914622 92
109 3300006847 Ga0075431_100955925 Ga0075431_1009559252 92
110 3300006914 Ga0075436_100545433 Ga0075436_1005454332 92
111 3300009094 Ga0111539_10303782 Ga0111539_103037822 92
112 3300009148 Ga0105243_11348675 Ga0105243_113486752 92
113 3300009174 Ga0105241_12688771 Ga0105241_126887712 92
114 3300009545 Ga0105237_12109908 Ga0105237_121099082 92
115 3300009551 Ga0105238_11159050 Ga0105238_111590502 92
116 3300012485 Ga0157325_1009929 Ga0157325_10099292 92
117 3300012507 Ga0157342_1047625 Ga0157342_10476252 92
118 3300012512 Ga0157327_1017263 Ga0157327_10172632 92
119 3300013102 Ga0157371_11212729 Ga0157371_112127292 92
120 3300013307 Ga0157372_10345161 Ga0157372_103451612 92
121 3300014745 Ga0157377_11149008 Ga0157377_111490082 92
122 3300015265 Ga0182005_1287864 Ga0182005_12878642 92
123 3300020070 Ga0206356_10254714 Ga0206356_102547142 92
124 3300020081 Ga0206354_11109484 Ga0206354_111094842 92
125 3300020082 Ga0206353_11136966 Ga0206353_111369662 92
126 3300025909 Ga0207705_10138541 Ga0207705_101385413 92
127 3300025912 Ga0207707_10131937 Ga0207707_101319372 92
128 3300025912 Ga0207707_10151294 Ga0207707_101512942 92
129 3300025912 Ga0207707_10439253 Ga0207707_104392532 92
130 3300025916 Ga0207663_10597325 Ga0207663_105973252 92
131 3300025917 Ga0207660_10033381 Ga0207660_100333812 92
132 3300025919 Ga0207657_10044826 Ga0207657_100448262 92
133 3300025920 Ga0207649_11287647 Ga0207649_112876472 92
134 3300025921 Ga0207652_10291925 Ga0207652_102919252 92
135 3300025921 Ga0207652_10806233 Ga0207652_108062332 92
136 3300025922 Ga0207646_10356640 Ga0207646_103566402 92
137 3300025929 Ga0207664_10001609 Ga0207664_1000160910 92
138 3300025931 Ga0207644_11743499 Ga0207644_117434992 92
139 3300025932 Ga0207690_10102201 Ga0207690_101022012 92
140 3300025932 Ga0207690_11033481 Ga0207690_110334812 92
141 3300025944 Ga0207661_11537765 Ga0207661_115377652 92
142 3300025981 Ga0207640_10636946 Ga0207640_106369462 92
143 3300026067 Ga0207678_11335814 Ga0207678_113358142 92
144 3300028573 Ga0265334_10025424 Ga0265334_100254243 92
145 3300028654 Ga0265322_10034572 Ga0265322_100345722 92
146 3300031251 Ga0265327_10027140 Ga0265327_100271404 92
147 3300031595 Ga0265313_10007235 Ga0265313_100072358 92
148 3300032133 Ga0316583_10244609 Ga0316583_102446092 92
149 3300035410 Ga0373924_0522235 Ga0373924_0522235_181_459 92
150 3300037312 Ga0395899_0070021 Ga0395899_0070021_281_559 92
151 3300037312 Ga0395899_0215897 Ga0395899_0215897_221_499 92
152 3300037418 Ga0395900_0319831 Ga0395900_0319831_1151_1429 92
153 3300037418 Ga0395900_0727276 Ga0395900_0727276_597_875 92
154 3300037466 Ga0395898_0038648 Ga0395898_0038648_2968_3246 92
155 3300037471 Ga0395905_0043423 Ga0395905_0043423_2789_3067 92
156 3300038443 Ga0395901_0691525 Ga0395901_0691525_575_853 92
157 3300038443 Ga0395901_1228699 Ga0395901_1228699_220_498 92
158 3300039438 Ga0436360_0797120 Ga0436360_0797120_667_960 92
159 3300042005 Ga0439448_0108015 Ga0439448_0108015_227_505 92
160 3300044673 Ga0453683_0392787 Ga0453683_0392787_115_393 92
161 3300044694 Ga0466963_0547778 Ga0466963_0547778_73_351 92
162 3300044706 Ga0466964_0749754 Ga0466964_0749754_122_400 92
163 3300045049 Ga0466959_0494639 Ga0466959_0494639_354_632 92
164 3300045976 Ga0466967_0138966 Ga0466967_0138966_1908_2186 92
165 3300046459 Ga0495629_0079401 Ga0495629_0079401_930_1208 92
166 3300046511 Ga0495608_0372557 Ga0495608_0372557_153_431 92
167 3300046514 Ga0495618_0847597 Ga0495618_0847597_150_428 92
168 3300046517 Ga0495630_0124145 Ga0495630_0124145_177_455 92
169 3300046517 Ga0495630_0803942 Ga0495630_0803942_393_671 92
170 3300046517 Ga0495630_1361752 Ga0495630_1361752_127_405 92
171 3300046531 Ga0495665_0331054 Ga0495665_0331054_189_467 92
172 3300046533 Ga0495640_0253664 Ga0495640_0253664_174_452 92
173 3300046559 Ga0495667_0113340 Ga0495667_0113340_1059_1337 92
174 3300046663 Ga0495635_0017484 Ga0495635_0017484_3877_4155 92
175 3300046675 Ga0495657_0408757 Ga0495657_0408757_371_649 92
176 3300046675 Ga0495657_0648035 Ga0495657_0648035_22_300 92
177 3300046689 Ga0495613_0362797 Ga0495613_0362797_251_529 92
178 3300046691 Ga0495670_0820989 Ga0495670_0820989_153_431 92
179 3300047315 Ga0495581_0529566 Ga0495581_0529566_176_454 92
180 3300047319 Ga0495674_1420164 Ga0495674_1420164_13_291 92
181 3300047321 Ga0495676_0944601 Ga0495676_0944601_143_421 92
182 3300047322 Ga0495680_0477257 Ga0495680_0477257_175_453 92
183 3300047471 Ga0495684_0369064 Ga0495684_0369064_459_737 92
184 3300047673 Ga0495593_0163249 Ga0495593_0163249_29_307 92
185 3300048915 Ga0496112_0015040 Ga0496112_0015040_2983_3261 92
186 3300048915 Ga0496112_0043585 Ga0496112_0043585_1369_1647 92
187 3300048915 Ga0496112_0207476 Ga0496112_0207476_1159_1437 92
188 3300048916 Ga0496113_0643510 Ga0496113_0643510_107_385 92
189 3300049570 Ga0501033_1058100 Ga0501033_1058100_121_399 92
190 3300049571 Ga0501034_1366071 Ga0501034_1366071_55_333 92
191 3300049581 Ga0501047_0325760 Ga0501047_0325760_898_1176 92
192 3300049583 Ga0501067_0359540 Ga0501067_0359540_142_420 92
193 3300049584 Ga0501068_0648445 Ga0501068_0648445_82_360 92
194 3300049741 Ga0501079_0436811 Ga0501079_0436811_299_577 92
195 3300049742 Ga0501080_0061138 Ga0501080_0061138_3206_3484 92
196 3300049744 Ga0501083_0230237 Ga0501083_0230237_322_600 92
197 3300049823 Ga0501044_0763693 Ga0501044_0763693_300_578 92
198 3300050507 nmdc:mga05p37_469579_c1 nmdc:mga05p37_469579_c1_669_947 92
199 3300050510 nmdc:mga06r32_1113076_c1 nmdc:mga06r32_1113076_c1_349_627 92
200 3300050512 nmdc:mga0n895_1305584_c1 nmdc:mga0n895_1305584_c1_268_546 92
201 3300050515 nmdc:mga0a205_90384_c2 nmdc:mga0a205_90384_c2_176_454 92
202 3300053077 Ga0495601_0459690 Ga0495601_0459690_128_406 92
203 3300053084 Ga0495595_0273718 Ga0495595_0273718_516_794 92
204 3300053085 Ga0495619_0023672 Ga0495619_0023672_106_384 92
205 3300053085 Ga0495619_0178580 Ga0495619_0178580_604_882 92
206 3300060353 Ga0501082_1580540 Ga0501082_1580540_88_369 92
207 3300060353 Ga0501082_1600315 Ga0501082_1600315_65_343 92
208 3300061734 Ga0530510_0820471 Ga0530510_0820471_154_432 92
209 3300005329 Ga0070683_101942035 Ga0070683_1019420352 93
210 3300005336 Ga0070680_100239043 Ga0070680_1002390432 93
211 3300005336 Ga0070680_100266248 Ga0070680_1002662483 93
212 3300005336 Ga0070680_100573625 Ga0070680_1005736252 93
213 3300005336 Ga0070680_101632286 Ga0070680_1016322862 93
214 3300005337 Ga0070682_100281338 Ga0070682_1002813382 93
215 3300005337 Ga0070682_101956658 Ga0070682_1019566582 93
216 3300005338 Ga0068868_100159779 Ga0068868_1001597793 93
217 3300005354 Ga0070675_101617159 Ga0070675_1016171592 93
218 3300005434 Ga0070709_10034391 Ga0070709_100343912 93
219 3300005434 Ga0070709_10769327 Ga0070709_107693272 93
220 3300005435 Ga0070714_100040084 Ga0070714_1000400842 93
221 3300005435 Ga0070714_100085136 Ga0070714_1000851364 93
222 3300005435 Ga0070714_100277024 Ga0070714_1002770243 93
223 3300005435 Ga0070714_100322262 Ga0070714_1003222622 93
224 3300005435 Ga0070714_100613220 Ga0070714_1006132202 93
225 3300005435 Ga0070714_101599301 Ga0070714_1015993012 93
226 3300005436 Ga0070713_100050722 Ga0070713_1000507226 93
227 3300005436 Ga0070713_100084771 Ga0070713_1000847714 93
228 3300005436 Ga0070713_100134397 Ga0070713_1001343974 93
229 3300005437 Ga0070710_10015854 Ga0070710_100158542 93
230 3300005437 Ga0070710_10017530 Ga0070710_100175302 93
231 3300005437 Ga0070710_10748958 Ga0070710_107489581 93
232 3300005439 Ga0070711_100026065 Ga0070711_1000260655 93
233 3300005439 Ga0070711_100034412 Ga0070711_1000344123 93
234 3300005440 Ga0070705_100958373 Ga0070705_1009583732 93
235 3300005444 Ga0070694_101411123 Ga0070694_1014111231 93
236 3300005445 Ga0070708_101502300 Ga0070708_1015023001 93
237 3300005456 Ga0070678_101835749 Ga0070678_1018357492 93
238 3300005457 Ga0070662_100726056 Ga0070662_1007260562 93
239 3300005458 Ga0070681_10375886 Ga0070681_103758862 93
240 3300005466 Ga0070685_11227182 Ga0070685_112271822 93
241 3300005530 Ga0070679_100160799 Ga0070679_1001607992 93
242 3300005535 Ga0070684_100314314 Ga0070684_1003143142 93
243 3300005535 Ga0070684_100773928 Ga0070684_1007739282 93
244 3300005545 Ga0070695_100000001 Ga0070695_100000001144 93
245 3300005547 Ga0070693_100256844 Ga0070693_1002568442 93
246 3300005547 Ga0070693_100507254 Ga0070693_1005072542 93
247 3300005548 Ga0070665_101625712 Ga0070665_1016257122 93
248 3300005549 Ga0070704_100278161 Ga0070704_1002781612 93
249 3300005563 Ga0068855_101248940 Ga0068855_1012489402 93
250 3300005937 Ga0081455_10081052 Ga0081455_100810522 93
251 3300006028 Ga0070717_10001309 Ga0070717_1000130927 93
252 3300006028 Ga0070717_10030492 Ga0070717_100304928 93
253 3300006028 Ga0070717_10101105 Ga0070717_101011054 93
254 3300006028 Ga0070717_10575896 Ga0070717_105758962 93
255 3300006163 Ga0070715_10000128 Ga0070715_100001282 93
256 3300006163 Ga0070715_10413476 Ga0070715_104134761 93
257 3300006173 Ga0070716_100053160 Ga0070716_1000531604 93
258 3300006237 Ga0097621_101495899 Ga0097621_1014958992 93
259 3300006852 Ga0075433_10784797 Ga0075433_107847972 93
260 3300006871 Ga0075434_100068175 Ga0075434_1000681752 93
261 3300006871 Ga0075434_100958861 Ga0075434_1009588612 93
262 3300006881 Ga0068865_101221006 Ga0068865_1012210062 93
263 3300006914 Ga0075436_100983602 Ga0075436_1009836022 93
264 3300007076 Ga0075435_100018465 Ga0075435_1000184654 93
265 3300009011 Ga0105251_10192717 Ga0105251_101927172 93
266 3300009036 Ga0105244_10363702 Ga0105244_103637022 93
267 3300009093 Ga0105240_10370482 Ga0105240_103704822 93
268 3300009098 Ga0105245_10106987 Ga0105245_101069872 93
269 3300009098 Ga0105245_10572474 Ga0105245_105724741 93
270 3300009101 Ga0105247_10108687 Ga0105247_101086872 93
271 3300009176 Ga0105242_11191433 Ga0105242_111914332 93
272 3300009176 Ga0105242_11976149 Ga0105242_119761492 93
273 3300009177 Ga0105248_11045812 Ga0105248_110458121 93
274 3300009545 Ga0105237_10884010 Ga0105237_108840102 93
275 3300009545 Ga0105237_12303676 Ga0105237_123036761 93
276 3300009553 Ga0105249_11090214 Ga0105249_110902142 93
277 3300012488 Ga0157343_1027074 Ga0157343_10270742 93
278 3300012515 Ga0157338_1021715 Ga0157338_10217152 93
279 3300013105 Ga0157369_10835163 Ga0157369_108351632 93
280 3300013296 Ga0157374_12931549 Ga0157374_129315491 93
281 3300013306 Ga0163162_11664315 Ga0163162_116643152 93
282 3300013307 Ga0157372_10028900 Ga0157372_100289002 93
283 3300014325 Ga0163163_10936059 Ga0163163_109360592 93
284 3300014497 Ga0182008_10236797 Ga0182008_102367972 93
285 3300014968 Ga0157379_10519000 Ga0157379_105190002 93
286 3300015261 Ga0182006_1099328 Ga0182006_10993282 93
287 3300015262 Ga0182007_10227678 Ga0182007_102276782 93
288 3300020069 Ga0197907_11460375 Ga0197907_114603752 93
289 3300020082 Ga0206353_11574996 Ga0206353_115749962 93
290 3300025885 Ga0207653_10336738 Ga0207653_103367381 93
291 3300025898 Ga0207692_10009582 Ga0207692_100095822 93
292 3300025898 Ga0207692_10027645 Ga0207692_100276454 93
293 3300025900 Ga0207710_10175205 Ga0207710_101752052 93
294 3300025905 Ga0207685_10094627 Ga0207685_100946272 93
295 3300025905 Ga0207685_10290775 Ga0207685_102907752 93
296 3300025906 Ga0207699_10016080 Ga0207699_100160803 93
297 3300025909 Ga0207705_10537376 Ga0207705_105373762 93
298 3300025911 Ga0207654_10330308 Ga0207654_103303082 93
299 3300025913 Ga0207695_10043452 Ga0207695_100434524 93
300 3300025914 Ga0207671_10786221 Ga0207671_107862212 93
301 3300025915 Ga0207693_10002202 Ga0207693_1000220227 93
302 3300025915 Ga0207693_10135217 Ga0207693_101352174 93
303 3300025916 Ga0207663_10003571 Ga0207663_100035712 93
304 3300025916 Ga0207663_10019761 Ga0207663_100197615 93
305 3300025917 Ga0207660_10056430 Ga0207660_100564302 93
306 3300025917 Ga0207660_10380568 Ga0207660_103805682 93
307 3300025918 Ga0207662_10494781 Ga0207662_104947812 93
308 3300025919 Ga0207657_10201819 Ga0207657_102018191 93
309 3300025921 Ga0207652_10101655 Ga0207652_101016552 93
310 3300025921 Ga0207652_10896633 Ga0207652_108966332 93
311 3300025921 Ga0207652_11188861 Ga0207652_111888612 93
312 3300025927 Ga0207687_10146153 Ga0207687_101461534 93
313 3300025927 Ga0207687_10505718 Ga0207687_105057183 93
314 3300025928 Ga0207700_10036475 Ga0207700_100364752 93
315 3300025928 Ga0207700_10420219 Ga0207700_104202192 93
316 3300025929 Ga0207664_10004974 Ga0207664_1000497412 93
317 3300025929 Ga0207664_10460075 Ga0207664_104600752 93
318 3300025929 Ga0207664_10477977 Ga0207664_104779773 93
319 3300025929 Ga0207664_11040651 Ga0207664_110406511 93
320 3300025929 Ga0207664_11752494 Ga0207664_117524942 93
321 3300025931 Ga0207644_10308682 Ga0207644_103086822 93
322 3300025931 Ga0207644_11724278 Ga0207644_117242782 93
323 3300025933 Ga0207706_10803108 Ga0207706_108031082 93
324 3300025938 Ga0207704_10229245 Ga0207704_102292453 93
325 3300025939 Ga0207665_10001140 Ga0207665_100011402 93
326 3300025941 Ga0207711_10716038 Ga0207711_107160382 93
327 3300025944 Ga0207661_10916739 Ga0207661_109167392 93
328 3300025961 Ga0207712_11785080 Ga0207712_117850802 93
329 3300026035 Ga0207703_11828374 Ga0207703_118283742 93
330 3300026041 Ga0207639_11025116 Ga0207639_110251162 93
331 3300026067 Ga0207678_10741938 Ga0207678_107419382 93
332 3300026078 Ga0207702_10066346 Ga0207702_100663462 93
333 3300026095 Ga0207676_10459705 Ga0207676_104597052 93
334 3300026121 Ga0207683_11349474 Ga0207683_113494742 93
335 3300026142 Ga0207698_10959231 Ga0207698_109592312 93
336 3300028666 Ga0265336_10075832 Ga0265336_100758322 93
337 3300031731 Ga0307405_10713404 Ga0307405_107134041 93
338 3300031903 Ga0307407_11353387 Ga0307407_113533872 93
339 3300031995 Ga0307409_100230655 Ga0307409_1002306552 93
340 3300032002 Ga0307416_100576903 Ga0307416_1005769031 93
341 3300032126 Ga0307415_100361217 Ga0307415_1003612172 93
342 3300034817 Ga0373948_0105794 Ga0373948_0105794_148_429 93
343 3300034817 Ga0373948_0107953 Ga0373948_0107953_120_416 93
344 3300034957 Ga0373938_0032742 Ga0373938_0032742_554_835 93
345 3300035083 Ga0373926_0047449 Ga0373926_0047449_446_727 93
346 3300035083 Ga0373926_0049612 Ga0373926_0049612_78_365 93
347 3300035084 Ga0373928_0020857 Ga0373928_0020857_202_486 93
348 3300035085 Ga0373929_0061945 Ga0373929_0061945_167_448 93
349 3300035086 Ga0373934_0359379 Ga0373934_0359379_97_378 93
350 3300035088 Ga0373940_0053404 Ga0373940_0053404_273_554 93
351 3300035089 Ga0373944_0410587 Ga0373944_0410587_52_333 93
352 3300035092 Ga0373952_0290234 Ga0373952_0290234_66_353 93
353 3300035116 Ga0373945_0014009 Ga0373945_0014009_1418_1705 93
354 3300035116 Ga0373945_0029445 Ga0373945_0029445_410_691 93
355 3300035170 Ga0373943_0015268 Ga0373943_0015268_1636_1923 93
356 3300035170 Ga0373943_0686444 Ga0373943_0686444_49_339 93
357 3300035171 Ga0373946_0026705 Ga0373946_0026705_1080_1361 93
358 3300035410 Ga0373924_0425623 Ga0373924_0425623_293_574 93
359 3300035691 Ga0373931_0068548 Ga0373931_0068548_559_840 93
360 3300035692 Ga0373935_0067291 Ga0373935_0067291_1494_1781 93
361 3300035692 Ga0373935_0381878 Ga0373935_0381878_520_801 93
362 3300035695 Ga0373927_0046932 Ga0373927_0046932_2417_2698 93
363 3300035725 Ga0373947_0012958 Ga0373947_0012958_3343_3624 93
364 3300035725 Ga0373947_0082679 Ga0373947_0082679_1667_1954 93
365 3300037068 Ga0373925_0009943 Ga0373925_0009943_4703_4990 93
366 3300037068 Ga0373925_0029959 Ga0373925_0029959_1626_1907 93
367 3300037312 Ga0395899_0936207 Ga0395899_0936207_58_342 93
368 3300037418 Ga0395900_0076531 Ga0395900_0076531_2671_2955 93
369 3300037418 Ga0395900_0112617 Ga0395900_0112617_1944_2231 93
370 3300037418 Ga0395900_0879655 Ga0395900_0879655_117_404 93
371 3300037418 Ga0395900_1010427 Ga0395900_1010427_420_704 93
372 3300037466 Ga0395898_0096858 Ga0395898_0096858_73_357 93
373 3300037466 Ga0395898_0581555 Ga0395898_0581555_705_989 93
374 3300037466 Ga0395898_1269438 Ga0395898_1269438_217_504 93
375 3300037471 Ga0395905_0354707 Ga0395905_0354707_251_538 93
376 3300038443 Ga0395901_0822598 Ga0395901_0822598_220_507 93
377 3300038443 Ga0395901_0969441 Ga0395901_0969441_24_311 93
378 3300039450 Ga0436363_0947939 Ga0436363_0947939_91_372 93
379 3300039450 Ga0436363_1605281 Ga0436363_1605281_785_1075 93
380 3300041452 Ga0451793_1601599 Ga0451793_1601599_183_464 93
381 3300041459 Ga0451800_0468417 Ga0451800_0468417_194_475 93
382 3300041501 Ga0451845_0708858 Ga0451845_0708858_428_715 93
383 3300041507 Ga0451851_1210558 Ga0451851_1210558_258_539 93
384 3300044656 Ga0466969_0019346 Ga0466969_0019346_1438_1728 93
385 3300044656 Ga0466969_0023023 Ga0466969_0023023_480_779 93
386 3300044683 Ga0466965_0243892 Ga0466965_0243892_128_418 93
387 3300044684 Ga0466966_0119824 Ga0466966_0119824_701_982 93
388 3300044684 Ga0466966_0216779 Ga0466966_0216779_464_754 93
389 3300044684 Ga0466966_0706156 Ga0466966_0706156_126_431 93
390 3300044684 Ga0466966_0909745 Ga0466966_0909745_181_480 93
391 3300044693 Ga0466961_0020838 Ga0466961_0020838_3740_4039 93
392 3300044693 Ga0466961_0209881 Ga0466961_0209881_358_648 93
393 3300044693 Ga0466961_0215387 Ga0466961_0215387_230_511 93
394 3300044693 Ga0466961_0269262 Ga0466961_0269262_263_553 93
395 3300044693 Ga0466961_0679850 Ga0466961_0679850_102_407 93
396 3300044693 Ga0466961_0744289 Ga0466961_0744289_36_326 93
397 3300044694 Ga0466963_0006203 Ga0466963_0006203_1820_2101 93
398 3300044694 Ga0466963_0015154 Ga0466963_0015154_1707_1988 93
399 3300044694 Ga0466963_0021769 Ga0466963_0021769_3673_3963 93
400 3300044694 Ga0466963_0033491 Ga0466963_0033491_1833_2123 93
401 3300044694 Ga0466963_0038785 Ga0466963_0038785_380_670 93
402 3300044694 Ga0466963_0079127 Ga0466963_0079127_262_543 93
403 3300044694 Ga0466963_0089585 Ga0466963_0089585_913_1203 93
404 3300044694 Ga0466963_0124090 Ga0466963_0124090_813_1094 93
405 3300044694 Ga0466963_0151220 Ga0466963_0151220_1043_1342 93
406 3300044694 Ga0466963_0431417 Ga0466963_0431417_308_589 93
407 3300044706 Ga0466964_0000606 Ga0466964_0000606_9959_10249 93
408 3300044706 Ga0466964_0078933 Ga0466964_0078933_636_926 93
409 3300044706 Ga0466964_0163420 Ga0466964_0163420_453_743 93
410 3300044706 Ga0466964_0174304 Ga0466964_0174304_299_586 93
411 3300044706 Ga0466964_0233796 Ga0466964_0233796_315_599 93
412 3300044706 Ga0466964_0239476 Ga0466964_0239476_418_708 93
413 3300044719 Ga0466971_0006232 Ga0466971_0006232_209_508 93
414 3300044719 Ga0466971_0163313 Ga0466971_0163313_443_733 93
415 3300044735 Ga0466968_0002271 Ga0466968_0002271_3165_3455 93
416 3300044735 Ga0466968_0004485 Ga0466968_0004485_4865_5146 93
417 3300044735 Ga0466968_0005377 Ga0466968_0005377_2309_2590 93
418 3300044735 Ga0466968_0074794 Ga0466968_0074794_215_496 93
419 3300044735 Ga0466968_0291978 Ga0466968_0291978_100_381 93
420 3300044765 Ga0466970_0005237 Ga0466970_0005237_3192_3482 93
421 3300044765 Ga0466970_0176783 Ga0466970_0176783_505_795 93
422 3300044842 Ga0466957_0005092 Ga0466957_0005092_4667_4966 93
423 3300044842 Ga0466957_0090892 Ga0466957_0090892_1208_1498 93
424 3300044842 Ga0466957_0214946 Ga0466957_0214946_357_647 93
425 3300044842 Ga0466957_0270103 Ga0466957_0270103_152_433 93
426 3300044842 Ga0466957_0376391 Ga0466957_0376391_12_302 93
427 3300044842 Ga0466957_0488315 Ga0466957_0488315_273_563 93
428 3300044901 Ga0466960_0080835 Ga0466960_0080835_900_1190 93
429 3300044901 Ga0466960_0309226 Ga0466960_0309226_235_525 93
430 3300044901 Ga0466960_0343511 Ga0466960_0343511_163_444 93
431 3300045049 Ga0466959_0014657 Ga0466959_0014657_2669_2959 93
432 3300045049 Ga0466959_0050671 Ga0466959_0050671_309_608 93
433 3300045049 Ga0466959_0166867 Ga0466959_0166867_1117_1407 93
434 3300045049 Ga0466959_0319057 Ga0466959_0319057_329_619 93
435 3300045049 Ga0466959_0710541 Ga0466959_0710541_213_494 93
436 3300045836 Ga0466958_0018517 Ga0466958_0018517_808_1107 93
437 3300045836 Ga0466958_0037941 Ga0466958_0037941_2023_2313 93
438 3300045836 Ga0466958_0065609 Ga0466958_0065609_1257_1547 93
439 3300045836 Ga0466958_0129652 Ga0466958_0129652_443_733 93
440 3300045836 Ga0466958_0459286 Ga0466958_0459286_510_800 93
441 3300045836 Ga0466958_0487546 Ga0466958_0487546_344_625 93
442 3300045836 Ga0466958_0567733 Ga0466958_0567733_346_627 93
443 3300045836 Ga0466958_0730568 Ga0466958_0730568_194_475 93
444 3300045836 Ga0466958_0772406 Ga0466958_0772406_59_340 93
445 3300045976 Ga0466967_0006945 Ga0466967_0006945_2378_2668 93
446 3300045976 Ga0466967_0016687 Ga0466967_0016687_3803_4087 93
447 3300045976 Ga0466967_0018925 Ga0466967_0018925_2214_2495 93
448 3300045976 Ga0466967_0045118 Ga0466967_0045118_1218_1499 93
449 3300045976 Ga0466967_0054010 Ga0466967_0054010_165_455 93
450 3300045976 Ga0466967_0072616 Ga0466967_0072616_1789_2070 93
451 3300045976 Ga0466967_0250297 Ga0466967_0250297_1075_1365 93
452 3300045976 Ga0466967_0593718 Ga0466967_0593718_165_455 93
453 3300045976 Ga0466967_0627841 Ga0466967_0627841_505_786 93
454 3300045976 Ga0466967_0821205 Ga0466967_0821205_152_433 93
455 3300045976 Ga0466967_0894264 Ga0466967_0894264_98_379 93
456 3300045976 Ga0466967_1588114 Ga0466967_1588114_248_538 93
457 3300045976 Ga0466967_1726847 Ga0466967_1726847_256_537 93
458 3300045976 Ga0466967_2154927 Ga0466967_2154927_205_495 93
459 3300046455 Ga0495603_0349596 Ga0495603_0349596_281_571 93
460 3300046459 Ga0495629_0093246 Ga0495629_0093246_1806_2087 93
461 3300046459 Ga0495629_0169497 Ga0495629_0169497_484_765 93
462 3300046459 Ga0495629_0839677 Ga0495629_0839677_197_487 93
463 3300046461 Ga0495641_0046020 Ga0495641_0046020_823_1110 93
464 3300046461 Ga0495641_0069451 Ga0495641_0069451_679_969 93
465 3300046461 Ga0495641_0102256 Ga0495641_0102256_609_890 93
466 3300046463 Ga0495653_0264193 Ga0495653_0264193_567_848 93
467 3300046473 Ga0495582_0133510 Ga0495582_0133510_881_1162 93
468 3300046476 Ga0495662_0034643 Ga0495662_0034643_603_884 93
469 3300046476 Ga0495662_0343754 Ga0495662_0343754_177_458 93
470 3300046477 Ga0495664_0312755 Ga0495664_0312755_56_337 93
471 3300046514 Ga0495618_0112890 Ga0495618_0112890_862_1143 93
472 3300046514 Ga0495618_0308767 Ga0495618_0308767_501_782 93
473 3300046514 Ga0495618_0658808 Ga0495618_0658808_122_403 93
474 3300046516 Ga0495628_0735417 Ga0495628_0735417_243_524 93
475 3300046517 Ga0495630_0003475 Ga0495630_0003475_10170_10451 93
476 3300046517 Ga0495630_0023872 Ga0495630_0023872_36_317 93
477 3300046517 Ga0495630_0108360 Ga0495630_0108360_520_807 93
478 3300046517 Ga0495630_0273116 Ga0495630_0273116_513_794 93
479 3300046517 Ga0495630_0660431 Ga0495630_0660431_433_714 93
480 3300046517 Ga0495630_0667828 Ga0495630_0667828_235_525 93
481 3300046517 Ga0495630_0765747 Ga0495630_0765747_164_445 93
482 3300046526 Ga0495666_0035611 Ga0495666_0035611_513_794 93
483 3300046529 Ga0495652_0283324 Ga0495652_0283324_554_835 93
484 3300046529 Ga0495652_0356584 Ga0495652_0356584_537_848 93
485 3300046531 Ga0495665_0013588 Ga0495665_0013588_1503_1784 93
486 3300046531 Ga0495665_0297262 Ga0495665_0297262_407_694 93
487 3300046533 Ga0495640_0058821 Ga0495640_0058821_2289_2579 93
488 3300046533 Ga0495640_0099935 Ga0495640_0099935_468_749 93
489 3300046535 Ga0495586_0016645 Ga0495586_0016645_313_594 93
490 3300046535 Ga0495586_0283341 Ga0495586_0283341_66_347 93
491 3300046535 Ga0495586_0396117 Ga0495586_0396117_17_298 93
492 3300046535 Ga0495586_0439234 Ga0495586_0439234_245_535 93
493 3300046539 Ga0495621_0483628 Ga0495621_0483628_186_473 93
494 3300046559 Ga0495667_0295996 Ga0495667_0295996_100_411 93
495 3300046559 Ga0495667_0402523 Ga0495667_0402523_265_546 93
496 3300046642 Ga0495634_0036902 Ga0495634_0036902_2593_2874 93
497 3300046642 Ga0495634_0056615 Ga0495634_0056615_2227_2523 93
498 3300046642 Ga0495634_0061935 Ga0495634_0061935_2065_2346 93
499 3300046642 Ga0495634_0070141 Ga0495634_0070141_1878_2159 93
500 3300046663 Ga0495635_0304861 Ga0495635_0304861_642_923 93
501 3300046664 Ga0495659_0141467 Ga0495659_0141467_331_621 93
502 3300046675 Ga0495657_0854781 Ga0495657_0854781_110_406 93
503 3300046681 Ga0495647_0228303 Ga0495647_0228303_96_386 93
504 3300046681 Ga0495647_0310184 Ga0495647_0310184_270_551 93
505 3300046681 Ga0495647_0356351 Ga0495647_0356351_121_411 93
506 3300046683 Ga0495658_0024133 Ga0495658_0024133_2364_2645 93
507 3300046683 Ga0495658_0213883 Ga0495658_0213883_77_364 93
508 3300046689 Ga0495613_0097374 Ga0495613_0097374_1553_1834 93
509 3300046689 Ga0495613_0431194 Ga0495613_0431194_452_733 93
510 3300046690 Ga0495624_0009082 Ga0495624_0009082_2604_2885 93
511 3300046692 Ga0495671_0326370 Ga0495671_0326370_153_443 93
512 3300047315 Ga0495581_0073484 Ga0495581_0073484_1092_1373 93
513 3300047319 Ga0495674_0161940 Ga0495674_0161940_498_779 93
514 3300047319 Ga0495674_0235661 Ga0495674_0235661_741_1022 93
515 3300047319 Ga0495674_0706930 Ga0495674_0706930_12_293 93
516 3300047321 Ga0495676_0060498 Ga0495676_0060498_881_1162 93
517 3300047321 Ga0495676_0158235 Ga0495676_0158235_1208_1495 93
518 3300047321 Ga0495676_0307635 Ga0495676_0307635_668_958 93
519 3300047322 Ga0495680_0194644 Ga0495680_0194644_376_657 93
520 3300047471 Ga0495684_0046785 Ga0495684_0046785_2597_2878 93
521 3300047471 Ga0495684_0082589 Ga0495684_0082589_1721_2002 93
522 3300047673 Ga0495593_0068368 Ga0495593_0068368_607_888 93
523 3300048089 Ga0495614_0009099 Ga0495614_0009099_2979_3260 93
524 3300048903 Ga0496100_0117641 Ga0496100_0117641_495_776 93
525 3300048903 Ga0496100_0253528 Ga0496100_0253528_302_583 93
526 3300048903 Ga0496100_0792777 Ga0496100_0792777_424_714 93
527 3300048903 Ga0496100_1269124 Ga0496100_1269124_156_443 93
528 3300048904 Ga0496101_0024104 Ga0496101_0024104_1643_1930 93
529 3300048904 Ga0496101_0088218 Ga0496101_0088218_985_1266 93
530 3300048904 Ga0496101_0459659 Ga0496101_0459659_526_807 93
531 3300048904 Ga0496101_0811977 Ga0496101_0811977_33_323 93
532 3300048904 Ga0496101_1547787 Ga0496101_1547787_146_436 93
533 3300048905 Ga0496102_0017242 Ga0496102_0017242_3332_3622 93
534 3300048905 Ga0496102_0226077 Ga0496102_0226077_1090_1371 93
535 3300048905 Ga0496102_0479947 Ga0496102_0479947_356_637 93
536 3300048905 Ga0496102_1367577 Ga0496102_1367577_61_348 93
537 3300048906 Ga0496103_0012805 Ga0496103_0012805_3337_3627 93
538 3300048907 Ga0496104_0064535 Ga0496104_0064535_1781_2071 93
539 3300048907 Ga0496104_0150006 Ga0496104_0150006_652_933 93
540 3300048907 Ga0496104_1030380 Ga0496104_1030380_219_506 93
541 3300048908 Ga0496105_0031205 Ga0496105_0031205_823_1104 93
542 3300048908 Ga0496105_0257819 Ga0496105_0257819_640_921 93
543 3300048909 Ga0496106_0012999 Ga0496106_0012999_669_950 93
544 3300048909 Ga0496106_0338864 Ga0496106_0338864_484_771 93
545 3300048909 Ga0496106_1341844 Ga0496106_1341844_124_414 93
546 3300048910 Ga0496107_0005142 Ga0496107_0005142_6134_6421 93
547 3300048911 Ga0496108_0061399 Ga0496108_0061399_498_779 93
548 3300048911 Ga0496108_0078793 Ga0496108_0078793_313_594 93
549 3300048911 Ga0496108_0694735 Ga0496108_0694735_409_699 93
550 3300048912 Ga0496109_0073842 Ga0496109_0073842_2660_2950 93
551 3300048912 Ga0496109_0241351 Ga0496109_0241351_634_915 93
552 3300048912 Ga0496109_0302125 Ga0496109_0302125_861_1142 93
553 3300048913 Ga0496110_0039901 Ga0496110_0039901_745_1026 93
554 3300048914 Ga0496111_0002119 Ga0496111_0002119_4192_4473 93
555 3300048914 Ga0496111_0598673 Ga0496111_0598673_233_514 93
556 3300048915 Ga0496112_0123442 Ga0496112_0123442_2132_2422 93
557 3300048915 Ga0496112_0196892 Ga0496112_0196892_521_802 93
558 3300048915 Ga0496112_0652248 Ga0496112_0652248_169_459 93
559 3300048915 Ga0496112_1055089 Ga0496112_1055089_251_532 93
560 3300048916 Ga0496113_0875561 Ga0496113_0875561_65_355 93
561 3300048917 Ga0496114_0085324 Ga0496114_0085324_1081_1371 93
562 3300048917 Ga0496114_0112319 Ga0496114_0112319_90_371 93
563 3300048918 Ga0496115_0056169 Ga0496115_0056169_351_638 93
564 3300048918 Ga0496115_0197635 Ga0496115_0197635_861_1142 93
565 3300049569 Ga0501032_0511454 Ga0501032_0511454_356_637 93
566 3300049571 Ga0501034_0877154 Ga0501034_0877154_146_427 93
567 3300049580 Ga0501046_0433765 Ga0501046_0433765_59_340 93
568 3300049581 Ga0501047_0258008 Ga0501047_0258008_1273_1554 93
569 3300049581 Ga0501047_0470892 Ga0501047_0470892_754_1035 93
570 3300049581 Ga0501047_0987508 Ga0501047_0987508_208_489 93
571 3300049583 Ga0501067_0032576 Ga0501067_0032576_505_795 93
572 3300049583 Ga0501067_0283683 Ga0501067_0283683_178_459 93
573 3300049585 Ga0501069_0030953 Ga0501069_0030953_1678_1959 93
574 3300049586 Ga0501070_0011133 Ga0501070_0011133_4659_4940 93
575 3300049586 Ga0501070_0247307 Ga0501070_0247307_154_444 93
576 3300049586 Ga0501070_0758133 Ga0501070_0758133_461_742 93
577 3300049586 Ga0501070_1158104 Ga0501070_1158104_69_350 93
578 3300049589 Ga0501073_0028986 Ga0501073_0028986_2056_2337 93
579 3300049590 Ga0501074_0015662 Ga0501074_0015662_465_746 93
580 3300049590 Ga0501074_0144568 Ga0501074_0144568_1206_1487 93
581 3300049741 Ga0501079_0179805 Ga0501079_0179805_1077_1358 93
582 3300049742 Ga0501080_0125186 Ga0501080_0125186_111_392 93
583 3300049744 Ga0501083_0001476 Ga0501083_0001476_6755_7036 93
584 3300049822 Ga0501035_0784477 Ga0501035_0784477_140_421 93
585 3300049823 Ga0501044_0713900 Ga0501044_0713900_267_548 93
586 3300049823 Ga0501044_1362192 Ga0501044_1362192_46_327 93
587 3300050512 nmdc:mga0n895_75033_c1 nmdc:mga0n895_75033_c1_2579_2866 93
588 3300050513 nmdc:mga0rr50_6584_c1 nmdc:mga0rr50_6584_c1_5152_5439 93
589 3300050514 nmdc:mga08x19_1064596_c1 nmdc:mga08x19_1064596_c1_238_528 93
590 3300050514 nmdc:mga08x19_213418_c1 nmdc:mga08x19_213418_c1_143_424 93
591 3300053077 Ga0495601_0091489 Ga0495601_0091489_137_418 93
592 3300053077 Ga0495601_0110314 Ga0495601_0110314_326_607 93
593 3300053077 Ga0495601_0451511 Ga0495601_0451511_502_783 93
594 3300053077 Ga0495601_0567748 Ga0495601_0567748_274_585 93
595 3300053077 Ga0495601_0574178 Ga0495601_0574178_190_486 93
596 3300053085 Ga0495619_0242655 Ga0495619_0242655_469_750 93
597 3300053085 Ga0495619_0555247 Ga0495619_0555247_172_462 93
598 3300054114 Ga0501084_0465079 Ga0501084_0465079_492_773 93
599 3300059644 Ga0587075_054501 Ga0587075_054501_19_300 93
600 3300061719 Ga0466962_0028444 Ga0466962_0028444_1391_1672 93
601 3300061719 Ga0466962_0236792 Ga0466962_0236792_76_375 93
602 3300061719 Ga0466962_0277150 Ga0466962_0277150_66_356 93
603 3300061719 Ga0466962_0729393 Ga0466962_0729393_26_316 93
604 3300061734 Ga0530510_0289349 Ga0530510_0289349_325_606 93
605 3300005329 Ga0070683_100052446 Ga0070683_1000524464 94
606 3300005338 Ga0068868_101255791 Ga0068868_1012557912 94
607 3300005355 Ga0070671_101891308 Ga0070671_1018913082 94
608 3300005434 Ga0070709_11246950 Ga0070709_112469502 94
609 3300005435 Ga0070714_100716788 Ga0070714_1007167881 94
610 3300005435 Ga0070714_100945906 Ga0070714_1009459061 94
611 3300005437 Ga0070710_10913076 Ga0070710_109130762 94
612 3300005439 Ga0070711_101797281 Ga0070711_1017972812 94
613 3300005440 Ga0070705_101078870 Ga0070705_1010788702 94
614 3300005444 Ga0070694_100209348 Ga0070694_1002093482 94
615 3300005471 Ga0070698_100258548 Ga0070698_1002585483 94
616 3300005530 Ga0070679_100114800 Ga0070679_1001148003 94
617 3300005564 Ga0070664_100505956 Ga0070664_1005059562 94
618 3300005616 Ga0068852_100147275 Ga0068852_1001472752 94
619 3300006058 Ga0075432_10116539 Ga0075432_101165392 94
620 3300006173 Ga0070716_101764908 Ga0070716_1017649082 94
621 3300006175 Ga0070712_100490266 Ga0070712_1004902662 94
622 3300006175 Ga0070712_100823035 Ga0070712_1008230352 94
623 3300006237 Ga0097621_100447317 Ga0097621_1004473172 94
624 3300006852 Ga0075433_10317353 Ga0075433_103173532 94
625 3300006871 Ga0075434_100165162 Ga0075434_1001651622 94
626 3300007076 Ga0075435_100689428 Ga0075435_1006894282 94
627 3300009094 Ga0111539_10476269 Ga0111539_104762692 94
628 3300009098 Ga0105245_10171862 Ga0105245_101718623 94
629 3300013104 Ga0157370_11215828 Ga0157370_112158281 94
630 3300013105 Ga0157369_10840299 Ga0157369_108402992 94
631 3300013296 Ga0157374_11806434 Ga0157374_118064342 94
632 3300013307 Ga0157372_11515200 Ga0157372_115152002 94
633 3300013308 Ga0157375_10056241 Ga0157375_100562412 94
634 3300014969 Ga0157376_10546351 Ga0157376_105463512 94
635 3300015265 Ga0182005_1206880 Ga0182005_12068802 94
636 3300020070 Ga0206356_10506411 Ga0206356_105064112 94
637 3300020075 Ga0206349_1954900 Ga0206349_19549002 94
638 3300020081 Ga0206354_11702124 Ga0206354_117021244 94
639 3300020082 Ga0206353_11189789 Ga0206353_111897892 94
640 3300025898 Ga0207692_11075321 Ga0207692_110753212 94
641 3300025909 Ga0207705_10271211 Ga0207705_102712112 94
642 3300025915 Ga0207693_11470024 Ga0207693_114700242 94
643 3300025917 Ga0207660_10286588 Ga0207660_102865882 94
644 3300025921 Ga0207652_10846460 Ga0207652_108464602 94
645 3300025927 Ga0207687_11226320 Ga0207687_112263202 94
646 3300025939 Ga0207665_10347307 Ga0207665_103473072 94
647 3300025944 Ga0207661_10139196 Ga0207661_101391964 94
648 3300025944 Ga0207661_11602907 Ga0207661_116029071 94
649 3300025960 Ga0207651_10464865 Ga0207651_104648652 94
650 3300026142 Ga0207698_11051181 Ga0207698_110511812 94
651 3300027907 Ga0207428_10156120 Ga0207428_101561204 94
652 3300028379 Ga0268266_11254832 Ga0268266_112548322 94
653 3300034819 Ga0373958_0194308 Ga0373958_0194308_82_375 94
654 3300035117 Ga0373953_0491730 Ga0373953_0491730_92_388 94
655 3300035121 Ga0373960_0137675 Ga0373960_0137675_61_354 94
656 3300035172 Ga0373955_0577222 Ga0373955_0577222_331_627 94
657 3300035410 Ga0373924_0211246 Ga0373924_0211246_487_783 94
658 3300035691 Ga0373931_0421327 Ga0373931_0421327_502_795 94
659 3300035725 Ga0373947_0696405 Ga0373947_0696405_267_557 94
660 3300036401 Ga0373937_0882978 Ga0373937_0882978_477_773 94
661 3300037471 Ga0395905_1206246 Ga0395905_1206246_65_355 94
662 3300041492 Ga0451835_0395632 Ga0451835_0395632_91_381 94
663 3300044656 Ga0466969_0219409 Ga0466969_0219409_37_330 94
664 3300044683 Ga0466965_0149736 Ga0466965_0149736_264_557 94
665 3300044684 Ga0466966_0090406 Ga0466966_0090406_1039_1332 94
666 3300044693 Ga0466961_0012971 Ga0466961_0012971_679_972 94
667 3300044693 Ga0466961_0059397 Ga0466961_0059397_1890_2180 94
668 3300044693 Ga0466961_0080403 Ga0466961_0080403_1194_1487 94
669 3300044693 Ga0466961_0638924 Ga0466961_0638924_181_465 94
670 3300044694 Ga0466963_0002677 Ga0466963_0002677_9290_9583 94
671 3300044694 Ga0466963_0003889 Ga0466963_0003889_4457_4750 94
672 3300044694 Ga0466963_0385080 Ga0466963_0385080_91_384 94
673 3300044694 Ga0466963_0504215 Ga0466963_0504215_22_312 94
674 3300044694 Ga0466963_1320784 Ga0466963_1320784_119_412 94
675 3300044706 Ga0466964_0771182 Ga0466964_0771182_149_442 94
676 3300044719 Ga0466971_0010936 Ga0466971_0010936_3102_3395 94
677 3300044719 Ga0466971_0046865 Ga0466971_0046865_261_554 94
678 3300044735 Ga0466968_0565715 Ga0466968_0565715_22_306 94
679 3300044765 Ga0466970_0727246 Ga0466970_0727246_146_436 94
680 3300044765 Ga0466970_0934276 Ga0466970_0934276_146_430 94
681 3300044842 Ga0466957_0280783 Ga0466957_0280783_607_900 94
682 3300044842 Ga0466957_0770629 Ga0466957_0770629_288_578 94
683 3300045049 Ga0466959_0001430 Ga0466959_0001430_3246_3536 94
684 3300045049 Ga0466959_0099997 Ga0466959_0099997_230_523 94
685 3300045049 Ga0466959_0278007 Ga0466959_0278007_347_631 94
686 3300045049 Ga0466959_0599116 Ga0466959_0599116_302_595 94
687 3300045836 Ga0466958_0035358 Ga0466958_0035358_2125_2418 94
688 3300045836 Ga0466958_0083367 Ga0466958_0083367_512_802 94
689 3300045836 Ga0466958_0248838 Ga0466958_0248838_761_1054 94
690 3300045976 Ga0466967_0301568 Ga0466967_0301568_176_469 94
691 3300045976 Ga0466967_0438368 Ga0466967_0438368_470_763 94
692 3300045976 Ga0466967_0742037 Ga0466967_0742037_496_786 94
693 3300045976 Ga0466967_1011715 Ga0466967_1011715_308_601 94
694 3300046452 Ga0495617_190785 Ga0495617_190785_339_632 94
695 3300046454 Ga0495592_0111239 Ga0495592_0111239_39_332 94
696 3300046461 Ga0495641_0221787 Ga0495641_0221787_243_533 94
697 3300046473 Ga0495582_0096863 Ga0495582_0096863_898_1188 94
698 3300046473 Ga0495582_0564415 Ga0495582_0564415_339_629 94
699 3300046473 Ga0495582_0617203 Ga0495582_0617203_177_470 94
700 3300046474 Ga0495605_0118834 Ga0495605_0118834_85_378 94
701 3300046475 Ga0495639_0249618 Ga0495639_0249618_79_369 94
702 3300046475 Ga0495639_0659167 Ga0495639_0659167_167_457 94
703 3300046477 Ga0495664_0484269 Ga0495664_0484269_325_621 94
704 3300046499 Ga0495594_0588010 Ga0495594_0588010_186_476 94
705 3300046514 Ga0495618_0059715 Ga0495618_0059715_180_476 94
706 3300046516 Ga0495628_0936071 Ga0495628_0936071_233_529 94
707 3300046517 Ga0495630_0675444 Ga0495630_0675444_327_623 94
708 3300046517 Ga0495630_0978372 Ga0495630_0978372_153_446 94
709 3300046517 Ga0495630_1003238 Ga0495630_1003238_147_440 94
710 3300046528 Ga0495642_0107054 Ga0495642_0107054_794_1087 94
711 3300046529 Ga0495652_0313182 Ga0495652_0313182_88_384 94
712 3300046535 Ga0495586_0425846 Ga0495586_0425846_331_627 94
713 3300046536 Ga0495587_0685182 Ga0495587_0685182_250_546 94
714 3300046543 Ga0495645_0119020 Ga0495645_0119020_1300_1596 94
715 3300046543 Ga0495645_0120708 Ga0495645_0120708_1500_1793 94
716 3300046615 Ga0495656_0135436 Ga0495656_0135436_434_727 94
717 3300046642 Ga0495634_0383535 Ga0495634_0383535_385_681 94
718 3300046680 Ga0495646_0323741 Ga0495646_0323741_115_411 94
719 3300046681 Ga0495647_0261465 Ga0495647_0261465_321_617 94
720 3300046683 Ga0495658_0147251 Ga0495658_0147251_531_824 94
721 3300046683 Ga0495658_0526691 Ga0495658_0526691_94_390 94
722 3300046689 Ga0495613_0580393 Ga0495613_0580393_367_663 94
723 3300046690 Ga0495624_0324851 Ga0495624_0324851_343_636 94
724 3300047318 Ga0495636_0297975 Ga0495636_0297975_145_438 94
725 3300047319 Ga0495674_0587486 Ga0495674_0587486_191_487 94
726 3300047321 Ga0495676_0209132 Ga0495676_0209132_580_870 94
727 3300047321 Ga0495676_0597960 Ga0495676_0597960_277_570 94
728 3300047322 Ga0495680_0694648 Ga0495680_0694648_126_422 94
729 3300047445 Ga0495677_0121939 Ga0495677_0121939_466_759 94
730 3300048903 Ga0496100_0115702 Ga0496100_0115702_650_940 94
731 3300048903 Ga0496100_0863746 Ga0496100_0863746_252_542 94
732 3300048903 Ga0496100_1009048 Ga0496100_1009048_126_416 94
733 3300048904 Ga0496101_0206192 Ga0496101_0206192_489_779 94
734 3300048905 Ga0496102_0290048 Ga0496102_0290048_701_991 94
735 3300048907 Ga0496104_0423921 Ga0496104_0423921_434_724 94
736 3300048907 Ga0496104_0595201 Ga0496104_0595201_529_822 94
737 3300048907 Ga0496104_0736702 Ga0496104_0736702_458_745 94
738 3300048908 Ga0496105_0199502 Ga0496105_0199502_464_757 94
739 3300048911 Ga0496108_0730804 Ga0496108_0730804_144_437 94
740 3300048911 Ga0496108_0801673 Ga0496108_0801673_353_643 94
741 3300048912 Ga0496109_0201436 Ga0496109_0201436_885_1175 94
742 3300048913 Ga0496110_0326317 Ga0496110_0326317_533_823 94
743 3300048913 Ga0496110_0526511 Ga0496110_0526511_418_708 94
744 3300048917 Ga0496114_0012447 Ga0496114_0012447_1910_2200 94
745 3300048917 Ga0496114_0030886 Ga0496114_0030886_3046_3336 94
746 3300050512 nmdc:mga0n895_64924_c1 nmdc:mga0n895_64924_c1_248_541 94
747 3300050513 nmdc:mga0rr50_40345_c1 nmdc:mga0rr50_40345_c1_126_419 94
748 3300050515 nmdc:mga0a205_1201227_c1 nmdc:mga0a205_1201227_c1_10_303 94
749 3300053077 Ga0495601_0309736 Ga0495601_0309736_533_829 94
750 3300053078 Ga0495612_0177212 Ga0495612_0177212_423_719 94
751 3300053084 Ga0495595_0639412 Ga0495595_0639412_33_329 94
752 3300061719 Ga0466962_0000620 Ga0466962_0000620_4323_4616 94
753 3300061719 Ga0466962_0000842 Ga0466962_0000842_4254_4547 94
754 3300061719 Ga0466962_0044594 Ga0466962_0044594_1066_1359 94
755 3300015262 Ga0182007_10238154 Ga0182007_102381542 95
756 3300025941 Ga0207711_11576274 Ga0207711_115762742 95
757 3300035116 Ga0373945_0569445 Ga0373945_0569445_190_495 95
758 3300035119 Ga0373956_0149673 Ga0373956_0149673_315_620 95
759 3300035172 Ga0373955_0730131 Ga0373955_0730131_96_401 95
760 3300035724 Ga0373933_0079441 Ga0373933_0079441_462_767 95
761 3300036401 Ga0373937_0038431 Ga0373937_0038431_3240_3545 95
762 3300044735 Ga0466968_0337404 Ga0466968_0337404_318_620 95
763 3300044842 Ga0466957_0929110 Ga0466957_0929110_15_320 95
764 3300044901 Ga0466960_0095494 Ga0466960_0095494_514_801 95
765 3300045836 Ga0466958_0057958 Ga0466958_0057958_646_951 95
766 3300045976 Ga0466967_0727559 Ga0466967_0727559_358_660 95
767 3300045976 Ga0466967_0956132 Ga0466967_0956132_118_423 95
768 3300046454 Ga0495592_0001526 Ga0495592_0001526_14782_15087 95
769 3300046454 Ga0495592_0633826 Ga0495592_0633826_26_331 95
770 3300046459 Ga0495629_0145491 Ga0495629_0145491_562_867 95
771 3300046462 Ga0495651_0001467 Ga0495651_0001467_2308_2613 95
772 3300046463 Ga0495653_0000781 Ga0495653_0000781_9621_9926 95
773 3300046473 Ga0495582_0149856 Ga0495582_0149856_106_408 95
774 3300046511 Ga0495608_0009146 Ga0495608_0009146_1061_1366 95
775 3300046511 Ga0495608_0389823 Ga0495608_0389823_418_714 95
776 3300046514 Ga0495618_0000680 Ga0495618_0000680_5623_5928 95
777 3300046516 Ga0495628_0002347 Ga0495628_0002347_15619_15924 95
778 3300046529 Ga0495652_0002978 Ga0495652_0002978_15619_15924 95
779 3300046536 Ga0495587_0001454 Ga0495587_0001454_13792_14097 95
780 3300046543 Ga0495645_0000988 Ga0495645_0000988_1156_1461 95
781 3300046559 Ga0495667_0254939 Ga0495667_0254939_465_770 95
782 3300046559 Ga0495667_0485417 Ga0495667_0485417_181_477 95
783 3300046642 Ga0495634_0678370 Ga0495634_0678370_141_446 95
784 3300046663 Ga0495635_0638355 Ga0495635_0638355_296_601 95
785 3300046675 Ga0495657_0010367 Ga0495657_0010367_345_650 95
786 3300046675 Ga0495657_0018183 Ga0495657_0018183_92_388 95
787 3300046678 Ga0495599_0002970 Ga0495599_0002970_2370_2675 95
788 3300046679 Ga0495623_0004124 Ga0495623_0004124_2074_2379 95
789 3300046680 Ga0495646_0010511 Ga0495646_0010511_1065_1370 95
790 3300046809 Ga0495600_0006726 Ga0495600_0006726_2065_2370 95
791 3300047317 Ga0495604_0012690 Ga0495604_0012690_1133_1438 95
792 3300047319 Ga0495674_0224628 Ga0495674_0224628_482_787 95
793 3300047319 Ga0495674_1049500 Ga0495674_1049500_306_602 95
794 3300047322 Ga0495680_0006100 Ga0495680_0006100_1052_1357 95
795 3300047322 Ga0495680_0252107 Ga0495680_0252107_522_818 95
796 3300047444 Ga0495675_0000809 Ga0495675_0000809_17930_18235 95
797 3300048088 Ga0495602_0001857 Ga0495602_0001857_2917_3222 95
798 3300048911 Ga0496108_0012844 Ga0496108_0012844_2584_2889 95
799 3300048912 Ga0496109_0034832 Ga0496109_0034832_1562_1867 95
800 3300048914 Ga0496111_0121645 Ga0496111_0121645_412_717 95
801 3300048915 Ga0496112_0082100 Ga0496112_0082100_1617_1922 95
802 3300048918 Ga0496115_0161337 Ga0496115_0161337_946_1248 95
803 3300053077 Ga0495601_0008246 Ga0495601_0008246_4757_5062 95
804 3300053078 Ga0495612_0407262 Ga0495612_0407262_142_447 95
805 3300053084 Ga0495595_0049857 Ga0495595_0049857_1077_1382 95
806 3300053084 Ga0495595_0446177 Ga0495595_0446177_177_473 95
807 3300053085 Ga0495619_0000340 Ga0495619_0000340_8908_9213 95
808 3300053085 Ga0495619_0362260 Ga0495619_0362260_97_393 95
809 3300005327 Ga0070658_10003469 Ga0070658_1000346915 96
810 3300005329 Ga0070683_100323271 Ga0070683_1003232712 96
811 3300005336 Ga0070680_100265238 Ga0070680_1002652383 96
812 3300005337 Ga0070682_101385388 Ga0070682_1013853882 96
813 3300005338 Ga0068868_102018356 Ga0068868_1020183562 96
814 3300005339 Ga0070660_100103906 Ga0070660_1001039062 96
815 3300005339 Ga0070660_100611469 Ga0070660_1006114692 96
816 3300005341 Ga0070691_10071494 Ga0070691_100714942 96
817 3300005344 Ga0070661_100584652 Ga0070661_1005846522 96
818 3300005344 Ga0070661_101560580 Ga0070661_1015605802 96
819 3300005345 Ga0070692_10215121 Ga0070692_102151213 96
820 3300005366 Ga0070659_100198333 Ga0070659_1001983333 96
821 3300005457 Ga0070662_100728941 Ga0070662_1007289412 96
822 3300005458 Ga0070681_10639546 Ga0070681_106395462 96
823 3300005458 Ga0070681_12041023 Ga0070681_120410231 96
824 3300005539 Ga0068853_101093450 Ga0068853_1010934502 96
825 3300005563 Ga0068855_100291723 Ga0068855_1002917233 96
826 3300005564 Ga0070664_100428808 Ga0070664_1004288082 96
827 3300005614 Ga0068856_100437936 Ga0068856_1004379363 96
828 3300005616 Ga0068852_100316029 Ga0068852_1003160292 96
829 3300006237 Ga0097621_101003848 Ga0097621_1010038482 96
830 3300009174 Ga0105241_10997661 Ga0105241_109976612 96
831 3300009545 Ga0105237_10540801 Ga0105237_105408012 96
832 3300009551 Ga0105238_12703763 Ga0105238_127037632 96
833 3300013102 Ga0157371_10659940 Ga0157371_106599402 96
834 3300013105 Ga0157369_10759161 Ga0157369_107591612 96
835 3300013297 Ga0157378_10280808 Ga0157378_102808082 96
836 3300013307 Ga0157372_10869734 Ga0157372_108697342 96
837 3300020081 Ga0206354_10042482 Ga0206354_100424822 96
838 3300020082 Ga0206353_11462915 Ga0206353_114629151 96
839 3300022467 Ga0224712_10094948 Ga0224712_100949482 96
840 3300025909 Ga0207705_10072226 Ga0207705_100722264 96
841 3300025912 Ga0207707_10527390 Ga0207707_105273902 96
842 3300025917 Ga0207660_10842822 Ga0207660_108428222 96
843 3300025919 Ga0207657_10137356 Ga0207657_101373562 96
844 3300025924 Ga0207694_10033763 Ga0207694_100337632 96
845 3300025927 Ga0207687_11962266 Ga0207687_119622662 96
846 3300025932 Ga0207690_10816024 Ga0207690_108160242 96
847 3300025933 Ga0207706_10978598 Ga0207706_109785982 96
848 3300025944 Ga0207661_12170801 Ga0207661_121708012 96
849 3300025945 Ga0207679_10514788 Ga0207679_105147882 96
850 3300025949 Ga0207667_10396537 Ga0207667_103965372 96
851 3300026023 Ga0207677_10560669 Ga0207677_105606692 96
852 3300026078 Ga0207702_10137271 Ga0207702_101372714 96
853 3300026078 Ga0207702_11033479 Ga0207702_110334792 96
854 3300035171 Ga0373946_0020493 Ga0373946_0020493_767_1081 96
855 3300037312 Ga0395899_0020914 Ga0395899_0020914_2282_2572 96
856 3300037418 Ga0395900_0340838 Ga0395900_0340838_847_1137 96
857 3300037466 Ga0395898_0274595 Ga0395898_0274595_499_789 96
858 3300037466 Ga0395898_0973258 Ga0395898_0973258_455_772 96
859 3300037471 Ga0395905_0678769 Ga0395905_0678769_122_412 96
860 3300038443 Ga0395901_0048637 Ga0395901_0048637_3955_4245 96
861 3300046533 Ga0495640_0835962 Ga0495640_0835962_169_477 96
862 3300048903 Ga0496100_0105858 Ga0496100_0105858_1248_1550 96
863 3300048904 Ga0496101_0307002 Ga0496101_0307002_471_773 96
864 3300048906 Ga0496103_1050631 Ga0496103_1050631_118_420 96
865 3300048908 Ga0496105_0619102 Ga0496105_0619102_267_569 96
866 3300048910 Ga0496107_0385608 Ga0496107_0385608_143_445 96
867 3300048911 Ga0496108_0133200 Ga0496108_0133200_237_539 96
868 3300048912 Ga0496109_0155672 Ga0496109_0155672_806_1108 96
869 3300048913 Ga0496110_0665963 Ga0496110_0665963_330_632 96
870 3300048914 Ga0496111_0382679 Ga0496111_0382679_655_957 96
871 3300048915 Ga0496112_0059102 Ga0496112_0059102_2518_2820 96
872 3300048916 Ga0496113_0738146 Ga0496113_0738146_107_409 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06243

PaaB

Phenylacetic acid degradation B

9

90

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8445 1 61
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8208 1 61
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8188 1 61
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.7848 1 61
1a5i-assembly1.cif.gz_A catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone) 0.78 2 26
ID Description Score Start End Superfamily
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8583 3 61 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8403 1 61 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8164 1 61 3.10.20.520
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.7861 3 61 3.10.20.520
2qcsB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7445 3 28 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5P9P7A3-F1-model_v4 RSAM-partnered protein 0.9135 1 57
AF-A0A830FDE0-F1-model_v4 RSAM-partnered protein 0.9034 2 57
AF-A0A7D5P112-F1-model_v4 RSAM-partnered protein 0.9014 2 61
AF-A0A1I6K1K5-F1-model_v4 RSAM-partnered protein, Htur_1727 family 0.8982 3 61
AF-A0A1H6IDK4-F1-model_v4 RSAM-partnered protein, Htur_1727 family 0.8952 3 63

Feature Viewer

pLDDT pTM Quality
80.97 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map