F484215
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 872 | 321 | 872 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_12041023|Ga0070681_120410231 |
| Length | 104 |
| Sequence | VGARRSGRSVIYEVFRQDRKGQPFEHAGSVVAPDVEFAEAWAREQYGRRGESVALWLVPRDAVHVIADWADEFDLKYRRVDGYSIKARLKEARERAGTAAAGDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 71 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 72 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 73 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 74 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 165 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 166 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 167 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 203 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 204 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 1.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.06 |
| Rhizosphere | 90.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10003469 | 3300005327 | Bacteria | 12957 |
| 2 | Ga0070658_10170777 | 3300005327 | Bacteria | 1826 |
| 3 | Ga0070658_10383887 | 3300005327 | Bacteria | 1205 |
| 4 | Ga0070658_10706052 | 3300005327 | Unclassified | 875 |
| 5 | Ga0070683_100052446 | 3300005329 | Bacteria | 3778 |
| 6 | Ga0070683_100323271 | 3300005329 | Bacteria | 1468 |
| 7 | Ga0070683_101116101 | 3300005329 | Bacteria | 758 |
| 8 | Ga0070683_101700906 | 3300005329 | Unclassified | 607 |
| 9 | Ga0070683_101942035 | 3300005329 | Bacteria | 566 |
| 10 | Ga0070680_100150818 | 3300005336 | Bacteria | 1951 |
| 11 | Ga0070680_100239043 | 3300005336 | Bacteria | 1535 |
| 12 | Ga0070680_100265238 | 3300005336 | Unclassified | 1453 |
| 13 | Ga0070680_100266248 | 3300005336 | Bacteria | 1451 |
| 14 | Ga0070680_100536159 | 3300005336 | Bacteria | 1002 |
| 15 | Ga0070680_100573625 | 3300005336 | Bacteria | 968 |
| 16 | Ga0070680_101315747 | 3300005336 | Unclassified | 625 |
| 17 | Ga0070680_101632286 | 3300005336 | Unclassified | 559 |
| 18 | Ga0070682_100013765 | 3300005337 | Bacteria | 4663 |
| 19 | Ga0070682_100281338 | 3300005337 | Unclassified | 1213 |
| 20 | Ga0070682_101385388 | 3300005337 | Bacteria | 601 |
| 21 | Ga0070682_101956658 | 3300005337 | Bacteria | 515 |
| 22 | Ga0068868_100159779 | 3300005338 | Unclassified | 1860 |
| 23 | Ga0068868_101255791 | 3300005338 | Unclassified | 687 |
| 24 | Ga0068868_102018356 | 3300005338 | Unclassified | 548 |
| 25 | Ga0070660_100103906 | 3300005339 | Bacteria | 2253 |
| 26 | Ga0070660_100611469 | 3300005339 | Bacteria | 912 |
| 27 | Ga0070660_100935263 | 3300005339 | Unclassified | 731 |
| 28 | Ga0070691_10071494 | 3300005341 | Bacteria | 1684 |
| 29 | Ga0070661_100558665 | 3300005344 | Unclassified | 922 |
| 30 | Ga0070661_100584652 | 3300005344 | Unclassified | 901 |
| 31 | Ga0070661_101560580 | 3300005344 | Unclassified | 558 |
| 32 | Ga0070692_10215121 | 3300005345 | Bacteria | 1133 |
| 33 | Ga0070692_10961010 | 3300005345 | Bacteria | 595 |
| 34 | Ga0070675_101617159 | 3300005354 | Unclassified | 598 |
| 35 | Ga0070671_100034184 | 3300005355 | Bacteria | 4208 |
| 36 | Ga0070671_101891308 | 3300005355 | Unclassified | 531 |
| 37 | Ga0070659_100198333 | 3300005366 | Bacteria | 1651 |
| 38 | Ga0070659_100555076 | 3300005366 | Bacteria | 983 |
| 39 | Ga0070659_101043479 | 3300005366 | Unclassified | 719 |
| 40 | Ga0070709_10034391 | 3300005434 | Unclassified | 3072 |
| 41 | Ga0070709_10245795 | 3300005434 | Unclassified | 1287 |
| 42 | Ga0070709_10769327 | 3300005434 | Bacteria | 754 |
| 43 | Ga0070709_11246950 | 3300005434 | Unclassified | 599 |
| 44 | Ga0070714_100040084 | 3300005435 | Bacteria | 3947 |
| 45 | Ga0070714_100085136 | 3300005435 | Unclassified | 2760 |
| 46 | Ga0070714_100277024 | 3300005435 | Bacteria | 1557 |
| 47 | Ga0070714_100322262 | 3300005435 | Unclassified | 1445 |
| 48 | Ga0070714_100340116 | 3300005435 | Bacteria | 1407 |
| 49 | Ga0070714_100613220 | 3300005435 | Unclassified | 1046 |
| 50 | Ga0070714_100716788 | 3300005435 | Bacteria | 966 |
| 51 | Ga0070714_100945906 | 3300005435 | Unclassified | 837 |
| 52 | Ga0070714_101599301 | 3300005435 | Unclassified | 637 |
| 53 | Ga0070714_101740666 | 3300005435 | Unclassified | 609 |
| 54 | Ga0070713_100050722 | 3300005436 | Bacteria | 3429 |
| 55 | Ga0070713_100084771 | 3300005436 | Bacteria | 2712 |
| 56 | Ga0070713_100134397 | 3300005436 | Bacteria | 2184 |
| 57 | Ga0070713_101565409 | 3300005436 | Bacteria | 640 |
| 58 | Ga0070710_10015854 | 3300005437 | Bacteria | 3822 |
| 59 | Ga0070710_10017530 | 3300005437 | Bacteria | 3666 |
| 60 | Ga0070710_10748958 | 3300005437 | Unclassified | 693 |
| 61 | Ga0070710_10913076 | 3300005437 | Unclassified | 635 |
| 62 | Ga0070711_100026065 | 3300005439 | Bacteria | 3829 |
| 63 | Ga0070711_100034412 | 3300005439 | Bacteria | 3379 |
| 64 | Ga0070711_101284536 | 3300005439 | Bacteria | 635 |
| 65 | Ga0070711_101797281 | 3300005439 | Archaea | 538 |
| 66 | Ga0070705_100958373 | 3300005440 | Bacteria | 692 |
| 67 | Ga0070705_101078870 | 3300005440 | Unclassified | 656 |
| 68 | Ga0070694_100209348 | 3300005444 | Bacteria | 1457 |
| 69 | Ga0070694_101411123 | 3300005444 | Unclassified | 588 |
| 70 | Ga0070708_100468967 | 3300005445 | Bacteria | 1188 |
| 71 | Ga0070708_101502300 | 3300005445 | Unclassified | 628 |
| 72 | Ga0070663_101355499 | 3300005455 | Unclassified | 629 |
| 73 | Ga0070678_101835749 | 3300005456 | Bacteria | 572 |
| 74 | Ga0070662_100726056 | 3300005457 | Unclassified | 841 |
| 75 | Ga0070662_100728941 | 3300005457 | Bacteria | 840 |
| 76 | Ga0070681_10177585 | 3300005458 | Bacteria | 2051 |
| 77 | Ga0070681_10182685 | 3300005458 | Bacteria | 2018 |
| 78 | Ga0070681_10197498 | 3300005458 | Bacteria | 1930 |
| 79 | Ga0070681_10375886 | 3300005458 | Unclassified | 1331 |
| 80 | Ga0070681_10639546 | 3300005458 | Bacteria | 978 |
| 81 | Ga0070681_12041023 | 3300005458 | Bacteria | 502 |
| 82 | Ga0070685_11227182 | 3300005466 | Unclassified | 571 |
| 83 | Ga0070706_102014070 | 3300005467 | Bacteria | 523 |
| 84 | Ga0070706_102022873 | 3300005467 | Bacteria | 522 |
| 85 | Ga0070707_100061249 | 3300005468 | Bacteria | 3609 |
| 86 | Ga0070707_100798702 | 3300005468 | Unclassified | 907 |
| 87 | Ga0070698_100258548 | 3300005471 | Bacteria | 1673 |
| 88 | Ga0070698_100290667 | 3300005471 | Bacteria | 1565 |
| 89 | Ga0070698_100301966 | 3300005471 | Bacteria | 1532 |
| 90 | Ga0070698_100973855 | 3300005471 | Bacteria | 795 |
| 91 | Ga0070699_101054327 | 3300005518 | Bacteria | 746 |
| 92 | Ga0070679_100114800 | 3300005530 | Bacteria | 2679 |
| 93 | Ga0070679_100160799 | 3300005530 | Bacteria | 2220 |
| 94 | Ga0070679_100317396 | 3300005530 | Bacteria | 1508 |
| 95 | Ga0070679_100504805 | 3300005530 | Bacteria | 1153 |
| 96 | Ga0070679_100903806 | 3300005530 | Unclassified | 826 |
| 97 | Ga0070684_100252548 | 3300005535 | Unclassified | 1612 |
| 98 | Ga0070684_100314314 | 3300005535 | Bacteria | 1438 |
| 99 | Ga0070684_100773928 | 3300005535 | Unclassified | 896 |
| 100 | Ga0070684_100774014 | 3300005535 | Unclassified | 896 |
| 101 | Ga0068853_101093450 | 3300005539 | Bacteria | 769 |
| 102 | Ga0070695_100000001 | 3300005545 | Bacteria | 150757 |
| 103 | Ga0070693_100256844 | 3300005547 | Bacteria | 1160 |
| 104 | Ga0070693_100507254 | 3300005547 | Bacteria | 857 |
| 105 | Ga0070665_101625712 | 3300005548 | Unclassified | 654 |
| 106 | Ga0070704_100278161 | 3300005549 | Unclassified | 1385 |
| 107 | Ga0068855_100291723 | 3300005563 | Bacteria | 1808 |
| 108 | Ga0068855_101096172 | 3300005563 | Unclassified | 832 |
| 109 | Ga0068855_101248940 | 3300005563 | Unclassified | 771 |
| 110 | Ga0070664_100428808 | 3300005564 | Bacteria | 1212 |
| 111 | Ga0070664_100505956 | 3300005564 | Bacteria | 1114 |
| 112 | Ga0068854_101948201 | 3300005578 | Unclassified | 541 |
| 113 | Ga0068856_100437936 | 3300005614 | Bacteria | 1327 |
| 114 | Ga0068852_100095164 | 3300005616 | Bacteria | 2674 |
| 115 | Ga0068852_100147275 | 3300005616 | Unclassified | 2185 |
| 116 | Ga0068852_100316029 | 3300005616 | Bacteria | 1515 |
| 117 | Ga0068866_10354110 | 3300005718 | Bacteria | 934 |
| 118 | Ga0068863_100591462 | 3300005841 | Unclassified | 1098 |
| 119 | Ga0081455_10081052 | 3300005937 | Bacteria | 2659 |
| 120 | Ga0070717_10001309 | 3300006028 | Bacteria | 17038 |
| 121 | Ga0070717_10030492 | 3300006028 | Bacteria | 4333 |
| 122 | Ga0070717_10101105 | 3300006028 | Bacteria | 2448 |
| 123 | Ga0070717_10575896 | 3300006028 | Unclassified | 1020 |
| 124 | Ga0075432_10116539 | 3300006058 | Unclassified | 1000 |
| 125 | Ga0070715_10000128 | 3300006163 | Bacteria | 18010 |
| 126 | Ga0070715_10413476 | 3300006163 | Unclassified | 753 |
| 127 | Ga0070716_100053160 | 3300006173 | Unclassified | 2308 |
| 128 | Ga0070716_101764908 | 3300006173 | Unclassified | 512 |
| 129 | Ga0070712_100490266 | 3300006175 | Bacteria | 1029 |
| 130 | Ga0070712_100823035 | 3300006175 | Unclassified | 797 |
| 131 | Ga0097621_100447317 | 3300006237 | Bacteria | 1163 |
| 132 | Ga0097621_101003848 | 3300006237 | Unclassified | 781 |
| 133 | Ga0097621_101495899 | 3300006237 | Bacteria | 641 |
| 134 | Ga0075431_100955925 | 3300006847 | Bacteria | 825 |
| 135 | Ga0075433_10317353 | 3300006852 | Bacteria | 1379 |
| 136 | Ga0075433_10784797 | 3300006852 | Bacteria | 833 |
| 137 | Ga0075434_100068175 | 3300006871 | Bacteria | 3544 |
| 138 | Ga0075434_100165162 | 3300006871 | Unclassified | 2234 |
| 139 | Ga0075434_100958861 | 3300006871 | Unclassified | 870 |
| 140 | Ga0068865_101221006 | 3300006881 | Unclassified | 666 |
| 141 | Ga0075436_100545433 | 3300006914 | Unclassified | 851 |
| 142 | Ga0075436_100983602 | 3300006914 | Bacteria | 633 |
| 143 | Ga0075435_100018465 | 3300007076 | Bacteria | 5305 |
| 144 | Ga0075435_100689428 | 3300007076 | Bacteria | 888 |
| 145 | Ga0105251_10192717 | 3300009011 | Unclassified | 918 |
| 146 | Ga0105244_10363702 | 3300009036 | Unclassified | 666 |
| 147 | Ga0105240_10370482 | 3300009093 | Bacteria | 1619 |
| 148 | Ga0111539_10303782 | 3300009094 | Bacteria | 1857 |
| 149 | Ga0111539_10476269 | 3300009094 | Bacteria | 1454 |
| 150 | Ga0105245_10106987 | 3300009098 | Unclassified | 2596 |
| 151 | Ga0105245_10171862 | 3300009098 | Bacteria | 2064 |
| 152 | Ga0105245_10572474 | 3300009098 | Bacteria | 1153 |
| 153 | Ga0105247_10108687 | 3300009101 | Unclassified | 1782 |
| 154 | Ga0105243_11348675 | 3300009148 | Bacteria | 732 |
| 155 | Ga0105241_10997661 | 3300009174 | Bacteria | 783 |
| 156 | Ga0105241_12688771 | 3300009174 | Unclassified | 501 |
| 157 | Ga0105242_11191433 | 3300009176 | Bacteria | 780 |
| 158 | Ga0105242_11976149 | 3300009176 | Unclassified | 625 |
| 159 | Ga0105248_11045812 | 3300009177 | Bacteria | 922 |
| 160 | Ga0105248_11051757 | 3300009177 | Unclassified | 920 |
| 161 | Ga0105237_10540801 | 3300009545 | Bacteria | 1172 |
| 162 | Ga0105237_10884010 | 3300009545 | Unclassified | 900 |
| 163 | Ga0105237_12109908 | 3300009545 | Unclassified | 573 |
| 164 | Ga0105237_12303676 | 3300009545 | Unclassified | 548 |
| 165 | Ga0105238_11159050 | 3300009551 | Bacteria | 797 |
| 166 | Ga0105238_12703763 | 3300009551 | Unclassified | 533 |
| 167 | Ga0105249_11090214 | 3300009553 | Bacteria | 868 |
| 168 | Ga0105249_12661074 | 3300009553 | Unclassified | 572 |
| 169 | Ga0157325_1009929 | 3300012485 | Bacteria | 690 |
| 170 | Ga0157343_1027074 | 3300012488 | Bacteria | 557 |
| 171 | Ga0157342_1047625 | 3300012507 | Unclassified | 594 |
| 172 | Ga0157327_1017263 | 3300012512 | Bacteria | 773 |
| 173 | Ga0157338_1021715 | 3300012515 | Bacteria | 754 |
| 174 | Ga0157371_10659940 | 3300013102 | Bacteria | 781 |
| 175 | Ga0157371_11212729 | 3300013102 | Unclassified | 582 |
| 176 | Ga0157370_11215828 | 3300013104 | Unclassified | 680 |
| 177 | Ga0157369_10759161 | 3300013105 | Bacteria | 997 |
| 178 | Ga0157369_10835163 | 3300013105 | Unclassified | 946 |
| 179 | Ga0157369_10840299 | 3300013105 | Unclassified | 943 |
| 180 | Ga0157369_11013114 | 3300013105 | Unclassified | 850 |
| 181 | Ga0157374_11806434 | 3300013296 | Bacteria | 637 |
| 182 | Ga0157374_12931549 | 3300013296 | Bacteria | 504 |
| 183 | Ga0157378_10280808 | 3300013297 | Bacteria | 1605 |
| 184 | Ga0163162_10853232 | 3300013306 | Unclassified | 1026 |
| 185 | Ga0163162_11664315 | 3300013306 | Bacteria | 728 |
| 186 | Ga0157372_10028900 | 3300013307 | Bacteria | 6050 |
| 187 | Ga0157372_10345161 | 3300013307 | Bacteria | 1734 |
| 188 | Ga0157372_10869734 | 3300013307 | Bacteria | 1046 |
| 189 | Ga0157372_11515200 | 3300013307 | Unclassified | 772 |
| 190 | Ga0157375_10056241 | 3300013308 | Bacteria | 3883 |
| 191 | Ga0163163_10936059 | 3300014325 | Unclassified | 930 |
| 192 | Ga0182008_10236797 | 3300014497 | Unclassified | 938 |
| 193 | Ga0157377_11149008 | 3300014745 | Unclassified | 598 |
| 194 | Ga0157379_10519000 | 3300014968 | Unclassified | 1106 |
| 195 | Ga0157376_10546351 | 3300014969 | Bacteria | 1146 |
| 196 | Ga0157376_11238392 | 3300014969 | Unclassified | 775 |
| 197 | Ga0182006_1099328 | 3300015261 | Unclassified | 1035 |
| 198 | Ga0182007_10227678 | 3300015262 | Bacteria | 661 |
| 199 | Ga0182007_10238154 | 3300015262 | Unclassified | 649 |
| 200 | Ga0182005_1206880 | 3300015265 | Bacteria | 592 |
| 201 | Ga0182005_1287864 | 3300015265 | Bacteria | 516 |
| 202 | Ga0197907_11460375 | 3300020069 | Unclassified | 969 |
| 203 | Ga0197907_11462768 | 3300020069 | Bacteria | 1115 |
| 204 | Ga0206356_10254714 | 3300020070 | Unclassified | 894 |
| 205 | Ga0206356_10506411 | 3300020070 | Unclassified | 611 |
| 206 | Ga0206349_1954900 | 3300020075 | Unclassified | 746 |
| 207 | Ga0206354_10042482 | 3300020081 | Bacteria | 515 |
| 208 | Ga0206354_10301111 | 3300020081 | Bacteria | 5364 |
| 209 | Ga0206354_11109484 | 3300020081 | Unclassified | 801 |
| 210 | Ga0206354_11702124 | 3300020081 | Unclassified | 2032 |
| 211 | Ga0206353_11136966 | 3300020082 | Bacteria | 785 |
| 212 | Ga0206353_11189789 | 3300020082 | Bacteria | 1123 |
| 213 | Ga0206353_11253177 | 3300020082 | Bacteria | 1807 |
| 214 | Ga0206353_11462915 | 3300020082 | Unclassified | 658 |
| 215 | Ga0206353_11574996 | 3300020082 | Unclassified | 619 |
| 216 | Ga0224712_10094948 | 3300022467 | Bacteria | 1255 |
| 217 | Ga0207653_10336738 | 3300025885 | Unclassified | 588 |
| 218 | Ga0207692_10009582 | 3300025898 | Bacteria | 4052 |
| 219 | Ga0207692_10027645 | 3300025898 | Unclassified | 2674 |
| 220 | Ga0207692_11075321 | 3300025898 | Unclassified | 532 |
| 221 | Ga0207710_10175205 | 3300025900 | Bacteria | 1050 |
| 222 | Ga0207685_10094627 | 3300025905 | Unclassified | 1266 |
| 223 | Ga0207685_10290775 | 3300025905 | Unclassified | 805 |
| 224 | Ga0207699_10016080 | 3300025906 | Bacteria | 3904 |
| 225 | Ga0207705_10072226 | 3300025909 | Bacteria | 2502 |
| 226 | Ga0207705_10138541 | 3300025909 | Unclassified | 1816 |
| 227 | Ga0207705_10271211 | 3300025909 | Archaea | 1297 |
| 228 | Ga0207705_10537376 | 3300025909 | Bacteria | 909 |
| 229 | Ga0207705_10551023 | 3300025909 | Bacteria | 896 |
| 230 | Ga0207654_10330308 | 3300025911 | Unclassified | 1045 |
| 231 | Ga0207707_10131937 | 3300025912 | Bacteria | 2185 |
| 232 | Ga0207707_10151294 | 3300025912 | Bacteria | 2029 |
| 233 | Ga0207707_10439253 | 3300025912 | Bacteria | 1117 |
| 234 | Ga0207707_10527390 | 3300025912 | Unclassified | 1005 |
| 235 | Ga0207695_10043452 | 3300025913 | Bacteria | 4789 |
| 236 | Ga0207671_10786221 | 3300025914 | Unclassified | 755 |
| 237 | Ga0207693_10002202 | 3300025915 | Bacteria | 16996 |
| 238 | Ga0207693_10135217 | 3300025915 | Bacteria | 1938 |
| 239 | Ga0207693_11470024 | 3300025915 | Bacteria | 504 |
| 240 | Ga0207663_10003571 | 3300025916 | Bacteria | 7630 |
| 241 | Ga0207663_10019761 | 3300025916 | Bacteria | 3802 |
| 242 | Ga0207663_10597325 | 3300025916 | Bacteria | 867 |
| 243 | Ga0207660_10033381 | 3300025917 | Bacteria | 3560 |
| 244 | Ga0207660_10056430 | 3300025917 | Bacteria | 2810 |
| 245 | Ga0207660_10286588 | 3300025917 | Bacteria | 1308 |
| 246 | Ga0207660_10380568 | 3300025917 | Bacteria | 1134 |
| 247 | Ga0207660_10842822 | 3300025917 | Bacteria | 748 |
| 248 | Ga0207660_11401922 | 3300025917 | Bacteria | 566 |
| 249 | Ga0207662_10494781 | 3300025918 | Unclassified | 841 |
| 250 | Ga0207657_10044826 | 3300025919 | Bacteria | 3885 |
| 251 | Ga0207657_10137356 | 3300025919 | Bacteria | 1999 |
| 252 | Ga0207657_10201819 | 3300025919 | Bacteria | 1599 |
| 253 | Ga0207649_11287647 | 3300025920 | Bacteria | 578 |
| 254 | Ga0207652_10101655 | 3300025921 | Bacteria | 2539 |
| 255 | Ga0207652_10291925 | 3300025921 | Bacteria | 1471 |
| 256 | Ga0207652_10528923 | 3300025921 | Bacteria | 1061 |
| 257 | Ga0207652_10806233 | 3300025921 | Unclassified | 833 |
| 258 | Ga0207652_10846460 | 3300025921 | Bacteria | 810 |
| 259 | Ga0207652_10896633 | 3300025921 | Unclassified | 783 |
| 260 | Ga0207652_11188861 | 3300025921 | Bacteria | 664 |
| 261 | Ga0207646_10356640 | 3300025922 | Unclassified | 1321 |
| 262 | Ga0207694_10033763 | 3300025924 | Bacteria | 3920 |
| 263 | Ga0207659_11471315 | 3300025926 | Bacteria | 583 |
| 264 | Ga0207687_10146153 | 3300025927 | Unclassified | 1799 |
| 265 | Ga0207687_10505718 | 3300025927 | Bacteria | 1009 |
| 266 | Ga0207687_11226320 | 3300025927 | Unclassified | 645 |
| 267 | Ga0207687_11962266 | 3300025927 | Unclassified | 500 |
| 268 | Ga0207700_10036475 | 3300025928 | Bacteria | 3552 |
| 269 | Ga0207700_10420219 | 3300025928 | Unclassified | 1174 |
| 270 | Ga0207664_10001609 | 3300025929 | Bacteria | 14849 |
| 271 | Ga0207664_10004974 | 3300025929 | Bacteria | 9035 |
| 272 | Ga0207664_10460075 | 3300025929 | Bacteria | 1136 |
| 273 | Ga0207664_10477977 | 3300025929 | Unclassified | 1114 |
| 274 | Ga0207664_11040651 | 3300025929 | Bacteria | 733 |
| 275 | Ga0207664_11752494 | 3300025929 | Unclassified | 543 |
| 276 | Ga0207664_11809616 | 3300025929 | Unclassified | 533 |
| 277 | Ga0207644_10308682 | 3300025931 | Unclassified | 1277 |
| 278 | Ga0207644_11724278 | 3300025931 | Unclassified | 525 |
| 279 | Ga0207644_11743499 | 3300025931 | Unclassified | 521 |
| 280 | Ga0207690_10102201 | 3300025932 | Bacteria | 2049 |
| 281 | Ga0207690_10816024 | 3300025932 | Bacteria | 771 |
| 282 | Ga0207690_11033481 | 3300025932 | Unclassified | 684 |
| 283 | Ga0207706_10803108 | 3300025933 | Unclassified | 799 |
| 284 | Ga0207706_10978598 | 3300025933 | Bacteria | 712 |
| 285 | Ga0207704_10229245 | 3300025938 | Bacteria | 1380 |
| 286 | Ga0207665_10001140 | 3300025939 | Bacteria | 17874 |
| 287 | Ga0207665_10347307 | 3300025939 | Bacteria | 1119 |
| 288 | Ga0207711_10716038 | 3300025941 | Bacteria | 933 |
| 289 | Ga0207711_11483967 | 3300025941 | Archaea | 621 |
| 290 | Ga0207711_11576274 | 3300025941 | Archaea | 600 |
| 291 | Ga0207661_10116140 | 3300025944 | Bacteria | 2271 |
| 292 | Ga0207661_10139196 | 3300025944 | Bacteria | 2087 |
| 293 | Ga0207661_10354710 | 3300025944 | Bacteria | 1324 |
| 294 | Ga0207661_10916739 | 3300025944 | Unclassified | 807 |
| 295 | Ga0207661_11537765 | 3300025944 | Unclassified | 609 |
| 296 | Ga0207661_11602907 | 3300025944 | Unclassified | 596 |
| 297 | Ga0207661_12170801 | 3300025944 | Bacteria | 501 |
| 298 | Ga0207679_10514788 | 3300025945 | Bacteria | 1069 |
| 299 | Ga0207667_10396537 | 3300025949 | Bacteria | 1405 |
| 300 | Ga0207651_10464865 | 3300025960 | Unclassified | 1088 |
| 301 | Ga0207712_11785080 | 3300025961 | Bacteria | 551 |
| 302 | Ga0207640_10636946 | 3300025981 | Unclassified | 907 |
| 303 | Ga0207677_10560669 | 3300026023 | Unclassified | 997 |
| 304 | Ga0207703_11828374 | 3300026035 | Unclassified | 584 |
| 305 | Ga0207639_11025116 | 3300026041 | Bacteria | 773 |
| 306 | Ga0207678_10741938 | 3300026067 | Bacteria | 865 |
| 307 | Ga0207678_11335814 | 3300026067 | Unclassified | 634 |
| 308 | Ga0207702_10066346 | 3300026078 | Bacteria | 3093 |
| 309 | Ga0207702_10137271 | 3300026078 | Bacteria | 2208 |
| 310 | Ga0207702_11033479 | 3300026078 | Bacteria | 815 |
| 311 | Ga0207648_11571287 | 3300026089 | Unclassified | 618 |
| 312 | Ga0207676_10459705 | 3300026095 | Unclassified | 1202 |
| 313 | Ga0207683_11349474 | 3300026121 | Bacteria | 660 |
| 314 | Ga0207698_10959231 | 3300026142 | Unclassified | 864 |
| 315 | Ga0207698_11051181 | 3300026142 | Bacteria | 826 |
| 316 | Ga0207428_10156120 | 3300027907 | Unclassified | 1735 |
| 317 | Ga0268266_11254832 | 3300028379 | Unclassified | 716 |
| 318 | Ga0265337_1060553 | 3300028556 | Bacteria | 1050 |
| 319 | Ga0265334_10025424 | 3300028573 | Bacteria | 2396 |
| 320 | Ga0265334_10114417 | 3300028573 | Bacteria | 968 |
| 321 | Ga0265318_10032382 | 3300028577 | Bacteria | 2023 |
| 322 | Ga0265322_10034572 | 3300028654 | Bacteria | 1440 |
| 323 | Ga0265336_10017841 | 3300028666 | Bacteria | 2306 |
| 324 | Ga0265336_10075832 | 3300028666 | Unclassified | 1004 |
| 325 | Ga0265338_10003515 | 3300028800 | Bacteria | 21949 |
| 326 | Ga0265338_10009802 | 3300028800 | Bacteria | 11356 |
| 327 | Ga0265338_10044099 | 3300028800 | Bacteria | 4123 |
| 328 | Ga0265338_10047409 | 3300028800 | Bacteria | 3924 |
| 329 | Ga0265330_10099369 | 3300031235 | Bacteria | 1246 |
| 330 | Ga0265332_10028012 | 3300031238 | Bacteria | 2467 |
| 331 | Ga0265325_10018923 | 3300031241 | Bacteria | 3815 |
| 332 | Ga0265329_10090670 | 3300031242 | Bacteria | 970 |
| 333 | Ga0265340_10490417 | 3300031247 | Bacteria | 541 |
| 334 | Ga0265327_10004489 | 3300031251 | Bacteria | 12329 |
| 335 | Ga0265327_10027140 | 3300031251 | Bacteria | 3301 |
| 336 | Ga0265327_10354442 | 3300031251 | Bacteria | 640 |
| 337 | Ga0265316_10105558 | 3300031344 | Bacteria | 2137 |
| 338 | Ga0265313_10007235 | 3300031595 | Bacteria | 7635 |
| 339 | Ga0265313_10066148 | 3300031595 | Bacteria | 1676 |
| 340 | Ga0265314_10086718 | 3300031711 | Bacteria | 2048 |
| 341 | Ga0265342_10384072 | 3300031712 | Unclassified | 727 |
| 342 | Ga0307405_10713404 | 3300031731 | Unclassified | 832 |
| 343 | Ga0307407_11353387 | 3300031903 | Unclassified | 560 |
| 344 | Ga0307409_100230655 | 3300031995 | Unclassified | 1678 |
| 345 | Ga0307416_100576903 | 3300032002 | Unclassified | 1201 |
| 346 | Ga0307415_100361217 | 3300032126 | Unclassified | 1226 |
| 347 | Ga0316583_10157755 | 3300032133 | Bacteria | 790 |
| 348 | Ga0316583_10244609 | 3300032133 | Bacteria | 621 |
| 349 | Ga0373948_0105794 | 3300034817 | Unclassified | 667 |
| 350 | Ga0373948_0107953 | 3300034817 | Bacteria | 662 |
| 351 | Ga0373958_0194308 | 3300034819 | Unclassified | 529 |
| 352 | Ga0373959_0062929 | 3300034820 | Bacteria | 825 |
| 353 | Ga0373938_0032742 | 3300034957 | Unclassified | 1121 |
| 354 | Ga0373926_0047449 | 3300035083 | Bacteria | 1543 |
| 355 | Ga0373926_0049612 | 3300035083 | Bacteria | 1512 |
| 356 | Ga0373928_0020857 | 3300035084 | Bacteria | 1377 |
| 357 | Ga0373929_0061945 | 3300035085 | Unclassified | 878 |
| 358 | Ga0373934_0359379 | 3300035086 | Bacteria | 607 |
| 359 | Ga0373940_0053404 | 3300035088 | Unclassified | 1140 |
| 360 | Ga0373944_0410587 | 3300035089 | Unclassified | 523 |
| 361 | Ga0373952_0290234 | 3300035092 | Unclassified | 507 |
| 362 | Ga0373945_0014009 | 3300035116 | Bacteria | 2682 |
| 363 | Ga0373945_0029445 | 3300035116 | Bacteria | 1930 |
| 364 | Ga0373945_0569445 | 3300035116 | Unclassified | 510 |
| 365 | Ga0373953_0491730 | 3300035117 | Unclassified | 543 |
| 366 | Ga0373956_0149673 | 3300035119 | Unclassified | 1098 |
| 367 | Ga0373960_0137675 | 3300035121 | Bacteria | 824 |
| 368 | Ga0373943_0015268 | 3300035170 | Bacteria | 3487 |
| 369 | Ga0373943_0686444 | 3300035170 | Bacteria | 606 |
| 370 | Ga0373946_0020493 | 3300035171 | Bacteria | 2556 |
| 371 | Ga0373946_0026705 | 3300035171 | Bacteria | 2280 |
| 372 | Ga0373955_0577222 | 3300035172 | Bacteria | 688 |
| 373 | Ga0373955_0730131 | 3300035172 | Bacteria | 608 |
| 374 | Ga0373924_0211246 | 3300035410 | Unclassified | 857 |
| 375 | Ga0373924_0425623 | 3300035410 | Unclassified | 594 |
| 376 | Ga0373924_0522235 | 3300035410 | Bacteria | 534 |
| 377 | Ga0373931_0068548 | 3300035691 | Unclassified | 1931 |
| 378 | Ga0373931_0421327 | 3300035691 | Unclassified | 849 |
| 379 | Ga0373935_0067291 | 3300035692 | Bacteria | 2303 |
| 380 | Ga0373935_0381878 | 3300035692 | Unclassified | 1009 |
| 381 | Ga0373927_0046932 | 3300035695 | Bacteria | 2794 |
| 382 | Ga0373933_0079441 | 3300035724 | Bacteria | 2009 |
| 383 | Ga0373947_0012958 | 3300035725 | Bacteria | 4780 |
| 384 | Ga0373947_0082679 | 3300035725 | Bacteria | 1990 |
| 385 | Ga0373947_0696405 | 3300035725 | Unclassified | 693 |
| 386 | Ga0373937_0038431 | 3300036401 | Bacteria | 4360 |
| 387 | Ga0373937_0882978 | 3300036401 | Unclassified | 843 |
| 388 | Ga0373925_0009943 | 3300037068 | Bacteria | 6909 |
| 389 | Ga0373925_0029959 | 3300037068 | Bacteria | 3992 |
| 390 | Ga0395899_0020914 | 3300037312 | Bacteria | 4963 |
| 391 | Ga0395899_0070021 | 3300037312 | Bacteria | 2567 |
| 392 | Ga0395899_0215897 | 3300037312 | Bacteria | 1331 |
| 393 | Ga0395899_0936207 | 3300037312 | Unclassified | 526 |
| 394 | Ga0395900_0076531 | 3300037418 | Bacteria | 3439 |
| 395 | Ga0395900_0112617 | 3300037418 | Bacteria | 2794 |
| 396 | Ga0395900_0319831 | 3300037418 | Bacteria | 1532 |
| 397 | Ga0395900_0340838 | 3300037418 | Bacteria | 1474 |
| 398 | Ga0395900_0727276 | 3300037418 | Unclassified | 924 |
| 399 | Ga0395900_0879655 | 3300037418 | Bacteria | 820 |
| 400 | Ga0395900_0896768 | 3300037418 | Bacteria | 810 |
| 401 | Ga0395900_1010427 | 3300037418 | Bacteria | 751 |
| 402 | Ga0395900_1352527 | 3300037418 | Bacteria | 626 |
| 403 | Ga0395898_0038648 | 3300037466 | Bacteria | 4728 |
| 404 | Ga0395898_0096858 | 3300037466 | Bacteria | 2834 |
| 405 | Ga0395898_0274595 | 3300037466 | Unclassified | 1607 |
| 406 | Ga0395898_0581555 | 3300037466 | Bacteria | 1062 |
| 407 | Ga0395898_0973258 | 3300037466 | Bacteria | 785 |
| 408 | Ga0395898_1269438 | 3300037466 | Unclassified | 666 |
| 409 | Ga0395905_0043423 | 3300037471 | Bacteria | 4217 |
| 410 | Ga0395905_0354707 | 3300037471 | Bacteria | 1359 |
| 411 | Ga0395905_0678769 | 3300037471 | Unclassified | 932 |
| 412 | Ga0395905_1206246 | 3300037471 | Bacteria | 660 |
| 413 | Ga0395901_0048637 | 3300038443 | Bacteria | 4404 |
| 414 | Ga0395901_0440504 | 3300038443 | Bacteria | 1334 |
| 415 | Ga0395901_0691525 | 3300038443 | Unclassified | 1018 |
| 416 | Ga0395901_0696359 | 3300038443 | Bacteria | 1014 |
| 417 | Ga0395901_0822598 | 3300038443 | Bacteria | 916 |
| 418 | Ga0395901_0954329 | 3300038443 | Unclassified | 836 |
| 419 | Ga0395901_0969441 | 3300038443 | Bacteria | 828 |
| 420 | Ga0395901_1228699 | 3300038443 | Bacteria | 714 |
| 421 | Ga0436365_1190190 | 3300039437 | Unclassified | 620 |
| 422 | Ga0436365_1505933 | 3300039437 | Bacteria | 831 |
| 423 | Ga0436360_0797120 | 3300039438 | Bacteria | 1240 |
| 424 | Ga0436363_0947939 | 3300039450 | Unclassified | 613 |
| 425 | Ga0436363_1605281 | 3300039450 | Bacteria | 1278 |
| 426 | Ga0436362_0023355 | 3300039453 | Bacteria | 965 |
| 427 | Ga0451793_1601599 | 3300041452 | Unclassified | 571 |
| 428 | Ga0451800_0468417 | 3300041459 | Unclassified | 575 |
| 429 | Ga0451835_0395632 | 3300041492 | Unclassified | 641 |
| 430 | Ga0451845_0708858 | 3300041501 | Unclassified | 821 |
| 431 | Ga0451851_1210558 | 3300041507 | Unclassified | 549 |
| 432 | Ga0439448_0108015 | 3300042005 | Bacteria | 949 |
| 433 | Ga0466969_0019346 | 3300044656 | Unclassified | 3541 |
| 434 | Ga0466969_0023023 | 3300044656 | Bacteria | 3212 |
| 435 | Ga0466969_0219409 | 3300044656 | Unclassified | 865 |
| 436 | Ga0453683_0392787 | 3300044673 | Unclassified | 894 |
| 437 | Ga0466965_0149736 | 3300044683 | Bacteria | 1219 |
| 438 | Ga0466965_0243892 | 3300044683 | Unclassified | 962 |
| 439 | Ga0466966_0090406 | 3300044684 | Bacteria | 1901 |
| 440 | Ga0466966_0119824 | 3300044684 | Bacteria | 1617 |
| 441 | Ga0466966_0216779 | 3300044684 | Unclassified | 1156 |
| 442 | Ga0466966_0706156 | 3300044684 | Bacteria | 608 |
| 443 | Ga0466966_0909745 | 3300044684 | Bacteria | 530 |
| 444 | Ga0466961_0012971 | 3300044693 | Bacteria | 5331 |
| 445 | Ga0466961_0020838 | 3300044693 | Bacteria | 4219 |
| 446 | Ga0466961_0059397 | 3300044693 | Bacteria | 2432 |
| 447 | Ga0466961_0080403 | 3300044693 | Bacteria | 2063 |
| 448 | Ga0466961_0209881 | 3300044693 | Unclassified | 1202 |
| 449 | Ga0466961_0215387 | 3300044693 | Bacteria | 1185 |
| 450 | Ga0466961_0269262 | 3300044693 | Unclassified | 1044 |
| 451 | Ga0466961_0638924 | 3300044693 | Bacteria | 639 |
| 452 | Ga0466961_0679850 | 3300044693 | Bacteria | 617 |
| 453 | Ga0466961_0744289 | 3300044693 | Bacteria | 586 |
| 454 | Ga0466961_0826467 | 3300044693 | Unclassified | 553 |
| 455 | Ga0466963_0002677 | 3300044694 | Bacteria | 10032 |
| 456 | Ga0466963_0003889 | 3300044694 | Bacteria | 8623 |
| 457 | Ga0466963_0006203 | 3300044694 | Bacteria | 7061 |
| 458 | Ga0466963_0008754 | 3300044694 | Bacteria | 6078 |
| 459 | Ga0466963_0015154 | 3300044694 | Bacteria | 4767 |
| 460 | Ga0466963_0021769 | 3300044694 | Bacteria | 4049 |
| 461 | Ga0466963_0033491 | 3300044694 | Bacteria | 3336 |
| 462 | Ga0466963_0038785 | 3300044694 | Bacteria | 3117 |
| 463 | Ga0466963_0079127 | 3300044694 | Bacteria | 2224 |
| 464 | Ga0466963_0089585 | 3300044694 | Bacteria | 2093 |
| 465 | Ga0466963_0124090 | 3300044694 | Bacteria | 1779 |
| 466 | Ga0466963_0151220 | 3300044694 | Bacteria | 1612 |
| 467 | Ga0466963_0385080 | 3300044694 | Unclassified | 988 |
| 468 | Ga0466963_0431417 | 3300044694 | Unclassified | 929 |
| 469 | Ga0466963_0504215 | 3300044694 | Bacteria | 854 |
| 470 | Ga0466963_0547778 | 3300044694 | Unclassified | 817 |
| 471 | Ga0466963_1320784 | 3300044694 | Bacteria | 506 |
| 472 | Ga0466964_0000606 | 3300044706 | Bacteria | 11362 |
| 473 | Ga0466964_0078933 | 3300044706 | Archaea | 1408 |
| 474 | Ga0466964_0163420 | 3300044706 | Bacteria | 1042 |
| 475 | Ga0466964_0174304 | 3300044706 | Unclassified | 1015 |
| 476 | Ga0466964_0233796 | 3300044706 | Bacteria | 898 |
| 477 | Ga0466964_0239476 | 3300044706 | Unclassified | 889 |
| 478 | Ga0466964_0749754 | 3300044706 | Unclassified | 548 |
| 479 | Ga0466964_0771182 | 3300044706 | Bacteria | 541 |
| 480 | Ga0466971_0006232 | 3300044719 | Bacteria | 5184 |
| 481 | Ga0466971_0010936 | 3300044719 | Bacteria | 3970 |
| 482 | Ga0466971_0046865 | 3300044719 | Unclassified | 1942 |
| 483 | Ga0466971_0163313 | 3300044719 | Bacteria | 1043 |
| 484 | Ga0466968_0002271 | 3300044735 | Bacteria | 7025 |
| 485 | Ga0466968_0004485 | 3300044735 | Bacteria | 5220 |
| 486 | Ga0466968_0005377 | 3300044735 | Bacteria | 4792 |
| 487 | Ga0466968_0074794 | 3300044735 | Bacteria | 1480 |
| 488 | Ga0466968_0291978 | 3300044735 | Unclassified | 782 |
| 489 | Ga0466968_0337404 | 3300044735 | Unclassified | 730 |
| 490 | Ga0466968_0565715 | 3300044735 | Bacteria | 571 |
| 491 | Ga0466970_0005237 | 3300044765 | Bacteria | 6419 |
| 492 | Ga0466970_0176783 | 3300044765 | Unclassified | 1184 |
| 493 | Ga0466970_0727246 | 3300044765 | Bacteria | 579 |
| 494 | Ga0466970_0934276 | 3300044765 | Bacteria | 511 |
| 495 | Ga0466957_0005092 | 3300044842 | Bacteria | 7351 |
| 496 | Ga0466957_0090892 | 3300044842 | Bacteria | 1912 |
| 497 | Ga0466957_0214946 | 3300044842 | Unclassified | 1267 |
| 498 | Ga0466957_0219858 | 3300044842 | Unclassified | 1254 |
| 499 | Ga0466957_0270103 | 3300044842 | Bacteria | 1135 |
| 500 | Ga0466957_0280783 | 3300044842 | Bacteria | 1114 |
| 501 | Ga0466957_0376391 | 3300044842 | Bacteria | 967 |
| 502 | Ga0466957_0469353 | 3300044842 | Unclassified | 869 |
| 503 | Ga0466957_0488315 | 3300044842 | Bacteria | 852 |
| 504 | Ga0466957_0770629 | 3300044842 | Bacteria | 682 |
| 505 | Ga0466957_0929110 | 3300044842 | Bacteria | 623 |
| 506 | Ga0466960_0080835 | 3300044901 | Unclassified | 1637 |
| 507 | Ga0466960_0095494 | 3300044901 | Bacteria | 1522 |
| 508 | Ga0466960_0309226 | 3300044901 | Unclassified | 892 |
| 509 | Ga0466960_0343511 | 3300044901 | Bacteria | 850 |
| 510 | Ga0466959_0001430 | 3300045049 | Bacteria | 14615 |
| 511 | Ga0466959_0014657 | 3300045049 | Bacteria | 5703 |
| 512 | Ga0466959_0050671 | 3300045049 | Bacteria | 3047 |
| 513 | Ga0466959_0099997 | 3300045049 | Bacteria | 2076 |
| 514 | Ga0466959_0166867 | 3300045049 | Bacteria | 1546 |
| 515 | Ga0466959_0278007 | 3300045049 | Bacteria | 1149 |
| 516 | Ga0466959_0319057 | 3300045049 | Bacteria | 1062 |
| 517 | Ga0466959_0494639 | 3300045049 | Bacteria | 827 |
| 518 | Ga0466959_0599116 | 3300045049 | Bacteria | 741 |
| 519 | Ga0466959_0710541 | 3300045049 | Unclassified | 673 |
| 520 | Ga0466958_0018517 | 3300045836 | Bacteria | 4042 |
| 521 | Ga0466958_0035358 | 3300045836 | Bacteria | 2984 |
| 522 | Ga0466958_0037941 | 3300045836 | Bacteria | 2888 |
| 523 | Ga0466958_0057958 | 3300045836 | Bacteria | 2354 |
| 524 | Ga0466958_0065609 | 3300045836 | Bacteria | 2215 |
| 525 | Ga0466958_0083367 | 3300045836 | Bacteria | 1970 |
| 526 | Ga0466958_0129652 | 3300045836 | Bacteria | 1583 |
| 527 | Ga0466958_0248838 | 3300045836 | Bacteria | 1136 |
| 528 | Ga0466958_0459286 | 3300045836 | Bacteria | 825 |
| 529 | Ga0466958_0487546 | 3300045836 | Bacteria | 799 |
| 530 | Ga0466958_0567733 | 3300045836 | Bacteria | 737 |
| 531 | Ga0466958_0730568 | 3300045836 | Bacteria | 645 |
| 532 | Ga0466958_0772406 | 3300045836 | Unclassified | 626 |
| 533 | Ga0466967_0006945 | 3300045976 | Bacteria | 8097 |
| 534 | Ga0466967_0016687 | 3300045976 | Bacteria | 5800 |
| 535 | Ga0466967_0018925 | 3300045976 | Bacteria | 5523 |
| 536 | Ga0466967_0045118 | 3300045976 | Bacteria | 3828 |
| 537 | Ga0466967_0054010 | 3300045976 | Unclassified | 3533 |
| 538 | Ga0466967_0072616 | 3300045976 | Bacteria | 3084 |
| 539 | Ga0466967_0138966 | 3300045976 | Bacteria | 2261 |
| 540 | Ga0466967_0250297 | 3300045976 | Bacteria | 1692 |
| 541 | Ga0466967_0301568 | 3300045976 | Bacteria | 1541 |
| 542 | Ga0466967_0438368 | 3300045976 | Bacteria | 1275 |
| 543 | Ga0466967_0593718 | 3300045976 | Bacteria | 1092 |
| 544 | Ga0466967_0627841 | 3300045976 | Unclassified | 1061 |
| 545 | Ga0466967_0727559 | 3300045976 | Archaea | 983 |
| 546 | Ga0466967_0742037 | 3300045976 | Bacteria | 973 |
| 547 | Ga0466967_0821205 | 3300045976 | Bacteria | 923 |
| 548 | Ga0466967_0894264 | 3300045976 | Bacteria | 883 |
| 549 | Ga0466967_0956132 | 3300045976 | Bacteria | 852 |
| 550 | Ga0466967_1011715 | 3300045976 | Bacteria | 827 |
| 551 | Ga0466967_1588114 | 3300045976 | Unclassified | 651 |
| 552 | Ga0466967_1726847 | 3300045976 | Unclassified | 623 |
| 553 | Ga0466967_1923499 | 3300045976 | Bacteria | 588 |
| 554 | Ga0466967_2154927 | 3300045976 | Unclassified | 553 |
| 555 | Ga0495617_190785 | 3300046452 | Unclassified | 643 |
| 556 | Ga0495592_0001526 | 3300046454 | Bacteria | 16137 |
| 557 | Ga0495592_0069096 | 3300046454 | Bacteria | 2576 |
| 558 | Ga0495592_0111239 | 3300046454 | Bacteria | 1938 |
| 559 | Ga0495592_0633826 | 3300046454 | Unclassified | 649 |
| 560 | Ga0495603_0349596 | 3300046455 | Unclassified | 848 |
| 561 | Ga0495629_0079401 | 3300046459 | Bacteria | 2291 |
| 562 | Ga0495629_0093246 | 3300046459 | Bacteria | 2101 |
| 563 | Ga0495629_0145491 | 3300046459 | Bacteria | 1648 |
| 564 | Ga0495629_0169497 | 3300046459 | Bacteria | 1515 |
| 565 | Ga0495629_0839677 | 3300046459 | Unclassified | 604 |
| 566 | Ga0495641_0046020 | 3300046461 | Bacteria | 2007 |
| 567 | Ga0495641_0069451 | 3300046461 | Bacteria | 1583 |
| 568 | Ga0495641_0102256 | 3300046461 | Bacteria | 1278 |
| 569 | Ga0495641_0221787 | 3300046461 | Unclassified | 848 |
| 570 | Ga0495651_0001467 | 3300046462 | Bacteria | 18231 |
| 571 | Ga0495651_0094352 | 3300046462 | Unclassified | 2239 |
| 572 | Ga0495653_0000781 | 3300046463 | Bacteria | 24458 |
| 573 | Ga0495653_0264193 | 3300046463 | Unclassified | 1136 |
| 574 | Ga0495582_0096863 | 3300046473 | Unclassified | 1650 |
| 575 | Ga0495582_0133510 | 3300046473 | Bacteria | 1403 |
| 576 | Ga0495582_0149856 | 3300046473 | Bacteria | 1324 |
| 577 | Ga0495582_0564415 | 3300046473 | Unclassified | 659 |
| 578 | Ga0495582_0617203 | 3300046473 | Archaea | 627 |
| 579 | Ga0495605_0118834 | 3300046474 | Bacteria | 1200 |
| 580 | Ga0495639_0249618 | 3300046475 | Bacteria | 877 |
| 581 | Ga0495639_0659167 | 3300046475 | Unclassified | 540 |
| 582 | Ga0495662_0034643 | 3300046476 | Bacteria | 2436 |
| 583 | Ga0495662_0343754 | 3300046476 | Unclassified | 733 |
| 584 | Ga0495664_0312755 | 3300046477 | Bacteria | 948 |
| 585 | Ga0495664_0484269 | 3300046477 | Unclassified | 739 |
| 586 | Ga0495594_0588010 | 3300046499 | Bacteria | 631 |
| 587 | Ga0495608_0009146 | 3300046511 | Bacteria | 6925 |
| 588 | Ga0495608_0372557 | 3300046511 | Unclassified | 876 |
| 589 | Ga0495608_0389823 | 3300046511 | Unclassified | 853 |
| 590 | Ga0495618_0000680 | 3300046514 | Bacteria | 23842 |
| 591 | Ga0495618_0059715 | 3300046514 | Bacteria | 2417 |
| 592 | Ga0495618_0112890 | 3300046514 | Bacteria | 1739 |
| 593 | Ga0495618_0308767 | 3300046514 | Bacteria | 981 |
| 594 | Ga0495618_0658808 | 3300046514 | Bacteria | 618 |
| 595 | Ga0495618_0847597 | 3300046514 | Unclassified | 530 |
| 596 | Ga0495628_0002347 | 3300046516 | Bacteria | 17097 |
| 597 | Ga0495628_0027710 | 3300046516 | Bacteria | 4605 |
| 598 | Ga0495628_0735417 | 3300046516 | Unclassified | 694 |
| 599 | Ga0495628_0936071 | 3300046516 | Unclassified | 599 |
| 600 | Ga0495630_0003475 | 3300046517 | Bacteria | 10948 |
| 601 | Ga0495630_0023872 | 3300046517 | Bacteria | 4520 |
| 602 | Ga0495630_0108360 | 3300046517 | Bacteria | 2104 |
| 603 | Ga0495630_0124145 | 3300046517 | Bacteria | 1959 |
| 604 | Ga0495630_0273116 | 3300046517 | Bacteria | 1291 |
| 605 | Ga0495630_0660431 | 3300046517 | Bacteria | 800 |
| 606 | Ga0495630_0667828 | 3300046517 | Unclassified | 795 |
| 607 | Ga0495630_0675444 | 3300046517 | Unclassified | 790 |
| 608 | Ga0495630_0765747 | 3300046517 | Bacteria | 737 |
| 609 | Ga0495630_0803942 | 3300046517 | Unclassified | 718 |
| 610 | Ga0495630_0978372 | 3300046517 | Unclassified | 643 |
| 611 | Ga0495630_1003238 | 3300046517 | Unclassified | 634 |
| 612 | Ga0495630_1361752 | 3300046517 | Bacteria | 534 |
| 613 | Ga0495666_0035611 | 3300046526 | Bacteria | 2426 |
| 614 | Ga0495642_0107054 | 3300046528 | Bacteria | 1193 |
| 615 | Ga0495652_0002978 | 3300046529 | Bacteria | 17019 |
| 616 | Ga0495652_0117810 | 3300046529 | Bacteria | 2123 |
| 617 | Ga0495652_0283324 | 3300046529 | Bacteria | 1212 |
| 618 | Ga0495652_0313182 | 3300046529 | Bacteria | 1136 |
| 619 | Ga0495652_0356584 | 3300046529 | Bacteria | 1046 |
| 620 | Ga0495665_0013588 | 3300046531 | Bacteria | 4400 |
| 621 | Ga0495665_0297262 | 3300046531 | Bacteria | 827 |
| 622 | Ga0495665_0331054 | 3300046531 | Bacteria | 777 |
| 623 | Ga0495640_0058821 | 3300046533 | Bacteria | 2620 |
| 624 | Ga0495640_0099935 | 3300046533 | Bacteria | 1905 |
| 625 | Ga0495640_0253664 | 3300046533 | Bacteria | 1101 |
| 626 | Ga0495640_0835962 | 3300046533 | Bacteria | 547 |
| 627 | Ga0495586_0016645 | 3300046535 | Bacteria | 3909 |
| 628 | Ga0495586_0283341 | 3300046535 | Bacteria | 948 |
| 629 | Ga0495586_0396117 | 3300046535 | Bacteria | 794 |
| 630 | Ga0495586_0425846 | 3300046535 | Unclassified | 764 |
| 631 | Ga0495586_0439234 | 3300046535 | Unclassified | 752 |
| 632 | Ga0495587_0001454 | 3300046536 | Bacteria | 15799 |
| 633 | Ga0495587_0239347 | 3300046536 | Bacteria | 1021 |
| 634 | Ga0495587_0685182 | 3300046536 | Bacteria | 562 |
| 635 | Ga0495621_0483628 | 3300046539 | Unclassified | 533 |
| 636 | Ga0495645_0000988 | 3300046543 | Bacteria | 19388 |
| 637 | Ga0495645_0119020 | 3300046543 | Bacteria | 1861 |
| 638 | Ga0495645_0120708 | 3300046543 | Bacteria | 1845 |
| 639 | Ga0495667_0113340 | 3300046559 | Bacteria | 1752 |
| 640 | Ga0495667_0254939 | 3300046559 | Bacteria | 1116 |
| 641 | Ga0495667_0295996 | 3300046559 | Bacteria | 1026 |
| 642 | Ga0495667_0402523 | 3300046559 | Bacteria | 862 |
| 643 | Ga0495667_0485417 | 3300046559 | Unclassified | 774 |
| 644 | Ga0495656_0135436 | 3300046615 | Bacteria | 1176 |
| 645 | Ga0495634_0036902 | 3300046642 | Bacteria | 3340 |
| 646 | Ga0495634_0056615 | 3300046642 | Bacteria | 2619 |
| 647 | Ga0495634_0061935 | 3300046642 | Bacteria | 2485 |
| 648 | Ga0495634_0070141 | 3300046642 | Bacteria | 2310 |
| 649 | Ga0495634_0383535 | 3300046642 | Unclassified | 837 |
| 650 | Ga0495634_0678370 | 3300046642 | Unclassified | 594 |
| 651 | Ga0495635_0017484 | 3300046663 | Bacteria | 5008 |
| 652 | Ga0495635_0304861 | 3300046663 | Bacteria | 1067 |
| 653 | Ga0495635_0638355 | 3300046663 | Bacteria | 693 |
| 654 | Ga0495659_0141467 | 3300046664 | Bacteria | 961 |
| 655 | Ga0495657_0010367 | 3300046675 | Bacteria | 7013 |
| 656 | Ga0495657_0018183 | 3300046675 | Bacteria | 5092 |
| 657 | Ga0495657_0408757 | 3300046675 | Unclassified | 798 |
| 658 | Ga0495657_0648035 | 3300046675 | Unclassified | 609 |
| 659 | Ga0495657_0854781 | 3300046675 | Bacteria | 518 |
| 660 | Ga0495599_0001277 | 3300046678 | Bacteria | 14305 |
| 661 | Ga0495599_0002970 | 3300046678 | Bacteria | 9872 |
| 662 | Ga0495623_0004124 | 3300046679 | Bacteria | 9576 |
| 663 | Ga0495646_0010511 | 3300046680 | Bacteria | 5880 |
| 664 | Ga0495646_0010885 | 3300046680 | Bacteria | 5777 |
| 665 | Ga0495646_0323741 | 3300046680 | Bacteria | 811 |
| 666 | Ga0495647_0228303 | 3300046681 | Unclassified | 824 |
| 667 | Ga0495647_0261465 | 3300046681 | Unclassified | 772 |
| 668 | Ga0495647_0310184 | 3300046681 | Bacteria | 712 |
| 669 | Ga0495647_0356351 | 3300046681 | Unclassified | 666 |
| 670 | Ga0495658_0024133 | 3300046683 | Bacteria | 3235 |
| 671 | Ga0495658_0147251 | 3300046683 | Unclassified | 1444 |
| 672 | Ga0495658_0213883 | 3300046683 | Bacteria | 1205 |
| 673 | Ga0495658_0526691 | 3300046683 | Unclassified | 756 |
| 674 | Ga0495613_0097374 | 3300046689 | Bacteria | 2126 |
| 675 | Ga0495613_0362797 | 3300046689 | Bacteria | 993 |
| 676 | Ga0495613_0431194 | 3300046689 | Bacteria | 895 |
| 677 | Ga0495613_0580393 | 3300046689 | Unclassified | 747 |
| 678 | Ga0495624_0009082 | 3300046690 | Bacteria | 6897 |
| 679 | Ga0495624_0324851 | 3300046690 | Bacteria | 926 |
| 680 | Ga0495670_0820989 | 3300046691 | Unclassified | 508 |
| 681 | Ga0495671_0326370 | 3300046692 | Bacteria | 737 |
| 682 | Ga0495600_0006726 | 3300046809 | Bacteria | 7008 |
| 683 | Ga0495581_0073484 | 3300047315 | Bacteria | 1978 |
| 684 | Ga0495581_0529566 | 3300047315 | Unclassified | 684 |
| 685 | Ga0495604_0012690 | 3300047317 | Bacteria | 6703 |
| 686 | Ga0495636_0297975 | 3300047318 | Bacteria | 754 |
| 687 | Ga0495674_0161940 | 3300047319 | Bacteria | 1871 |
| 688 | Ga0495674_0168263 | 3300047319 | Bacteria | 1830 |
| 689 | Ga0495674_0224628 | 3300047319 | Bacteria | 1551 |
| 690 | Ga0495674_0235661 | 3300047319 | Bacteria | 1509 |
| 691 | Ga0495674_0587486 | 3300047319 | Bacteria | 883 |
| 692 | Ga0495674_0706930 | 3300047319 | Unclassified | 790 |
| 693 | Ga0495674_1049500 | 3300047319 | Unclassified | 622 |
| 694 | Ga0495674_1420164 | 3300047319 | Bacteria | 516 |
| 695 | Ga0495676_0060498 | 3300047321 | Bacteria | 2967 |
| 696 | Ga0495676_0158235 | 3300047321 | Bacteria | 1605 |
| 697 | Ga0495676_0209132 | 3300047321 | Bacteria | 1351 |
| 698 | Ga0495676_0307635 | 3300047321 | Bacteria | 1067 |
| 699 | Ga0495676_0597960 | 3300047321 | Unclassified | 718 |
| 700 | Ga0495676_0944601 | 3300047321 | Unclassified | 551 |
| 701 | Ga0495680_0006100 | 3300047322 | Bacteria | 11252 |
| 702 | Ga0495680_0194644 | 3300047322 | Bacteria | 1457 |
| 703 | Ga0495680_0252107 | 3300047322 | Unclassified | 1251 |
| 704 | Ga0495680_0477257 | 3300047322 | Bacteria | 850 |
| 705 | Ga0495680_0694648 | 3300047322 | Unclassified | 672 |
| 706 | Ga0495675_0000809 | 3300047444 | Bacteria | 19282 |
| 707 | Ga0495675_0243922 | 3300047444 | Bacteria | 1081 |
| 708 | Ga0495677_0121939 | 3300047445 | Unclassified | 995 |
| 709 | Ga0495684_0046785 | 3300047471 | Bacteria | 3309 |
| 710 | Ga0495684_0082589 | 3300047471 | Bacteria | 2437 |
| 711 | Ga0495684_0269746 | 3300047471 | Bacteria | 1232 |
| 712 | Ga0495684_0369064 | 3300047471 | Bacteria | 1015 |
| 713 | Ga0495593_0068368 | 3300047673 | Bacteria | 1848 |
| 714 | Ga0495593_0163249 | 3300047673 | Bacteria | 1124 |
| 715 | Ga0495602_0001857 | 3300048088 | Bacteria | 21151 |
| 716 | Ga0495602_0091252 | 3300048088 | Bacteria | 2527 |
| 717 | Ga0495614_0009099 | 3300048089 | Bacteria | 4402 |
| 718 | Ga0496100_0105858 | 3300048903 | Bacteria | 1946 |
| 719 | Ga0496100_0115702 | 3300048903 | Bacteria | 1870 |
| 720 | Ga0496100_0117641 | 3300048903 | Unclassified | 1855 |
| 721 | Ga0496100_0253528 | 3300048903 | Unclassified | 1302 |
| 722 | Ga0496100_0792777 | 3300048903 | Bacteria | 742 |
| 723 | Ga0496100_0863746 | 3300048903 | Unclassified | 710 |
| 724 | Ga0496100_1009048 | 3300048903 | Unclassified | 655 |
| 725 | Ga0496100_1269124 | 3300048903 | Bacteria | 581 |
| 726 | Ga0496101_0024104 | 3300048904 | Bacteria | 4209 |
| 727 | Ga0496101_0088218 | 3300048904 | Bacteria | 2303 |
| 728 | Ga0496101_0206192 | 3300048904 | Bacteria | 1521 |
| 729 | Ga0496101_0307002 | 3300048904 | Bacteria | 1243 |
| 730 | Ga0496101_0459659 | 3300048904 | Unclassified | 1004 |
| 731 | Ga0496101_0811977 | 3300048904 | Bacteria | 737 |
| 732 | Ga0496101_1547787 | 3300048904 | Bacteria | 516 |
| 733 | Ga0496102_0017242 | 3300048905 | Bacteria | 6324 |
| 734 | Ga0496102_0226077 | 3300048905 | Unclassified | 1764 |
| 735 | Ga0496102_0290048 | 3300048905 | Bacteria | 1542 |
| 736 | Ga0496102_0479947 | 3300048905 | Unclassified | 1164 |
| 737 | Ga0496102_1367577 | 3300048905 | Unclassified | 627 |
| 738 | Ga0496103_0012805 | 3300048906 | Bacteria | 4974 |
| 739 | Ga0496103_1050631 | 3300048906 | Unclassified | 505 |
| 740 | Ga0496104_0064535 | 3300048907 | Bacteria | 3473 |
| 741 | Ga0496104_0150006 | 3300048907 | Unclassified | 2238 |
| 742 | Ga0496104_0423921 | 3300048907 | Bacteria | 1242 |
| 743 | Ga0496104_0595201 | 3300048907 | Archaea | 1016 |
| 744 | Ga0496104_0736702 | 3300048907 | Unclassified | 893 |
| 745 | Ga0496104_1030380 | 3300048907 | Unclassified | 727 |
| 746 | Ga0496105_0031205 | 3300048908 | Bacteria | 4368 |
| 747 | Ga0496105_0199502 | 3300048908 | Bacteria | 1633 |
| 748 | Ga0496105_0257819 | 3300048908 | Unclassified | 1411 |
| 749 | Ga0496105_0619102 | 3300048908 | Bacteria | 838 |
| 750 | Ga0496106_0012999 | 3300048909 | Bacteria | 6141 |
| 751 | Ga0496106_0338864 | 3300048909 | Archaea | 1207 |
| 752 | Ga0496106_1341844 | 3300048909 | Bacteria | 554 |
| 753 | Ga0496107_0005142 | 3300048910 | Bacteria | 8928 |
| 754 | Ga0496107_0385608 | 3300048910 | Bacteria | 1042 |
| 755 | Ga0496108_0012844 | 3300048911 | Bacteria | 6821 |
| 756 | Ga0496108_0061399 | 3300048911 | Bacteria | 3162 |
| 757 | Ga0496108_0078793 | 3300048911 | Bacteria | 2789 |
| 758 | Ga0496108_0133200 | 3300048911 | Bacteria | 2136 |
| 759 | Ga0496108_0694735 | 3300048911 | Unclassified | 882 |
| 760 | Ga0496108_0730804 | 3300048911 | Bacteria | 857 |
| 761 | Ga0496108_0801673 | 3300048911 | Bacteria | 812 |
| 762 | Ga0496109_0034832 | 3300048912 | Unclassified | 4538 |
| 763 | Ga0496109_0073842 | 3300048912 | Bacteria | 3134 |
| 764 | Ga0496109_0155672 | 3300048912 | Bacteria | 2140 |
| 765 | Ga0496109_0201436 | 3300048912 | Bacteria | 1871 |
| 766 | Ga0496109_0241351 | 3300048912 | Unclassified | 1700 |
| 767 | Ga0496109_0302125 | 3300048912 | Unclassified | 1509 |
| 768 | Ga0496110_0039901 | 3300048913 | Bacteria | 4090 |
| 769 | Ga0496110_0326317 | 3300048913 | Bacteria | 1398 |
| 770 | Ga0496110_0526511 | 3300048913 | Bacteria | 1075 |
| 771 | Ga0496110_0665963 | 3300048913 | Bacteria | 941 |
| 772 | Ga0496111_0002119 | 3300048914 | Bacteria | 11851 |
| 773 | Ga0496111_0121645 | 3300048914 | Unclassified | 1928 |
| 774 | Ga0496111_0382679 | 3300048914 | Bacteria | 1040 |
| 775 | Ga0496111_0598673 | 3300048914 | Bacteria | 807 |
| 776 | Ga0496112_0015040 | 3300048915 | Bacteria | 7203 |
| 777 | Ga0496112_0043585 | 3300048915 | Bacteria | 4393 |
| 778 | Ga0496112_0059102 | 3300048915 | Bacteria | 3777 |
| 779 | Ga0496112_0082100 | 3300048915 | Unclassified | 3188 |
| 780 | Ga0496112_0123442 | 3300048915 | Bacteria | 2561 |
| 781 | Ga0496112_0196892 | 3300048915 | Unclassified | 1975 |
| 782 | Ga0496112_0207476 | 3300048915 | Bacteria | 1917 |
| 783 | Ga0496112_0652248 | 3300048915 | Unclassified | 982 |
| 784 | Ga0496112_1055089 | 3300048915 | Bacteria | 731 |
| 785 | Ga0496113_0643510 | 3300048916 | Unclassified | 848 |
| 786 | Ga0496113_0738146 | 3300048916 | Bacteria | 784 |
| 787 | Ga0496113_0875561 | 3300048916 | Unclassified | 711 |
| 788 | Ga0496114_0012447 | 3300048917 | Bacteria | 6811 |
| 789 | Ga0496114_0030886 | 3300048917 | Bacteria | 4407 |
| 790 | Ga0496114_0085324 | 3300048917 | Bacteria | 2674 |
| 791 | Ga0496114_0112319 | 3300048917 | Unclassified | 2335 |
| 792 | Ga0496115_0056169 | 3300048918 | Archaea | 3164 |
| 793 | Ga0496115_0161337 | 3300048918 | Bacteria | 1852 |
| 794 | Ga0496115_0197635 | 3300048918 | Unclassified | 1661 |
| 795 | Ga0501032_0511454 | 3300049569 | Bacteria | 767 |
| 796 | Ga0501033_1058100 | 3300049570 | Archaea | 541 |
| 797 | Ga0501034_0877154 | 3300049571 | Unclassified | 786 |
| 798 | Ga0501034_1366071 | 3300049571 | Unclassified | 584 |
| 799 | Ga0501046_0433765 | 3300049580 | Bacteria | 946 |
| 800 | Ga0501047_0258008 | 3300049581 | Bacteria | 1591 |
| 801 | Ga0501047_0325760 | 3300049581 | Bacteria | 1375 |
| 802 | Ga0501047_0470892 | 3300049581 | Bacteria | 1084 |
| 803 | Ga0501047_0987508 | 3300049581 | Unclassified | 655 |
| 804 | Ga0501067_0032576 | 3300049583 | Bacteria | 2893 |
| 805 | Ga0501067_0283683 | 3300049583 | Archaea | 922 |
| 806 | Ga0501067_0359540 | 3300049583 | Bacteria | 812 |
| 807 | Ga0501068_0648445 | 3300049584 | Unclassified | 689 |
| 808 | Ga0501069_0030953 | 3300049585 | Bacteria | 2941 |
| 809 | Ga0501070_0011133 | 3300049586 | Bacteria | 7592 |
| 810 | Ga0501070_0247307 | 3300049586 | Bacteria | 1459 |
| 811 | Ga0501070_0758133 | 3300049586 | Bacteria | 764 |
| 812 | Ga0501070_1158104 | 3300049586 | Bacteria | 595 |
| 813 | Ga0501073_0028986 | 3300049589 | Bacteria | 3955 |
| 814 | Ga0501074_0015662 | 3300049590 | Bacteria | 5512 |
| 815 | Ga0501074_0144568 | 3300049590 | Bacteria | 1701 |
| 816 | Ga0501079_0179805 | 3300049741 | Bacteria | 1650 |
| 817 | Ga0501079_0436811 | 3300049741 | Unclassified | 1028 |
| 818 | Ga0501080_0061138 | 3300049742 | Bacteria | 3507 |
| 819 | Ga0501080_0125186 | 3300049742 | Bacteria | 2380 |
| 820 | Ga0501083_0001476 | 3300049744 | Bacteria | 16080 |
| 821 | Ga0501083_0230237 | 3300049744 | Unclassified | 1207 |
| 822 | Ga0501035_0784477 | 3300049822 | Unclassified | 762 |
| 823 | Ga0501044_0713900 | 3300049823 | Bacteria | 887 |
| 824 | Ga0501044_0763693 | 3300049823 | Unclassified | 848 |
| 825 | Ga0501044_1362192 | 3300049823 | Archaea | 575 |
| 826 | nmdc:mga05p37_469579_c1 | 3300050507 | Unclassified | 1452 |
| 827 | nmdc:mga06r32_1113076_c1 | 3300050510 | Bacteria | 738 |
| 828 | nmdc:mga0n895_1305584_c1 | 3300050512 | Unclassified | 696 |
| 829 | nmdc:mga0n895_64924_c1 | 3300050512 | Unclassified | 3612 |
| 830 | nmdc:mga0n895_75033_c1 | 3300050512 | Bacteria | 3361 |
| 831 | nmdc:mga0rr50_40345_c1 | 3300050513 | Bacteria | 3393 |
| 832 | nmdc:mga0rr50_6584_c1 | 3300050513 | Bacteria | 7095 |
| 833 | nmdc:mga08x19_1064596_c1 | 3300050514 | Archaea | 574 |
| 834 | nmdc:mga08x19_213418_c1 | 3300050514 | Bacteria | 1325 |
| 835 | nmdc:mga0a205_1201227_c1 | 3300050515 | Unclassified | 606 |
| 836 | nmdc:mga0a205_90384_c2 | 3300050515 | Bacteria | 1382 |
| 837 | Ga0495601_0008246 | 3300053077 | Bacteria | 6148 |
| 838 | Ga0495601_0091489 | 3300053077 | Bacteria | 1958 |
| 839 | Ga0495601_0108336 | 3300053077 | Bacteria | 1797 |
| 840 | Ga0495601_0110314 | 3300053077 | Bacteria | 1781 |
| 841 | Ga0495601_0309736 | 3300053077 | Bacteria | 1028 |
| 842 | Ga0495601_0451511 | 3300053077 | Unclassified | 831 |
| 843 | Ga0495601_0459690 | 3300053077 | Unclassified | 823 |
| 844 | Ga0495601_0567748 | 3300053077 | Bacteria | 729 |
| 845 | Ga0495601_0574178 | 3300053077 | Bacteria | 725 |
| 846 | Ga0495601_0633578 | 3300053077 | Unclassified | 685 |
| 847 | Ga0495612_0080389 | 3300053078 | Bacteria | 1369 |
| 848 | Ga0495612_0177212 | 3300053078 | Bacteria | 935 |
| 849 | Ga0495612_0407262 | 3300053078 | Unclassified | 618 |
| 850 | Ga0495595_0049857 | 3300053084 | Bacteria | 1937 |
| 851 | Ga0495595_0273718 | 3300053084 | Unclassified | 847 |
| 852 | Ga0495595_0446177 | 3300053084 | Unclassified | 657 |
| 853 | Ga0495595_0639412 | 3300053084 | Unclassified | 544 |
| 854 | Ga0495619_0000340 | 3300053085 | Bacteria | 32830 |
| 855 | Ga0495619_0023672 | 3300053085 | Bacteria | 3939 |
| 856 | Ga0495619_0178580 | 3300053085 | Bacteria | 1469 |
| 857 | Ga0495619_0242655 | 3300053085 | Bacteria | 1248 |
| 858 | Ga0495619_0362260 | 3300053085 | Bacteria | 1002 |
| 859 | Ga0495619_0555247 | 3300053085 | Bacteria | 787 |
| 860 | Ga0501084_0465079 | 3300054114 | Archaea | 1069 |
| 861 | Ga0587075_054501 | 3300059644 | Bacteria | 706 |
| 862 | Ga0501082_1580540 | 3300060353 | Bacteria | 573 |
| 863 | Ga0501082_1600315 | 3300060353 | Unclassified | 569 |
| 864 | Ga0466962_0000620 | 3300061719 | Bacteria | 15733 |
| 865 | Ga0466962_0000842 | 3300061719 | Bacteria | 13849 |
| 866 | Ga0466962_0028444 | 3300061719 | Bacteria | 2678 |
| 867 | Ga0466962_0044594 | 3300061719 | Bacteria | 2121 |
| 868 | Ga0466962_0236792 | 3300061719 | Bacteria | 895 |
| 869 | Ga0466962_0277150 | 3300061719 | Unclassified | 827 |
| 870 | Ga0466962_0729393 | 3300061719 | Unclassified | 509 |
| 871 | Ga0530510_0289349 | 3300061734 | Bacteria | 1225 |
| 872 | Ga0530510_0820471 | 3300061734 | Bacteria | 710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10047409 | Ga0265338_100474098 | 87 |
| 2 | 3300009177 | Ga0105248_11051757 | Ga0105248_110517572 | 88 |
| 3 | 3300025941 | Ga0207711_11483967 | Ga0207711_114839671 | 88 |
| 4 | 3300028556 | Ga0265337_1060553 | Ga0265337_10605532 | 90 |
| 5 | 3300028666 | Ga0265336_10017841 | Ga0265336_100178414 | 90 |
| 6 | 3300034820 | Ga0373959_0062929 | Ga0373959_0062929_393_689 | 90 |
| 7 | 3300039453 | Ga0436362_0023355 | Ga0436362_0023355_668_940 | 90 |
| 8 | 3300044842 | Ga0466957_0219858 | Ga0466957_0219858_957_1238 | 90 |
| 9 | 3300046454 | Ga0495592_0069096 | Ga0495592_0069096_1058_1339 | 90 |
| 10 | 3300046462 | Ga0495651_0094352 | Ga0495651_0094352_1819_2100 | 90 |
| 11 | 3300046516 | Ga0495628_0027710 | Ga0495628_0027710_2505_2786 | 90 |
| 12 | 3300046529 | Ga0495652_0117810 | Ga0495652_0117810_1771_2052 | 90 |
| 13 | 3300046536 | Ga0495587_0239347 | Ga0495587_0239347_406_687 | 90 |
| 14 | 3300046678 | Ga0495599_0001277 | Ga0495599_0001277_12787_13068 | 90 |
| 15 | 3300046680 | Ga0495646_0010885 | Ga0495646_0010885_1238_1519 | 90 |
| 16 | 3300047319 | Ga0495674_0168263 | Ga0495674_0168263_1067_1348 | 90 |
| 17 | 3300047444 | Ga0495675_0243922 | Ga0495675_0243922_655_936 | 90 |
| 18 | 3300047471 | Ga0495684_0269746 | Ga0495684_0269746_163_444 | 90 |
| 19 | 3300048088 | Ga0495602_0091252 | Ga0495602_0091252_889_1170 | 90 |
| 20 | 3300053077 | Ga0495601_0108336 | Ga0495601_0108336_284_565 | 90 |
| 21 | 3300053078 | Ga0495612_0080389 | Ga0495612_0080389_894_1175 | 90 |
| 22 | 3300005327 | Ga0070658_10383887 | Ga0070658_103838871 | 91 |
| 23 | 3300005329 | Ga0070683_101700906 | Ga0070683_1017009062 | 91 |
| 24 | 3300005435 | Ga0070714_101740666 | Ga0070714_1017406661 | 91 |
| 25 | 3300005458 | Ga0070681_10182685 | Ga0070681_101826851 | 91 |
| 26 | 3300005468 | Ga0070707_100798702 | Ga0070707_1007987022 | 91 |
| 27 | 3300005471 | Ga0070698_100301966 | Ga0070698_1003019662 | 91 |
| 28 | 3300005471 | Ga0070698_100973855 | Ga0070698_1009738551 | 91 |
| 29 | 3300005530 | Ga0070679_100504805 | Ga0070679_1005048052 | 91 |
| 30 | 3300005535 | Ga0070684_100774014 | Ga0070684_1007740142 | 91 |
| 31 | 3300009553 | Ga0105249_12661074 | Ga0105249_126610742 | 91 |
| 32 | 3300013105 | Ga0157369_11013114 | Ga0157369_110131141 | 91 |
| 33 | 3300013306 | Ga0163162_10853232 | Ga0163162_108532322 | 91 |
| 34 | 3300014969 | Ga0157376_11238392 | Ga0157376_112383922 | 91 |
| 35 | 3300020069 | Ga0197907_11462768 | Ga0197907_114627682 | 91 |
| 36 | 3300020081 | Ga0206354_10301111 | Ga0206354_103011116 | 91 |
| 37 | 3300020082 | Ga0206353_11253177 | Ga0206353_112531772 | 91 |
| 38 | 3300025909 | Ga0207705_10551023 | Ga0207705_105510232 | 91 |
| 39 | 3300025917 | Ga0207660_11401922 | Ga0207660_114019222 | 91 |
| 40 | 3300025921 | Ga0207652_10528923 | Ga0207652_105289232 | 91 |
| 41 | 3300025926 | Ga0207659_11471315 | Ga0207659_114713152 | 91 |
| 42 | 3300025929 | Ga0207664_11809616 | Ga0207664_118096162 | 91 |
| 43 | 3300025944 | Ga0207661_10116140 | Ga0207661_101161402 | 91 |
| 44 | 3300025944 | Ga0207661_10354710 | Ga0207661_103547102 | 91 |
| 45 | 3300026089 | Ga0207648_11571287 | Ga0207648_115712872 | 91 |
| 46 | 3300028573 | Ga0265334_10114417 | Ga0265334_101144172 | 91 |
| 47 | 3300028577 | Ga0265318_10032382 | Ga0265318_100323822 | 91 |
| 48 | 3300028800 | Ga0265338_10003515 | Ga0265338_1000351513 | 91 |
| 49 | 3300028800 | Ga0265338_10009802 | Ga0265338_100098029 | 91 |
| 50 | 3300028800 | Ga0265338_10044099 | Ga0265338_100440998 | 91 |
| 51 | 3300031235 | Ga0265330_10099369 | Ga0265330_100993692 | 91 |
| 52 | 3300031238 | Ga0265332_10028012 | Ga0265332_100280124 | 91 |
| 53 | 3300031241 | Ga0265325_10018923 | Ga0265325_100189236 | 91 |
| 54 | 3300031242 | Ga0265329_10090670 | Ga0265329_100906702 | 91 |
| 55 | 3300031247 | Ga0265340_10490417 | Ga0265340_104904172 | 91 |
| 56 | 3300031251 | Ga0265327_10004489 | Ga0265327_100044896 | 91 |
| 57 | 3300031251 | Ga0265327_10354442 | Ga0265327_103544422 | 91 |
| 58 | 3300031344 | Ga0265316_10105558 | Ga0265316_101055582 | 91 |
| 59 | 3300031595 | Ga0265313_10066148 | Ga0265313_100661482 | 91 |
| 60 | 3300031711 | Ga0265314_10086718 | Ga0265314_100867182 | 91 |
| 61 | 3300031712 | Ga0265342_10384072 | Ga0265342_103840722 | 91 |
| 62 | 3300032133 | Ga0316583_10157755 | Ga0316583_101577552 | 91 |
| 63 | 3300037418 | Ga0395900_0896768 | Ga0395900_0896768_469_747 | 91 |
| 64 | 3300037418 | Ga0395900_1352527 | Ga0395900_1352527_21_302 | 91 |
| 65 | 3300038443 | Ga0395901_0440504 | Ga0395901_0440504_520_801 | 91 |
| 66 | 3300038443 | Ga0395901_0696359 | Ga0395901_0696359_254_532 | 91 |
| 67 | 3300038443 | Ga0395901_0954329 | Ga0395901_0954329_79_354 | 91 |
| 68 | 3300039437 | Ga0436365_1190190 | Ga0436365_1190190_218_493 | 91 |
| 69 | 3300039437 | Ga0436365_1505933 | Ga0436365_1505933_31_306 | 91 |
| 70 | 3300044693 | Ga0466961_0826467 | Ga0466961_0826467_138_413 | 91 |
| 71 | 3300044694 | Ga0466963_0008754 | Ga0466963_0008754_591_866 | 91 |
| 72 | 3300044842 | Ga0466957_0469353 | Ga0466957_0469353_166_441 | 91 |
| 73 | 3300045976 | Ga0466967_1923499 | Ga0466967_1923499_32_307 | 91 |
| 74 | 3300053077 | Ga0495601_0633578 | Ga0495601_0633578_126_413 | 91 |
| 75 | 3300005327 | Ga0070658_10170777 | Ga0070658_101707771 | 92 |
| 76 | 3300005327 | Ga0070658_10706052 | Ga0070658_107060522 | 92 |
| 77 | 3300005329 | Ga0070683_101116101 | Ga0070683_1011161012 | 92 |
| 78 | 3300005336 | Ga0070680_100150818 | Ga0070680_1001508183 | 92 |
| 79 | 3300005336 | Ga0070680_100536159 | Ga0070680_1005361592 | 92 |
| 80 | 3300005336 | Ga0070680_101315747 | Ga0070680_1013157472 | 92 |
| 81 | 3300005337 | Ga0070682_100013765 | Ga0070682_1000137652 | 92 |
| 82 | 3300005339 | Ga0070660_100935263 | Ga0070660_1009352632 | 92 |
| 83 | 3300005344 | Ga0070661_100558665 | Ga0070661_1005586651 | 92 |
| 84 | 3300005345 | Ga0070692_10961010 | Ga0070692_109610102 | 92 |
| 85 | 3300005355 | Ga0070671_100034184 | Ga0070671_1000341845 | 92 |
| 86 | 3300005366 | Ga0070659_100555076 | Ga0070659_1005550762 | 92 |
| 87 | 3300005366 | Ga0070659_101043479 | Ga0070659_1010434792 | 92 |
| 88 | 3300005434 | Ga0070709_10245795 | Ga0070709_102457952 | 92 |
| 89 | 3300005435 | Ga0070714_100340116 | Ga0070714_1003401162 | 92 |
| 90 | 3300005436 | Ga0070713_101565409 | Ga0070713_1015654092 | 92 |
| 91 | 3300005439 | Ga0070711_101284536 | Ga0070711_1012845361 | 92 |
| 92 | 3300005445 | Ga0070708_100468967 | Ga0070708_1004689672 | 92 |
| 93 | 3300005455 | Ga0070663_101355499 | Ga0070663_1013554992 | 92 |
| 94 | 3300005458 | Ga0070681_10177585 | Ga0070681_101775853 | 92 |
| 95 | 3300005458 | Ga0070681_10197498 | Ga0070681_101974983 | 92 |
| 96 | 3300005467 | Ga0070706_102014070 | Ga0070706_1020140702 | 92 |
| 97 | 3300005467 | Ga0070706_102022873 | Ga0070706_1020228732 | 92 |
| 98 | 3300005468 | Ga0070707_100061249 | Ga0070707_1000612492 | 92 |
| 99 | 3300005471 | Ga0070698_100290667 | Ga0070698_1002906672 | 92 |
| 100 | 3300005518 | Ga0070699_101054327 | Ga0070699_1010543272 | 92 |
| 101 | 3300005530 | Ga0070679_100317396 | Ga0070679_1003173962 | 92 |
| 102 | 3300005530 | Ga0070679_100903806 | Ga0070679_1009038062 | 92 |
| 103 | 3300005535 | Ga0070684_100252548 | Ga0070684_1002525482 | 92 |
| 104 | 3300005563 | Ga0068855_101096172 | Ga0068855_1010961722 | 92 |
| 105 | 3300005578 | Ga0068854_101948201 | Ga0068854_1019482012 | 92 |
| 106 | 3300005616 | Ga0068852_100095164 | Ga0068852_1000951644 | 92 |
| 107 | 3300005718 | Ga0068866_10354110 | Ga0068866_103541102 | 92 |
| 108 | 3300005841 | Ga0068863_100591462 | Ga0068863_1005914622 | 92 |
| 109 | 3300006847 | Ga0075431_100955925 | Ga0075431_1009559252 | 92 |
| 110 | 3300006914 | Ga0075436_100545433 | Ga0075436_1005454332 | 92 |
| 111 | 3300009094 | Ga0111539_10303782 | Ga0111539_103037822 | 92 |
| 112 | 3300009148 | Ga0105243_11348675 | Ga0105243_113486752 | 92 |
| 113 | 3300009174 | Ga0105241_12688771 | Ga0105241_126887712 | 92 |
| 114 | 3300009545 | Ga0105237_12109908 | Ga0105237_121099082 | 92 |
| 115 | 3300009551 | Ga0105238_11159050 | Ga0105238_111590502 | 92 |
| 116 | 3300012485 | Ga0157325_1009929 | Ga0157325_10099292 | 92 |
| 117 | 3300012507 | Ga0157342_1047625 | Ga0157342_10476252 | 92 |
| 118 | 3300012512 | Ga0157327_1017263 | Ga0157327_10172632 | 92 |
| 119 | 3300013102 | Ga0157371_11212729 | Ga0157371_112127292 | 92 |
| 120 | 3300013307 | Ga0157372_10345161 | Ga0157372_103451612 | 92 |
| 121 | 3300014745 | Ga0157377_11149008 | Ga0157377_111490082 | 92 |
| 122 | 3300015265 | Ga0182005_1287864 | Ga0182005_12878642 | 92 |
| 123 | 3300020070 | Ga0206356_10254714 | Ga0206356_102547142 | 92 |
| 124 | 3300020081 | Ga0206354_11109484 | Ga0206354_111094842 | 92 |
| 125 | 3300020082 | Ga0206353_11136966 | Ga0206353_111369662 | 92 |
| 126 | 3300025909 | Ga0207705_10138541 | Ga0207705_101385413 | 92 |
| 127 | 3300025912 | Ga0207707_10131937 | Ga0207707_101319372 | 92 |
| 128 | 3300025912 | Ga0207707_10151294 | Ga0207707_101512942 | 92 |
| 129 | 3300025912 | Ga0207707_10439253 | Ga0207707_104392532 | 92 |
| 130 | 3300025916 | Ga0207663_10597325 | Ga0207663_105973252 | 92 |
| 131 | 3300025917 | Ga0207660_10033381 | Ga0207660_100333812 | 92 |
| 132 | 3300025919 | Ga0207657_10044826 | Ga0207657_100448262 | 92 |
| 133 | 3300025920 | Ga0207649_11287647 | Ga0207649_112876472 | 92 |
| 134 | 3300025921 | Ga0207652_10291925 | Ga0207652_102919252 | 92 |
| 135 | 3300025921 | Ga0207652_10806233 | Ga0207652_108062332 | 92 |
| 136 | 3300025922 | Ga0207646_10356640 | Ga0207646_103566402 | 92 |
| 137 | 3300025929 | Ga0207664_10001609 | Ga0207664_1000160910 | 92 |
| 138 | 3300025931 | Ga0207644_11743499 | Ga0207644_117434992 | 92 |
| 139 | 3300025932 | Ga0207690_10102201 | Ga0207690_101022012 | 92 |
| 140 | 3300025932 | Ga0207690_11033481 | Ga0207690_110334812 | 92 |
| 141 | 3300025944 | Ga0207661_11537765 | Ga0207661_115377652 | 92 |
| 142 | 3300025981 | Ga0207640_10636946 | Ga0207640_106369462 | 92 |
| 143 | 3300026067 | Ga0207678_11335814 | Ga0207678_113358142 | 92 |
| 144 | 3300028573 | Ga0265334_10025424 | Ga0265334_100254243 | 92 |
| 145 | 3300028654 | Ga0265322_10034572 | Ga0265322_100345722 | 92 |
| 146 | 3300031251 | Ga0265327_10027140 | Ga0265327_100271404 | 92 |
| 147 | 3300031595 | Ga0265313_10007235 | Ga0265313_100072358 | 92 |
| 148 | 3300032133 | Ga0316583_10244609 | Ga0316583_102446092 | 92 |
| 149 | 3300035410 | Ga0373924_0522235 | Ga0373924_0522235_181_459 | 92 |
| 150 | 3300037312 | Ga0395899_0070021 | Ga0395899_0070021_281_559 | 92 |
| 151 | 3300037312 | Ga0395899_0215897 | Ga0395899_0215897_221_499 | 92 |
| 152 | 3300037418 | Ga0395900_0319831 | Ga0395900_0319831_1151_1429 | 92 |
| 153 | 3300037418 | Ga0395900_0727276 | Ga0395900_0727276_597_875 | 92 |
| 154 | 3300037466 | Ga0395898_0038648 | Ga0395898_0038648_2968_3246 | 92 |
| 155 | 3300037471 | Ga0395905_0043423 | Ga0395905_0043423_2789_3067 | 92 |
| 156 | 3300038443 | Ga0395901_0691525 | Ga0395901_0691525_575_853 | 92 |
| 157 | 3300038443 | Ga0395901_1228699 | Ga0395901_1228699_220_498 | 92 |
| 158 | 3300039438 | Ga0436360_0797120 | Ga0436360_0797120_667_960 | 92 |
| 159 | 3300042005 | Ga0439448_0108015 | Ga0439448_0108015_227_505 | 92 |
| 160 | 3300044673 | Ga0453683_0392787 | Ga0453683_0392787_115_393 | 92 |
| 161 | 3300044694 | Ga0466963_0547778 | Ga0466963_0547778_73_351 | 92 |
| 162 | 3300044706 | Ga0466964_0749754 | Ga0466964_0749754_122_400 | 92 |
| 163 | 3300045049 | Ga0466959_0494639 | Ga0466959_0494639_354_632 | 92 |
| 164 | 3300045976 | Ga0466967_0138966 | Ga0466967_0138966_1908_2186 | 92 |
| 165 | 3300046459 | Ga0495629_0079401 | Ga0495629_0079401_930_1208 | 92 |
| 166 | 3300046511 | Ga0495608_0372557 | Ga0495608_0372557_153_431 | 92 |
| 167 | 3300046514 | Ga0495618_0847597 | Ga0495618_0847597_150_428 | 92 |
| 168 | 3300046517 | Ga0495630_0124145 | Ga0495630_0124145_177_455 | 92 |
| 169 | 3300046517 | Ga0495630_0803942 | Ga0495630_0803942_393_671 | 92 |
| 170 | 3300046517 | Ga0495630_1361752 | Ga0495630_1361752_127_405 | 92 |
| 171 | 3300046531 | Ga0495665_0331054 | Ga0495665_0331054_189_467 | 92 |
| 172 | 3300046533 | Ga0495640_0253664 | Ga0495640_0253664_174_452 | 92 |
| 173 | 3300046559 | Ga0495667_0113340 | Ga0495667_0113340_1059_1337 | 92 |
| 174 | 3300046663 | Ga0495635_0017484 | Ga0495635_0017484_3877_4155 | 92 |
| 175 | 3300046675 | Ga0495657_0408757 | Ga0495657_0408757_371_649 | 92 |
| 176 | 3300046675 | Ga0495657_0648035 | Ga0495657_0648035_22_300 | 92 |
| 177 | 3300046689 | Ga0495613_0362797 | Ga0495613_0362797_251_529 | 92 |
| 178 | 3300046691 | Ga0495670_0820989 | Ga0495670_0820989_153_431 | 92 |
| 179 | 3300047315 | Ga0495581_0529566 | Ga0495581_0529566_176_454 | 92 |
| 180 | 3300047319 | Ga0495674_1420164 | Ga0495674_1420164_13_291 | 92 |
| 181 | 3300047321 | Ga0495676_0944601 | Ga0495676_0944601_143_421 | 92 |
| 182 | 3300047322 | Ga0495680_0477257 | Ga0495680_0477257_175_453 | 92 |
| 183 | 3300047471 | Ga0495684_0369064 | Ga0495684_0369064_459_737 | 92 |
| 184 | 3300047673 | Ga0495593_0163249 | Ga0495593_0163249_29_307 | 92 |
| 185 | 3300048915 | Ga0496112_0015040 | Ga0496112_0015040_2983_3261 | 92 |
| 186 | 3300048915 | Ga0496112_0043585 | Ga0496112_0043585_1369_1647 | 92 |
| 187 | 3300048915 | Ga0496112_0207476 | Ga0496112_0207476_1159_1437 | 92 |
| 188 | 3300048916 | Ga0496113_0643510 | Ga0496113_0643510_107_385 | 92 |
| 189 | 3300049570 | Ga0501033_1058100 | Ga0501033_1058100_121_399 | 92 |
| 190 | 3300049571 | Ga0501034_1366071 | Ga0501034_1366071_55_333 | 92 |
| 191 | 3300049581 | Ga0501047_0325760 | Ga0501047_0325760_898_1176 | 92 |
| 192 | 3300049583 | Ga0501067_0359540 | Ga0501067_0359540_142_420 | 92 |
| 193 | 3300049584 | Ga0501068_0648445 | Ga0501068_0648445_82_360 | 92 |
| 194 | 3300049741 | Ga0501079_0436811 | Ga0501079_0436811_299_577 | 92 |
| 195 | 3300049742 | Ga0501080_0061138 | Ga0501080_0061138_3206_3484 | 92 |
| 196 | 3300049744 | Ga0501083_0230237 | Ga0501083_0230237_322_600 | 92 |
| 197 | 3300049823 | Ga0501044_0763693 | Ga0501044_0763693_300_578 | 92 |
| 198 | 3300050507 | nmdc:mga05p37_469579_c1 | nmdc:mga05p37_469579_c1_669_947 | 92 |
| 199 | 3300050510 | nmdc:mga06r32_1113076_c1 | nmdc:mga06r32_1113076_c1_349_627 | 92 |
| 200 | 3300050512 | nmdc:mga0n895_1305584_c1 | nmdc:mga0n895_1305584_c1_268_546 | 92 |
| 201 | 3300050515 | nmdc:mga0a205_90384_c2 | nmdc:mga0a205_90384_c2_176_454 | 92 |
| 202 | 3300053077 | Ga0495601_0459690 | Ga0495601_0459690_128_406 | 92 |
| 203 | 3300053084 | Ga0495595_0273718 | Ga0495595_0273718_516_794 | 92 |
| 204 | 3300053085 | Ga0495619_0023672 | Ga0495619_0023672_106_384 | 92 |
| 205 | 3300053085 | Ga0495619_0178580 | Ga0495619_0178580_604_882 | 92 |
| 206 | 3300060353 | Ga0501082_1580540 | Ga0501082_1580540_88_369 | 92 |
| 207 | 3300060353 | Ga0501082_1600315 | Ga0501082_1600315_65_343 | 92 |
| 208 | 3300061734 | Ga0530510_0820471 | Ga0530510_0820471_154_432 | 92 |
| 209 | 3300005329 | Ga0070683_101942035 | Ga0070683_1019420352 | 93 |
| 210 | 3300005336 | Ga0070680_100239043 | Ga0070680_1002390432 | 93 |
| 211 | 3300005336 | Ga0070680_100266248 | Ga0070680_1002662483 | 93 |
| 212 | 3300005336 | Ga0070680_100573625 | Ga0070680_1005736252 | 93 |
| 213 | 3300005336 | Ga0070680_101632286 | Ga0070680_1016322862 | 93 |
| 214 | 3300005337 | Ga0070682_100281338 | Ga0070682_1002813382 | 93 |
| 215 | 3300005337 | Ga0070682_101956658 | Ga0070682_1019566582 | 93 |
| 216 | 3300005338 | Ga0068868_100159779 | Ga0068868_1001597793 | 93 |
| 217 | 3300005354 | Ga0070675_101617159 | Ga0070675_1016171592 | 93 |
| 218 | 3300005434 | Ga0070709_10034391 | Ga0070709_100343912 | 93 |
| 219 | 3300005434 | Ga0070709_10769327 | Ga0070709_107693272 | 93 |
| 220 | 3300005435 | Ga0070714_100040084 | Ga0070714_1000400842 | 93 |
| 221 | 3300005435 | Ga0070714_100085136 | Ga0070714_1000851364 | 93 |
| 222 | 3300005435 | Ga0070714_100277024 | Ga0070714_1002770243 | 93 |
| 223 | 3300005435 | Ga0070714_100322262 | Ga0070714_1003222622 | 93 |
| 224 | 3300005435 | Ga0070714_100613220 | Ga0070714_1006132202 | 93 |
| 225 | 3300005435 | Ga0070714_101599301 | Ga0070714_1015993012 | 93 |
| 226 | 3300005436 | Ga0070713_100050722 | Ga0070713_1000507226 | 93 |
| 227 | 3300005436 | Ga0070713_100084771 | Ga0070713_1000847714 | 93 |
| 228 | 3300005436 | Ga0070713_100134397 | Ga0070713_1001343974 | 93 |
| 229 | 3300005437 | Ga0070710_10015854 | Ga0070710_100158542 | 93 |
| 230 | 3300005437 | Ga0070710_10017530 | Ga0070710_100175302 | 93 |
| 231 | 3300005437 | Ga0070710_10748958 | Ga0070710_107489581 | 93 |
| 232 | 3300005439 | Ga0070711_100026065 | Ga0070711_1000260655 | 93 |
| 233 | 3300005439 | Ga0070711_100034412 | Ga0070711_1000344123 | 93 |
| 234 | 3300005440 | Ga0070705_100958373 | Ga0070705_1009583732 | 93 |
| 235 | 3300005444 | Ga0070694_101411123 | Ga0070694_1014111231 | 93 |
| 236 | 3300005445 | Ga0070708_101502300 | Ga0070708_1015023001 | 93 |
| 237 | 3300005456 | Ga0070678_101835749 | Ga0070678_1018357492 | 93 |
| 238 | 3300005457 | Ga0070662_100726056 | Ga0070662_1007260562 | 93 |
| 239 | 3300005458 | Ga0070681_10375886 | Ga0070681_103758862 | 93 |
| 240 | 3300005466 | Ga0070685_11227182 | Ga0070685_112271822 | 93 |
| 241 | 3300005530 | Ga0070679_100160799 | Ga0070679_1001607992 | 93 |
| 242 | 3300005535 | Ga0070684_100314314 | Ga0070684_1003143142 | 93 |
| 243 | 3300005535 | Ga0070684_100773928 | Ga0070684_1007739282 | 93 |
| 244 | 3300005545 | Ga0070695_100000001 | Ga0070695_100000001144 | 93 |
| 245 | 3300005547 | Ga0070693_100256844 | Ga0070693_1002568442 | 93 |
| 246 | 3300005547 | Ga0070693_100507254 | Ga0070693_1005072542 | 93 |
| 247 | 3300005548 | Ga0070665_101625712 | Ga0070665_1016257122 | 93 |
| 248 | 3300005549 | Ga0070704_100278161 | Ga0070704_1002781612 | 93 |
| 249 | 3300005563 | Ga0068855_101248940 | Ga0068855_1012489402 | 93 |
| 250 | 3300005937 | Ga0081455_10081052 | Ga0081455_100810522 | 93 |
| 251 | 3300006028 | Ga0070717_10001309 | Ga0070717_1000130927 | 93 |
| 252 | 3300006028 | Ga0070717_10030492 | Ga0070717_100304928 | 93 |
| 253 | 3300006028 | Ga0070717_10101105 | Ga0070717_101011054 | 93 |
| 254 | 3300006028 | Ga0070717_10575896 | Ga0070717_105758962 | 93 |
| 255 | 3300006163 | Ga0070715_10000128 | Ga0070715_100001282 | 93 |
| 256 | 3300006163 | Ga0070715_10413476 | Ga0070715_104134761 | 93 |
| 257 | 3300006173 | Ga0070716_100053160 | Ga0070716_1000531604 | 93 |
| 258 | 3300006237 | Ga0097621_101495899 | Ga0097621_1014958992 | 93 |
| 259 | 3300006852 | Ga0075433_10784797 | Ga0075433_107847972 | 93 |
| 260 | 3300006871 | Ga0075434_100068175 | Ga0075434_1000681752 | 93 |
| 261 | 3300006871 | Ga0075434_100958861 | Ga0075434_1009588612 | 93 |
| 262 | 3300006881 | Ga0068865_101221006 | Ga0068865_1012210062 | 93 |
| 263 | 3300006914 | Ga0075436_100983602 | Ga0075436_1009836022 | 93 |
| 264 | 3300007076 | Ga0075435_100018465 | Ga0075435_1000184654 | 93 |
| 265 | 3300009011 | Ga0105251_10192717 | Ga0105251_101927172 | 93 |
| 266 | 3300009036 | Ga0105244_10363702 | Ga0105244_103637022 | 93 |
| 267 | 3300009093 | Ga0105240_10370482 | Ga0105240_103704822 | 93 |
| 268 | 3300009098 | Ga0105245_10106987 | Ga0105245_101069872 | 93 |
| 269 | 3300009098 | Ga0105245_10572474 | Ga0105245_105724741 | 93 |
| 270 | 3300009101 | Ga0105247_10108687 | Ga0105247_101086872 | 93 |
| 271 | 3300009176 | Ga0105242_11191433 | Ga0105242_111914332 | 93 |
| 272 | 3300009176 | Ga0105242_11976149 | Ga0105242_119761492 | 93 |
| 273 | 3300009177 | Ga0105248_11045812 | Ga0105248_110458121 | 93 |
| 274 | 3300009545 | Ga0105237_10884010 | Ga0105237_108840102 | 93 |
| 275 | 3300009545 | Ga0105237_12303676 | Ga0105237_123036761 | 93 |
| 276 | 3300009553 | Ga0105249_11090214 | Ga0105249_110902142 | 93 |
| 277 | 3300012488 | Ga0157343_1027074 | Ga0157343_10270742 | 93 |
| 278 | 3300012515 | Ga0157338_1021715 | Ga0157338_10217152 | 93 |
| 279 | 3300013105 | Ga0157369_10835163 | Ga0157369_108351632 | 93 |
| 280 | 3300013296 | Ga0157374_12931549 | Ga0157374_129315491 | 93 |
| 281 | 3300013306 | Ga0163162_11664315 | Ga0163162_116643152 | 93 |
| 282 | 3300013307 | Ga0157372_10028900 | Ga0157372_100289002 | 93 |
| 283 | 3300014325 | Ga0163163_10936059 | Ga0163163_109360592 | 93 |
| 284 | 3300014497 | Ga0182008_10236797 | Ga0182008_102367972 | 93 |
| 285 | 3300014968 | Ga0157379_10519000 | Ga0157379_105190002 | 93 |
| 286 | 3300015261 | Ga0182006_1099328 | Ga0182006_10993282 | 93 |
| 287 | 3300015262 | Ga0182007_10227678 | Ga0182007_102276782 | 93 |
| 288 | 3300020069 | Ga0197907_11460375 | Ga0197907_114603752 | 93 |
| 289 | 3300020082 | Ga0206353_11574996 | Ga0206353_115749962 | 93 |
| 290 | 3300025885 | Ga0207653_10336738 | Ga0207653_103367381 | 93 |
| 291 | 3300025898 | Ga0207692_10009582 | Ga0207692_100095822 | 93 |
| 292 | 3300025898 | Ga0207692_10027645 | Ga0207692_100276454 | 93 |
| 293 | 3300025900 | Ga0207710_10175205 | Ga0207710_101752052 | 93 |
| 294 | 3300025905 | Ga0207685_10094627 | Ga0207685_100946272 | 93 |
| 295 | 3300025905 | Ga0207685_10290775 | Ga0207685_102907752 | 93 |
| 296 | 3300025906 | Ga0207699_10016080 | Ga0207699_100160803 | 93 |
| 297 | 3300025909 | Ga0207705_10537376 | Ga0207705_105373762 | 93 |
| 298 | 3300025911 | Ga0207654_10330308 | Ga0207654_103303082 | 93 |
| 299 | 3300025913 | Ga0207695_10043452 | Ga0207695_100434524 | 93 |
| 300 | 3300025914 | Ga0207671_10786221 | Ga0207671_107862212 | 93 |
| 301 | 3300025915 | Ga0207693_10002202 | Ga0207693_1000220227 | 93 |
| 302 | 3300025915 | Ga0207693_10135217 | Ga0207693_101352174 | 93 |
| 303 | 3300025916 | Ga0207663_10003571 | Ga0207663_100035712 | 93 |
| 304 | 3300025916 | Ga0207663_10019761 | Ga0207663_100197615 | 93 |
| 305 | 3300025917 | Ga0207660_10056430 | Ga0207660_100564302 | 93 |
| 306 | 3300025917 | Ga0207660_10380568 | Ga0207660_103805682 | 93 |
| 307 | 3300025918 | Ga0207662_10494781 | Ga0207662_104947812 | 93 |
| 308 | 3300025919 | Ga0207657_10201819 | Ga0207657_102018191 | 93 |
| 309 | 3300025921 | Ga0207652_10101655 | Ga0207652_101016552 | 93 |
| 310 | 3300025921 | Ga0207652_10896633 | Ga0207652_108966332 | 93 |
| 311 | 3300025921 | Ga0207652_11188861 | Ga0207652_111888612 | 93 |
| 312 | 3300025927 | Ga0207687_10146153 | Ga0207687_101461534 | 93 |
| 313 | 3300025927 | Ga0207687_10505718 | Ga0207687_105057183 | 93 |
| 314 | 3300025928 | Ga0207700_10036475 | Ga0207700_100364752 | 93 |
| 315 | 3300025928 | Ga0207700_10420219 | Ga0207700_104202192 | 93 |
| 316 | 3300025929 | Ga0207664_10004974 | Ga0207664_1000497412 | 93 |
| 317 | 3300025929 | Ga0207664_10460075 | Ga0207664_104600752 | 93 |
| 318 | 3300025929 | Ga0207664_10477977 | Ga0207664_104779773 | 93 |
| 319 | 3300025929 | Ga0207664_11040651 | Ga0207664_110406511 | 93 |
| 320 | 3300025929 | Ga0207664_11752494 | Ga0207664_117524942 | 93 |
| 321 | 3300025931 | Ga0207644_10308682 | Ga0207644_103086822 | 93 |
| 322 | 3300025931 | Ga0207644_11724278 | Ga0207644_117242782 | 93 |
| 323 | 3300025933 | Ga0207706_10803108 | Ga0207706_108031082 | 93 |
| 324 | 3300025938 | Ga0207704_10229245 | Ga0207704_102292453 | 93 |
| 325 | 3300025939 | Ga0207665_10001140 | Ga0207665_100011402 | 93 |
| 326 | 3300025941 | Ga0207711_10716038 | Ga0207711_107160382 | 93 |
| 327 | 3300025944 | Ga0207661_10916739 | Ga0207661_109167392 | 93 |
| 328 | 3300025961 | Ga0207712_11785080 | Ga0207712_117850802 | 93 |
| 329 | 3300026035 | Ga0207703_11828374 | Ga0207703_118283742 | 93 |
| 330 | 3300026041 | Ga0207639_11025116 | Ga0207639_110251162 | 93 |
| 331 | 3300026067 | Ga0207678_10741938 | Ga0207678_107419382 | 93 |
| 332 | 3300026078 | Ga0207702_10066346 | Ga0207702_100663462 | 93 |
| 333 | 3300026095 | Ga0207676_10459705 | Ga0207676_104597052 | 93 |
| 334 | 3300026121 | Ga0207683_11349474 | Ga0207683_113494742 | 93 |
| 335 | 3300026142 | Ga0207698_10959231 | Ga0207698_109592312 | 93 |
| 336 | 3300028666 | Ga0265336_10075832 | Ga0265336_100758322 | 93 |
| 337 | 3300031731 | Ga0307405_10713404 | Ga0307405_107134041 | 93 |
| 338 | 3300031903 | Ga0307407_11353387 | Ga0307407_113533872 | 93 |
| 339 | 3300031995 | Ga0307409_100230655 | Ga0307409_1002306552 | 93 |
| 340 | 3300032002 | Ga0307416_100576903 | Ga0307416_1005769031 | 93 |
| 341 | 3300032126 | Ga0307415_100361217 | Ga0307415_1003612172 | 93 |
| 342 | 3300034817 | Ga0373948_0105794 | Ga0373948_0105794_148_429 | 93 |
| 343 | 3300034817 | Ga0373948_0107953 | Ga0373948_0107953_120_416 | 93 |
| 344 | 3300034957 | Ga0373938_0032742 | Ga0373938_0032742_554_835 | 93 |
| 345 | 3300035083 | Ga0373926_0047449 | Ga0373926_0047449_446_727 | 93 |
| 346 | 3300035083 | Ga0373926_0049612 | Ga0373926_0049612_78_365 | 93 |
| 347 | 3300035084 | Ga0373928_0020857 | Ga0373928_0020857_202_486 | 93 |
| 348 | 3300035085 | Ga0373929_0061945 | Ga0373929_0061945_167_448 | 93 |
| 349 | 3300035086 | Ga0373934_0359379 | Ga0373934_0359379_97_378 | 93 |
| 350 | 3300035088 | Ga0373940_0053404 | Ga0373940_0053404_273_554 | 93 |
| 351 | 3300035089 | Ga0373944_0410587 | Ga0373944_0410587_52_333 | 93 |
| 352 | 3300035092 | Ga0373952_0290234 | Ga0373952_0290234_66_353 | 93 |
| 353 | 3300035116 | Ga0373945_0014009 | Ga0373945_0014009_1418_1705 | 93 |
| 354 | 3300035116 | Ga0373945_0029445 | Ga0373945_0029445_410_691 | 93 |
| 355 | 3300035170 | Ga0373943_0015268 | Ga0373943_0015268_1636_1923 | 93 |
| 356 | 3300035170 | Ga0373943_0686444 | Ga0373943_0686444_49_339 | 93 |
| 357 | 3300035171 | Ga0373946_0026705 | Ga0373946_0026705_1080_1361 | 93 |
| 358 | 3300035410 | Ga0373924_0425623 | Ga0373924_0425623_293_574 | 93 |
| 359 | 3300035691 | Ga0373931_0068548 | Ga0373931_0068548_559_840 | 93 |
| 360 | 3300035692 | Ga0373935_0067291 | Ga0373935_0067291_1494_1781 | 93 |
| 361 | 3300035692 | Ga0373935_0381878 | Ga0373935_0381878_520_801 | 93 |
| 362 | 3300035695 | Ga0373927_0046932 | Ga0373927_0046932_2417_2698 | 93 |
| 363 | 3300035725 | Ga0373947_0012958 | Ga0373947_0012958_3343_3624 | 93 |
| 364 | 3300035725 | Ga0373947_0082679 | Ga0373947_0082679_1667_1954 | 93 |
| 365 | 3300037068 | Ga0373925_0009943 | Ga0373925_0009943_4703_4990 | 93 |
| 366 | 3300037068 | Ga0373925_0029959 | Ga0373925_0029959_1626_1907 | 93 |
| 367 | 3300037312 | Ga0395899_0936207 | Ga0395899_0936207_58_342 | 93 |
| 368 | 3300037418 | Ga0395900_0076531 | Ga0395900_0076531_2671_2955 | 93 |
| 369 | 3300037418 | Ga0395900_0112617 | Ga0395900_0112617_1944_2231 | 93 |
| 370 | 3300037418 | Ga0395900_0879655 | Ga0395900_0879655_117_404 | 93 |
| 371 | 3300037418 | Ga0395900_1010427 | Ga0395900_1010427_420_704 | 93 |
| 372 | 3300037466 | Ga0395898_0096858 | Ga0395898_0096858_73_357 | 93 |
| 373 | 3300037466 | Ga0395898_0581555 | Ga0395898_0581555_705_989 | 93 |
| 374 | 3300037466 | Ga0395898_1269438 | Ga0395898_1269438_217_504 | 93 |
| 375 | 3300037471 | Ga0395905_0354707 | Ga0395905_0354707_251_538 | 93 |
| 376 | 3300038443 | Ga0395901_0822598 | Ga0395901_0822598_220_507 | 93 |
| 377 | 3300038443 | Ga0395901_0969441 | Ga0395901_0969441_24_311 | 93 |
| 378 | 3300039450 | Ga0436363_0947939 | Ga0436363_0947939_91_372 | 93 |
| 379 | 3300039450 | Ga0436363_1605281 | Ga0436363_1605281_785_1075 | 93 |
| 380 | 3300041452 | Ga0451793_1601599 | Ga0451793_1601599_183_464 | 93 |
| 381 | 3300041459 | Ga0451800_0468417 | Ga0451800_0468417_194_475 | 93 |
| 382 | 3300041501 | Ga0451845_0708858 | Ga0451845_0708858_428_715 | 93 |
| 383 | 3300041507 | Ga0451851_1210558 | Ga0451851_1210558_258_539 | 93 |
| 384 | 3300044656 | Ga0466969_0019346 | Ga0466969_0019346_1438_1728 | 93 |
| 385 | 3300044656 | Ga0466969_0023023 | Ga0466969_0023023_480_779 | 93 |
| 386 | 3300044683 | Ga0466965_0243892 | Ga0466965_0243892_128_418 | 93 |
| 387 | 3300044684 | Ga0466966_0119824 | Ga0466966_0119824_701_982 | 93 |
| 388 | 3300044684 | Ga0466966_0216779 | Ga0466966_0216779_464_754 | 93 |
| 389 | 3300044684 | Ga0466966_0706156 | Ga0466966_0706156_126_431 | 93 |
| 390 | 3300044684 | Ga0466966_0909745 | Ga0466966_0909745_181_480 | 93 |
| 391 | 3300044693 | Ga0466961_0020838 | Ga0466961_0020838_3740_4039 | 93 |
| 392 | 3300044693 | Ga0466961_0209881 | Ga0466961_0209881_358_648 | 93 |
| 393 | 3300044693 | Ga0466961_0215387 | Ga0466961_0215387_230_511 | 93 |
| 394 | 3300044693 | Ga0466961_0269262 | Ga0466961_0269262_263_553 | 93 |
| 395 | 3300044693 | Ga0466961_0679850 | Ga0466961_0679850_102_407 | 93 |
| 396 | 3300044693 | Ga0466961_0744289 | Ga0466961_0744289_36_326 | 93 |
| 397 | 3300044694 | Ga0466963_0006203 | Ga0466963_0006203_1820_2101 | 93 |
| 398 | 3300044694 | Ga0466963_0015154 | Ga0466963_0015154_1707_1988 | 93 |
| 399 | 3300044694 | Ga0466963_0021769 | Ga0466963_0021769_3673_3963 | 93 |
| 400 | 3300044694 | Ga0466963_0033491 | Ga0466963_0033491_1833_2123 | 93 |
| 401 | 3300044694 | Ga0466963_0038785 | Ga0466963_0038785_380_670 | 93 |
| 402 | 3300044694 | Ga0466963_0079127 | Ga0466963_0079127_262_543 | 93 |
| 403 | 3300044694 | Ga0466963_0089585 | Ga0466963_0089585_913_1203 | 93 |
| 404 | 3300044694 | Ga0466963_0124090 | Ga0466963_0124090_813_1094 | 93 |
| 405 | 3300044694 | Ga0466963_0151220 | Ga0466963_0151220_1043_1342 | 93 |
| 406 | 3300044694 | Ga0466963_0431417 | Ga0466963_0431417_308_589 | 93 |
| 407 | 3300044706 | Ga0466964_0000606 | Ga0466964_0000606_9959_10249 | 93 |
| 408 | 3300044706 | Ga0466964_0078933 | Ga0466964_0078933_636_926 | 93 |
| 409 | 3300044706 | Ga0466964_0163420 | Ga0466964_0163420_453_743 | 93 |
| 410 | 3300044706 | Ga0466964_0174304 | Ga0466964_0174304_299_586 | 93 |
| 411 | 3300044706 | Ga0466964_0233796 | Ga0466964_0233796_315_599 | 93 |
| 412 | 3300044706 | Ga0466964_0239476 | Ga0466964_0239476_418_708 | 93 |
| 413 | 3300044719 | Ga0466971_0006232 | Ga0466971_0006232_209_508 | 93 |
| 414 | 3300044719 | Ga0466971_0163313 | Ga0466971_0163313_443_733 | 93 |
| 415 | 3300044735 | Ga0466968_0002271 | Ga0466968_0002271_3165_3455 | 93 |
| 416 | 3300044735 | Ga0466968_0004485 | Ga0466968_0004485_4865_5146 | 93 |
| 417 | 3300044735 | Ga0466968_0005377 | Ga0466968_0005377_2309_2590 | 93 |
| 418 | 3300044735 | Ga0466968_0074794 | Ga0466968_0074794_215_496 | 93 |
| 419 | 3300044735 | Ga0466968_0291978 | Ga0466968_0291978_100_381 | 93 |
| 420 | 3300044765 | Ga0466970_0005237 | Ga0466970_0005237_3192_3482 | 93 |
| 421 | 3300044765 | Ga0466970_0176783 | Ga0466970_0176783_505_795 | 93 |
| 422 | 3300044842 | Ga0466957_0005092 | Ga0466957_0005092_4667_4966 | 93 |
| 423 | 3300044842 | Ga0466957_0090892 | Ga0466957_0090892_1208_1498 | 93 |
| 424 | 3300044842 | Ga0466957_0214946 | Ga0466957_0214946_357_647 | 93 |
| 425 | 3300044842 | Ga0466957_0270103 | Ga0466957_0270103_152_433 | 93 |
| 426 | 3300044842 | Ga0466957_0376391 | Ga0466957_0376391_12_302 | 93 |
| 427 | 3300044842 | Ga0466957_0488315 | Ga0466957_0488315_273_563 | 93 |
| 428 | 3300044901 | Ga0466960_0080835 | Ga0466960_0080835_900_1190 | 93 |
| 429 | 3300044901 | Ga0466960_0309226 | Ga0466960_0309226_235_525 | 93 |
| 430 | 3300044901 | Ga0466960_0343511 | Ga0466960_0343511_163_444 | 93 |
| 431 | 3300045049 | Ga0466959_0014657 | Ga0466959_0014657_2669_2959 | 93 |
| 432 | 3300045049 | Ga0466959_0050671 | Ga0466959_0050671_309_608 | 93 |
| 433 | 3300045049 | Ga0466959_0166867 | Ga0466959_0166867_1117_1407 | 93 |
| 434 | 3300045049 | Ga0466959_0319057 | Ga0466959_0319057_329_619 | 93 |
| 435 | 3300045049 | Ga0466959_0710541 | Ga0466959_0710541_213_494 | 93 |
| 436 | 3300045836 | Ga0466958_0018517 | Ga0466958_0018517_808_1107 | 93 |
| 437 | 3300045836 | Ga0466958_0037941 | Ga0466958_0037941_2023_2313 | 93 |
| 438 | 3300045836 | Ga0466958_0065609 | Ga0466958_0065609_1257_1547 | 93 |
| 439 | 3300045836 | Ga0466958_0129652 | Ga0466958_0129652_443_733 | 93 |
| 440 | 3300045836 | Ga0466958_0459286 | Ga0466958_0459286_510_800 | 93 |
| 441 | 3300045836 | Ga0466958_0487546 | Ga0466958_0487546_344_625 | 93 |
| 442 | 3300045836 | Ga0466958_0567733 | Ga0466958_0567733_346_627 | 93 |
| 443 | 3300045836 | Ga0466958_0730568 | Ga0466958_0730568_194_475 | 93 |
| 444 | 3300045836 | Ga0466958_0772406 | Ga0466958_0772406_59_340 | 93 |
| 445 | 3300045976 | Ga0466967_0006945 | Ga0466967_0006945_2378_2668 | 93 |
| 446 | 3300045976 | Ga0466967_0016687 | Ga0466967_0016687_3803_4087 | 93 |
| 447 | 3300045976 | Ga0466967_0018925 | Ga0466967_0018925_2214_2495 | 93 |
| 448 | 3300045976 | Ga0466967_0045118 | Ga0466967_0045118_1218_1499 | 93 |
| 449 | 3300045976 | Ga0466967_0054010 | Ga0466967_0054010_165_455 | 93 |
| 450 | 3300045976 | Ga0466967_0072616 | Ga0466967_0072616_1789_2070 | 93 |
| 451 | 3300045976 | Ga0466967_0250297 | Ga0466967_0250297_1075_1365 | 93 |
| 452 | 3300045976 | Ga0466967_0593718 | Ga0466967_0593718_165_455 | 93 |
| 453 | 3300045976 | Ga0466967_0627841 | Ga0466967_0627841_505_786 | 93 |
| 454 | 3300045976 | Ga0466967_0821205 | Ga0466967_0821205_152_433 | 93 |
| 455 | 3300045976 | Ga0466967_0894264 | Ga0466967_0894264_98_379 | 93 |
| 456 | 3300045976 | Ga0466967_1588114 | Ga0466967_1588114_248_538 | 93 |
| 457 | 3300045976 | Ga0466967_1726847 | Ga0466967_1726847_256_537 | 93 |
| 458 | 3300045976 | Ga0466967_2154927 | Ga0466967_2154927_205_495 | 93 |
| 459 | 3300046455 | Ga0495603_0349596 | Ga0495603_0349596_281_571 | 93 |
| 460 | 3300046459 | Ga0495629_0093246 | Ga0495629_0093246_1806_2087 | 93 |
| 461 | 3300046459 | Ga0495629_0169497 | Ga0495629_0169497_484_765 | 93 |
| 462 | 3300046459 | Ga0495629_0839677 | Ga0495629_0839677_197_487 | 93 |
| 463 | 3300046461 | Ga0495641_0046020 | Ga0495641_0046020_823_1110 | 93 |
| 464 | 3300046461 | Ga0495641_0069451 | Ga0495641_0069451_679_969 | 93 |
| 465 | 3300046461 | Ga0495641_0102256 | Ga0495641_0102256_609_890 | 93 |
| 466 | 3300046463 | Ga0495653_0264193 | Ga0495653_0264193_567_848 | 93 |
| 467 | 3300046473 | Ga0495582_0133510 | Ga0495582_0133510_881_1162 | 93 |
| 468 | 3300046476 | Ga0495662_0034643 | Ga0495662_0034643_603_884 | 93 |
| 469 | 3300046476 | Ga0495662_0343754 | Ga0495662_0343754_177_458 | 93 |
| 470 | 3300046477 | Ga0495664_0312755 | Ga0495664_0312755_56_337 | 93 |
| 471 | 3300046514 | Ga0495618_0112890 | Ga0495618_0112890_862_1143 | 93 |
| 472 | 3300046514 | Ga0495618_0308767 | Ga0495618_0308767_501_782 | 93 |
| 473 | 3300046514 | Ga0495618_0658808 | Ga0495618_0658808_122_403 | 93 |
| 474 | 3300046516 | Ga0495628_0735417 | Ga0495628_0735417_243_524 | 93 |
| 475 | 3300046517 | Ga0495630_0003475 | Ga0495630_0003475_10170_10451 | 93 |
| 476 | 3300046517 | Ga0495630_0023872 | Ga0495630_0023872_36_317 | 93 |
| 477 | 3300046517 | Ga0495630_0108360 | Ga0495630_0108360_520_807 | 93 |
| 478 | 3300046517 | Ga0495630_0273116 | Ga0495630_0273116_513_794 | 93 |
| 479 | 3300046517 | Ga0495630_0660431 | Ga0495630_0660431_433_714 | 93 |
| 480 | 3300046517 | Ga0495630_0667828 | Ga0495630_0667828_235_525 | 93 |
| 481 | 3300046517 | Ga0495630_0765747 | Ga0495630_0765747_164_445 | 93 |
| 482 | 3300046526 | Ga0495666_0035611 | Ga0495666_0035611_513_794 | 93 |
| 483 | 3300046529 | Ga0495652_0283324 | Ga0495652_0283324_554_835 | 93 |
| 484 | 3300046529 | Ga0495652_0356584 | Ga0495652_0356584_537_848 | 93 |
| 485 | 3300046531 | Ga0495665_0013588 | Ga0495665_0013588_1503_1784 | 93 |
| 486 | 3300046531 | Ga0495665_0297262 | Ga0495665_0297262_407_694 | 93 |
| 487 | 3300046533 | Ga0495640_0058821 | Ga0495640_0058821_2289_2579 | 93 |
| 488 | 3300046533 | Ga0495640_0099935 | Ga0495640_0099935_468_749 | 93 |
| 489 | 3300046535 | Ga0495586_0016645 | Ga0495586_0016645_313_594 | 93 |
| 490 | 3300046535 | Ga0495586_0283341 | Ga0495586_0283341_66_347 | 93 |
| 491 | 3300046535 | Ga0495586_0396117 | Ga0495586_0396117_17_298 | 93 |
| 492 | 3300046535 | Ga0495586_0439234 | Ga0495586_0439234_245_535 | 93 |
| 493 | 3300046539 | Ga0495621_0483628 | Ga0495621_0483628_186_473 | 93 |
| 494 | 3300046559 | Ga0495667_0295996 | Ga0495667_0295996_100_411 | 93 |
| 495 | 3300046559 | Ga0495667_0402523 | Ga0495667_0402523_265_546 | 93 |
| 496 | 3300046642 | Ga0495634_0036902 | Ga0495634_0036902_2593_2874 | 93 |
| 497 | 3300046642 | Ga0495634_0056615 | Ga0495634_0056615_2227_2523 | 93 |
| 498 | 3300046642 | Ga0495634_0061935 | Ga0495634_0061935_2065_2346 | 93 |
| 499 | 3300046642 | Ga0495634_0070141 | Ga0495634_0070141_1878_2159 | 93 |
| 500 | 3300046663 | Ga0495635_0304861 | Ga0495635_0304861_642_923 | 93 |
| 501 | 3300046664 | Ga0495659_0141467 | Ga0495659_0141467_331_621 | 93 |
| 502 | 3300046675 | Ga0495657_0854781 | Ga0495657_0854781_110_406 | 93 |
| 503 | 3300046681 | Ga0495647_0228303 | Ga0495647_0228303_96_386 | 93 |
| 504 | 3300046681 | Ga0495647_0310184 | Ga0495647_0310184_270_551 | 93 |
| 505 | 3300046681 | Ga0495647_0356351 | Ga0495647_0356351_121_411 | 93 |
| 506 | 3300046683 | Ga0495658_0024133 | Ga0495658_0024133_2364_2645 | 93 |
| 507 | 3300046683 | Ga0495658_0213883 | Ga0495658_0213883_77_364 | 93 |
| 508 | 3300046689 | Ga0495613_0097374 | Ga0495613_0097374_1553_1834 | 93 |
| 509 | 3300046689 | Ga0495613_0431194 | Ga0495613_0431194_452_733 | 93 |
| 510 | 3300046690 | Ga0495624_0009082 | Ga0495624_0009082_2604_2885 | 93 |
| 511 | 3300046692 | Ga0495671_0326370 | Ga0495671_0326370_153_443 | 93 |
| 512 | 3300047315 | Ga0495581_0073484 | Ga0495581_0073484_1092_1373 | 93 |
| 513 | 3300047319 | Ga0495674_0161940 | Ga0495674_0161940_498_779 | 93 |
| 514 | 3300047319 | Ga0495674_0235661 | Ga0495674_0235661_741_1022 | 93 |
| 515 | 3300047319 | Ga0495674_0706930 | Ga0495674_0706930_12_293 | 93 |
| 516 | 3300047321 | Ga0495676_0060498 | Ga0495676_0060498_881_1162 | 93 |
| 517 | 3300047321 | Ga0495676_0158235 | Ga0495676_0158235_1208_1495 | 93 |
| 518 | 3300047321 | Ga0495676_0307635 | Ga0495676_0307635_668_958 | 93 |
| 519 | 3300047322 | Ga0495680_0194644 | Ga0495680_0194644_376_657 | 93 |
| 520 | 3300047471 | Ga0495684_0046785 | Ga0495684_0046785_2597_2878 | 93 |
| 521 | 3300047471 | Ga0495684_0082589 | Ga0495684_0082589_1721_2002 | 93 |
| 522 | 3300047673 | Ga0495593_0068368 | Ga0495593_0068368_607_888 | 93 |
| 523 | 3300048089 | Ga0495614_0009099 | Ga0495614_0009099_2979_3260 | 93 |
| 524 | 3300048903 | Ga0496100_0117641 | Ga0496100_0117641_495_776 | 93 |
| 525 | 3300048903 | Ga0496100_0253528 | Ga0496100_0253528_302_583 | 93 |
| 526 | 3300048903 | Ga0496100_0792777 | Ga0496100_0792777_424_714 | 93 |
| 527 | 3300048903 | Ga0496100_1269124 | Ga0496100_1269124_156_443 | 93 |
| 528 | 3300048904 | Ga0496101_0024104 | Ga0496101_0024104_1643_1930 | 93 |
| 529 | 3300048904 | Ga0496101_0088218 | Ga0496101_0088218_985_1266 | 93 |
| 530 | 3300048904 | Ga0496101_0459659 | Ga0496101_0459659_526_807 | 93 |
| 531 | 3300048904 | Ga0496101_0811977 | Ga0496101_0811977_33_323 | 93 |
| 532 | 3300048904 | Ga0496101_1547787 | Ga0496101_1547787_146_436 | 93 |
| 533 | 3300048905 | Ga0496102_0017242 | Ga0496102_0017242_3332_3622 | 93 |
| 534 | 3300048905 | Ga0496102_0226077 | Ga0496102_0226077_1090_1371 | 93 |
| 535 | 3300048905 | Ga0496102_0479947 | Ga0496102_0479947_356_637 | 93 |
| 536 | 3300048905 | Ga0496102_1367577 | Ga0496102_1367577_61_348 | 93 |
| 537 | 3300048906 | Ga0496103_0012805 | Ga0496103_0012805_3337_3627 | 93 |
| 538 | 3300048907 | Ga0496104_0064535 | Ga0496104_0064535_1781_2071 | 93 |
| 539 | 3300048907 | Ga0496104_0150006 | Ga0496104_0150006_652_933 | 93 |
| 540 | 3300048907 | Ga0496104_1030380 | Ga0496104_1030380_219_506 | 93 |
| 541 | 3300048908 | Ga0496105_0031205 | Ga0496105_0031205_823_1104 | 93 |
| 542 | 3300048908 | Ga0496105_0257819 | Ga0496105_0257819_640_921 | 93 |
| 543 | 3300048909 | Ga0496106_0012999 | Ga0496106_0012999_669_950 | 93 |
| 544 | 3300048909 | Ga0496106_0338864 | Ga0496106_0338864_484_771 | 93 |
| 545 | 3300048909 | Ga0496106_1341844 | Ga0496106_1341844_124_414 | 93 |
| 546 | 3300048910 | Ga0496107_0005142 | Ga0496107_0005142_6134_6421 | 93 |
| 547 | 3300048911 | Ga0496108_0061399 | Ga0496108_0061399_498_779 | 93 |
| 548 | 3300048911 | Ga0496108_0078793 | Ga0496108_0078793_313_594 | 93 |
| 549 | 3300048911 | Ga0496108_0694735 | Ga0496108_0694735_409_699 | 93 |
| 550 | 3300048912 | Ga0496109_0073842 | Ga0496109_0073842_2660_2950 | 93 |
| 551 | 3300048912 | Ga0496109_0241351 | Ga0496109_0241351_634_915 | 93 |
| 552 | 3300048912 | Ga0496109_0302125 | Ga0496109_0302125_861_1142 | 93 |
| 553 | 3300048913 | Ga0496110_0039901 | Ga0496110_0039901_745_1026 | 93 |
| 554 | 3300048914 | Ga0496111_0002119 | Ga0496111_0002119_4192_4473 | 93 |
| 555 | 3300048914 | Ga0496111_0598673 | Ga0496111_0598673_233_514 | 93 |
| 556 | 3300048915 | Ga0496112_0123442 | Ga0496112_0123442_2132_2422 | 93 |
| 557 | 3300048915 | Ga0496112_0196892 | Ga0496112_0196892_521_802 | 93 |
| 558 | 3300048915 | Ga0496112_0652248 | Ga0496112_0652248_169_459 | 93 |
| 559 | 3300048915 | Ga0496112_1055089 | Ga0496112_1055089_251_532 | 93 |
| 560 | 3300048916 | Ga0496113_0875561 | Ga0496113_0875561_65_355 | 93 |
| 561 | 3300048917 | Ga0496114_0085324 | Ga0496114_0085324_1081_1371 | 93 |
| 562 | 3300048917 | Ga0496114_0112319 | Ga0496114_0112319_90_371 | 93 |
| 563 | 3300048918 | Ga0496115_0056169 | Ga0496115_0056169_351_638 | 93 |
| 564 | 3300048918 | Ga0496115_0197635 | Ga0496115_0197635_861_1142 | 93 |
| 565 | 3300049569 | Ga0501032_0511454 | Ga0501032_0511454_356_637 | 93 |
| 566 | 3300049571 | Ga0501034_0877154 | Ga0501034_0877154_146_427 | 93 |
| 567 | 3300049580 | Ga0501046_0433765 | Ga0501046_0433765_59_340 | 93 |
| 568 | 3300049581 | Ga0501047_0258008 | Ga0501047_0258008_1273_1554 | 93 |
| 569 | 3300049581 | Ga0501047_0470892 | Ga0501047_0470892_754_1035 | 93 |
| 570 | 3300049581 | Ga0501047_0987508 | Ga0501047_0987508_208_489 | 93 |
| 571 | 3300049583 | Ga0501067_0032576 | Ga0501067_0032576_505_795 | 93 |
| 572 | 3300049583 | Ga0501067_0283683 | Ga0501067_0283683_178_459 | 93 |
| 573 | 3300049585 | Ga0501069_0030953 | Ga0501069_0030953_1678_1959 | 93 |
| 574 | 3300049586 | Ga0501070_0011133 | Ga0501070_0011133_4659_4940 | 93 |
| 575 | 3300049586 | Ga0501070_0247307 | Ga0501070_0247307_154_444 | 93 |
| 576 | 3300049586 | Ga0501070_0758133 | Ga0501070_0758133_461_742 | 93 |
| 577 | 3300049586 | Ga0501070_1158104 | Ga0501070_1158104_69_350 | 93 |
| 578 | 3300049589 | Ga0501073_0028986 | Ga0501073_0028986_2056_2337 | 93 |
| 579 | 3300049590 | Ga0501074_0015662 | Ga0501074_0015662_465_746 | 93 |
| 580 | 3300049590 | Ga0501074_0144568 | Ga0501074_0144568_1206_1487 | 93 |
| 581 | 3300049741 | Ga0501079_0179805 | Ga0501079_0179805_1077_1358 | 93 |
| 582 | 3300049742 | Ga0501080_0125186 | Ga0501080_0125186_111_392 | 93 |
| 583 | 3300049744 | Ga0501083_0001476 | Ga0501083_0001476_6755_7036 | 93 |
| 584 | 3300049822 | Ga0501035_0784477 | Ga0501035_0784477_140_421 | 93 |
| 585 | 3300049823 | Ga0501044_0713900 | Ga0501044_0713900_267_548 | 93 |
| 586 | 3300049823 | Ga0501044_1362192 | Ga0501044_1362192_46_327 | 93 |
| 587 | 3300050512 | nmdc:mga0n895_75033_c1 | nmdc:mga0n895_75033_c1_2579_2866 | 93 |
| 588 | 3300050513 | nmdc:mga0rr50_6584_c1 | nmdc:mga0rr50_6584_c1_5152_5439 | 93 |
| 589 | 3300050514 | nmdc:mga08x19_1064596_c1 | nmdc:mga08x19_1064596_c1_238_528 | 93 |
| 590 | 3300050514 | nmdc:mga08x19_213418_c1 | nmdc:mga08x19_213418_c1_143_424 | 93 |
| 591 | 3300053077 | Ga0495601_0091489 | Ga0495601_0091489_137_418 | 93 |
| 592 | 3300053077 | Ga0495601_0110314 | Ga0495601_0110314_326_607 | 93 |
| 593 | 3300053077 | Ga0495601_0451511 | Ga0495601_0451511_502_783 | 93 |
| 594 | 3300053077 | Ga0495601_0567748 | Ga0495601_0567748_274_585 | 93 |
| 595 | 3300053077 | Ga0495601_0574178 | Ga0495601_0574178_190_486 | 93 |
| 596 | 3300053085 | Ga0495619_0242655 | Ga0495619_0242655_469_750 | 93 |
| 597 | 3300053085 | Ga0495619_0555247 | Ga0495619_0555247_172_462 | 93 |
| 598 | 3300054114 | Ga0501084_0465079 | Ga0501084_0465079_492_773 | 93 |
| 599 | 3300059644 | Ga0587075_054501 | Ga0587075_054501_19_300 | 93 |
| 600 | 3300061719 | Ga0466962_0028444 | Ga0466962_0028444_1391_1672 | 93 |
| 601 | 3300061719 | Ga0466962_0236792 | Ga0466962_0236792_76_375 | 93 |
| 602 | 3300061719 | Ga0466962_0277150 | Ga0466962_0277150_66_356 | 93 |
| 603 | 3300061719 | Ga0466962_0729393 | Ga0466962_0729393_26_316 | 93 |
| 604 | 3300061734 | Ga0530510_0289349 | Ga0530510_0289349_325_606 | 93 |
| 605 | 3300005329 | Ga0070683_100052446 | Ga0070683_1000524464 | 94 |
| 606 | 3300005338 | Ga0068868_101255791 | Ga0068868_1012557912 | 94 |
| 607 | 3300005355 | Ga0070671_101891308 | Ga0070671_1018913082 | 94 |
| 608 | 3300005434 | Ga0070709_11246950 | Ga0070709_112469502 | 94 |
| 609 | 3300005435 | Ga0070714_100716788 | Ga0070714_1007167881 | 94 |
| 610 | 3300005435 | Ga0070714_100945906 | Ga0070714_1009459061 | 94 |
| 611 | 3300005437 | Ga0070710_10913076 | Ga0070710_109130762 | 94 |
| 612 | 3300005439 | Ga0070711_101797281 | Ga0070711_1017972812 | 94 |
| 613 | 3300005440 | Ga0070705_101078870 | Ga0070705_1010788702 | 94 |
| 614 | 3300005444 | Ga0070694_100209348 | Ga0070694_1002093482 | 94 |
| 615 | 3300005471 | Ga0070698_100258548 | Ga0070698_1002585483 | 94 |
| 616 | 3300005530 | Ga0070679_100114800 | Ga0070679_1001148003 | 94 |
| 617 | 3300005564 | Ga0070664_100505956 | Ga0070664_1005059562 | 94 |
| 618 | 3300005616 | Ga0068852_100147275 | Ga0068852_1001472752 | 94 |
| 619 | 3300006058 | Ga0075432_10116539 | Ga0075432_101165392 | 94 |
| 620 | 3300006173 | Ga0070716_101764908 | Ga0070716_1017649082 | 94 |
| 621 | 3300006175 | Ga0070712_100490266 | Ga0070712_1004902662 | 94 |
| 622 | 3300006175 | Ga0070712_100823035 | Ga0070712_1008230352 | 94 |
| 623 | 3300006237 | Ga0097621_100447317 | Ga0097621_1004473172 | 94 |
| 624 | 3300006852 | Ga0075433_10317353 | Ga0075433_103173532 | 94 |
| 625 | 3300006871 | Ga0075434_100165162 | Ga0075434_1001651622 | 94 |
| 626 | 3300007076 | Ga0075435_100689428 | Ga0075435_1006894282 | 94 |
| 627 | 3300009094 | Ga0111539_10476269 | Ga0111539_104762692 | 94 |
| 628 | 3300009098 | Ga0105245_10171862 | Ga0105245_101718623 | 94 |
| 629 | 3300013104 | Ga0157370_11215828 | Ga0157370_112158281 | 94 |
| 630 | 3300013105 | Ga0157369_10840299 | Ga0157369_108402992 | 94 |
| 631 | 3300013296 | Ga0157374_11806434 | Ga0157374_118064342 | 94 |
| 632 | 3300013307 | Ga0157372_11515200 | Ga0157372_115152002 | 94 |
| 633 | 3300013308 | Ga0157375_10056241 | Ga0157375_100562412 | 94 |
| 634 | 3300014969 | Ga0157376_10546351 | Ga0157376_105463512 | 94 |
| 635 | 3300015265 | Ga0182005_1206880 | Ga0182005_12068802 | 94 |
| 636 | 3300020070 | Ga0206356_10506411 | Ga0206356_105064112 | 94 |
| 637 | 3300020075 | Ga0206349_1954900 | Ga0206349_19549002 | 94 |
| 638 | 3300020081 | Ga0206354_11702124 | Ga0206354_117021244 | 94 |
| 639 | 3300020082 | Ga0206353_11189789 | Ga0206353_111897892 | 94 |
| 640 | 3300025898 | Ga0207692_11075321 | Ga0207692_110753212 | 94 |
| 641 | 3300025909 | Ga0207705_10271211 | Ga0207705_102712112 | 94 |
| 642 | 3300025915 | Ga0207693_11470024 | Ga0207693_114700242 | 94 |
| 643 | 3300025917 | Ga0207660_10286588 | Ga0207660_102865882 | 94 |
| 644 | 3300025921 | Ga0207652_10846460 | Ga0207652_108464602 | 94 |
| 645 | 3300025927 | Ga0207687_11226320 | Ga0207687_112263202 | 94 |
| 646 | 3300025939 | Ga0207665_10347307 | Ga0207665_103473072 | 94 |
| 647 | 3300025944 | Ga0207661_10139196 | Ga0207661_101391964 | 94 |
| 648 | 3300025944 | Ga0207661_11602907 | Ga0207661_116029071 | 94 |
| 649 | 3300025960 | Ga0207651_10464865 | Ga0207651_104648652 | 94 |
| 650 | 3300026142 | Ga0207698_11051181 | Ga0207698_110511812 | 94 |
| 651 | 3300027907 | Ga0207428_10156120 | Ga0207428_101561204 | 94 |
| 652 | 3300028379 | Ga0268266_11254832 | Ga0268266_112548322 | 94 |
| 653 | 3300034819 | Ga0373958_0194308 | Ga0373958_0194308_82_375 | 94 |
| 654 | 3300035117 | Ga0373953_0491730 | Ga0373953_0491730_92_388 | 94 |
| 655 | 3300035121 | Ga0373960_0137675 | Ga0373960_0137675_61_354 | 94 |
| 656 | 3300035172 | Ga0373955_0577222 | Ga0373955_0577222_331_627 | 94 |
| 657 | 3300035410 | Ga0373924_0211246 | Ga0373924_0211246_487_783 | 94 |
| 658 | 3300035691 | Ga0373931_0421327 | Ga0373931_0421327_502_795 | 94 |
| 659 | 3300035725 | Ga0373947_0696405 | Ga0373947_0696405_267_557 | 94 |
| 660 | 3300036401 | Ga0373937_0882978 | Ga0373937_0882978_477_773 | 94 |
| 661 | 3300037471 | Ga0395905_1206246 | Ga0395905_1206246_65_355 | 94 |
| 662 | 3300041492 | Ga0451835_0395632 | Ga0451835_0395632_91_381 | 94 |
| 663 | 3300044656 | Ga0466969_0219409 | Ga0466969_0219409_37_330 | 94 |
| 664 | 3300044683 | Ga0466965_0149736 | Ga0466965_0149736_264_557 | 94 |
| 665 | 3300044684 | Ga0466966_0090406 | Ga0466966_0090406_1039_1332 | 94 |
| 666 | 3300044693 | Ga0466961_0012971 | Ga0466961_0012971_679_972 | 94 |
| 667 | 3300044693 | Ga0466961_0059397 | Ga0466961_0059397_1890_2180 | 94 |
| 668 | 3300044693 | Ga0466961_0080403 | Ga0466961_0080403_1194_1487 | 94 |
| 669 | 3300044693 | Ga0466961_0638924 | Ga0466961_0638924_181_465 | 94 |
| 670 | 3300044694 | Ga0466963_0002677 | Ga0466963_0002677_9290_9583 | 94 |
| 671 | 3300044694 | Ga0466963_0003889 | Ga0466963_0003889_4457_4750 | 94 |
| 672 | 3300044694 | Ga0466963_0385080 | Ga0466963_0385080_91_384 | 94 |
| 673 | 3300044694 | Ga0466963_0504215 | Ga0466963_0504215_22_312 | 94 |
| 674 | 3300044694 | Ga0466963_1320784 | Ga0466963_1320784_119_412 | 94 |
| 675 | 3300044706 | Ga0466964_0771182 | Ga0466964_0771182_149_442 | 94 |
| 676 | 3300044719 | Ga0466971_0010936 | Ga0466971_0010936_3102_3395 | 94 |
| 677 | 3300044719 | Ga0466971_0046865 | Ga0466971_0046865_261_554 | 94 |
| 678 | 3300044735 | Ga0466968_0565715 | Ga0466968_0565715_22_306 | 94 |
| 679 | 3300044765 | Ga0466970_0727246 | Ga0466970_0727246_146_436 | 94 |
| 680 | 3300044765 | Ga0466970_0934276 | Ga0466970_0934276_146_430 | 94 |
| 681 | 3300044842 | Ga0466957_0280783 | Ga0466957_0280783_607_900 | 94 |
| 682 | 3300044842 | Ga0466957_0770629 | Ga0466957_0770629_288_578 | 94 |
| 683 | 3300045049 | Ga0466959_0001430 | Ga0466959_0001430_3246_3536 | 94 |
| 684 | 3300045049 | Ga0466959_0099997 | Ga0466959_0099997_230_523 | 94 |
| 685 | 3300045049 | Ga0466959_0278007 | Ga0466959_0278007_347_631 | 94 |
| 686 | 3300045049 | Ga0466959_0599116 | Ga0466959_0599116_302_595 | 94 |
| 687 | 3300045836 | Ga0466958_0035358 | Ga0466958_0035358_2125_2418 | 94 |
| 688 | 3300045836 | Ga0466958_0083367 | Ga0466958_0083367_512_802 | 94 |
| 689 | 3300045836 | Ga0466958_0248838 | Ga0466958_0248838_761_1054 | 94 |
| 690 | 3300045976 | Ga0466967_0301568 | Ga0466967_0301568_176_469 | 94 |
| 691 | 3300045976 | Ga0466967_0438368 | Ga0466967_0438368_470_763 | 94 |
| 692 | 3300045976 | Ga0466967_0742037 | Ga0466967_0742037_496_786 | 94 |
| 693 | 3300045976 | Ga0466967_1011715 | Ga0466967_1011715_308_601 | 94 |
| 694 | 3300046452 | Ga0495617_190785 | Ga0495617_190785_339_632 | 94 |
| 695 | 3300046454 | Ga0495592_0111239 | Ga0495592_0111239_39_332 | 94 |
| 696 | 3300046461 | Ga0495641_0221787 | Ga0495641_0221787_243_533 | 94 |
| 697 | 3300046473 | Ga0495582_0096863 | Ga0495582_0096863_898_1188 | 94 |
| 698 | 3300046473 | Ga0495582_0564415 | Ga0495582_0564415_339_629 | 94 |
| 699 | 3300046473 | Ga0495582_0617203 | Ga0495582_0617203_177_470 | 94 |
| 700 | 3300046474 | Ga0495605_0118834 | Ga0495605_0118834_85_378 | 94 |
| 701 | 3300046475 | Ga0495639_0249618 | Ga0495639_0249618_79_369 | 94 |
| 702 | 3300046475 | Ga0495639_0659167 | Ga0495639_0659167_167_457 | 94 |
| 703 | 3300046477 | Ga0495664_0484269 | Ga0495664_0484269_325_621 | 94 |
| 704 | 3300046499 | Ga0495594_0588010 | Ga0495594_0588010_186_476 | 94 |
| 705 | 3300046514 | Ga0495618_0059715 | Ga0495618_0059715_180_476 | 94 |
| 706 | 3300046516 | Ga0495628_0936071 | Ga0495628_0936071_233_529 | 94 |
| 707 | 3300046517 | Ga0495630_0675444 | Ga0495630_0675444_327_623 | 94 |
| 708 | 3300046517 | Ga0495630_0978372 | Ga0495630_0978372_153_446 | 94 |
| 709 | 3300046517 | Ga0495630_1003238 | Ga0495630_1003238_147_440 | 94 |
| 710 | 3300046528 | Ga0495642_0107054 | Ga0495642_0107054_794_1087 | 94 |
| 711 | 3300046529 | Ga0495652_0313182 | Ga0495652_0313182_88_384 | 94 |
| 712 | 3300046535 | Ga0495586_0425846 | Ga0495586_0425846_331_627 | 94 |
| 713 | 3300046536 | Ga0495587_0685182 | Ga0495587_0685182_250_546 | 94 |
| 714 | 3300046543 | Ga0495645_0119020 | Ga0495645_0119020_1300_1596 | 94 |
| 715 | 3300046543 | Ga0495645_0120708 | Ga0495645_0120708_1500_1793 | 94 |
| 716 | 3300046615 | Ga0495656_0135436 | Ga0495656_0135436_434_727 | 94 |
| 717 | 3300046642 | Ga0495634_0383535 | Ga0495634_0383535_385_681 | 94 |
| 718 | 3300046680 | Ga0495646_0323741 | Ga0495646_0323741_115_411 | 94 |
| 719 | 3300046681 | Ga0495647_0261465 | Ga0495647_0261465_321_617 | 94 |
| 720 | 3300046683 | Ga0495658_0147251 | Ga0495658_0147251_531_824 | 94 |
| 721 | 3300046683 | Ga0495658_0526691 | Ga0495658_0526691_94_390 | 94 |
| 722 | 3300046689 | Ga0495613_0580393 | Ga0495613_0580393_367_663 | 94 |
| 723 | 3300046690 | Ga0495624_0324851 | Ga0495624_0324851_343_636 | 94 |
| 724 | 3300047318 | Ga0495636_0297975 | Ga0495636_0297975_145_438 | 94 |
| 725 | 3300047319 | Ga0495674_0587486 | Ga0495674_0587486_191_487 | 94 |
| 726 | 3300047321 | Ga0495676_0209132 | Ga0495676_0209132_580_870 | 94 |
| 727 | 3300047321 | Ga0495676_0597960 | Ga0495676_0597960_277_570 | 94 |
| 728 | 3300047322 | Ga0495680_0694648 | Ga0495680_0694648_126_422 | 94 |
| 729 | 3300047445 | Ga0495677_0121939 | Ga0495677_0121939_466_759 | 94 |
| 730 | 3300048903 | Ga0496100_0115702 | Ga0496100_0115702_650_940 | 94 |
| 731 | 3300048903 | Ga0496100_0863746 | Ga0496100_0863746_252_542 | 94 |
| 732 | 3300048903 | Ga0496100_1009048 | Ga0496100_1009048_126_416 | 94 |
| 733 | 3300048904 | Ga0496101_0206192 | Ga0496101_0206192_489_779 | 94 |
| 734 | 3300048905 | Ga0496102_0290048 | Ga0496102_0290048_701_991 | 94 |
| 735 | 3300048907 | Ga0496104_0423921 | Ga0496104_0423921_434_724 | 94 |
| 736 | 3300048907 | Ga0496104_0595201 | Ga0496104_0595201_529_822 | 94 |
| 737 | 3300048907 | Ga0496104_0736702 | Ga0496104_0736702_458_745 | 94 |
| 738 | 3300048908 | Ga0496105_0199502 | Ga0496105_0199502_464_757 | 94 |
| 739 | 3300048911 | Ga0496108_0730804 | Ga0496108_0730804_144_437 | 94 |
| 740 | 3300048911 | Ga0496108_0801673 | Ga0496108_0801673_353_643 | 94 |
| 741 | 3300048912 | Ga0496109_0201436 | Ga0496109_0201436_885_1175 | 94 |
| 742 | 3300048913 | Ga0496110_0326317 | Ga0496110_0326317_533_823 | 94 |
| 743 | 3300048913 | Ga0496110_0526511 | Ga0496110_0526511_418_708 | 94 |
| 744 | 3300048917 | Ga0496114_0012447 | Ga0496114_0012447_1910_2200 | 94 |
| 745 | 3300048917 | Ga0496114_0030886 | Ga0496114_0030886_3046_3336 | 94 |
| 746 | 3300050512 | nmdc:mga0n895_64924_c1 | nmdc:mga0n895_64924_c1_248_541 | 94 |
| 747 | 3300050513 | nmdc:mga0rr50_40345_c1 | nmdc:mga0rr50_40345_c1_126_419 | 94 |
| 748 | 3300050515 | nmdc:mga0a205_1201227_c1 | nmdc:mga0a205_1201227_c1_10_303 | 94 |
| 749 | 3300053077 | Ga0495601_0309736 | Ga0495601_0309736_533_829 | 94 |
| 750 | 3300053078 | Ga0495612_0177212 | Ga0495612_0177212_423_719 | 94 |
| 751 | 3300053084 | Ga0495595_0639412 | Ga0495595_0639412_33_329 | 94 |
| 752 | 3300061719 | Ga0466962_0000620 | Ga0466962_0000620_4323_4616 | 94 |
| 753 | 3300061719 | Ga0466962_0000842 | Ga0466962_0000842_4254_4547 | 94 |
| 754 | 3300061719 | Ga0466962_0044594 | Ga0466962_0044594_1066_1359 | 94 |
| 755 | 3300015262 | Ga0182007_10238154 | Ga0182007_102381542 | 95 |
| 756 | 3300025941 | Ga0207711_11576274 | Ga0207711_115762742 | 95 |
| 757 | 3300035116 | Ga0373945_0569445 | Ga0373945_0569445_190_495 | 95 |
| 758 | 3300035119 | Ga0373956_0149673 | Ga0373956_0149673_315_620 | 95 |
| 759 | 3300035172 | Ga0373955_0730131 | Ga0373955_0730131_96_401 | 95 |
| 760 | 3300035724 | Ga0373933_0079441 | Ga0373933_0079441_462_767 | 95 |
| 761 | 3300036401 | Ga0373937_0038431 | Ga0373937_0038431_3240_3545 | 95 |
| 762 | 3300044735 | Ga0466968_0337404 | Ga0466968_0337404_318_620 | 95 |
| 763 | 3300044842 | Ga0466957_0929110 | Ga0466957_0929110_15_320 | 95 |
| 764 | 3300044901 | Ga0466960_0095494 | Ga0466960_0095494_514_801 | 95 |
| 765 | 3300045836 | Ga0466958_0057958 | Ga0466958_0057958_646_951 | 95 |
| 766 | 3300045976 | Ga0466967_0727559 | Ga0466967_0727559_358_660 | 95 |
| 767 | 3300045976 | Ga0466967_0956132 | Ga0466967_0956132_118_423 | 95 |
| 768 | 3300046454 | Ga0495592_0001526 | Ga0495592_0001526_14782_15087 | 95 |
| 769 | 3300046454 | Ga0495592_0633826 | Ga0495592_0633826_26_331 | 95 |
| 770 | 3300046459 | Ga0495629_0145491 | Ga0495629_0145491_562_867 | 95 |
| 771 | 3300046462 | Ga0495651_0001467 | Ga0495651_0001467_2308_2613 | 95 |
| 772 | 3300046463 | Ga0495653_0000781 | Ga0495653_0000781_9621_9926 | 95 |
| 773 | 3300046473 | Ga0495582_0149856 | Ga0495582_0149856_106_408 | 95 |
| 774 | 3300046511 | Ga0495608_0009146 | Ga0495608_0009146_1061_1366 | 95 |
| 775 | 3300046511 | Ga0495608_0389823 | Ga0495608_0389823_418_714 | 95 |
| 776 | 3300046514 | Ga0495618_0000680 | Ga0495618_0000680_5623_5928 | 95 |
| 777 | 3300046516 | Ga0495628_0002347 | Ga0495628_0002347_15619_15924 | 95 |
| 778 | 3300046529 | Ga0495652_0002978 | Ga0495652_0002978_15619_15924 | 95 |
| 779 | 3300046536 | Ga0495587_0001454 | Ga0495587_0001454_13792_14097 | 95 |
| 780 | 3300046543 | Ga0495645_0000988 | Ga0495645_0000988_1156_1461 | 95 |
| 781 | 3300046559 | Ga0495667_0254939 | Ga0495667_0254939_465_770 | 95 |
| 782 | 3300046559 | Ga0495667_0485417 | Ga0495667_0485417_181_477 | 95 |
| 783 | 3300046642 | Ga0495634_0678370 | Ga0495634_0678370_141_446 | 95 |
| 784 | 3300046663 | Ga0495635_0638355 | Ga0495635_0638355_296_601 | 95 |
| 785 | 3300046675 | Ga0495657_0010367 | Ga0495657_0010367_345_650 | 95 |
| 786 | 3300046675 | Ga0495657_0018183 | Ga0495657_0018183_92_388 | 95 |
| 787 | 3300046678 | Ga0495599_0002970 | Ga0495599_0002970_2370_2675 | 95 |
| 788 | 3300046679 | Ga0495623_0004124 | Ga0495623_0004124_2074_2379 | 95 |
| 789 | 3300046680 | Ga0495646_0010511 | Ga0495646_0010511_1065_1370 | 95 |
| 790 | 3300046809 | Ga0495600_0006726 | Ga0495600_0006726_2065_2370 | 95 |
| 791 | 3300047317 | Ga0495604_0012690 | Ga0495604_0012690_1133_1438 | 95 |
| 792 | 3300047319 | Ga0495674_0224628 | Ga0495674_0224628_482_787 | 95 |
| 793 | 3300047319 | Ga0495674_1049500 | Ga0495674_1049500_306_602 | 95 |
| 794 | 3300047322 | Ga0495680_0006100 | Ga0495680_0006100_1052_1357 | 95 |
| 795 | 3300047322 | Ga0495680_0252107 | Ga0495680_0252107_522_818 | 95 |
| 796 | 3300047444 | Ga0495675_0000809 | Ga0495675_0000809_17930_18235 | 95 |
| 797 | 3300048088 | Ga0495602_0001857 | Ga0495602_0001857_2917_3222 | 95 |
| 798 | 3300048911 | Ga0496108_0012844 | Ga0496108_0012844_2584_2889 | 95 |
| 799 | 3300048912 | Ga0496109_0034832 | Ga0496109_0034832_1562_1867 | 95 |
| 800 | 3300048914 | Ga0496111_0121645 | Ga0496111_0121645_412_717 | 95 |
| 801 | 3300048915 | Ga0496112_0082100 | Ga0496112_0082100_1617_1922 | 95 |
| 802 | 3300048918 | Ga0496115_0161337 | Ga0496115_0161337_946_1248 | 95 |
| 803 | 3300053077 | Ga0495601_0008246 | Ga0495601_0008246_4757_5062 | 95 |
| 804 | 3300053078 | Ga0495612_0407262 | Ga0495612_0407262_142_447 | 95 |
| 805 | 3300053084 | Ga0495595_0049857 | Ga0495595_0049857_1077_1382 | 95 |
| 806 | 3300053084 | Ga0495595_0446177 | Ga0495595_0446177_177_473 | 95 |
| 807 | 3300053085 | Ga0495619_0000340 | Ga0495619_0000340_8908_9213 | 95 |
| 808 | 3300053085 | Ga0495619_0362260 | Ga0495619_0362260_97_393 | 95 |
| 809 | 3300005327 | Ga0070658_10003469 | Ga0070658_1000346915 | 96 |
| 810 | 3300005329 | Ga0070683_100323271 | Ga0070683_1003232712 | 96 |
| 811 | 3300005336 | Ga0070680_100265238 | Ga0070680_1002652383 | 96 |
| 812 | 3300005337 | Ga0070682_101385388 | Ga0070682_1013853882 | 96 |
| 813 | 3300005338 | Ga0068868_102018356 | Ga0068868_1020183562 | 96 |
| 814 | 3300005339 | Ga0070660_100103906 | Ga0070660_1001039062 | 96 |
| 815 | 3300005339 | Ga0070660_100611469 | Ga0070660_1006114692 | 96 |
| 816 | 3300005341 | Ga0070691_10071494 | Ga0070691_100714942 | 96 |
| 817 | 3300005344 | Ga0070661_100584652 | Ga0070661_1005846522 | 96 |
| 818 | 3300005344 | Ga0070661_101560580 | Ga0070661_1015605802 | 96 |
| 819 | 3300005345 | Ga0070692_10215121 | Ga0070692_102151213 | 96 |
| 820 | 3300005366 | Ga0070659_100198333 | Ga0070659_1001983333 | 96 |
| 821 | 3300005457 | Ga0070662_100728941 | Ga0070662_1007289412 | 96 |
| 822 | 3300005458 | Ga0070681_10639546 | Ga0070681_106395462 | 96 |
| 823 | 3300005458 | Ga0070681_12041023 | Ga0070681_120410231 | 96 |
| 824 | 3300005539 | Ga0068853_101093450 | Ga0068853_1010934502 | 96 |
| 825 | 3300005563 | Ga0068855_100291723 | Ga0068855_1002917233 | 96 |
| 826 | 3300005564 | Ga0070664_100428808 | Ga0070664_1004288082 | 96 |
| 827 | 3300005614 | Ga0068856_100437936 | Ga0068856_1004379363 | 96 |
| 828 | 3300005616 | Ga0068852_100316029 | Ga0068852_1003160292 | 96 |
| 829 | 3300006237 | Ga0097621_101003848 | Ga0097621_1010038482 | 96 |
| 830 | 3300009174 | Ga0105241_10997661 | Ga0105241_109976612 | 96 |
| 831 | 3300009545 | Ga0105237_10540801 | Ga0105237_105408012 | 96 |
| 832 | 3300009551 | Ga0105238_12703763 | Ga0105238_127037632 | 96 |
| 833 | 3300013102 | Ga0157371_10659940 | Ga0157371_106599402 | 96 |
| 834 | 3300013105 | Ga0157369_10759161 | Ga0157369_107591612 | 96 |
| 835 | 3300013297 | Ga0157378_10280808 | Ga0157378_102808082 | 96 |
| 836 | 3300013307 | Ga0157372_10869734 | Ga0157372_108697342 | 96 |
| 837 | 3300020081 | Ga0206354_10042482 | Ga0206354_100424822 | 96 |
| 838 | 3300020082 | Ga0206353_11462915 | Ga0206353_114629151 | 96 |
| 839 | 3300022467 | Ga0224712_10094948 | Ga0224712_100949482 | 96 |
| 840 | 3300025909 | Ga0207705_10072226 | Ga0207705_100722264 | 96 |
| 841 | 3300025912 | Ga0207707_10527390 | Ga0207707_105273902 | 96 |
| 842 | 3300025917 | Ga0207660_10842822 | Ga0207660_108428222 | 96 |
| 843 | 3300025919 | Ga0207657_10137356 | Ga0207657_101373562 | 96 |
| 844 | 3300025924 | Ga0207694_10033763 | Ga0207694_100337632 | 96 |
| 845 | 3300025927 | Ga0207687_11962266 | Ga0207687_119622662 | 96 |
| 846 | 3300025932 | Ga0207690_10816024 | Ga0207690_108160242 | 96 |
| 847 | 3300025933 | Ga0207706_10978598 | Ga0207706_109785982 | 96 |
| 848 | 3300025944 | Ga0207661_12170801 | Ga0207661_121708012 | 96 |
| 849 | 3300025945 | Ga0207679_10514788 | Ga0207679_105147882 | 96 |
| 850 | 3300025949 | Ga0207667_10396537 | Ga0207667_103965372 | 96 |
| 851 | 3300026023 | Ga0207677_10560669 | Ga0207677_105606692 | 96 |
| 852 | 3300026078 | Ga0207702_10137271 | Ga0207702_101372714 | 96 |
| 853 | 3300026078 | Ga0207702_11033479 | Ga0207702_110334792 | 96 |
| 854 | 3300035171 | Ga0373946_0020493 | Ga0373946_0020493_767_1081 | 96 |
| 855 | 3300037312 | Ga0395899_0020914 | Ga0395899_0020914_2282_2572 | 96 |
| 856 | 3300037418 | Ga0395900_0340838 | Ga0395900_0340838_847_1137 | 96 |
| 857 | 3300037466 | Ga0395898_0274595 | Ga0395898_0274595_499_789 | 96 |
| 858 | 3300037466 | Ga0395898_0973258 | Ga0395898_0973258_455_772 | 96 |
| 859 | 3300037471 | Ga0395905_0678769 | Ga0395905_0678769_122_412 | 96 |
| 860 | 3300038443 | Ga0395901_0048637 | Ga0395901_0048637_3955_4245 | 96 |
| 861 | 3300046533 | Ga0495640_0835962 | Ga0495640_0835962_169_477 | 96 |
| 862 | 3300048903 | Ga0496100_0105858 | Ga0496100_0105858_1248_1550 | 96 |
| 863 | 3300048904 | Ga0496101_0307002 | Ga0496101_0307002_471_773 | 96 |
| 864 | 3300048906 | Ga0496103_1050631 | Ga0496103_1050631_118_420 | 96 |
| 865 | 3300048908 | Ga0496105_0619102 | Ga0496105_0619102_267_569 | 96 |
| 866 | 3300048910 | Ga0496107_0385608 | Ga0496107_0385608_143_445 | 96 |
| 867 | 3300048911 | Ga0496108_0133200 | Ga0496108_0133200_237_539 | 96 |
| 868 | 3300048912 | Ga0496109_0155672 | Ga0496109_0155672_806_1108 | 96 |
| 869 | 3300048913 | Ga0496110_0665963 | Ga0496110_0665963_330_632 | 96 |
| 870 | 3300048914 | Ga0496111_0382679 | Ga0496111_0382679_655_957 | 96 |
| 871 | 3300048915 | Ga0496112_0059102 | Ga0496112_0059102_2518_2820 | 96 |
| 872 | 3300048916 | Ga0496113_0738146 | Ga0496113_0738146_107_409 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3egr-assembly1.cif.gz_B-2 | crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution | 0.8445 | 1 | 61 |
| 3egr-assembly1.cif.gz_B-2 | crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution | 0.8208 | 1 | 61 |
| 4iit-assembly1.cif.gz_B-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.8188 | 1 | 61 |
| 4iit-assembly1.cif.gz_B-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.7848 | 1 | 61 |
| 1a5i-assembly1.cif.gz_A | catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone) | 0.78 | 2 | 26 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76078_2_65_3.10.20.520 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8583 | 3 | 61 | 3.10.20.520 |
| 3egrB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8403 | 1 | 61 | 3.10.20.520 |
| 3egrB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8164 | 1 | 61 | 3.10.20.520 |
| af_P76078_2_65_3.10.20.520 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.7861 | 3 | 61 | 3.10.20.520 |
| 2qcsB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7445 | 3 | 28 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5P9P7A3-F1-model_v4 | RSAM-partnered protein | 0.9135 | 1 | 57 |
|
| AF-A0A830FDE0-F1-model_v4 | RSAM-partnered protein | 0.9034 | 2 | 57 |
|
| AF-A0A7D5P112-F1-model_v4 | RSAM-partnered protein | 0.9014 | 2 | 61 |
|
| AF-A0A1I6K1K5-F1-model_v4 | RSAM-partnered protein, Htur_1727 family | 0.8982 | 3 | 61 |
|
| AF-A0A1H6IDK4-F1-model_v4 | RSAM-partnered protein, Htur_1727 family | 0.8952 | 3 | 63 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar