F484148

General Info

Members Datasets Scaffolds Average Seq Length
870 366 1740 125

Family's Representative Sequence

Representative Sequence 3300020081|Ga0206354_10187001|Ga0206354_101870011
Length 147
Sequence MLTVEVDNRSGAEVDDGAAVELVCAVLRAEGIEDGELGLAFVGPEEMRELKREHLGIDEPTDVLSFPIDGRDELPEGMPRALGDVVLCPQVVKDEWPWPLTHGVLHLLGYDHGDEMEAKELDHLRRRLDGPEASAEAPARPEPEEQN

Samples

Sample ID Description Type Environment
1 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
87 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
88 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
89 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
217 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
218 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
219 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
220 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
333 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
334 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
335 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
336 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
337 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
355 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
356 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 7.82
Rhizosphere 90.92
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206354_10187001 3300020081 Bacteria 725
2 JGI24743J22301_10001015 3300001991 Bacteria 3684
3 JGI24738J21930_10000561 3300002075 Bacteria 10619
4 JGI24744J21845_10022255 3300002077 Bacteria 1246
5 JGI24742J22300_10004961 3300002244 Bacteria 2185
6 JGI25407J50210_10079309 3300003373 Bacteria 817
7 Ga0070658_10003404 3300005327 Bacteria 13081
8 Ga0070658_11084318 3300005327 Bacteria 697
9 Ga0070683_100007373 3300005329 Bacteria 9292
10 Ga0070683_100025155 3300005329 Bacteria 5343
11 Ga0070683_100060728 3300005329 Bacteria 3513
12 Ga0070683_100682237 3300005329 Bacteria 984
13 Ga0070683_100961769 3300005329 Bacteria 819
14 Ga0070680_100018180 3300005336 Bacteria 5552
15 Ga0070680_100241893 3300005336 Bacteria 1525
16 Ga0070682_100010912 3300005337 Bacteria 5176
17 Ga0068868_100030465 3300005338 Bacteria 4137
18 Ga0068868_100556115 3300005338 Bacteria 1012
19 Ga0070660_100003349 3300005339 Bacteria 11013
20 Ga0070689_100110319 3300005340 Bacteria 2187
21 Ga0070691_10000980 3300005341 Bacteria 11656
22 Ga0070687_100620347 3300005343 Bacteria 745
23 Ga0070661_100021829 3300005344 Bacteria 4579
24 Ga0070661_100046249 3300005344 Bacteria 3183
25 Ga0070692_10000477 3300005345 Bacteria 12289
26 Ga0070692_10040248 3300005345 Bacteria 2389
27 Ga0070692_10287720 3300005345 Bacteria 999
28 Ga0070668_101462437 3300005347 Bacteria 624
29 Ga0070669_100207080 3300005353 Bacteria 1546
30 Ga0070675_100011418 3300005354 Bacteria 6952
31 Ga0070675_100185784 3300005354 Bacteria 1799
32 Ga0070675_100745130 3300005354 Bacteria 894
33 Ga0070675_100935605 3300005354 Bacteria 795
34 Ga0070671_100344479 3300005355 Bacteria 1271
35 Ga0070671_100880534 3300005355 Bacteria 782
36 Ga0070674_100068163 3300005356 Bacteria 2505
37 Ga0070674_100950243 3300005356 Bacteria 751
38 Ga0070673_100073667 3300005364 Bacteria 2749
39 Ga0070688_100094107 3300005365 Bacteria 1964
40 Ga0070659_100002964 3300005366 Bacteria 12102
41 Ga0070659_100026771 3300005366 Bacteria 4439
42 Ga0070659_100150140 3300005366 Bacteria 1901
43 Ga0070659_100379824 3300005366 Bacteria 1190
44 Ga0070667_100416374 3300005367 Bacteria 1224
45 Ga0070667_101416387 3300005367 Bacteria 652
46 Ga0070714_100070767 3300005435 Bacteria 3015
47 Ga0070701_10154063 3300005438 Bacteria 1326
48 Ga0070711_101872540 3300005439 Unclassified 527
49 Ga0070700_100029006 3300005441 Bacteria 3296
50 Ga0070700_100196883 3300005441 Bacteria 1413
51 Ga0070700_100566980 3300005441 Bacteria 884
52 Ga0070700_100678360 3300005441 Bacteria 817
53 Ga0070694_100133061 3300005444 Bacteria 1799
54 Ga0070694_101313765 3300005444 Bacteria 608
55 Ga0070708_100057642 3300005445 Bacteria 3459
56 Ga0070663_100278212 3300005455 Bacteria 1333
57 Ga0070678_100180491 3300005456 Bacteria 1727
58 Ga0070678_100250142 3300005456 Bacteria 1486
59 Ga0070662_100050553 3300005457 Bacteria 2999
60 Ga0070662_100156845 3300005457 Bacteria 1777
61 Ga0070681_10011671 3300005458 Bacteria 8700
62 Ga0070681_10086307 3300005458 Bacteria 3091
63 Ga0068867_100049857 3300005459 Bacteria 3083
64 Ga0068867_100710780 3300005459 Bacteria 888
65 Ga0068867_101204167 3300005459 Bacteria 696
66 Ga0070706_100887566 3300005467 Bacteria 824
67 Ga0070707_100824090 3300005468 Unclassified 892
68 Ga0070698_100685030 3300005471 Bacteria 967
69 Ga0070679_100002041 3300005530 Bacteria 18130
70 Ga0070679_100023415 3300005530 Bacteria 6044
71 Ga0070679_100560834 3300005530 Bacteria 1086
72 Ga0070684_100019209 3300005535 Bacteria 5650
73 Ga0070684_100050016 3300005535 Bacteria 3629
74 Ga0070684_100067255 3300005535 Unclassified 3147
75 Ga0070684_100069280 3300005535 Bacteria 3103
76 Ga0070684_100178815 3300005535 Bacteria 1928
77 Ga0070684_100236976 3300005535 Bacteria 1667
78 Ga0070684_100751047 3300005535 Bacteria 911
79 Ga0070684_100822865 3300005535 Bacteria 869
80 Ga0070684_101988762 3300005535 Bacteria 549
81 Ga0070697_100534033 3300005536 Bacteria 1028
82 Ga0068853_100009437 3300005539 Bacteria 7862
83 Ga0068853_100091817 3300005539 Bacteria 2671
84 Ga0068853_101208470 3300005539 Bacteria 730
85 Ga0070672_100004959 3300005543 Bacteria 8762
86 Ga0070672_100029322 3300005543 Bacteria 4125
87 Ga0070686_100117155 3300005544 Bacteria 1824
88 Ga0070686_100121172 3300005544 Bacteria 1796
89 Ga0070693_100023150 3300005547 Bacteria 3316
90 Ga0070693_100044765 3300005547 Bacteria 2505
91 Ga0070693_100216026 3300005547 Bacteria 1254
92 Ga0070704_100070968 3300005549 Bacteria 2529
93 Ga0068855_100033066 3300005563 Bacteria 6174
94 Ga0068855_100040111 3300005563 Bacteria 5558
95 Ga0068855_100064998 3300005563 Bacteria 4253
96 Ga0068855_100114289 3300005563 Bacteria 3095
97 Ga0068855_100271074 3300005563 Bacteria 1887
98 Ga0068855_100849270 3300005563 Bacteria 967
99 Ga0068855_100988693 3300005563 Bacteria 884
100 Ga0070664_100006431 3300005564 Bacteria 9478
101 Ga0070664_100137962 3300005564 Bacteria 2146
102 Ga0070664_101247665 3300005564 Bacteria 702
103 Ga0068857_100003198 3300005577 Bacteria 13580
104 Ga0068857_100083105 3300005577 Bacteria 2860
105 Ga0068857_100416031 3300005577 Bacteria 1253
106 Ga0068857_100573423 3300005577 Bacteria 1065
107 Ga0068854_100003631 3300005578 Bacteria 9657
108 Ga0068854_100985063 3300005578 Bacteria 746
109 Ga0068854_101174601 3300005578 Bacteria 687
110 Ga0068856_100048087 3300005614 Bacteria 4202
111 Ga0068856_100792087 3300005614 Bacteria 968
112 Ga0068856_100818462 3300005614 Bacteria 951
113 Ga0070702_100670545 3300005615 Bacteria 787
114 Ga0068852_100006341 3300005616 Bacteria 8536
115 Ga0068852_100007514 3300005616 Bacteria 7957
116 Ga0068864_100118253 3300005618 Bacteria 2366
117 Ga0068864_100391711 3300005618 Bacteria 1319
118 Ga0068864_100879837 3300005618 Bacteria 884
119 Ga0068866_10229632 3300005718 Bacteria 1125
120 Ga0068866_10534122 3300005718 Bacteria 781
121 Ga0068861_100032453 3300005719 Bacteria 3844
122 Ga0068851_10029379 3300005834 Bacteria 2722
123 Ga0068870_10083612 3300005840 Bacteria 1770
124 Ga0068860_100395802 3300005843 Bacteria 1366
125 Ga0068862_100287082 3300005844 Bacteria 1510
126 Ga0081455_10038253 3300005937 Bacteria 4249
127 Ga0081538_10011208 3300005981 Bacteria 7281
128 Ga0081538_10052606 3300005981 Bacteria 2431
129 Ga0081538_10164876 3300005981 Bacteria 978
130 Ga0081539_10222587 3300005985 Bacteria 857
131 Ga0070717_10635550 3300006028 Bacteria 969
132 Ga0070717_10744935 3300006028 Bacteria 891
133 Ga0075432_10013630 3300006058 Bacteria 2762
134 Ga0070716_101747322 3300006173 Unclassified 514
135 Ga0097621_100058416 3300006237 Bacteria 3156
136 Ga0075428_100004576 3300006844 Bacteria 15296
137 Ga0075433_10046058 3300006852 Bacteria 3792
138 Ga0075429_100009096 3300006880 Bacteria 8626
139 Ga0075429_100298014 3300006880 Bacteria 1412
140 Ga0068865_100002718 3300006881 Bacteria 10501
141 Ga0068865_100016943 3300006881 Bacteria 4675
142 Ga0068865_101401912 3300006881 Bacteria 624
143 Ga0105240_10061243 3300009093 Bacteria 4690
144 Ga0105240_10599783 3300009093 Bacteria 1213
145 Ga0111539_10008396 3300009094 Bacteria 13142
146 Ga0111539_10718411 3300009094 Bacteria 1163
147 Ga0111539_10746370 3300009094 Bacteria 1139
148 Ga0111539_11875920 3300009094 Bacteria 695
149 Ga0105245_10009579 3300009098 Bacteria 8450
150 Ga0105245_10022466 3300009098 Bacteria 5537
151 Ga0105245_10961608 3300009098 Bacteria 897
152 Ga0105245_11245428 3300009098 Bacteria 792
153 Ga0105245_11527726 3300009098 Bacteria 719
154 Ga0114129_10137571 3300009147 Bacteria 3351
155 Ga0105243_10002349 3300009148 Bacteria 15832
156 Ga0105243_10021154 3300009148 Bacteria 4937
157 Ga0105243_10059994 3300009148 Bacteria 3038
158 Ga0105243_10537991 3300009148 Bacteria 1114
159 Ga0105243_10619454 3300009148 Bacteria 1044
160 Ga0105243_11552037 3300009148 Bacteria 687
161 Ga0105242_10007255 3300009176 Bacteria 8548
162 Ga0105242_10022851 3300009176 Bacteria 4924
163 Ga0105242_11101367 3300009176 Bacteria 808
164 Ga0105248_10155979 3300009177 Bacteria 2576
165 Ga0105237_10560110 3300009545 Bacteria 1150
166 Ga0105238_10013752 3300009551 Bacteria 8179
167 Ga0105238_10207211 3300009551 Bacteria 1937
168 Ga0105249_10444536 3300009553 Bacteria 1334
169 Ga0105239_10114244 3300010375 Bacteria 2995
170 Ga0105239_10166053 3300010375 Bacteria 2468
171 Ga0105239_10436726 3300010375 Bacteria 1484
172 Ga0105239_10683883 3300010375 Bacteria 1173
173 Ga0105239_10868155 3300010375 Bacteria 1035
174 Ga0105246_10007974 3300011119 Bacteria 6500
175 Ga0105246_10040527 3300011119 Bacteria 3144
176 Ga0157345_1028764 3300012498 Bacteria 611
177 Ga0157342_1016664 3300012507 Bacteria 815
178 Ga0157315_1014579 3300012508 Bacteria 755
179 Ga0157316_1002252 3300012510 Bacteria 1295
180 Ga0157373_10152227 3300013100 Bacteria 1627
181 Ga0157371_10024922 3300013102 Bacteria 4365
182 Ga0157371_10095050 3300013102 Bacteria 2112
183 Ga0157370_10025745 3300013104 Bacteria 5820
184 Ga0157370_10075071 3300013104 Bacteria 3188
185 Ga0157370_10142380 3300013104 Bacteria 2234
186 Ga0157370_10478132 3300013104 Bacteria 1145
187 Ga0157370_11224551 3300013104 Bacteria 677
188 Ga0157370_11969259 3300013104 Bacteria 524
189 Ga0157369_10040655 3300013105 Bacteria 5076
190 Ga0157369_10697373 3300013105 Bacteria 1046
191 Ga0157374_10211517 3300013296 Bacteria 1901
192 Ga0157374_10273224 3300013296 Bacteria 1667
193 Ga0157374_12032555 3300013296 Bacteria 601
194 Ga0163162_10199870 3300013306 Bacteria 2128
195 Ga0163162_10418708 3300013306 Bacteria 1472
196 Ga0163162_11316294 3300013306 Bacteria 821
197 Ga0157372_10056390 3300013307 Bacteria 4390
198 Ga0157372_12133101 3300013307 Bacteria 644
199 Ga0157375_10011579 3300013308 Bacteria 7792
200 Ga0157375_10146467 3300013308 Bacteria 2492
201 Ga0157375_10551533 3300013308 Bacteria 1314
202 Ga0157375_11104659 3300013308 Bacteria 928
203 Ga0157375_11334478 3300013308 Bacteria 844
204 Ga0163163_10065425 3300014325 Bacteria 3609
205 Ga0163163_10276187 3300014325 Bacteria 1731
206 Ga0157380_10015681 3300014326 Bacteria 5571
207 Ga0157380_10049173 3300014326 Bacteria 3324
208 Ga0157380_11319566 3300014326 Bacteria 769
209 Ga0157380_12248403 3300014326 Bacteria 609
210 Ga0157377_10016746 3300014745 Bacteria 3776
211 Ga0157377_10203492 3300014745 Unclassified 1258
212 Ga0157377_10215786 3300014745 Bacteria 1226
213 Ga0197907_11327233 3300020069 Bacteria 573
214 Ga0206356_11587627 3300020070 Bacteria 1250
215 Ga0206356_11795520 3300020070 Unclassified 1464
216 Ga0206354_11345423 3300020081 Bacteria 831
217 Ga0206353_11282731 3300020082 Bacteria 696
218 Ga0213873_10121022 3300021358 Bacteria 768
219 Ga0213874_10084666 3300021377 Bacteria 1033
220 Ga0213876_10283665 3300021384 Bacteria 880
221 Ga0213875_10200104 3300021388 Bacteria 940
222 Ga0207656_10004007 3300025321 Bacteria 5107
223 Ga0207692_10009278 3300025898 Bacteria 4103
224 Ga0207692_10292100 3300025898 Bacteria 989
225 Ga0207642_10115513 3300025899 Bacteria 1375
226 Ga0207642_10460890 3300025899 Bacteria 772
227 Ga0207642_10519558 3300025899 Bacteria 731
228 Ga0207688_10005424 3300025901 Bacteria 6934
229 Ga0207688_10038105 3300025901 Bacteria 2667
230 Ga0207688_10640002 3300025901 Bacteria 671
231 Ga0207685_10066960 3300025905 Bacteria 1443
232 Ga0207699_10006032 3300025906 Bacteria 5834
233 Ga0207699_10346841 3300025906 Bacteria 1047
234 Ga0207643_10070140 3300025908 Bacteria 2015
235 Ga0207705_10026768 3300025909 Bacteria 4110
236 Ga0207705_10201420 3300025909 Bacteria 1508
237 Ga0207705_10913542 3300025909 Bacteria 680
238 Ga0207705_11092859 3300025909 Bacteria 614
239 Ga0207684_10401304 3300025910 Bacteria 1179
240 Ga0207654_10018415 3300025911 Bacteria 3664
241 Ga0207707_10057939 3300025912 Bacteria 3372
242 Ga0207695_10155311 3300025913 Bacteria 2223
243 Ga0207695_10431855 3300025913 Bacteria 1201
244 Ga0207671_10474268 3300025914 Bacteria 997
245 Ga0207693_10457375 3300025915 Bacteria 997
246 Ga0207693_10600102 3300025915 Bacteria 857
247 Ga0207693_10898837 3300025915 Bacteria 679
248 Ga0207693_11216837 3300025915 Bacteria 567
249 Ga0207663_10065298 3300025916 Bacteria 2326
250 Ga0207660_10113254 3300025917 Bacteria 2044
251 Ga0207662_10467995 3300025918 Unclassified 864
252 Ga0207657_10004668 3300025919 Bacteria 14470
253 Ga0207657_10250612 3300025919 Bacteria 1412
254 Ga0207649_10025627 3300025920 Bacteria 3440
255 Ga0207649_10106584 3300025920 Bacteria 1864
256 Ga0207652_10018886 3300025921 Bacteria 5659
257 Ga0207652_10112947 3300025921 Bacteria 2411
258 Ga0207652_10505048 3300025921 Bacteria 1088
259 Ga0207694_10028677 3300025924 Bacteria 4244
260 Ga0207694_10296202 3300025924 Bacteria 1331
261 Ga0207694_11286312 3300025924 Bacteria 619
262 Ga0207650_10611063 3300025925 Bacteria 917
263 Ga0207659_10113986 3300025926 Bacteria 2060
264 Ga0207659_10129452 3300025926 Bacteria 1946
265 Ga0207659_10408800 3300025926 Bacteria 1136
266 Ga0207659_10531804 3300025926 Bacteria 998
267 Ga0207687_10071190 3300025927 Bacteria 2484
268 Ga0207687_10242536 3300025927 Bacteria 1429
269 Ga0207687_10814423 3300025927 Bacteria 797
270 Ga0207700_10000004 3300025928 Bacteria 443409
271 Ga0207700_10511731 3300025928 Bacteria 1063
272 Ga0207700_10947902 3300025928 Bacteria 770
273 Ga0207664_10078154 3300025929 Bacteria 2683
274 Ga0207664_10308604 3300025929 Unclassified 1394
275 Ga0207664_10461380 3300025929 Bacteria 1135
276 Ga0207644_10068646 3300025931 Bacteria 2587
277 Ga0207644_10145182 3300025931 Bacteria 1831
278 Ga0207644_11018429 3300025931 Unclassified 695
279 Ga0207690_10004794 3300025932 Bacteria 7980
280 Ga0207690_10038365 3300025932 Bacteria 3117
281 Ga0207690_10231868 3300025932 Bacteria 1418
282 Ga0207690_11318112 3300025932 Bacteria 603
283 Ga0207706_10024437 3300025933 Bacteria 5417
284 Ga0207706_10055523 3300025933 Bacteria 3492
285 Ga0207706_10986069 3300025933 Bacteria 708
286 Ga0207686_10020992 3300025934 Bacteria 3740
287 Ga0207686_10967353 3300025934 Bacteria 690
288 Ga0207709_10006589 3300025935 Bacteria 6520
289 Ga0207709_10024537 3300025935 Bacteria 3444
290 Ga0207709_10598392 3300025935 Bacteria 873
291 Ga0207669_10027065 3300025937 Bacteria 3131
292 Ga0207669_10283600 3300025937 Bacteria 1250
293 Ga0207669_10694209 3300025937 Bacteria 836
294 Ga0207669_11008132 3300025937 Bacteria 700
295 Ga0207704_10009496 3300025938 Bacteria 4696
296 Ga0207704_11059989 3300025938 Bacteria 688
297 Ga0207665_10004341 3300025939 Bacteria 9417
298 Ga0207665_10019278 3300025939 Bacteria 4484
299 Ga0207691_10012070 3300025940 Bacteria 8287
300 Ga0207691_10056012 3300025940 Bacteria 3593
301 Ga0207711_10048669 3300025941 Bacteria 3627
302 Ga0207689_10121793 3300025942 Bacteria 2145
303 Ga0207689_10214092 3300025942 Bacteria 1592
304 Ga0207661_10004390 3300025944 Bacteria 9888
305 Ga0207661_10008323 3300025944 Bacteria 7408
306 Ga0207661_10025210 3300025944 Bacteria 4519
307 Ga0207661_10474087 3300025944 Bacteria 1142
308 Ga0207661_11200653 3300025944 Bacteria 698
309 Ga0207679_10280865 3300025945 Bacteria 1428
310 Ga0207679_10376285 3300025945 Bacteria 1244
311 Ga0207679_10672122 3300025945 Bacteria 938
312 Ga0207679_10802136 3300025945 Bacteria 858
313 Ga0207679_11921651 3300025945 Unclassified 539
314 Ga0207667_10027576 3300025949 Bacteria 6180
315 Ga0207667_10048354 3300025949 Bacteria 4498
316 Ga0207667_10228697 3300025949 Bacteria 1905
317 Ga0207667_10302530 3300025949 Bacteria 1634
318 Ga0207651_10501578 3300025960 Bacteria 1049
319 Ga0207651_10595407 3300025960 Bacteria 966
320 Ga0207651_11034503 3300025960 Bacteria 735
321 Ga0207668_10635453 3300025972 Bacteria 933
322 Ga0207640_10013370 3300025981 Bacteria 4700
323 Ga0207658_10156723 3300025986 Bacteria 1862
324 Ga0207658_11074400 3300025986 Bacteria 735
325 Ga0207677_10052239 3300026023 Bacteria 2776
326 Ga0207703_10846506 3300026035 Bacteria 874
327 Ga0207639_10004159 3300026041 Bacteria 9743
328 Ga0207639_10168482 3300026041 Bacteria 1853
329 Ga0207639_10922965 3300026041 Bacteria 816
330 Ga0207678_10026025 3300026067 Bacteria 5105
331 Ga0207678_10501133 3300026067 Bacteria 1058
332 Ga0207708_10088736 3300026075 Bacteria 2382
333 Ga0207708_10283439 3300026075 Bacteria 1343
334 Ga0207708_10320189 3300026075 Bacteria 1265
335 Ga0207702_10006447 3300026078 Bacteria 10117
336 Ga0207702_11542110 3300026078 Unclassified 658
337 Ga0207648_10056797 3300026089 Bacteria 3415
338 Ga0207648_10146792 3300026089 Bacteria 2080
339 Ga0207648_10381319 3300026089 Bacteria 1275
340 Ga0207676_10740717 3300026095 Bacteria 955
341 Ga0207674_10000908 3300026116 Bacteria 38623
342 Ga0207674_10068814 3300026116 Bacteria 3562
343 Ga0207674_10180577 3300026116 Bacteria 2062
344 Ga0207674_10336264 3300026116 Bacteria 1460
345 Ga0207674_11428941 3300026116 Bacteria 661
346 Ga0207683_10003261 3300026121 Bacteria 14150
347 Ga0207683_10143088 3300026121 Bacteria 2155
348 Ga0207683_11512645 3300026121 Bacteria 620
349 Ga0207698_10003693 3300026142 Bacteria 9257
350 Ga0207698_10043082 3300026142 Bacteria 3379
351 Ga0207428_10000196 3300027907 Bacteria 84609
352 Ga0207428_10105489 3300027907 Bacteria 2173
353 Ga0268265_10341324 3300028380 Bacteria 1364
354 Ga0268264_10574236 3300028381 Bacteria 1108
355 Ga0265334_10021845 3300028573 Bacteria 2612
356 Ga0265318_10084152 3300028577 Bacteria 1173
357 Ga0265338_10011841 3300028800 Bacteria 10023
358 Ga0265338_10223519 3300028800 Bacteria 1405
359 Ga0265338_10427410 3300028800 Bacteria 941
360 Ga0265332_10035849 3300031238 Bacteria 2154
361 Ga0265340_10188077 3300031247 Bacteria 932
362 Ga0265327_10005943 3300031251 Bacteria 9948
363 Ga0265327_10031508 3300031251 Bacteria 2977
364 Ga0265327_10094757 3300031251 Bacteria 1450
365 Ga0265316_10009243 3300031344 Bacteria 9075
366 Ga0307408_100205568 3300031548 Bacteria 1597
367 Ga0307408_101775594 3300031548 Bacteria 589
368 Ga0265314_10015582 3300031711 Bacteria 6027
369 Ga0265342_10022153 3300031712 Bacteria 4044
370 Ga0307410_10028827 3300031852 Bacteria 3526
371 Ga0307406_10050402 3300031901 Bacteria 2639
372 Ga0307406_10688106 3300031901 Bacteria 853
373 Ga0307407_10006312 3300031903 Bacteria 5249
374 Ga0307412_10008378 3300031911 Bacteria 5898
375 Ga0307409_100029775 3300031995 Bacteria 3912
376 Ga0307409_100086349 3300031995 Bacteria 2554
377 Ga0307409_100296476 3300031995 Bacteria 1502
378 Ga0307416_100074817 3300032002 Bacteria 2831
379 Ga0307416_100299997 3300032002 Bacteria 1596
380 Ga0307416_100351275 3300032002 Bacteria 1492
381 Ga0307416_101473583 3300032002 Bacteria 786
382 Ga0307414_10103059 3300032004 Bacteria 2152
383 Ga0307411_10005379 3300032005 Bacteria 6283
384 Ga0307415_100044505 3300032126 Bacteria 2968
385 Ga0373930_0046004 3300034816 Bacteria 941
386 Ga0373958_0019363 3300034819 Bacteria 1243
387 Ga0373959_0016418 3300034820 Bacteria 1372
388 Ga0373926_0020105 3300035083 Bacteria 2305
389 Ga0373926_0130905 3300035083 Bacteria 950
390 Ga0373929_0032866 3300035085 Bacteria 1118
391 Ga0373944_0034076 3300035089 Bacteria 1546
392 Ga0373944_0404396 3300035089 Bacteria 527
393 Ga0373949_0003223 3300035090 Bacteria 3947
394 Ga0373952_0010253 3300035092 Bacteria 1808
395 Ga0373936_0002175 3300035113 Bacteria 7307
396 Ga0373936_0639975 3300035113 Unclassified 501
397 Ga0373939_0103485 3300035114 Bacteria 981
398 Ga0373939_0223339 3300035114 Bacteria 722
399 Ga0373941_0105576 3300035115 Bacteria 986
400 Ga0373945_0006186 3300035116 Bacteria 3851
401 Ga0373945_0021864 3300035116 Bacteria 2201
402 Ga0373943_0006651 3300035170 Bacteria 5187
403 Ga0373943_0045871 3300035170 Bacteria 2131
404 Ga0373943_0228180 3300035170 Bacteria 1039
405 Ga0373946_0037940 3300035171 Bacteria 1960
406 Ga0373946_0082053 3300035171 Bacteria 1414
407 Ga0373942_0022456 3300035207 Bacteria 1601
408 Ga0373961_0018428 3300035241 Bacteria 1823
409 Ga0373931_0149048 3300035691 Bacteria 1362
410 Ga0373931_0199933 3300035691 Bacteria 1193
411 Ga0373935_0070646 3300035692 Bacteria 2251
412 Ga0373927_0026206 3300035695 Bacteria 3810
413 Ga0373927_0122077 3300035695 Bacteria 1700
414 Ga0373947_0002323 3300035725 Bacteria 11501
415 Ga0373947_0006531 3300035725 Bacteria 6763
416 Ga0373947_0031564 3300035725 Bacteria 3119
417 Ga0373925_0005408 3300037068 Bacteria 9516
418 Ga0373925_0040621 3300037068 Bacteria 3445
419 Ga0373925_0073230 3300037068 Bacteria 2593
420 Ga0395899_0002477 3300037312 Bacteria 14979
421 Ga0395900_0003203 3300037418 Bacteria 17718
422 Ga0395900_0011833 3300037418 Bacteria 8924
423 Ga0395900_0017025 3300037418 Bacteria 7419
424 Ga0395900_0023261 3300037418 Bacteria 6342
425 Ga0395900_0025838 3300037418 Bacteria 6012
426 Ga0395900_0111228 3300037418 Bacteria 2813
427 Ga0395900_0917959 3300037418 Bacteria 798
428 Ga0395900_1834881 3300037418 Bacteria 517
429 Ga0395898_0003460 3300037466 Bacteria 17643
430 Ga0395898_0006664 3300037466 Bacteria 12316
431 Ga0395898_0040304 3300037466 Bacteria 4619
432 Ga0395898_0059292 3300037466 Bacteria 3724
433 Ga0395898_0099800 3300037466 Bacteria 2788
434 Ga0395898_0106519 3300037466 Bacteria 2689
435 Ga0395898_0324028 3300037466 Bacteria 1470
436 Ga0395898_1495342 3300037466 Bacteria 601
437 Ga0395898_1620611 3300037466 Bacteria 571
438 Ga0395905_0000568 3300037471 Bacteria 50013
439 Ga0395905_0022975 3300037471 Bacteria 5894
440 Ga0395905_0058215 3300037471 Bacteria 3614
441 Ga0395905_0099899 3300037471 Bacteria 2725
442 Ga0395905_0137375 3300037471 Bacteria 2300
443 Ga0395905_0416699 3300037471 Bacteria 1239
444 Ga0395901_0003134 3300038443 Bacteria 16607
445 Ga0395901_0006480 3300038443 Bacteria 11848
446 Ga0395901_0007746 3300038443 Bacteria 10836
447 Ga0395901_0021584 3300038443 Bacteria 6596
448 Ga0395901_0039014 3300038443 Bacteria 4913
449 Ga0395901_0241483 3300038443 Bacteria 1884
450 Ga0395901_0313505 3300038443 Bacteria 1624
451 Ga0395901_0467595 3300038443 Bacteria 1288
452 Ga0395901_0503809 3300038443 Bacteria 1232
453 Ga0395901_0537933 3300038443 Bacteria 1185
454 Ga0395901_0573132 3300038443 Bacteria 1141
455 Ga0395901_1269381 3300038443 Bacteria 699
456 Ga0395901_2144784 3300038443 Bacteria 503
457 Ga0436365_1309694 3300039437 Bacteria 548
458 Ga0436365_1590357 3300039437 Bacteria 769
459 Ga0436365_1645992 3300039437 Bacteria 1612
460 Ga0436360_0600304 3300039438 Bacteria 4142
461 Ga0436363_0474779 3300039450 Bacteria 770
462 Ga0436363_1043056 3300039450 Bacteria 705
463 Ga0436362_0795226 3300039453 Bacteria 1811
464 Ga0436362_0863784 3300039453 Bacteria 874
465 Ga0451807_0559972 3300041486 Bacteria 892
466 Ga0451807_2695406 3300041486 Bacteria 879
467 Ga0451847_0526676 3300041503 Unclassified 573
468 Ga0451851_0311280 3300041507 Bacteria 571
469 Ga0439451_095896 3300042009 Unclassified 599
470 Ga0450920_027224 3300042122 Bacteria 1118
471 Ga0450906_016764 3300042145 Bacteria 1324
472 Ga0439460_0136724 3300042461 Bacteria 811
473 Ga0466965_0789457 3300044683 Bacteria 549
474 Ga0466966_0002628 3300044684 Bacteria 11768
475 Ga0466966_0059879 3300044684 Bacteria 2404
476 Ga0466963_0021132 3300044694 Bacteria 4101
477 Ga0466963_0022468 3300044694 Bacteria 3995
478 Ga0466963_0110438 3300044694 Bacteria 1887
479 Ga0466963_0117871 3300044694 Bacteria 1825
480 Ga0466964_0013409 3300044706 Bacteria 3110
481 Ga0466964_0626680 3300044706 Bacteria 592
482 Ga0466971_0092849 3300044719 Bacteria 1383
483 Ga0466968_0077628 3300044735 Bacteria 1455
484 Ga0466957_0096139 3300044842 Bacteria 1861
485 Ga0466957_0343419 3300044842 Bacteria 1011
486 Ga0466959_0000435 3300045049 Bacteria 24320
487 Ga0451576_0013003 3300045051 Bacteria 9323
488 Ga0451576_0411458 3300045051 Bacteria 1418
489 Ga0466967_0003034 3300045976 Bacteria 10777
490 Ga0466967_0009902 3300045976 Bacteria 7111
491 Ga0466967_0015693 3300045976 Bacteria 5948
492 Ga0466967_0021416 3300045976 Bacteria 5249
493 Ga0466967_0036149 3300045976 Bacteria 4214
494 Ga0466967_0054410 3300045976 Bacteria 3522
495 Ga0466967_0329528 3300045976 Bacteria 1474
496 Ga0466967_0382504 3300045976 Unclassified 1367
497 Ga0466967_0857054 3300045976 Bacteria 903
498 Ga0466967_1874834 3300045976 Bacteria 596
499 Ga0495592_0534939 3300046454 Bacteria 723
500 Ga0495603_0008050 3300046455 Bacteria 6369
501 Ga0495603_0244515 3300046455 Bacteria 1033
502 Ga0495591_082904 3300046458 Bacteria 815
503 Ga0495629_0000880 3300046459 Bacteria 24212
504 Ga0495629_0392454 3300046459 Bacteria 944
505 Ga0495641_0000552 3300046461 Bacteria 31604
506 Ga0495641_0023759 3300046461 Bacteria 3038
507 Ga0495641_0138300 3300046461 Bacteria 1088
508 Ga0495653_0079703 3300046463 Bacteria 2424
509 Ga0495653_0628082 3300046463 Bacteria 658
510 Ga0495580_0364784 3300046472 Bacteria 977
511 Ga0495582_0000240 3300046473 Bacteria 30558
512 Ga0495582_0243312 3300046473 Bacteria 1031
513 Ga0495605_0042478 3300046474 Bacteria 2260
514 Ga0495605_0052876 3300046474 Bacteria 1972
515 Ga0495605_0075135 3300046474 Bacteria 1589
516 Ga0495639_0000921 3300046475 Bacteria 13282
517 Ga0495639_0097698 3300046475 Bacteria 1384
518 Ga0495662_0002056 3300046476 Bacteria 10092
519 Ga0495662_0097845 3300046476 Bacteria 1435
520 Ga0495662_0347433 3300046476 Unclassified 729
521 Ga0495662_0582081 3300046476 Bacteria 548
522 Ga0495584_0045758 3300046491 Bacteria 2207
523 Ga0495584_0413429 3300046491 Bacteria 686
524 Ga0495594_0393734 3300046499 Bacteria 788
525 Ga0495594_0554674 3300046499 Bacteria 652
526 Ga0495596_0277680 3300046500 Unclassified 651
527 Ga0495583_0258679 3300046506 Bacteria 697
528 Ga0495608_0503259 3300046511 Unclassified 733
529 Ga0495616_0126063 3300046513 Bacteria 1177
530 Ga0495618_0115788 3300046514 Bacteria 1716
531 Ga0495620_0067909 3300046515 Bacteria 1465
532 Ga0495628_0164400 3300046516 Bacteria 1685
533 Ga0495628_0620029 3300046516 Bacteria 771
534 Ga0495630_0004569 3300046517 Bacteria 9701
535 Ga0495630_0023500 3300046517 Bacteria 4557
536 Ga0495630_0941337 3300046517 Bacteria 657
537 Ga0495630_1150797 3300046517 Unclassified 587
538 Ga0495637_0055098 3300046520 Bacteria 1650
539 Ga0495637_0058413 3300046520 Bacteria 1590
540 Ga0495637_0059009 3300046520 Unclassified 1580
541 Ga0495644_0042535 3300046523 Bacteria 1711
542 Ga0495663_0116679 3300046525 Bacteria 891
543 Ga0495663_0132466 3300046525 Bacteria 841
544 Ga0495666_0166611 3300046526 Bacteria 1020
545 Ga0495642_0103561 3300046528 Unclassified 1213
546 Ga0495652_0084917 3300046529 Bacteria 2602
547 Ga0495665_0000685 3300046531 Bacteria 17384
548 Ga0495665_0176357 3300046531 Bacteria 1111
549 Ga0495640_0141210 3300046533 Bacteria 1552
550 Ga0495586_0097032 3300046535 Bacteria 1633
551 Ga0495598_0009016 3300046537 Bacteria 2343
552 Ga0495609_0039123 3300046538 Bacteria 2136
553 Ga0495597_0076075 3300046542 Bacteria 1440
554 Ga0495667_0440134 3300046559 Bacteria 819
555 Ga0495667_0688033 3300046559 Bacteria 634
556 Ga0495656_0118444 3300046615 Bacteria 1247
557 Ga0495656_0158088 3300046615 Bacteria 1100
558 Ga0495656_0195269 3300046615 Bacteria 1002
559 Ga0495656_0264265 3300046615 Bacteria 873
560 Ga0495656_0643913 3300046615 Bacteria 569
561 Ga0495634_0040086 3300046642 Bacteria 3187
562 Ga0495634_0099953 3300046642 Bacteria 1875
563 Ga0495634_0529696 3300046642 Unclassified 688
564 Ga0495611_0582781 3300046648 Bacteria 506
565 Ga0495635_0185631 3300046663 Bacteria 1413
566 Ga0495635_0230776 3300046663 Bacteria 1250
567 Ga0495659_0049432 3300046664 Bacteria 1527
568 Ga0495659_0070793 3300046664 Bacteria 1306
569 Ga0495659_0198551 3300046664 Bacteria 822
570 Ga0495661_0274858 3300046665 Bacteria 851
571 Ga0495588_0176569 3300046674 Bacteria 1129
572 Ga0495588_0458185 3300046674 Bacteria 669
573 Ga0495657_0092151 3300046675 Bacteria 1942
574 Ga0495657_0902272 3300046675 Bacteria 502
575 Ga0495599_0234170 3300046678 Bacteria 1121
576 Ga0495623_0297505 3300046679 Bacteria 893
577 Ga0495623_0331810 3300046679 Bacteria 833
578 Ga0495646_0075818 3300046680 Bacteria 1971
579 Ga0495647_0064877 3300046681 Bacteria 1449
580 Ga0495647_0355671 3300046681 Unclassified 667
581 Ga0495658_0000748 3300046683 Bacteria 17539
582 Ga0495658_0007224 3300046683 Bacteria 5489
583 Ga0495669_0010055 3300046684 Bacteria 3997
584 Ga0495669_0046327 3300046684 Bacteria 1940
585 Ga0495669_0139124 3300046684 Bacteria 1146
586 Ga0495613_0003539 3300046689 Bacteria 11708
587 Ga0495613_0068019 3300046689 Bacteria 2599
588 Ga0495624_0003367 3300046690 Bacteria 11871
589 Ga0495624_0742785 3300046690 Unclassified 581
590 Ga0495670_0392093 3300046691 Unclassified 750
591 Ga0495670_0565963 3300046691 Bacteria 619
592 Ga0495649_0220557 3300046694 Bacteria 981
593 Ga0495589_0085413 3300046794 Bacteria 1533
594 Ga0495600_0082102 3300046809 Bacteria 2103
595 Ga0495600_0499657 3300046809 Unclassified 747
596 Ga0495660_0084759 3300046810 Bacteria 1657
597 Ga0495660_0114285 3300046810 Bacteria 1374
598 Ga0495581_0000754 3300047315 Bacteria 17163
599 Ga0495581_0009125 3300047315 Bacteria 5738
600 Ga0495604_0040460 3300047317 Bacteria 3660
601 Ga0495674_0114605 3300047319 Bacteria 2282
602 Ga0495674_0173960 3300047319 Bacteria 1795
603 Ga0495674_0192628 3300047319 Bacteria 1694
604 Ga0495674_0570754 3300047319 Bacteria 899
605 Ga0495676_0000116 3300047321 Bacteria 61181
606 Ga0495676_0041281 3300047321 Bacteria 3799
607 Ga0495676_0431137 3300047321 Bacteria 871
608 Ga0495680_0016577 3300047322 Bacteria 6324
609 Ga0495680_0065797 3300047322 Bacteria 2775
610 Ga0495680_0555387 3300047322 Bacteria 773
611 Ga0495675_0270477 3300047444 Bacteria 1016
612 Ga0495677_0053595 3300047445 Bacteria 1487
613 Ga0495677_0161390 3300047445 Bacteria 865
614 Ga0495681_0313862 3300047470 Bacteria 604
615 Ga0495684_0009574 3300047471 Bacteria 7471
616 Ga0495684_0013921 3300047471 Bacteria 6187
617 Ga0495684_0439210 3300047471 Bacteria 909
618 Ga0495684_0872654 3300047471 Bacteria 582
619 Ga0495686_0000008 3300047472 Bacteria 727479
620 Ga0495593_0001321 3300047673 Bacteria 14526
621 Ga0495593_0201840 3300047673 Bacteria 999
622 Ga0495614_0011682 3300048089 Bacteria 3860
623 Ga0495614_0111009 3300048089 Bacteria 1204
624 Ga0495626_0100314 3300048091 Bacteria 1263
625 Ga0496100_0074139 3300048903 Bacteria 2279
626 Ga0496100_0442345 3300048903 Bacteria 995
627 Ga0496100_0467128 3300048903 Bacteria 969
628 Ga0496100_1363828 3300048903 Unclassified 560
629 Ga0496101_0017939 3300048904 Bacteria 4804
630 Ga0496101_0149472 3300048904 Bacteria 1786
631 Ga0496101_0149823 3300048904 Bacteria 1784
632 Ga0496101_0250113 3300048904 Bacteria 1381
633 Ga0496101_0771402 3300048904 Bacteria 758
634 Ga0496102_0007514 3300048905 Bacteria 9319
635 Ga0496102_0082066 3300048905 Bacteria 2973
636 Ga0496102_0197345 3300048905 Bacteria 1897
637 Ga0496103_0014063 3300048906 Bacteria 4751
638 Ga0496104_0002950 3300048907 Bacteria 14659
639 Ga0496104_0025579 3300048907 Bacteria 5442
640 Ga0496104_0096154 3300048907 Bacteria 2834
641 Ga0496104_0160845 3300048907 Bacteria 2154
642 Ga0496104_0473474 3300048907 Bacteria 1164
643 Ga0496104_0579691 3300048907 Bacteria 1032
644 Ga0496105_0005481 3300048908 Bacteria 9631
645 Ga0496105_0090879 3300048908 Bacteria 2521
646 Ga0496105_0098528 3300048908 Bacteria 2414
647 Ga0496106_0061677 3300048909 Bacteria 2845
648 Ga0496106_0474082 3300048909 Bacteria 1005
649 Ga0496106_0583865 3300048909 Bacteria 895
650 Ga0496107_0023113 3300048910 Bacteria 4394
651 Ga0496107_1139089 3300048910 Unclassified 562
652 Ga0496108_0389596 3300048911 Bacteria 1217
653 Ga0496108_0404629 3300048911 Bacteria 1192
654 Ga0496108_0666672 3300048911 Bacteria 903
655 Ga0496108_1002165 3300048911 Bacteria 713
656 Ga0496109_0129935 3300048912 Bacteria 2350
657 Ga0496109_0131966 3300048912 Bacteria 2332
658 Ga0496109_0155202 3300048912 Bacteria 2144
659 Ga0496109_0249902 3300048912 Bacteria 1670
660 Ga0496109_0584030 3300048912 Bacteria 1053
661 Ga0496109_0836322 3300048912 Bacteria 858
662 Ga0496109_1686573 3300048912 Unclassified 567
663 Ga0496110_0004582 3300048913 Bacteria 10738
664 Ga0496110_0006002 3300048913 Bacteria 9563
665 Ga0496110_0035999 3300048913 Bacteria 4297
666 Ga0496110_0193662 3300048913 Bacteria 1846
667 Ga0496110_0260794 3300048913 Unclassified 1577
668 Ga0496110_0535284 3300048913 Bacteria 1065
669 Ga0496110_0675633 3300048913 Bacteria 933
670 Ga0496111_0000714 3300048914 Bacteria 17654
671 Ga0496111_0045482 3300048914 Bacteria 3159
672 Ga0496112_0017751 3300048915 Bacteria 6697
673 Ga0496112_0019660 3300048915 Bacteria 6380
674 Ga0496112_0145987 3300048915 Bacteria 2334
675 Ga0496112_0275741 3300048915 Bacteria 1629
676 Ga0496113_0139436 3300048916 Bacteria 1907
677 Ga0496113_0192023 3300048916 Bacteria 1621
678 Ga0496113_0355608 3300048916 Bacteria 1175
679 Ga0496114_0025914 3300048917 Bacteria 4797
680 Ga0496114_0039353 3300048917 Bacteria 3912
681 Ga0496114_0071618 3300048917 Bacteria 2913
682 Ga0496114_0072801 3300048917 Bacteria 2891
683 Ga0496114_0157733 3300048917 Bacteria 1971
684 Ga0496114_0571175 3300048917 Unclassified 998
685 Ga0496115_0032869 3300048918 Bacteria 4095
686 Ga0496115_0072063 3300048918 Bacteria 2803
687 Ga0496115_0073089 3300048918 Bacteria 2783
688 Ga0496115_0275566 3300048918 Bacteria 1381
689 Ga0496115_0381335 3300048918 Unclassified 1146
690 Ga0496115_0448039 3300048918 Bacteria 1043
691 Ga0501291_092589 3300049514 Bacteria 619
692 Ga0501031_0004013 3300049568 Bacteria 9496
693 Ga0501031_0137391 3300049568 Bacteria 1597
694 Ga0501031_0302058 3300049568 Bacteria 1037
695 Ga0501031_0970333 3300049568 Bacteria 543
696 Ga0501032_0024945 3300049569 Bacteria 4125
697 Ga0501032_0137322 3300049569 Bacteria 1611
698 Ga0501033_0027299 3300049570 Bacteria 4292
699 Ga0501033_0464735 3300049570 Bacteria 878
700 Ga0501034_0208451 3300049571 Bacteria 1910
701 Ga0501036_0000261 3300049572 Bacteria 35846
702 Ga0501036_0005893 3300049572 Bacteria 9930
703 Ga0501036_0086238 3300049572 Bacteria 2654
704 Ga0501036_0774440 3300049572 Bacteria 791
705 Ga0501036_1674933 3300049572 Bacteria 513
706 Ga0501037_0026288 3300049573 Bacteria 4302
707 Ga0501037_0190592 3300049573 Bacteria 1452
708 Ga0501037_0769356 3300049573 Bacteria 637
709 Ga0501037_0854191 3300049573 Bacteria 598
710 Ga0501038_0023050 3300049574 Bacteria 5571
711 Ga0501038_0081648 3300049574 Bacteria 2724
712 Ga0501038_0094569 3300049574 Bacteria 2498
713 Ga0501038_0364341 3300049574 Bacteria 1124
714 Ga0501039_0011079 3300049575 Bacteria 6871
715 Ga0501039_0026396 3300049575 Bacteria 4463
716 Ga0501039_0691977 3300049575 Bacteria 797
717 Ga0501039_0770514 3300049575 Bacteria 751
718 Ga0501040_0000344 3300049576 Bacteria 27241
719 Ga0501040_0195824 3300049576 Bacteria 1434
720 Ga0501040_0765727 3300049576 Bacteria 698
721 Ga0501040_1169949 3300049576 Bacteria 558
722 Ga0501040_1317346 3300049576 Bacteria 524
723 Ga0501041_0001411 3300049577 Bacteria 13273
724 Ga0501041_0006031 3300049577 Bacteria 7089
725 Ga0501041_0092786 3300049577 Bacteria 1864
726 Ga0501041_0674737 3300049577 Bacteria 661
727 Ga0501042_0000265 3300049578 Bacteria 25490
728 Ga0501042_0139579 3300049578 Bacteria 1747
729 Ga0501042_0190046 3300049578 Bacteria 1481
730 Ga0501042_0660584 3300049578 Bacteria 760
731 Ga0501042_0720410 3300049578 Bacteria 725
732 Ga0501042_0852186 3300049578 Bacteria 663
733 Ga0501043_0368043 3300049579 Bacteria 1090
734 Ga0501043_0643354 3300049579 Bacteria 779
735 Ga0501046_0001305 3300049580 Bacteria 24139
736 Ga0501046_0006023 3300049580 Bacteria 10784
737 Ga0501046_0082969 3300049580 Bacteria 2475
738 Ga0501046_0180111 3300049580 Bacteria 1581
739 Ga0501046_0192481 3300049580 Bacteria 1521
740 Ga0501046_0309655 3300049580 Bacteria 1152
741 Ga0501046_0325596 3300049580 Bacteria 1119
742 Ga0501047_0000626 3300049581 Bacteria 37305
743 Ga0501047_0165518 3300049581 Bacteria 2082
744 Ga0501048_0061476 3300049582 Bacteria 2659
745 Ga0501048_0121681 3300049582 Bacteria 1844
746 Ga0501048_0170089 3300049582 Bacteria 1543
747 Ga0501048_0623507 3300049582 Bacteria 774
748 Ga0501067_0000208 3300049583 Bacteria 32744
749 Ga0501067_0013438 3300049583 Bacteria 4536
750 Ga0501067_0147031 3300049583 Bacteria 1313
751 Ga0501067_0168737 3300049583 Bacteria 1219
752 Ga0501068_0017059 3300049584 Bacteria 4196
753 Ga0501068_0033981 3300049584 Bacteria 3040
754 Ga0501068_0066233 3300049584 Bacteria 2200
755 Ga0501069_0000901 3300049585 Bacteria 14162
756 Ga0501069_0035587 3300049585 Bacteria 2744
757 Ga0501069_0067443 3300049585 Bacteria 2001
758 Ga0501070_0005080 3300049586 Bacteria 11215
759 Ga0501070_0067184 3300049586 Bacteria 2969
760 Ga0501070_0435656 3300049586 Bacteria 1058
761 Ga0501070_0475512 3300049586 Bacteria 1006
762 Ga0501070_0513897 3300049586 Bacteria 961
763 Ga0501070_1173828 3300049586 Bacteria 590
764 Ga0501071_0000430 3300049587 Bacteria 20980
765 Ga0501071_0101081 3300049587 Bacteria 2126
766 Ga0501071_0138107 3300049587 Bacteria 1814
767 Ga0501071_0204961 3300049587 Bacteria 1482
768 Ga0501071_0296679 3300049587 Bacteria 1225
769 Ga0501072_0000897 3300049588 Bacteria 21843
770 Ga0501072_0008013 3300049588 Bacteria 8018
771 Ga0501072_0451814 3300049588 Bacteria 1018
772 Ga0501072_0618420 3300049588 Bacteria 853
773 Ga0501072_0731388 3300049588 Bacteria 777
774 Ga0501072_0799019 3300049588 Bacteria 739
775 Ga0501073_0357468 3300049589 Bacteria 1009
776 Ga0501073_0541459 3300049589 Bacteria 804
777 Ga0501074_0019812 3300049590 Bacteria 4886
778 Ga0501074_0110593 3300049590 Bacteria 1966
779 Ga0501074_0209579 3300049590 Bacteria 1389
780 Ga0501075_0001217 3300049591 Bacteria 16683
781 Ga0501075_0012185 3300049591 Bacteria 6104
782 Ga0501075_0213797 3300049591 Bacteria 1471
783 Ga0501075_0695797 3300049591 Bacteria 774
784 Ga0501076_0000330 3300049592 Bacteria 29312
785 Ga0501076_0003143 3300049592 Bacteria 11515
786 Ga0501076_0003676 3300049592 Bacteria 10783
787 Ga0501076_0077398 3300049592 Bacteria 2669
788 Ga0501076_0099466 3300049592 Bacteria 2343
789 Ga0501076_0112296 3300049592 Bacteria 2204
790 Ga0501076_0503340 3300049592 Bacteria 998
791 Ga0501076_0730983 3300049592 Bacteria 817
792 Ga0501076_1420149 3300049592 Bacteria 570
793 Ga0501077_0002421 3300049593 Bacteria 11194
794 Ga0501077_0008570 3300049593 Bacteria 6337
795 Ga0501077_0347567 3300049593 Bacteria 946
796 Ga0501077_0647952 3300049593 Bacteria 679
797 Ga0501077_0811570 3300049593 Bacteria 602
798 Ga0501202_013010 3300049652 Bacteria 1579
799 Ga0501079_0030332 3300049741 Bacteria 4154
800 Ga0501079_0296199 3300049741 Bacteria 1265
801 Ga0501079_0640027 3300049741 Bacteria 837
802 Ga0501079_1367389 3300049741 Bacteria 557
803 Ga0501080_0000229 3300049742 Bacteria 42083
804 Ga0501080_0011873 3300049742 Bacteria 7979
805 Ga0501080_0126577 3300049742 Bacteria 2366
806 Ga0501080_0543843 3300049742 Bacteria 1035
807 Ga0501080_0794982 3300049742 Bacteria 830
808 Ga0501080_1141874 3300049742 Bacteria 671
809 Ga0501081_0001194 3300049743 Bacteria 15741
810 Ga0501081_0014696 3300049743 Bacteria 5164
811 Ga0501081_0569123 3300049743 Bacteria 847
812 Ga0501081_0617650 3300049743 Bacteria 812
813 Ga0501081_0656179 3300049743 Bacteria 787
814 Ga0501081_0974520 3300049743 Unclassified 640
815 Ga0501083_0060454 3300049744 Bacteria 2531
816 Ga0501083_0376056 3300049744 Bacteria 924
817 Ga0501083_0419644 3300049744 Bacteria 871
818 Ga0501035_0014888 3300049822 Bacteria 7178
819 Ga0501035_0041239 3300049822 Bacteria 4168
820 Ga0501035_0055632 3300049822 Bacteria 3532
821 Ga0501035_0716020 3300049822 Bacteria 806
822 Ga0501035_0958680 3300049822 Bacteria 675
823 Ga0501035_1451407 3300049822 Bacteria 524
824 Ga0501044_0036435 3300049823 Bacteria 5147
825 Ga0501044_0685786 3300049823 Bacteria 911
826 Ga0501044_1202437 3300049823 Bacteria 626
827 Ga0501045_0000784 3300049824 Bacteria 20425
828 Ga0501045_0002106 3300049824 Bacteria 13459
829 Ga0501045_0547023 3300049824 Bacteria 859
830 nmdc:mga00v17_406743_c1 3300050491 Bacteria 884
831 nmdc:mga05p37_17839_c1 3300050507 Bacteria 8568
832 nmdc:mga09592_13054_c1 3300050508 Bacteria 6781
833 nmdc:mga09592_440909_c1 3300050508 Bacteria 1124
834 nmdc:mga06r32_321459_c1 3300050510 Bacteria 1533
835 nmdc:mga08y16_22195_c1 3300050511 Bacteria 6699
836 nmdc:mga08y16_25978_c1 3300050511 Bacteria 6178
837 nmdc:mga08y16_318462_c1 3300050511 Bacteria 1601
838 nmdc:mga0n895_1717573_c1 3300050512 Bacteria 590
839 nmdc:mga0rr50_113920_c1 3300050513 Bacteria 2143
840 nmdc:mga0rr50_521026_c1 3300050513 Bacteria 1011
841 nmdc:mga0a205_171875_c1 3300050515 Bacteria 2063
842 Ga0495601_0029046 3300053077 Bacteria 3427
843 Ga0495601_0564203 3300053077 Bacteria 732
844 Ga0495655_0122949 3300053083 Bacteria 792
845 Ga0495595_0041335 3300053084 Bacteria 2109
846 Ga0495595_0309145 3300053084 Bacteria 796
847 Ga0495595_0386186 3300053084 Bacteria 709
848 Ga0495619_0017348 3300053085 Bacteria 4558
849 Ga0495619_0156365 3300053085 Bacteria 1573
850 Ga0495619_0481271 3300053085 Bacteria 854
851 Ga0501084_0000982 3300054114 Bacteria 22117
852 Ga0501084_0001732 3300054114 Bacteria 17318
853 Ga0501084_0005384 3300054114 Bacteria 10491
854 Ga0501084_0194739 3300054114 Bacteria 1710
855 Ga0501084_0652068 3300054114 Bacteria 889
856 Ga0501084_0801616 3300054114 Bacteria 793
857 Ga0501084_1114147 3300054114 Bacteria 663
858 Ga0501084_1387061 3300054114 Bacteria 589
859 Ga0501082_0003519 3300060353 Bacteria 13680
860 Ga0501082_0035686 3300060353 Bacteria 4285
861 Ga0501082_0655498 3300060353 Bacteria 919
862 Ga0501082_0781169 3300060353 Bacteria 835
863 Ga0501082_1647279 3300060353 Bacteria 560
864 Ga0466962_0145108 3300061719 Bacteria 1151
865 Ga0530510_0006712 3300061734 Bacteria 8023
866 Ga0530510_0056602 3300061734 Bacteria 2833
867 Ga0530510_0159086 3300061734 Bacteria 1670
868 Ga0530510_0694871 3300061734 Unclassified 775
869 Ga0530510_0729563 3300061734 Bacteria 755
870 Ga0530510_1415848 3300061734 Bacteria 533
871 Ga0206354_10187001
872 JGI24743J22301_10001015
873 JGI24738J21930_10000561
874 JGI24744J21845_10022255
875 JGI24742J22300_10004961
876 JGI25407J50210_10079309
877 Ga0070658_10003404
878 Ga0070658_11084318
879 Ga0070683_100007373
880 Ga0070683_100025155
881 Ga0070683_100060728
882 Ga0070683_100682237
883 Ga0070683_100961769
884 Ga0070680_100018180
885 Ga0070680_100241893
886 Ga0070682_100010912
887 Ga0068868_100030465
888 Ga0068868_100556115
889 Ga0070660_100003349
890 Ga0070689_100110319
891 Ga0070691_10000980
892 Ga0070687_100620347
893 Ga0070661_100021829
894 Ga0070661_100046249
895 Ga0070692_10000477
896 Ga0070692_10040248
897 Ga0070692_10287720
898 Ga0070668_101462437
899 Ga0070669_100207080
900 Ga0070675_100011418
901 Ga0070675_100185784
902 Ga0070675_100745130
903 Ga0070675_100935605
904 Ga0070671_100344479
905 Ga0070671_100880534
906 Ga0070674_100068163
907 Ga0070674_100950243
908 Ga0070673_100073667
909 Ga0070688_100094107
910 Ga0070659_100002964
911 Ga0070659_100026771
912 Ga0070659_100150140
913 Ga0070659_100379824
914 Ga0070667_100416374
915 Ga0070667_101416387
916 Ga0070714_100070767
917 Ga0070701_10154063
918 Ga0070711_101872540
919 Ga0070700_100029006
920 Ga0070700_100196883
921 Ga0070700_100566980
922 Ga0070700_100678360
923 Ga0070694_100133061
924 Ga0070694_101313765
925 Ga0070708_100057642
926 Ga0070663_100278212
927 Ga0070678_100180491
928 Ga0070678_100250142
929 Ga0070662_100050553
930 Ga0070662_100156845
931 Ga0070681_10011671
932 Ga0070681_10086307
933 Ga0068867_100049857
934 Ga0068867_100710780
935 Ga0068867_101204167
936 Ga0070706_100887566
937 Ga0070707_100824090
938 Ga0070698_100685030
939 Ga0070679_100002041
940 Ga0070679_100023415
941 Ga0070679_100560834
942 Ga0070684_100019209
943 Ga0070684_100050016
944 Ga0070684_100067255
945 Ga0070684_100069280
946 Ga0070684_100178815
947 Ga0070684_100236976
948 Ga0070684_100751047
949 Ga0070684_100822865
950 Ga0070684_101988762
951 Ga0070697_100534033
952 Ga0068853_100009437
953 Ga0068853_100091817
954 Ga0068853_101208470
955 Ga0070672_100004959
956 Ga0070672_100029322
957 Ga0070686_100117155
958 Ga0070686_100121172
959 Ga0070693_100023150
960 Ga0070693_100044765
961 Ga0070693_100216026
962 Ga0070704_100070968
963 Ga0068855_100033066
964 Ga0068855_100040111
965 Ga0068855_100064998
966 Ga0068855_100114289
967 Ga0068855_100271074
968 Ga0068855_100849270
969 Ga0068855_100988693
970 Ga0070664_100006431
971 Ga0070664_100137962
972 Ga0070664_101247665
973 Ga0068857_100003198
974 Ga0068857_100083105
975 Ga0068857_100416031
976 Ga0068857_100573423
977 Ga0068854_100003631
978 Ga0068854_100985063
979 Ga0068854_101174601
980 Ga0068856_100048087
981 Ga0068856_100792087
982 Ga0068856_100818462
983 Ga0070702_100670545
984 Ga0068852_100006341
985 Ga0068852_100007514
986 Ga0068864_100118253
987 Ga0068864_100391711
988 Ga0068864_100879837
989 Ga0068866_10229632
990 Ga0068866_10534122
991 Ga0068861_100032453
992 Ga0068851_10029379
993 Ga0068870_10083612
994 Ga0068860_100395802
995 Ga0068862_100287082
996 Ga0081455_10038253
997 Ga0081538_10011208
998 Ga0081538_10052606
999 Ga0081538_10164876
1000 Ga0081539_10222587
1001 Ga0070717_10635550
1002 Ga0070717_10744935
1003 Ga0075432_10013630
1004 Ga0070716_101747322
1005 Ga0097621_100058416
1006 Ga0075428_100004576
1007 Ga0075433_10046058
1008 Ga0075429_100009096
1009 Ga0075429_100298014
1010 Ga0068865_100002718
1011 Ga0068865_100016943
1012 Ga0068865_101401912
1013 Ga0105240_10061243
1014 Ga0105240_10599783
1015 Ga0111539_10008396
1016 Ga0111539_10718411
1017 Ga0111539_10746370
1018 Ga0111539_11875920
1019 Ga0105245_10009579
1020 Ga0105245_10022466
1021 Ga0105245_10961608
1022 Ga0105245_11245428
1023 Ga0105245_11527726
1024 Ga0114129_10137571
1025 Ga0105243_10002349
1026 Ga0105243_10021154
1027 Ga0105243_10059994
1028 Ga0105243_10537991
1029 Ga0105243_10619454
1030 Ga0105243_11552037
1031 Ga0105242_10007255
1032 Ga0105242_10022851
1033 Ga0105242_11101367
1034 Ga0105248_10155979
1035 Ga0105237_10560110
1036 Ga0105238_10013752
1037 Ga0105238_10207211
1038 Ga0105249_10444536
1039 Ga0105239_10114244
1040 Ga0105239_10166053
1041 Ga0105239_10436726
1042 Ga0105239_10683883
1043 Ga0105239_10868155
1044 Ga0105246_10007974
1045 Ga0105246_10040527
1046 Ga0157345_1028764
1047 Ga0157342_1016664
1048 Ga0157315_1014579
1049 Ga0157316_1002252
1050 Ga0157373_10152227
1051 Ga0157371_10024922
1052 Ga0157371_10095050
1053 Ga0157370_10025745
1054 Ga0157370_10075071
1055 Ga0157370_10142380
1056 Ga0157370_10478132
1057 Ga0157370_11224551
1058 Ga0157370_11969259
1059 Ga0157369_10040655
1060 Ga0157369_10697373
1061 Ga0157374_10211517
1062 Ga0157374_10273224
1063 Ga0157374_12032555
1064 Ga0163162_10199870
1065 Ga0163162_10418708
1066 Ga0163162_11316294
1067 Ga0157372_10056390
1068 Ga0157372_12133101
1069 Ga0157375_10011579
1070 Ga0157375_10146467
1071 Ga0157375_10551533
1072 Ga0157375_11104659
1073 Ga0157375_11334478
1074 Ga0163163_10065425
1075 Ga0163163_10276187
1076 Ga0157380_10015681
1077 Ga0157380_10049173
1078 Ga0157380_11319566
1079 Ga0157380_12248403
1080 Ga0157377_10016746
1081 Ga0157377_10203492
1082 Ga0157377_10215786
1083 Ga0197907_11327233
1084 Ga0206356_11587627
1085 Ga0206356_11795520
1086 Ga0206354_11345423
1087 Ga0206353_11282731
1088 Ga0213873_10121022
1089 Ga0213874_10084666
1090 Ga0213876_10283665
1091 Ga0213875_10200104
1092 Ga0207656_10004007
1093 Ga0207692_10009278
1094 Ga0207692_10292100
1095 Ga0207642_10115513
1096 Ga0207642_10460890
1097 Ga0207642_10519558
1098 Ga0207688_10005424
1099 Ga0207688_10038105
1100 Ga0207688_10640002
1101 Ga0207685_10066960
1102 Ga0207699_10006032
1103 Ga0207699_10346841
1104 Ga0207643_10070140
1105 Ga0207705_10026768
1106 Ga0207705_10201420
1107 Ga0207705_10913542
1108 Ga0207705_11092859
1109 Ga0207684_10401304
1110 Ga0207654_10018415
1111 Ga0207707_10057939
1112 Ga0207695_10155311
1113 Ga0207695_10431855
1114 Ga0207671_10474268
1115 Ga0207693_10457375
1116 Ga0207693_10600102
1117 Ga0207693_10898837
1118 Ga0207693_11216837
1119 Ga0207663_10065298
1120 Ga0207660_10113254
1121 Ga0207662_10467995
1122 Ga0207657_10004668
1123 Ga0207657_10250612
1124 Ga0207649_10025627
1125 Ga0207649_10106584
1126 Ga0207652_10018886
1127 Ga0207652_10112947
1128 Ga0207652_10505048
1129 Ga0207694_10028677
1130 Ga0207694_10296202
1131 Ga0207694_11286312
1132 Ga0207650_10611063
1133 Ga0207659_10113986
1134 Ga0207659_10129452
1135 Ga0207659_10408800
1136 Ga0207659_10531804
1137 Ga0207687_10071190
1138 Ga0207687_10242536
1139 Ga0207687_10814423
1140 Ga0207700_10000004
1141 Ga0207700_10511731
1142 Ga0207700_10947902
1143 Ga0207664_10078154
1144 Ga0207664_10308604
1145 Ga0207664_10461380
1146 Ga0207644_10068646
1147 Ga0207644_10145182
1148 Ga0207644_11018429
1149 Ga0207690_10004794
1150 Ga0207690_10038365
1151 Ga0207690_10231868
1152 Ga0207690_11318112
1153 Ga0207706_10024437
1154 Ga0207706_10055523
1155 Ga0207706_10986069
1156 Ga0207686_10020992
1157 Ga0207686_10967353
1158 Ga0207709_10006589
1159 Ga0207709_10024537
1160 Ga0207709_10598392
1161 Ga0207669_10027065
1162 Ga0207669_10283600
1163 Ga0207669_10694209
1164 Ga0207669_11008132
1165 Ga0207704_10009496
1166 Ga0207704_11059989
1167 Ga0207665_10004341
1168 Ga0207665_10019278
1169 Ga0207691_10012070
1170 Ga0207691_10056012
1171 Ga0207711_10048669
1172 Ga0207689_10121793
1173 Ga0207689_10214092
1174 Ga0207661_10004390
1175 Ga0207661_10008323
1176 Ga0207661_10025210
1177 Ga0207661_10474087
1178 Ga0207661_11200653
1179 Ga0207679_10280865
1180 Ga0207679_10376285
1181 Ga0207679_10672122
1182 Ga0207679_10802136
1183 Ga0207679_11921651
1184 Ga0207667_10027576
1185 Ga0207667_10048354
1186 Ga0207667_10228697
1187 Ga0207667_10302530
1188 Ga0207651_10501578
1189 Ga0207651_10595407
1190 Ga0207651_11034503
1191 Ga0207668_10635453
1192 Ga0207640_10013370
1193 Ga0207658_10156723
1194 Ga0207658_11074400
1195 Ga0207677_10052239
1196 Ga0207703_10846506
1197 Ga0207639_10004159
1198 Ga0207639_10168482
1199 Ga0207639_10922965
1200 Ga0207678_10026025
1201 Ga0207678_10501133
1202 Ga0207708_10088736
1203 Ga0207708_10283439
1204 Ga0207708_10320189
1205 Ga0207702_10006447
1206 Ga0207702_11542110
1207 Ga0207648_10056797
1208 Ga0207648_10146792
1209 Ga0207648_10381319
1210 Ga0207676_10740717
1211 Ga0207674_10000908
1212 Ga0207674_10068814
1213 Ga0207674_10180577
1214 Ga0207674_10336264
1215 Ga0207674_11428941
1216 Ga0207683_10003261
1217 Ga0207683_10143088
1218 Ga0207683_11512645
1219 Ga0207698_10003693
1220 Ga0207698_10043082
1221 Ga0207428_10000196
1222 Ga0207428_10105489
1223 Ga0268265_10341324
1224 Ga0268264_10574236
1225 Ga0265334_10021845
1226 Ga0265318_10084152
1227 Ga0265338_10011841
1228 Ga0265338_10223519
1229 Ga0265338_10427410
1230 Ga0265332_10035849
1231 Ga0265340_10188077
1232 Ga0265327_10005943
1233 Ga0265327_10031508
1234 Ga0265327_10094757
1235 Ga0265316_10009243
1236 Ga0307408_100205568
1237 Ga0307408_101775594
1238 Ga0265314_10015582
1239 Ga0265342_10022153
1240 Ga0307410_10028827
1241 Ga0307406_10050402
1242 Ga0307406_10688106
1243 Ga0307407_10006312
1244 Ga0307412_10008378
1245 Ga0307409_100029775
1246 Ga0307409_100086349
1247 Ga0307409_100296476
1248 Ga0307416_100074817
1249 Ga0307416_100299997
1250 Ga0307416_100351275
1251 Ga0307416_101473583
1252 Ga0307414_10103059
1253 Ga0307411_10005379
1254 Ga0307415_100044505
1255 Ga0373930_0046004
1256 Ga0373958_0019363
1257 Ga0373959_0016418
1258 Ga0373926_0020105
1259 Ga0373926_0130905
1260 Ga0373929_0032866
1261 Ga0373944_0034076
1262 Ga0373944_0404396
1263 Ga0373949_0003223
1264 Ga0373952_0010253
1265 Ga0373936_0002175
1266 Ga0373936_0639975
1267 Ga0373939_0103485
1268 Ga0373939_0223339
1269 Ga0373941_0105576
1270 Ga0373945_0006186
1271 Ga0373945_0021864
1272 Ga0373943_0006651
1273 Ga0373943_0045871
1274 Ga0373943_0228180
1275 Ga0373946_0037940
1276 Ga0373946_0082053
1277 Ga0373942_0022456
1278 Ga0373961_0018428
1279 Ga0373931_0149048
1280 Ga0373931_0199933
1281 Ga0373935_0070646
1282 Ga0373927_0026206
1283 Ga0373927_0122077
1284 Ga0373947_0002323
1285 Ga0373947_0006531
1286 Ga0373947_0031564
1287 Ga0373925_0005408
1288 Ga0373925_0040621
1289 Ga0373925_0073230
1290 Ga0395899_0002477
1291 Ga0395900_0003203
1292 Ga0395900_0011833
1293 Ga0395900_0017025
1294 Ga0395900_0023261
1295 Ga0395900_0025838
1296 Ga0395900_0111228
1297 Ga0395900_0917959
1298 Ga0395900_1834881
1299 Ga0395898_0003460
1300 Ga0395898_0006664
1301 Ga0395898_0040304
1302 Ga0395898_0059292
1303 Ga0395898_0099800
1304 Ga0395898_0106519
1305 Ga0395898_0324028
1306 Ga0395898_1495342
1307 Ga0395898_1620611
1308 Ga0395905_0000568
1309 Ga0395905_0022975
1310 Ga0395905_0058215
1311 Ga0395905_0099899
1312 Ga0395905_0137375
1313 Ga0395905_0416699
1314 Ga0395901_0003134
1315 Ga0395901_0006480
1316 Ga0395901_0007746
1317 Ga0395901_0021584
1318 Ga0395901_0039014
1319 Ga0395901_0241483
1320 Ga0395901_0313505
1321 Ga0395901_0467595
1322 Ga0395901_0503809
1323 Ga0395901_0537933
1324 Ga0395901_0573132
1325 Ga0395901_1269381
1326 Ga0395901_2144784
1327 Ga0436365_1309694
1328 Ga0436365_1590357
1329 Ga0436365_1645992
1330 Ga0436360_0600304
1331 Ga0436363_0474779
1332 Ga0436363_1043056
1333 Ga0436362_0795226
1334 Ga0436362_0863784
1335 Ga0451807_0559972
1336 Ga0451807_2695406
1337 Ga0451847_0526676
1338 Ga0451851_0311280
1339 Ga0439451_095896
1340 Ga0450920_027224
1341 Ga0450906_016764
1342 Ga0439460_0136724
1343 Ga0466965_0789457
1344 Ga0466966_0002628
1345 Ga0466966_0059879
1346 Ga0466963_0021132
1347 Ga0466963_0022468
1348 Ga0466963_0110438
1349 Ga0466963_0117871
1350 Ga0466964_0013409
1351 Ga0466964_0626680
1352 Ga0466971_0092849
1353 Ga0466968_0077628
1354 Ga0466957_0096139
1355 Ga0466957_0343419
1356 Ga0466959_0000435
1357 Ga0451576_0013003
1358 Ga0451576_0411458
1359 Ga0466967_0003034
1360 Ga0466967_0009902
1361 Ga0466967_0015693
1362 Ga0466967_0021416
1363 Ga0466967_0036149
1364 Ga0466967_0054410
1365 Ga0466967_0329528
1366 Ga0466967_0382504
1367 Ga0466967_0857054
1368 Ga0466967_1874834
1369 Ga0495592_0534939
1370 Ga0495603_0008050
1371 Ga0495603_0244515
1372 Ga0495591_082904
1373 Ga0495629_0000880
1374 Ga0495629_0392454
1375 Ga0495641_0000552
1376 Ga0495641_0023759
1377 Ga0495641_0138300
1378 Ga0495653_0079703
1379 Ga0495653_0628082
1380 Ga0495580_0364784
1381 Ga0495582_0000240
1382 Ga0495582_0243312
1383 Ga0495605_0042478
1384 Ga0495605_0052876
1385 Ga0495605_0075135
1386 Ga0495639_0000921
1387 Ga0495639_0097698
1388 Ga0495662_0002056
1389 Ga0495662_0097845
1390 Ga0495662_0347433
1391 Ga0495662_0582081
1392 Ga0495584_0045758
1393 Ga0495584_0413429
1394 Ga0495594_0393734
1395 Ga0495594_0554674
1396 Ga0495596_0277680
1397 Ga0495583_0258679
1398 Ga0495608_0503259
1399 Ga0495616_0126063
1400 Ga0495618_0115788
1401 Ga0495620_0067909
1402 Ga0495628_0164400
1403 Ga0495628_0620029
1404 Ga0495630_0004569
1405 Ga0495630_0023500
1406 Ga0495630_0941337
1407 Ga0495630_1150797
1408 Ga0495637_0055098
1409 Ga0495637_0058413
1410 Ga0495637_0059009
1411 Ga0495644_0042535
1412 Ga0495663_0116679
1413 Ga0495663_0132466
1414 Ga0495666_0166611
1415 Ga0495642_0103561
1416 Ga0495652_0084917
1417 Ga0495665_0000685
1418 Ga0495665_0176357
1419 Ga0495640_0141210
1420 Ga0495586_0097032
1421 Ga0495598_0009016
1422 Ga0495609_0039123
1423 Ga0495597_0076075
1424 Ga0495667_0440134
1425 Ga0495667_0688033
1426 Ga0495656_0118444
1427 Ga0495656_0158088
1428 Ga0495656_0195269
1429 Ga0495656_0264265
1430 Ga0495656_0643913
1431 Ga0495634_0040086
1432 Ga0495634_0099953
1433 Ga0495634_0529696
1434 Ga0495611_0582781
1435 Ga0495635_0185631
1436 Ga0495635_0230776
1437 Ga0495659_0049432
1438 Ga0495659_0070793
1439 Ga0495659_0198551
1440 Ga0495661_0274858
1441 Ga0495588_0176569
1442 Ga0495588_0458185
1443 Ga0495657_0092151
1444 Ga0495657_0902272
1445 Ga0495599_0234170
1446 Ga0495623_0297505
1447 Ga0495623_0331810
1448 Ga0495646_0075818
1449 Ga0495647_0064877
1450 Ga0495647_0355671
1451 Ga0495658_0000748
1452 Ga0495658_0007224
1453 Ga0495669_0010055
1454 Ga0495669_0046327
1455 Ga0495669_0139124
1456 Ga0495613_0003539
1457 Ga0495613_0068019
1458 Ga0495624_0003367
1459 Ga0495624_0742785
1460 Ga0495670_0392093
1461 Ga0495670_0565963
1462 Ga0495649_0220557
1463 Ga0495589_0085413
1464 Ga0495600_0082102
1465 Ga0495600_0499657
1466 Ga0495660_0084759
1467 Ga0495660_0114285
1468 Ga0495581_0000754
1469 Ga0495581_0009125
1470 Ga0495604_0040460
1471 Ga0495674_0114605
1472 Ga0495674_0173960
1473 Ga0495674_0192628
1474 Ga0495674_0570754
1475 Ga0495676_0000116
1476 Ga0495676_0041281
1477 Ga0495676_0431137
1478 Ga0495680_0016577
1479 Ga0495680_0065797
1480 Ga0495680_0555387
1481 Ga0495675_0270477
1482 Ga0495677_0053595
1483 Ga0495677_0161390
1484 Ga0495681_0313862
1485 Ga0495684_0009574
1486 Ga0495684_0013921
1487 Ga0495684_0439210
1488 Ga0495684_0872654
1489 Ga0495686_0000008
1490 Ga0495593_0001321
1491 Ga0495593_0201840
1492 Ga0495614_0011682
1493 Ga0495614_0111009
1494 Ga0495626_0100314
1495 Ga0496100_0074139
1496 Ga0496100_0442345
1497 Ga0496100_0467128
1498 Ga0496100_1363828
1499 Ga0496101_0017939
1500 Ga0496101_0149472
1501 Ga0496101_0149823
1502 Ga0496101_0250113
1503 Ga0496101_0771402
1504 Ga0496102_0007514
1505 Ga0496102_0082066
1506 Ga0496102_0197345
1507 Ga0496103_0014063
1508 Ga0496104_0002950
1509 Ga0496104_0025579
1510 Ga0496104_0096154
1511 Ga0496104_0160845
1512 Ga0496104_0473474
1513 Ga0496104_0579691
1514 Ga0496105_0005481
1515 Ga0496105_0090879
1516 Ga0496105_0098528
1517 Ga0496106_0061677
1518 Ga0496106_0474082
1519 Ga0496106_0583865
1520 Ga0496107_0023113
1521 Ga0496107_1139089
1522 Ga0496108_0389596
1523 Ga0496108_0404629
1524 Ga0496108_0666672
1525 Ga0496108_1002165
1526 Ga0496109_0129935
1527 Ga0496109_0131966
1528 Ga0496109_0155202
1529 Ga0496109_0249902
1530 Ga0496109_0584030
1531 Ga0496109_0836322
1532 Ga0496109_1686573
1533 Ga0496110_0004582
1534 Ga0496110_0006002
1535 Ga0496110_0035999
1536 Ga0496110_0193662
1537 Ga0496110_0260794
1538 Ga0496110_0535284
1539 Ga0496110_0675633
1540 Ga0496111_0000714
1541 Ga0496111_0045482
1542 Ga0496112_0017751
1543 Ga0496112_0019660
1544 Ga0496112_0145987
1545 Ga0496112_0275741
1546 Ga0496113_0139436
1547 Ga0496113_0192023
1548 Ga0496113_0355608
1549 Ga0496114_0025914
1550 Ga0496114_0039353
1551 Ga0496114_0071618
1552 Ga0496114_0072801
1553 Ga0496114_0157733
1554 Ga0496114_0571175
1555 Ga0496115_0032869
1556 Ga0496115_0072063
1557 Ga0496115_0073089
1558 Ga0496115_0275566
1559 Ga0496115_0381335
1560 Ga0496115_0448039
1561 Ga0501291_092589
1562 Ga0501031_0004013
1563 Ga0501031_0137391
1564 Ga0501031_0302058
1565 Ga0501031_0970333
1566 Ga0501032_0024945
1567 Ga0501032_0137322
1568 Ga0501033_0027299
1569 Ga0501033_0464735
1570 Ga0501034_0208451
1571 Ga0501036_0000261
1572 Ga0501036_0005893
1573 Ga0501036_0086238
1574 Ga0501036_0774440
1575 Ga0501036_1674933
1576 Ga0501037_0026288
1577 Ga0501037_0190592
1578 Ga0501037_0769356
1579 Ga0501037_0854191
1580 Ga0501038_0023050
1581 Ga0501038_0081648
1582 Ga0501038_0094569
1583 Ga0501038_0364341
1584 Ga0501039_0011079
1585 Ga0501039_0026396
1586 Ga0501039_0691977
1587 Ga0501039_0770514
1588 Ga0501040_0000344
1589 Ga0501040_0195824
1590 Ga0501040_0765727
1591 Ga0501040_1169949
1592 Ga0501040_1317346
1593 Ga0501041_0001411
1594 Ga0501041_0006031
1595 Ga0501041_0092786
1596 Ga0501041_0674737
1597 Ga0501042_0000265
1598 Ga0501042_0139579
1599 Ga0501042_0190046
1600 Ga0501042_0660584
1601 Ga0501042_0720410
1602 Ga0501042_0852186
1603 Ga0501043_0368043
1604 Ga0501043_0643354
1605 Ga0501046_0001305
1606 Ga0501046_0006023
1607 Ga0501046_0082969
1608 Ga0501046_0180111
1609 Ga0501046_0192481
1610 Ga0501046_0309655
1611 Ga0501046_0325596
1612 Ga0501047_0000626
1613 Ga0501047_0165518
1614 Ga0501048_0061476
1615 Ga0501048_0121681
1616 Ga0501048_0170089
1617 Ga0501048_0623507
1618 Ga0501067_0000208
1619 Ga0501067_0013438
1620 Ga0501067_0147031
1621 Ga0501067_0168737
1622 Ga0501068_0017059
1623 Ga0501068_0033981
1624 Ga0501068_0066233
1625 Ga0501069_0000901
1626 Ga0501069_0035587
1627 Ga0501069_0067443
1628 Ga0501070_0005080
1629 Ga0501070_0067184
1630 Ga0501070_0435656
1631 Ga0501070_0475512
1632 Ga0501070_0513897
1633 Ga0501070_1173828
1634 Ga0501071_0000430
1635 Ga0501071_0101081
1636 Ga0501071_0138107
1637 Ga0501071_0204961
1638 Ga0501071_0296679
1639 Ga0501072_0000897
1640 Ga0501072_0008013
1641 Ga0501072_0451814
1642 Ga0501072_0618420
1643 Ga0501072_0731388
1644 Ga0501072_0799019
1645 Ga0501073_0357468
1646 Ga0501073_0541459
1647 Ga0501074_0019812
1648 Ga0501074_0110593
1649 Ga0501074_0209579
1650 Ga0501075_0001217
1651 Ga0501075_0012185
1652 Ga0501075_0213797
1653 Ga0501075_0695797
1654 Ga0501076_0000330
1655 Ga0501076_0003143
1656 Ga0501076_0003676
1657 Ga0501076_0077398
1658 Ga0501076_0099466
1659 Ga0501076_0112296
1660 Ga0501076_0503340
1661 Ga0501076_0730983
1662 Ga0501076_1420149
1663 Ga0501077_0002421
1664 Ga0501077_0008570
1665 Ga0501077_0347567
1666 Ga0501077_0647952
1667 Ga0501077_0811570
1668 Ga0501202_013010
1669 Ga0501079_0030332
1670 Ga0501079_0296199
1671 Ga0501079_0640027
1672 Ga0501079_1367389
1673 Ga0501080_0000229
1674 Ga0501080_0011873
1675 Ga0501080_0126577
1676 Ga0501080_0543843
1677 Ga0501080_0794982
1678 Ga0501080_1141874
1679 Ga0501081_0001194
1680 Ga0501081_0014696
1681 Ga0501081_0569123
1682 Ga0501081_0617650
1683 Ga0501081_0656179
1684 Ga0501081_0974520
1685 Ga0501083_0060454
1686 Ga0501083_0376056
1687 Ga0501083_0419644
1688 Ga0501035_0014888
1689 Ga0501035_0041239
1690 Ga0501035_0055632
1691 Ga0501035_0716020
1692 Ga0501035_0958680
1693 Ga0501035_1451407
1694 Ga0501044_0036435
1695 Ga0501044_0685786
1696 Ga0501044_1202437
1697 Ga0501045_0000784
1698 Ga0501045_0002106
1699 Ga0501045_0547023
1700 nmdc:mga00v17_406743_c1
1701 nmdc:mga05p37_17839_c1
1702 nmdc:mga09592_13054_c1
1703 nmdc:mga09592_440909_c1
1704 nmdc:mga06r32_321459_c1
1705 nmdc:mga08y16_22195_c1
1706 nmdc:mga08y16_25978_c1
1707 nmdc:mga08y16_318462_c1
1708 nmdc:mga0n895_1717573_c1
1709 nmdc:mga0rr50_113920_c1
1710 nmdc:mga0rr50_521026_c1
1711 nmdc:mga0a205_171875_c1
1712 Ga0495601_0029046
1713 Ga0495601_0564203
1714 Ga0495655_0122949
1715 Ga0495595_0041335
1716 Ga0495595_0309145
1717 Ga0495595_0386186
1718 Ga0495619_0017348
1719 Ga0495619_0156365
1720 Ga0495619_0481271
1721 Ga0501084_0000982
1722 Ga0501084_0001732
1723 Ga0501084_0005384
1724 Ga0501084_0194739
1725 Ga0501084_0652068
1726 Ga0501084_0801616
1727 Ga0501084_1114147
1728 Ga0501084_1387061
1729 Ga0501082_0003519
1730 Ga0501082_0035686
1731 Ga0501082_0655498
1732 Ga0501082_0781169
1733 Ga0501082_1647279
1734 Ga0466962_0145108
1735 Ga0530510_0006712
1736 Ga0530510_0056602
1737 Ga0530510_0159086
1738 Ga0530510_0694871
1739 Ga0530510_0729563
1740 Ga0530510_1415848

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

13

129

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.8179 1 123
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.8138 1 124
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.8017 1 124
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7999 1 123
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7972 1 123
ID Description Score Start End Superfamily
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8629 3 122 3.40.390.30
af_Q4DNU0_12_187_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.842 17 124 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8236 3 122 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8179 1 123 3.40.390.30
af_A4IA97_11_196_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8089 13 123 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A538CZG4-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9899 1 125 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A1Q6XH06-F1-model_v4 rRNA maturation RNase YbeY 0.977 14 125 GO:0004222
GO:0004519
GO:0006364
GO:0046872
AF-A0A538KXI9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9714 2 125 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A1Q6XH06-F1-model_v4 rRNA maturation RNase YbeY 0.9685 14 125 GO:0004222
GO:0004519
GO:0006364
GO:0046872
AF-A0A538KXI9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9563 2 125 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Map