F484148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 366 | 1740 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300020081|Ga0206354_10187001|Ga0206354_101870011 |
| Length | 147 |
| Sequence | MLTVEVDNRSGAEVDDGAAVELVCAVLRAEGIEDGELGLAFVGPEEMRELKREHLGIDEPTDVLSFPIDGRDELPEGMPRALGDVVLCPQVVKDEWPWPLTHGVLHLLGYDHGDEMEAKELDHLRRRLDGPEASAEAPARPEPEEQN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 87 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 88 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 89 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 217 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 218 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 219 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 220 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 221 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 344 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 7.82 |
| Rhizosphere | 90.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0206354_10187001 | 3300020081 | Bacteria | 725 |
| 2 | JGI24743J22301_10001015 | 3300001991 | Bacteria | 3684 |
| 3 | JGI24738J21930_10000561 | 3300002075 | Bacteria | 10619 |
| 4 | JGI24744J21845_10022255 | 3300002077 | Bacteria | 1246 |
| 5 | JGI24742J22300_10004961 | 3300002244 | Bacteria | 2185 |
| 6 | JGI25407J50210_10079309 | 3300003373 | Bacteria | 817 |
| 7 | Ga0070658_10003404 | 3300005327 | Bacteria | 13081 |
| 8 | Ga0070658_11084318 | 3300005327 | Bacteria | 697 |
| 9 | Ga0070683_100007373 | 3300005329 | Bacteria | 9292 |
| 10 | Ga0070683_100025155 | 3300005329 | Bacteria | 5343 |
| 11 | Ga0070683_100060728 | 3300005329 | Bacteria | 3513 |
| 12 | Ga0070683_100682237 | 3300005329 | Bacteria | 984 |
| 13 | Ga0070683_100961769 | 3300005329 | Bacteria | 819 |
| 14 | Ga0070680_100018180 | 3300005336 | Bacteria | 5552 |
| 15 | Ga0070680_100241893 | 3300005336 | Bacteria | 1525 |
| 16 | Ga0070682_100010912 | 3300005337 | Bacteria | 5176 |
| 17 | Ga0068868_100030465 | 3300005338 | Bacteria | 4137 |
| 18 | Ga0068868_100556115 | 3300005338 | Bacteria | 1012 |
| 19 | Ga0070660_100003349 | 3300005339 | Bacteria | 11013 |
| 20 | Ga0070689_100110319 | 3300005340 | Bacteria | 2187 |
| 21 | Ga0070691_10000980 | 3300005341 | Bacteria | 11656 |
| 22 | Ga0070687_100620347 | 3300005343 | Bacteria | 745 |
| 23 | Ga0070661_100021829 | 3300005344 | Bacteria | 4579 |
| 24 | Ga0070661_100046249 | 3300005344 | Bacteria | 3183 |
| 25 | Ga0070692_10000477 | 3300005345 | Bacteria | 12289 |
| 26 | Ga0070692_10040248 | 3300005345 | Bacteria | 2389 |
| 27 | Ga0070692_10287720 | 3300005345 | Bacteria | 999 |
| 28 | Ga0070668_101462437 | 3300005347 | Bacteria | 624 |
| 29 | Ga0070669_100207080 | 3300005353 | Bacteria | 1546 |
| 30 | Ga0070675_100011418 | 3300005354 | Bacteria | 6952 |
| 31 | Ga0070675_100185784 | 3300005354 | Bacteria | 1799 |
| 32 | Ga0070675_100745130 | 3300005354 | Bacteria | 894 |
| 33 | Ga0070675_100935605 | 3300005354 | Bacteria | 795 |
| 34 | Ga0070671_100344479 | 3300005355 | Bacteria | 1271 |
| 35 | Ga0070671_100880534 | 3300005355 | Bacteria | 782 |
| 36 | Ga0070674_100068163 | 3300005356 | Bacteria | 2505 |
| 37 | Ga0070674_100950243 | 3300005356 | Bacteria | 751 |
| 38 | Ga0070673_100073667 | 3300005364 | Bacteria | 2749 |
| 39 | Ga0070688_100094107 | 3300005365 | Bacteria | 1964 |
| 40 | Ga0070659_100002964 | 3300005366 | Bacteria | 12102 |
| 41 | Ga0070659_100026771 | 3300005366 | Bacteria | 4439 |
| 42 | Ga0070659_100150140 | 3300005366 | Bacteria | 1901 |
| 43 | Ga0070659_100379824 | 3300005366 | Bacteria | 1190 |
| 44 | Ga0070667_100416374 | 3300005367 | Bacteria | 1224 |
| 45 | Ga0070667_101416387 | 3300005367 | Bacteria | 652 |
| 46 | Ga0070714_100070767 | 3300005435 | Bacteria | 3015 |
| 47 | Ga0070701_10154063 | 3300005438 | Bacteria | 1326 |
| 48 | Ga0070711_101872540 | 3300005439 | Unclassified | 527 |
| 49 | Ga0070700_100029006 | 3300005441 | Bacteria | 3296 |
| 50 | Ga0070700_100196883 | 3300005441 | Bacteria | 1413 |
| 51 | Ga0070700_100566980 | 3300005441 | Bacteria | 884 |
| 52 | Ga0070700_100678360 | 3300005441 | Bacteria | 817 |
| 53 | Ga0070694_100133061 | 3300005444 | Bacteria | 1799 |
| 54 | Ga0070694_101313765 | 3300005444 | Bacteria | 608 |
| 55 | Ga0070708_100057642 | 3300005445 | Bacteria | 3459 |
| 56 | Ga0070663_100278212 | 3300005455 | Bacteria | 1333 |
| 57 | Ga0070678_100180491 | 3300005456 | Bacteria | 1727 |
| 58 | Ga0070678_100250142 | 3300005456 | Bacteria | 1486 |
| 59 | Ga0070662_100050553 | 3300005457 | Bacteria | 2999 |
| 60 | Ga0070662_100156845 | 3300005457 | Bacteria | 1777 |
| 61 | Ga0070681_10011671 | 3300005458 | Bacteria | 8700 |
| 62 | Ga0070681_10086307 | 3300005458 | Bacteria | 3091 |
| 63 | Ga0068867_100049857 | 3300005459 | Bacteria | 3083 |
| 64 | Ga0068867_100710780 | 3300005459 | Bacteria | 888 |
| 65 | Ga0068867_101204167 | 3300005459 | Bacteria | 696 |
| 66 | Ga0070706_100887566 | 3300005467 | Bacteria | 824 |
| 67 | Ga0070707_100824090 | 3300005468 | Unclassified | 892 |
| 68 | Ga0070698_100685030 | 3300005471 | Bacteria | 967 |
| 69 | Ga0070679_100002041 | 3300005530 | Bacteria | 18130 |
| 70 | Ga0070679_100023415 | 3300005530 | Bacteria | 6044 |
| 71 | Ga0070679_100560834 | 3300005530 | Bacteria | 1086 |
| 72 | Ga0070684_100019209 | 3300005535 | Bacteria | 5650 |
| 73 | Ga0070684_100050016 | 3300005535 | Bacteria | 3629 |
| 74 | Ga0070684_100067255 | 3300005535 | Unclassified | 3147 |
| 75 | Ga0070684_100069280 | 3300005535 | Bacteria | 3103 |
| 76 | Ga0070684_100178815 | 3300005535 | Bacteria | 1928 |
| 77 | Ga0070684_100236976 | 3300005535 | Bacteria | 1667 |
| 78 | Ga0070684_100751047 | 3300005535 | Bacteria | 911 |
| 79 | Ga0070684_100822865 | 3300005535 | Bacteria | 869 |
| 80 | Ga0070684_101988762 | 3300005535 | Bacteria | 549 |
| 81 | Ga0070697_100534033 | 3300005536 | Bacteria | 1028 |
| 82 | Ga0068853_100009437 | 3300005539 | Bacteria | 7862 |
| 83 | Ga0068853_100091817 | 3300005539 | Bacteria | 2671 |
| 84 | Ga0068853_101208470 | 3300005539 | Bacteria | 730 |
| 85 | Ga0070672_100004959 | 3300005543 | Bacteria | 8762 |
| 86 | Ga0070672_100029322 | 3300005543 | Bacteria | 4125 |
| 87 | Ga0070686_100117155 | 3300005544 | Bacteria | 1824 |
| 88 | Ga0070686_100121172 | 3300005544 | Bacteria | 1796 |
| 89 | Ga0070693_100023150 | 3300005547 | Bacteria | 3316 |
| 90 | Ga0070693_100044765 | 3300005547 | Bacteria | 2505 |
| 91 | Ga0070693_100216026 | 3300005547 | Bacteria | 1254 |
| 92 | Ga0070704_100070968 | 3300005549 | Bacteria | 2529 |
| 93 | Ga0068855_100033066 | 3300005563 | Bacteria | 6174 |
| 94 | Ga0068855_100040111 | 3300005563 | Bacteria | 5558 |
| 95 | Ga0068855_100064998 | 3300005563 | Bacteria | 4253 |
| 96 | Ga0068855_100114289 | 3300005563 | Bacteria | 3095 |
| 97 | Ga0068855_100271074 | 3300005563 | Bacteria | 1887 |
| 98 | Ga0068855_100849270 | 3300005563 | Bacteria | 967 |
| 99 | Ga0068855_100988693 | 3300005563 | Bacteria | 884 |
| 100 | Ga0070664_100006431 | 3300005564 | Bacteria | 9478 |
| 101 | Ga0070664_100137962 | 3300005564 | Bacteria | 2146 |
| 102 | Ga0070664_101247665 | 3300005564 | Bacteria | 702 |
| 103 | Ga0068857_100003198 | 3300005577 | Bacteria | 13580 |
| 104 | Ga0068857_100083105 | 3300005577 | Bacteria | 2860 |
| 105 | Ga0068857_100416031 | 3300005577 | Bacteria | 1253 |
| 106 | Ga0068857_100573423 | 3300005577 | Bacteria | 1065 |
| 107 | Ga0068854_100003631 | 3300005578 | Bacteria | 9657 |
| 108 | Ga0068854_100985063 | 3300005578 | Bacteria | 746 |
| 109 | Ga0068854_101174601 | 3300005578 | Bacteria | 687 |
| 110 | Ga0068856_100048087 | 3300005614 | Bacteria | 4202 |
| 111 | Ga0068856_100792087 | 3300005614 | Bacteria | 968 |
| 112 | Ga0068856_100818462 | 3300005614 | Bacteria | 951 |
| 113 | Ga0070702_100670545 | 3300005615 | Bacteria | 787 |
| 114 | Ga0068852_100006341 | 3300005616 | Bacteria | 8536 |
| 115 | Ga0068852_100007514 | 3300005616 | Bacteria | 7957 |
| 116 | Ga0068864_100118253 | 3300005618 | Bacteria | 2366 |
| 117 | Ga0068864_100391711 | 3300005618 | Bacteria | 1319 |
| 118 | Ga0068864_100879837 | 3300005618 | Bacteria | 884 |
| 119 | Ga0068866_10229632 | 3300005718 | Bacteria | 1125 |
| 120 | Ga0068866_10534122 | 3300005718 | Bacteria | 781 |
| 121 | Ga0068861_100032453 | 3300005719 | Bacteria | 3844 |
| 122 | Ga0068851_10029379 | 3300005834 | Bacteria | 2722 |
| 123 | Ga0068870_10083612 | 3300005840 | Bacteria | 1770 |
| 124 | Ga0068860_100395802 | 3300005843 | Bacteria | 1366 |
| 125 | Ga0068862_100287082 | 3300005844 | Bacteria | 1510 |
| 126 | Ga0081455_10038253 | 3300005937 | Bacteria | 4249 |
| 127 | Ga0081538_10011208 | 3300005981 | Bacteria | 7281 |
| 128 | Ga0081538_10052606 | 3300005981 | Bacteria | 2431 |
| 129 | Ga0081538_10164876 | 3300005981 | Bacteria | 978 |
| 130 | Ga0081539_10222587 | 3300005985 | Bacteria | 857 |
| 131 | Ga0070717_10635550 | 3300006028 | Bacteria | 969 |
| 132 | Ga0070717_10744935 | 3300006028 | Bacteria | 891 |
| 133 | Ga0075432_10013630 | 3300006058 | Bacteria | 2762 |
| 134 | Ga0070716_101747322 | 3300006173 | Unclassified | 514 |
| 135 | Ga0097621_100058416 | 3300006237 | Bacteria | 3156 |
| 136 | Ga0075428_100004576 | 3300006844 | Bacteria | 15296 |
| 137 | Ga0075433_10046058 | 3300006852 | Bacteria | 3792 |
| 138 | Ga0075429_100009096 | 3300006880 | Bacteria | 8626 |
| 139 | Ga0075429_100298014 | 3300006880 | Bacteria | 1412 |
| 140 | Ga0068865_100002718 | 3300006881 | Bacteria | 10501 |
| 141 | Ga0068865_100016943 | 3300006881 | Bacteria | 4675 |
| 142 | Ga0068865_101401912 | 3300006881 | Bacteria | 624 |
| 143 | Ga0105240_10061243 | 3300009093 | Bacteria | 4690 |
| 144 | Ga0105240_10599783 | 3300009093 | Bacteria | 1213 |
| 145 | Ga0111539_10008396 | 3300009094 | Bacteria | 13142 |
| 146 | Ga0111539_10718411 | 3300009094 | Bacteria | 1163 |
| 147 | Ga0111539_10746370 | 3300009094 | Bacteria | 1139 |
| 148 | Ga0111539_11875920 | 3300009094 | Bacteria | 695 |
| 149 | Ga0105245_10009579 | 3300009098 | Bacteria | 8450 |
| 150 | Ga0105245_10022466 | 3300009098 | Bacteria | 5537 |
| 151 | Ga0105245_10961608 | 3300009098 | Bacteria | 897 |
| 152 | Ga0105245_11245428 | 3300009098 | Bacteria | 792 |
| 153 | Ga0105245_11527726 | 3300009098 | Bacteria | 719 |
| 154 | Ga0114129_10137571 | 3300009147 | Bacteria | 3351 |
| 155 | Ga0105243_10002349 | 3300009148 | Bacteria | 15832 |
| 156 | Ga0105243_10021154 | 3300009148 | Bacteria | 4937 |
| 157 | Ga0105243_10059994 | 3300009148 | Bacteria | 3038 |
| 158 | Ga0105243_10537991 | 3300009148 | Bacteria | 1114 |
| 159 | Ga0105243_10619454 | 3300009148 | Bacteria | 1044 |
| 160 | Ga0105243_11552037 | 3300009148 | Bacteria | 687 |
| 161 | Ga0105242_10007255 | 3300009176 | Bacteria | 8548 |
| 162 | Ga0105242_10022851 | 3300009176 | Bacteria | 4924 |
| 163 | Ga0105242_11101367 | 3300009176 | Bacteria | 808 |
| 164 | Ga0105248_10155979 | 3300009177 | Bacteria | 2576 |
| 165 | Ga0105237_10560110 | 3300009545 | Bacteria | 1150 |
| 166 | Ga0105238_10013752 | 3300009551 | Bacteria | 8179 |
| 167 | Ga0105238_10207211 | 3300009551 | Bacteria | 1937 |
| 168 | Ga0105249_10444536 | 3300009553 | Bacteria | 1334 |
| 169 | Ga0105239_10114244 | 3300010375 | Bacteria | 2995 |
| 170 | Ga0105239_10166053 | 3300010375 | Bacteria | 2468 |
| 171 | Ga0105239_10436726 | 3300010375 | Bacteria | 1484 |
| 172 | Ga0105239_10683883 | 3300010375 | Bacteria | 1173 |
| 173 | Ga0105239_10868155 | 3300010375 | Bacteria | 1035 |
| 174 | Ga0105246_10007974 | 3300011119 | Bacteria | 6500 |
| 175 | Ga0105246_10040527 | 3300011119 | Bacteria | 3144 |
| 176 | Ga0157345_1028764 | 3300012498 | Bacteria | 611 |
| 177 | Ga0157342_1016664 | 3300012507 | Bacteria | 815 |
| 178 | Ga0157315_1014579 | 3300012508 | Bacteria | 755 |
| 179 | Ga0157316_1002252 | 3300012510 | Bacteria | 1295 |
| 180 | Ga0157373_10152227 | 3300013100 | Bacteria | 1627 |
| 181 | Ga0157371_10024922 | 3300013102 | Bacteria | 4365 |
| 182 | Ga0157371_10095050 | 3300013102 | Bacteria | 2112 |
| 183 | Ga0157370_10025745 | 3300013104 | Bacteria | 5820 |
| 184 | Ga0157370_10075071 | 3300013104 | Bacteria | 3188 |
| 185 | Ga0157370_10142380 | 3300013104 | Bacteria | 2234 |
| 186 | Ga0157370_10478132 | 3300013104 | Bacteria | 1145 |
| 187 | Ga0157370_11224551 | 3300013104 | Bacteria | 677 |
| 188 | Ga0157370_11969259 | 3300013104 | Bacteria | 524 |
| 189 | Ga0157369_10040655 | 3300013105 | Bacteria | 5076 |
| 190 | Ga0157369_10697373 | 3300013105 | Bacteria | 1046 |
| 191 | Ga0157374_10211517 | 3300013296 | Bacteria | 1901 |
| 192 | Ga0157374_10273224 | 3300013296 | Bacteria | 1667 |
| 193 | Ga0157374_12032555 | 3300013296 | Bacteria | 601 |
| 194 | Ga0163162_10199870 | 3300013306 | Bacteria | 2128 |
| 195 | Ga0163162_10418708 | 3300013306 | Bacteria | 1472 |
| 196 | Ga0163162_11316294 | 3300013306 | Bacteria | 821 |
| 197 | Ga0157372_10056390 | 3300013307 | Bacteria | 4390 |
| 198 | Ga0157372_12133101 | 3300013307 | Bacteria | 644 |
| 199 | Ga0157375_10011579 | 3300013308 | Bacteria | 7792 |
| 200 | Ga0157375_10146467 | 3300013308 | Bacteria | 2492 |
| 201 | Ga0157375_10551533 | 3300013308 | Bacteria | 1314 |
| 202 | Ga0157375_11104659 | 3300013308 | Bacteria | 928 |
| 203 | Ga0157375_11334478 | 3300013308 | Bacteria | 844 |
| 204 | Ga0163163_10065425 | 3300014325 | Bacteria | 3609 |
| 205 | Ga0163163_10276187 | 3300014325 | Bacteria | 1731 |
| 206 | Ga0157380_10015681 | 3300014326 | Bacteria | 5571 |
| 207 | Ga0157380_10049173 | 3300014326 | Bacteria | 3324 |
| 208 | Ga0157380_11319566 | 3300014326 | Bacteria | 769 |
| 209 | Ga0157380_12248403 | 3300014326 | Bacteria | 609 |
| 210 | Ga0157377_10016746 | 3300014745 | Bacteria | 3776 |
| 211 | Ga0157377_10203492 | 3300014745 | Unclassified | 1258 |
| 212 | Ga0157377_10215786 | 3300014745 | Bacteria | 1226 |
| 213 | Ga0197907_11327233 | 3300020069 | Bacteria | 573 |
| 214 | Ga0206356_11587627 | 3300020070 | Bacteria | 1250 |
| 215 | Ga0206356_11795520 | 3300020070 | Unclassified | 1464 |
| 216 | Ga0206354_11345423 | 3300020081 | Bacteria | 831 |
| 217 | Ga0206353_11282731 | 3300020082 | Bacteria | 696 |
| 218 | Ga0213873_10121022 | 3300021358 | Bacteria | 768 |
| 219 | Ga0213874_10084666 | 3300021377 | Bacteria | 1033 |
| 220 | Ga0213876_10283665 | 3300021384 | Bacteria | 880 |
| 221 | Ga0213875_10200104 | 3300021388 | Bacteria | 940 |
| 222 | Ga0207656_10004007 | 3300025321 | Bacteria | 5107 |
| 223 | Ga0207692_10009278 | 3300025898 | Bacteria | 4103 |
| 224 | Ga0207692_10292100 | 3300025898 | Bacteria | 989 |
| 225 | Ga0207642_10115513 | 3300025899 | Bacteria | 1375 |
| 226 | Ga0207642_10460890 | 3300025899 | Bacteria | 772 |
| 227 | Ga0207642_10519558 | 3300025899 | Bacteria | 731 |
| 228 | Ga0207688_10005424 | 3300025901 | Bacteria | 6934 |
| 229 | Ga0207688_10038105 | 3300025901 | Bacteria | 2667 |
| 230 | Ga0207688_10640002 | 3300025901 | Bacteria | 671 |
| 231 | Ga0207685_10066960 | 3300025905 | Bacteria | 1443 |
| 232 | Ga0207699_10006032 | 3300025906 | Bacteria | 5834 |
| 233 | Ga0207699_10346841 | 3300025906 | Bacteria | 1047 |
| 234 | Ga0207643_10070140 | 3300025908 | Bacteria | 2015 |
| 235 | Ga0207705_10026768 | 3300025909 | Bacteria | 4110 |
| 236 | Ga0207705_10201420 | 3300025909 | Bacteria | 1508 |
| 237 | Ga0207705_10913542 | 3300025909 | Bacteria | 680 |
| 238 | Ga0207705_11092859 | 3300025909 | Bacteria | 614 |
| 239 | Ga0207684_10401304 | 3300025910 | Bacteria | 1179 |
| 240 | Ga0207654_10018415 | 3300025911 | Bacteria | 3664 |
| 241 | Ga0207707_10057939 | 3300025912 | Bacteria | 3372 |
| 242 | Ga0207695_10155311 | 3300025913 | Bacteria | 2223 |
| 243 | Ga0207695_10431855 | 3300025913 | Bacteria | 1201 |
| 244 | Ga0207671_10474268 | 3300025914 | Bacteria | 997 |
| 245 | Ga0207693_10457375 | 3300025915 | Bacteria | 997 |
| 246 | Ga0207693_10600102 | 3300025915 | Bacteria | 857 |
| 247 | Ga0207693_10898837 | 3300025915 | Bacteria | 679 |
| 248 | Ga0207693_11216837 | 3300025915 | Bacteria | 567 |
| 249 | Ga0207663_10065298 | 3300025916 | Bacteria | 2326 |
| 250 | Ga0207660_10113254 | 3300025917 | Bacteria | 2044 |
| 251 | Ga0207662_10467995 | 3300025918 | Unclassified | 864 |
| 252 | Ga0207657_10004668 | 3300025919 | Bacteria | 14470 |
| 253 | Ga0207657_10250612 | 3300025919 | Bacteria | 1412 |
| 254 | Ga0207649_10025627 | 3300025920 | Bacteria | 3440 |
| 255 | Ga0207649_10106584 | 3300025920 | Bacteria | 1864 |
| 256 | Ga0207652_10018886 | 3300025921 | Bacteria | 5659 |
| 257 | Ga0207652_10112947 | 3300025921 | Bacteria | 2411 |
| 258 | Ga0207652_10505048 | 3300025921 | Bacteria | 1088 |
| 259 | Ga0207694_10028677 | 3300025924 | Bacteria | 4244 |
| 260 | Ga0207694_10296202 | 3300025924 | Bacteria | 1331 |
| 261 | Ga0207694_11286312 | 3300025924 | Bacteria | 619 |
| 262 | Ga0207650_10611063 | 3300025925 | Bacteria | 917 |
| 263 | Ga0207659_10113986 | 3300025926 | Bacteria | 2060 |
| 264 | Ga0207659_10129452 | 3300025926 | Bacteria | 1946 |
| 265 | Ga0207659_10408800 | 3300025926 | Bacteria | 1136 |
| 266 | Ga0207659_10531804 | 3300025926 | Bacteria | 998 |
| 267 | Ga0207687_10071190 | 3300025927 | Bacteria | 2484 |
| 268 | Ga0207687_10242536 | 3300025927 | Bacteria | 1429 |
| 269 | Ga0207687_10814423 | 3300025927 | Bacteria | 797 |
| 270 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 271 | Ga0207700_10511731 | 3300025928 | Bacteria | 1063 |
| 272 | Ga0207700_10947902 | 3300025928 | Bacteria | 770 |
| 273 | Ga0207664_10078154 | 3300025929 | Bacteria | 2683 |
| 274 | Ga0207664_10308604 | 3300025929 | Unclassified | 1394 |
| 275 | Ga0207664_10461380 | 3300025929 | Bacteria | 1135 |
| 276 | Ga0207644_10068646 | 3300025931 | Bacteria | 2587 |
| 277 | Ga0207644_10145182 | 3300025931 | Bacteria | 1831 |
| 278 | Ga0207644_11018429 | 3300025931 | Unclassified | 695 |
| 279 | Ga0207690_10004794 | 3300025932 | Bacteria | 7980 |
| 280 | Ga0207690_10038365 | 3300025932 | Bacteria | 3117 |
| 281 | Ga0207690_10231868 | 3300025932 | Bacteria | 1418 |
| 282 | Ga0207690_11318112 | 3300025932 | Bacteria | 603 |
| 283 | Ga0207706_10024437 | 3300025933 | Bacteria | 5417 |
| 284 | Ga0207706_10055523 | 3300025933 | Bacteria | 3492 |
| 285 | Ga0207706_10986069 | 3300025933 | Bacteria | 708 |
| 286 | Ga0207686_10020992 | 3300025934 | Bacteria | 3740 |
| 287 | Ga0207686_10967353 | 3300025934 | Bacteria | 690 |
| 288 | Ga0207709_10006589 | 3300025935 | Bacteria | 6520 |
| 289 | Ga0207709_10024537 | 3300025935 | Bacteria | 3444 |
| 290 | Ga0207709_10598392 | 3300025935 | Bacteria | 873 |
| 291 | Ga0207669_10027065 | 3300025937 | Bacteria | 3131 |
| 292 | Ga0207669_10283600 | 3300025937 | Bacteria | 1250 |
| 293 | Ga0207669_10694209 | 3300025937 | Bacteria | 836 |
| 294 | Ga0207669_11008132 | 3300025937 | Bacteria | 700 |
| 295 | Ga0207704_10009496 | 3300025938 | Bacteria | 4696 |
| 296 | Ga0207704_11059989 | 3300025938 | Bacteria | 688 |
| 297 | Ga0207665_10004341 | 3300025939 | Bacteria | 9417 |
| 298 | Ga0207665_10019278 | 3300025939 | Bacteria | 4484 |
| 299 | Ga0207691_10012070 | 3300025940 | Bacteria | 8287 |
| 300 | Ga0207691_10056012 | 3300025940 | Bacteria | 3593 |
| 301 | Ga0207711_10048669 | 3300025941 | Bacteria | 3627 |
| 302 | Ga0207689_10121793 | 3300025942 | Bacteria | 2145 |
| 303 | Ga0207689_10214092 | 3300025942 | Bacteria | 1592 |
| 304 | Ga0207661_10004390 | 3300025944 | Bacteria | 9888 |
| 305 | Ga0207661_10008323 | 3300025944 | Bacteria | 7408 |
| 306 | Ga0207661_10025210 | 3300025944 | Bacteria | 4519 |
| 307 | Ga0207661_10474087 | 3300025944 | Bacteria | 1142 |
| 308 | Ga0207661_11200653 | 3300025944 | Bacteria | 698 |
| 309 | Ga0207679_10280865 | 3300025945 | Bacteria | 1428 |
| 310 | Ga0207679_10376285 | 3300025945 | Bacteria | 1244 |
| 311 | Ga0207679_10672122 | 3300025945 | Bacteria | 938 |
| 312 | Ga0207679_10802136 | 3300025945 | Bacteria | 858 |
| 313 | Ga0207679_11921651 | 3300025945 | Unclassified | 539 |
| 314 | Ga0207667_10027576 | 3300025949 | Bacteria | 6180 |
| 315 | Ga0207667_10048354 | 3300025949 | Bacteria | 4498 |
| 316 | Ga0207667_10228697 | 3300025949 | Bacteria | 1905 |
| 317 | Ga0207667_10302530 | 3300025949 | Bacteria | 1634 |
| 318 | Ga0207651_10501578 | 3300025960 | Bacteria | 1049 |
| 319 | Ga0207651_10595407 | 3300025960 | Bacteria | 966 |
| 320 | Ga0207651_11034503 | 3300025960 | Bacteria | 735 |
| 321 | Ga0207668_10635453 | 3300025972 | Bacteria | 933 |
| 322 | Ga0207640_10013370 | 3300025981 | Bacteria | 4700 |
| 323 | Ga0207658_10156723 | 3300025986 | Bacteria | 1862 |
| 324 | Ga0207658_11074400 | 3300025986 | Bacteria | 735 |
| 325 | Ga0207677_10052239 | 3300026023 | Bacteria | 2776 |
| 326 | Ga0207703_10846506 | 3300026035 | Bacteria | 874 |
| 327 | Ga0207639_10004159 | 3300026041 | Bacteria | 9743 |
| 328 | Ga0207639_10168482 | 3300026041 | Bacteria | 1853 |
| 329 | Ga0207639_10922965 | 3300026041 | Bacteria | 816 |
| 330 | Ga0207678_10026025 | 3300026067 | Bacteria | 5105 |
| 331 | Ga0207678_10501133 | 3300026067 | Bacteria | 1058 |
| 332 | Ga0207708_10088736 | 3300026075 | Bacteria | 2382 |
| 333 | Ga0207708_10283439 | 3300026075 | Bacteria | 1343 |
| 334 | Ga0207708_10320189 | 3300026075 | Bacteria | 1265 |
| 335 | Ga0207702_10006447 | 3300026078 | Bacteria | 10117 |
| 336 | Ga0207702_11542110 | 3300026078 | Unclassified | 658 |
| 337 | Ga0207648_10056797 | 3300026089 | Bacteria | 3415 |
| 338 | Ga0207648_10146792 | 3300026089 | Bacteria | 2080 |
| 339 | Ga0207648_10381319 | 3300026089 | Bacteria | 1275 |
| 340 | Ga0207676_10740717 | 3300026095 | Bacteria | 955 |
| 341 | Ga0207674_10000908 | 3300026116 | Bacteria | 38623 |
| 342 | Ga0207674_10068814 | 3300026116 | Bacteria | 3562 |
| 343 | Ga0207674_10180577 | 3300026116 | Bacteria | 2062 |
| 344 | Ga0207674_10336264 | 3300026116 | Bacteria | 1460 |
| 345 | Ga0207674_11428941 | 3300026116 | Bacteria | 661 |
| 346 | Ga0207683_10003261 | 3300026121 | Bacteria | 14150 |
| 347 | Ga0207683_10143088 | 3300026121 | Bacteria | 2155 |
| 348 | Ga0207683_11512645 | 3300026121 | Bacteria | 620 |
| 349 | Ga0207698_10003693 | 3300026142 | Bacteria | 9257 |
| 350 | Ga0207698_10043082 | 3300026142 | Bacteria | 3379 |
| 351 | Ga0207428_10000196 | 3300027907 | Bacteria | 84609 |
| 352 | Ga0207428_10105489 | 3300027907 | Bacteria | 2173 |
| 353 | Ga0268265_10341324 | 3300028380 | Bacteria | 1364 |
| 354 | Ga0268264_10574236 | 3300028381 | Bacteria | 1108 |
| 355 | Ga0265334_10021845 | 3300028573 | Bacteria | 2612 |
| 356 | Ga0265318_10084152 | 3300028577 | Bacteria | 1173 |
| 357 | Ga0265338_10011841 | 3300028800 | Bacteria | 10023 |
| 358 | Ga0265338_10223519 | 3300028800 | Bacteria | 1405 |
| 359 | Ga0265338_10427410 | 3300028800 | Bacteria | 941 |
| 360 | Ga0265332_10035849 | 3300031238 | Bacteria | 2154 |
| 361 | Ga0265340_10188077 | 3300031247 | Bacteria | 932 |
| 362 | Ga0265327_10005943 | 3300031251 | Bacteria | 9948 |
| 363 | Ga0265327_10031508 | 3300031251 | Bacteria | 2977 |
| 364 | Ga0265327_10094757 | 3300031251 | Bacteria | 1450 |
| 365 | Ga0265316_10009243 | 3300031344 | Bacteria | 9075 |
| 366 | Ga0307408_100205568 | 3300031548 | Bacteria | 1597 |
| 367 | Ga0307408_101775594 | 3300031548 | Bacteria | 589 |
| 368 | Ga0265314_10015582 | 3300031711 | Bacteria | 6027 |
| 369 | Ga0265342_10022153 | 3300031712 | Bacteria | 4044 |
| 370 | Ga0307410_10028827 | 3300031852 | Bacteria | 3526 |
| 371 | Ga0307406_10050402 | 3300031901 | Bacteria | 2639 |
| 372 | Ga0307406_10688106 | 3300031901 | Bacteria | 853 |
| 373 | Ga0307407_10006312 | 3300031903 | Bacteria | 5249 |
| 374 | Ga0307412_10008378 | 3300031911 | Bacteria | 5898 |
| 375 | Ga0307409_100029775 | 3300031995 | Bacteria | 3912 |
| 376 | Ga0307409_100086349 | 3300031995 | Bacteria | 2554 |
| 377 | Ga0307409_100296476 | 3300031995 | Bacteria | 1502 |
| 378 | Ga0307416_100074817 | 3300032002 | Bacteria | 2831 |
| 379 | Ga0307416_100299997 | 3300032002 | Bacteria | 1596 |
| 380 | Ga0307416_100351275 | 3300032002 | Bacteria | 1492 |
| 381 | Ga0307416_101473583 | 3300032002 | Bacteria | 786 |
| 382 | Ga0307414_10103059 | 3300032004 | Bacteria | 2152 |
| 383 | Ga0307411_10005379 | 3300032005 | Bacteria | 6283 |
| 384 | Ga0307415_100044505 | 3300032126 | Bacteria | 2968 |
| 385 | Ga0373930_0046004 | 3300034816 | Bacteria | 941 |
| 386 | Ga0373958_0019363 | 3300034819 | Bacteria | 1243 |
| 387 | Ga0373959_0016418 | 3300034820 | Bacteria | 1372 |
| 388 | Ga0373926_0020105 | 3300035083 | Bacteria | 2305 |
| 389 | Ga0373926_0130905 | 3300035083 | Bacteria | 950 |
| 390 | Ga0373929_0032866 | 3300035085 | Bacteria | 1118 |
| 391 | Ga0373944_0034076 | 3300035089 | Bacteria | 1546 |
| 392 | Ga0373944_0404396 | 3300035089 | Bacteria | 527 |
| 393 | Ga0373949_0003223 | 3300035090 | Bacteria | 3947 |
| 394 | Ga0373952_0010253 | 3300035092 | Bacteria | 1808 |
| 395 | Ga0373936_0002175 | 3300035113 | Bacteria | 7307 |
| 396 | Ga0373936_0639975 | 3300035113 | Unclassified | 501 |
| 397 | Ga0373939_0103485 | 3300035114 | Bacteria | 981 |
| 398 | Ga0373939_0223339 | 3300035114 | Bacteria | 722 |
| 399 | Ga0373941_0105576 | 3300035115 | Bacteria | 986 |
| 400 | Ga0373945_0006186 | 3300035116 | Bacteria | 3851 |
| 401 | Ga0373945_0021864 | 3300035116 | Bacteria | 2201 |
| 402 | Ga0373943_0006651 | 3300035170 | Bacteria | 5187 |
| 403 | Ga0373943_0045871 | 3300035170 | Bacteria | 2131 |
| 404 | Ga0373943_0228180 | 3300035170 | Bacteria | 1039 |
| 405 | Ga0373946_0037940 | 3300035171 | Bacteria | 1960 |
| 406 | Ga0373946_0082053 | 3300035171 | Bacteria | 1414 |
| 407 | Ga0373942_0022456 | 3300035207 | Bacteria | 1601 |
| 408 | Ga0373961_0018428 | 3300035241 | Bacteria | 1823 |
| 409 | Ga0373931_0149048 | 3300035691 | Bacteria | 1362 |
| 410 | Ga0373931_0199933 | 3300035691 | Bacteria | 1193 |
| 411 | Ga0373935_0070646 | 3300035692 | Bacteria | 2251 |
| 412 | Ga0373927_0026206 | 3300035695 | Bacteria | 3810 |
| 413 | Ga0373927_0122077 | 3300035695 | Bacteria | 1700 |
| 414 | Ga0373947_0002323 | 3300035725 | Bacteria | 11501 |
| 415 | Ga0373947_0006531 | 3300035725 | Bacteria | 6763 |
| 416 | Ga0373947_0031564 | 3300035725 | Bacteria | 3119 |
| 417 | Ga0373925_0005408 | 3300037068 | Bacteria | 9516 |
| 418 | Ga0373925_0040621 | 3300037068 | Bacteria | 3445 |
| 419 | Ga0373925_0073230 | 3300037068 | Bacteria | 2593 |
| 420 | Ga0395899_0002477 | 3300037312 | Bacteria | 14979 |
| 421 | Ga0395900_0003203 | 3300037418 | Bacteria | 17718 |
| 422 | Ga0395900_0011833 | 3300037418 | Bacteria | 8924 |
| 423 | Ga0395900_0017025 | 3300037418 | Bacteria | 7419 |
| 424 | Ga0395900_0023261 | 3300037418 | Bacteria | 6342 |
| 425 | Ga0395900_0025838 | 3300037418 | Bacteria | 6012 |
| 426 | Ga0395900_0111228 | 3300037418 | Bacteria | 2813 |
| 427 | Ga0395900_0917959 | 3300037418 | Bacteria | 798 |
| 428 | Ga0395900_1834881 | 3300037418 | Bacteria | 517 |
| 429 | Ga0395898_0003460 | 3300037466 | Bacteria | 17643 |
| 430 | Ga0395898_0006664 | 3300037466 | Bacteria | 12316 |
| 431 | Ga0395898_0040304 | 3300037466 | Bacteria | 4619 |
| 432 | Ga0395898_0059292 | 3300037466 | Bacteria | 3724 |
| 433 | Ga0395898_0099800 | 3300037466 | Bacteria | 2788 |
| 434 | Ga0395898_0106519 | 3300037466 | Bacteria | 2689 |
| 435 | Ga0395898_0324028 | 3300037466 | Bacteria | 1470 |
| 436 | Ga0395898_1495342 | 3300037466 | Bacteria | 601 |
| 437 | Ga0395898_1620611 | 3300037466 | Bacteria | 571 |
| 438 | Ga0395905_0000568 | 3300037471 | Bacteria | 50013 |
| 439 | Ga0395905_0022975 | 3300037471 | Bacteria | 5894 |
| 440 | Ga0395905_0058215 | 3300037471 | Bacteria | 3614 |
| 441 | Ga0395905_0099899 | 3300037471 | Bacteria | 2725 |
| 442 | Ga0395905_0137375 | 3300037471 | Bacteria | 2300 |
| 443 | Ga0395905_0416699 | 3300037471 | Bacteria | 1239 |
| 444 | Ga0395901_0003134 | 3300038443 | Bacteria | 16607 |
| 445 | Ga0395901_0006480 | 3300038443 | Bacteria | 11848 |
| 446 | Ga0395901_0007746 | 3300038443 | Bacteria | 10836 |
| 447 | Ga0395901_0021584 | 3300038443 | Bacteria | 6596 |
| 448 | Ga0395901_0039014 | 3300038443 | Bacteria | 4913 |
| 449 | Ga0395901_0241483 | 3300038443 | Bacteria | 1884 |
| 450 | Ga0395901_0313505 | 3300038443 | Bacteria | 1624 |
| 451 | Ga0395901_0467595 | 3300038443 | Bacteria | 1288 |
| 452 | Ga0395901_0503809 | 3300038443 | Bacteria | 1232 |
| 453 | Ga0395901_0537933 | 3300038443 | Bacteria | 1185 |
| 454 | Ga0395901_0573132 | 3300038443 | Bacteria | 1141 |
| 455 | Ga0395901_1269381 | 3300038443 | Bacteria | 699 |
| 456 | Ga0395901_2144784 | 3300038443 | Bacteria | 503 |
| 457 | Ga0436365_1309694 | 3300039437 | Bacteria | 548 |
| 458 | Ga0436365_1590357 | 3300039437 | Bacteria | 769 |
| 459 | Ga0436365_1645992 | 3300039437 | Bacteria | 1612 |
| 460 | Ga0436360_0600304 | 3300039438 | Bacteria | 4142 |
| 461 | Ga0436363_0474779 | 3300039450 | Bacteria | 770 |
| 462 | Ga0436363_1043056 | 3300039450 | Bacteria | 705 |
| 463 | Ga0436362_0795226 | 3300039453 | Bacteria | 1811 |
| 464 | Ga0436362_0863784 | 3300039453 | Bacteria | 874 |
| 465 | Ga0451807_0559972 | 3300041486 | Bacteria | 892 |
| 466 | Ga0451807_2695406 | 3300041486 | Bacteria | 879 |
| 467 | Ga0451847_0526676 | 3300041503 | Unclassified | 573 |
| 468 | Ga0451851_0311280 | 3300041507 | Bacteria | 571 |
| 469 | Ga0439451_095896 | 3300042009 | Unclassified | 599 |
| 470 | Ga0450920_027224 | 3300042122 | Bacteria | 1118 |
| 471 | Ga0450906_016764 | 3300042145 | Bacteria | 1324 |
| 472 | Ga0439460_0136724 | 3300042461 | Bacteria | 811 |
| 473 | Ga0466965_0789457 | 3300044683 | Bacteria | 549 |
| 474 | Ga0466966_0002628 | 3300044684 | Bacteria | 11768 |
| 475 | Ga0466966_0059879 | 3300044684 | Bacteria | 2404 |
| 476 | Ga0466963_0021132 | 3300044694 | Bacteria | 4101 |
| 477 | Ga0466963_0022468 | 3300044694 | Bacteria | 3995 |
| 478 | Ga0466963_0110438 | 3300044694 | Bacteria | 1887 |
| 479 | Ga0466963_0117871 | 3300044694 | Bacteria | 1825 |
| 480 | Ga0466964_0013409 | 3300044706 | Bacteria | 3110 |
| 481 | Ga0466964_0626680 | 3300044706 | Bacteria | 592 |
| 482 | Ga0466971_0092849 | 3300044719 | Bacteria | 1383 |
| 483 | Ga0466968_0077628 | 3300044735 | Bacteria | 1455 |
| 484 | Ga0466957_0096139 | 3300044842 | Bacteria | 1861 |
| 485 | Ga0466957_0343419 | 3300044842 | Bacteria | 1011 |
| 486 | Ga0466959_0000435 | 3300045049 | Bacteria | 24320 |
| 487 | Ga0451576_0013003 | 3300045051 | Bacteria | 9323 |
| 488 | Ga0451576_0411458 | 3300045051 | Bacteria | 1418 |
| 489 | Ga0466967_0003034 | 3300045976 | Bacteria | 10777 |
| 490 | Ga0466967_0009902 | 3300045976 | Bacteria | 7111 |
| 491 | Ga0466967_0015693 | 3300045976 | Bacteria | 5948 |
| 492 | Ga0466967_0021416 | 3300045976 | Bacteria | 5249 |
| 493 | Ga0466967_0036149 | 3300045976 | Bacteria | 4214 |
| 494 | Ga0466967_0054410 | 3300045976 | Bacteria | 3522 |
| 495 | Ga0466967_0329528 | 3300045976 | Bacteria | 1474 |
| 496 | Ga0466967_0382504 | 3300045976 | Unclassified | 1367 |
| 497 | Ga0466967_0857054 | 3300045976 | Bacteria | 903 |
| 498 | Ga0466967_1874834 | 3300045976 | Bacteria | 596 |
| 499 | Ga0495592_0534939 | 3300046454 | Bacteria | 723 |
| 500 | Ga0495603_0008050 | 3300046455 | Bacteria | 6369 |
| 501 | Ga0495603_0244515 | 3300046455 | Bacteria | 1033 |
| 502 | Ga0495591_082904 | 3300046458 | Bacteria | 815 |
| 503 | Ga0495629_0000880 | 3300046459 | Bacteria | 24212 |
| 504 | Ga0495629_0392454 | 3300046459 | Bacteria | 944 |
| 505 | Ga0495641_0000552 | 3300046461 | Bacteria | 31604 |
| 506 | Ga0495641_0023759 | 3300046461 | Bacteria | 3038 |
| 507 | Ga0495641_0138300 | 3300046461 | Bacteria | 1088 |
| 508 | Ga0495653_0079703 | 3300046463 | Bacteria | 2424 |
| 509 | Ga0495653_0628082 | 3300046463 | Bacteria | 658 |
| 510 | Ga0495580_0364784 | 3300046472 | Bacteria | 977 |
| 511 | Ga0495582_0000240 | 3300046473 | Bacteria | 30558 |
| 512 | Ga0495582_0243312 | 3300046473 | Bacteria | 1031 |
| 513 | Ga0495605_0042478 | 3300046474 | Bacteria | 2260 |
| 514 | Ga0495605_0052876 | 3300046474 | Bacteria | 1972 |
| 515 | Ga0495605_0075135 | 3300046474 | Bacteria | 1589 |
| 516 | Ga0495639_0000921 | 3300046475 | Bacteria | 13282 |
| 517 | Ga0495639_0097698 | 3300046475 | Bacteria | 1384 |
| 518 | Ga0495662_0002056 | 3300046476 | Bacteria | 10092 |
| 519 | Ga0495662_0097845 | 3300046476 | Bacteria | 1435 |
| 520 | Ga0495662_0347433 | 3300046476 | Unclassified | 729 |
| 521 | Ga0495662_0582081 | 3300046476 | Bacteria | 548 |
| 522 | Ga0495584_0045758 | 3300046491 | Bacteria | 2207 |
| 523 | Ga0495584_0413429 | 3300046491 | Bacteria | 686 |
| 524 | Ga0495594_0393734 | 3300046499 | Bacteria | 788 |
| 525 | Ga0495594_0554674 | 3300046499 | Bacteria | 652 |
| 526 | Ga0495596_0277680 | 3300046500 | Unclassified | 651 |
| 527 | Ga0495583_0258679 | 3300046506 | Bacteria | 697 |
| 528 | Ga0495608_0503259 | 3300046511 | Unclassified | 733 |
| 529 | Ga0495616_0126063 | 3300046513 | Bacteria | 1177 |
| 530 | Ga0495618_0115788 | 3300046514 | Bacteria | 1716 |
| 531 | Ga0495620_0067909 | 3300046515 | Bacteria | 1465 |
| 532 | Ga0495628_0164400 | 3300046516 | Bacteria | 1685 |
| 533 | Ga0495628_0620029 | 3300046516 | Bacteria | 771 |
| 534 | Ga0495630_0004569 | 3300046517 | Bacteria | 9701 |
| 535 | Ga0495630_0023500 | 3300046517 | Bacteria | 4557 |
| 536 | Ga0495630_0941337 | 3300046517 | Bacteria | 657 |
| 537 | Ga0495630_1150797 | 3300046517 | Unclassified | 587 |
| 538 | Ga0495637_0055098 | 3300046520 | Bacteria | 1650 |
| 539 | Ga0495637_0058413 | 3300046520 | Bacteria | 1590 |
| 540 | Ga0495637_0059009 | 3300046520 | Unclassified | 1580 |
| 541 | Ga0495644_0042535 | 3300046523 | Bacteria | 1711 |
| 542 | Ga0495663_0116679 | 3300046525 | Bacteria | 891 |
| 543 | Ga0495663_0132466 | 3300046525 | Bacteria | 841 |
| 544 | Ga0495666_0166611 | 3300046526 | Bacteria | 1020 |
| 545 | Ga0495642_0103561 | 3300046528 | Unclassified | 1213 |
| 546 | Ga0495652_0084917 | 3300046529 | Bacteria | 2602 |
| 547 | Ga0495665_0000685 | 3300046531 | Bacteria | 17384 |
| 548 | Ga0495665_0176357 | 3300046531 | Bacteria | 1111 |
| 549 | Ga0495640_0141210 | 3300046533 | Bacteria | 1552 |
| 550 | Ga0495586_0097032 | 3300046535 | Bacteria | 1633 |
| 551 | Ga0495598_0009016 | 3300046537 | Bacteria | 2343 |
| 552 | Ga0495609_0039123 | 3300046538 | Bacteria | 2136 |
| 553 | Ga0495597_0076075 | 3300046542 | Bacteria | 1440 |
| 554 | Ga0495667_0440134 | 3300046559 | Bacteria | 819 |
| 555 | Ga0495667_0688033 | 3300046559 | Bacteria | 634 |
| 556 | Ga0495656_0118444 | 3300046615 | Bacteria | 1247 |
| 557 | Ga0495656_0158088 | 3300046615 | Bacteria | 1100 |
| 558 | Ga0495656_0195269 | 3300046615 | Bacteria | 1002 |
| 559 | Ga0495656_0264265 | 3300046615 | Bacteria | 873 |
| 560 | Ga0495656_0643913 | 3300046615 | Bacteria | 569 |
| 561 | Ga0495634_0040086 | 3300046642 | Bacteria | 3187 |
| 562 | Ga0495634_0099953 | 3300046642 | Bacteria | 1875 |
| 563 | Ga0495634_0529696 | 3300046642 | Unclassified | 688 |
| 564 | Ga0495611_0582781 | 3300046648 | Bacteria | 506 |
| 565 | Ga0495635_0185631 | 3300046663 | Bacteria | 1413 |
| 566 | Ga0495635_0230776 | 3300046663 | Bacteria | 1250 |
| 567 | Ga0495659_0049432 | 3300046664 | Bacteria | 1527 |
| 568 | Ga0495659_0070793 | 3300046664 | Bacteria | 1306 |
| 569 | Ga0495659_0198551 | 3300046664 | Bacteria | 822 |
| 570 | Ga0495661_0274858 | 3300046665 | Bacteria | 851 |
| 571 | Ga0495588_0176569 | 3300046674 | Bacteria | 1129 |
| 572 | Ga0495588_0458185 | 3300046674 | Bacteria | 669 |
| 573 | Ga0495657_0092151 | 3300046675 | Bacteria | 1942 |
| 574 | Ga0495657_0902272 | 3300046675 | Bacteria | 502 |
| 575 | Ga0495599_0234170 | 3300046678 | Bacteria | 1121 |
| 576 | Ga0495623_0297505 | 3300046679 | Bacteria | 893 |
| 577 | Ga0495623_0331810 | 3300046679 | Bacteria | 833 |
| 578 | Ga0495646_0075818 | 3300046680 | Bacteria | 1971 |
| 579 | Ga0495647_0064877 | 3300046681 | Bacteria | 1449 |
| 580 | Ga0495647_0355671 | 3300046681 | Unclassified | 667 |
| 581 | Ga0495658_0000748 | 3300046683 | Bacteria | 17539 |
| 582 | Ga0495658_0007224 | 3300046683 | Bacteria | 5489 |
| 583 | Ga0495669_0010055 | 3300046684 | Bacteria | 3997 |
| 584 | Ga0495669_0046327 | 3300046684 | Bacteria | 1940 |
| 585 | Ga0495669_0139124 | 3300046684 | Bacteria | 1146 |
| 586 | Ga0495613_0003539 | 3300046689 | Bacteria | 11708 |
| 587 | Ga0495613_0068019 | 3300046689 | Bacteria | 2599 |
| 588 | Ga0495624_0003367 | 3300046690 | Bacteria | 11871 |
| 589 | Ga0495624_0742785 | 3300046690 | Unclassified | 581 |
| 590 | Ga0495670_0392093 | 3300046691 | Unclassified | 750 |
| 591 | Ga0495670_0565963 | 3300046691 | Bacteria | 619 |
| 592 | Ga0495649_0220557 | 3300046694 | Bacteria | 981 |
| 593 | Ga0495589_0085413 | 3300046794 | Bacteria | 1533 |
| 594 | Ga0495600_0082102 | 3300046809 | Bacteria | 2103 |
| 595 | Ga0495600_0499657 | 3300046809 | Unclassified | 747 |
| 596 | Ga0495660_0084759 | 3300046810 | Bacteria | 1657 |
| 597 | Ga0495660_0114285 | 3300046810 | Bacteria | 1374 |
| 598 | Ga0495581_0000754 | 3300047315 | Bacteria | 17163 |
| 599 | Ga0495581_0009125 | 3300047315 | Bacteria | 5738 |
| 600 | Ga0495604_0040460 | 3300047317 | Bacteria | 3660 |
| 601 | Ga0495674_0114605 | 3300047319 | Bacteria | 2282 |
| 602 | Ga0495674_0173960 | 3300047319 | Bacteria | 1795 |
| 603 | Ga0495674_0192628 | 3300047319 | Bacteria | 1694 |
| 604 | Ga0495674_0570754 | 3300047319 | Bacteria | 899 |
| 605 | Ga0495676_0000116 | 3300047321 | Bacteria | 61181 |
| 606 | Ga0495676_0041281 | 3300047321 | Bacteria | 3799 |
| 607 | Ga0495676_0431137 | 3300047321 | Bacteria | 871 |
| 608 | Ga0495680_0016577 | 3300047322 | Bacteria | 6324 |
| 609 | Ga0495680_0065797 | 3300047322 | Bacteria | 2775 |
| 610 | Ga0495680_0555387 | 3300047322 | Bacteria | 773 |
| 611 | Ga0495675_0270477 | 3300047444 | Bacteria | 1016 |
| 612 | Ga0495677_0053595 | 3300047445 | Bacteria | 1487 |
| 613 | Ga0495677_0161390 | 3300047445 | Bacteria | 865 |
| 614 | Ga0495681_0313862 | 3300047470 | Bacteria | 604 |
| 615 | Ga0495684_0009574 | 3300047471 | Bacteria | 7471 |
| 616 | Ga0495684_0013921 | 3300047471 | Bacteria | 6187 |
| 617 | Ga0495684_0439210 | 3300047471 | Bacteria | 909 |
| 618 | Ga0495684_0872654 | 3300047471 | Bacteria | 582 |
| 619 | Ga0495686_0000008 | 3300047472 | Bacteria | 727479 |
| 620 | Ga0495593_0001321 | 3300047673 | Bacteria | 14526 |
| 621 | Ga0495593_0201840 | 3300047673 | Bacteria | 999 |
| 622 | Ga0495614_0011682 | 3300048089 | Bacteria | 3860 |
| 623 | Ga0495614_0111009 | 3300048089 | Bacteria | 1204 |
| 624 | Ga0495626_0100314 | 3300048091 | Bacteria | 1263 |
| 625 | Ga0496100_0074139 | 3300048903 | Bacteria | 2279 |
| 626 | Ga0496100_0442345 | 3300048903 | Bacteria | 995 |
| 627 | Ga0496100_0467128 | 3300048903 | Bacteria | 969 |
| 628 | Ga0496100_1363828 | 3300048903 | Unclassified | 560 |
| 629 | Ga0496101_0017939 | 3300048904 | Bacteria | 4804 |
| 630 | Ga0496101_0149472 | 3300048904 | Bacteria | 1786 |
| 631 | Ga0496101_0149823 | 3300048904 | Bacteria | 1784 |
| 632 | Ga0496101_0250113 | 3300048904 | Bacteria | 1381 |
| 633 | Ga0496101_0771402 | 3300048904 | Bacteria | 758 |
| 634 | Ga0496102_0007514 | 3300048905 | Bacteria | 9319 |
| 635 | Ga0496102_0082066 | 3300048905 | Bacteria | 2973 |
| 636 | Ga0496102_0197345 | 3300048905 | Bacteria | 1897 |
| 637 | Ga0496103_0014063 | 3300048906 | Bacteria | 4751 |
| 638 | Ga0496104_0002950 | 3300048907 | Bacteria | 14659 |
| 639 | Ga0496104_0025579 | 3300048907 | Bacteria | 5442 |
| 640 | Ga0496104_0096154 | 3300048907 | Bacteria | 2834 |
| 641 | Ga0496104_0160845 | 3300048907 | Bacteria | 2154 |
| 642 | Ga0496104_0473474 | 3300048907 | Bacteria | 1164 |
| 643 | Ga0496104_0579691 | 3300048907 | Bacteria | 1032 |
| 644 | Ga0496105_0005481 | 3300048908 | Bacteria | 9631 |
| 645 | Ga0496105_0090879 | 3300048908 | Bacteria | 2521 |
| 646 | Ga0496105_0098528 | 3300048908 | Bacteria | 2414 |
| 647 | Ga0496106_0061677 | 3300048909 | Bacteria | 2845 |
| 648 | Ga0496106_0474082 | 3300048909 | Bacteria | 1005 |
| 649 | Ga0496106_0583865 | 3300048909 | Bacteria | 895 |
| 650 | Ga0496107_0023113 | 3300048910 | Bacteria | 4394 |
| 651 | Ga0496107_1139089 | 3300048910 | Unclassified | 562 |
| 652 | Ga0496108_0389596 | 3300048911 | Bacteria | 1217 |
| 653 | Ga0496108_0404629 | 3300048911 | Bacteria | 1192 |
| 654 | Ga0496108_0666672 | 3300048911 | Bacteria | 903 |
| 655 | Ga0496108_1002165 | 3300048911 | Bacteria | 713 |
| 656 | Ga0496109_0129935 | 3300048912 | Bacteria | 2350 |
| 657 | Ga0496109_0131966 | 3300048912 | Bacteria | 2332 |
| 658 | Ga0496109_0155202 | 3300048912 | Bacteria | 2144 |
| 659 | Ga0496109_0249902 | 3300048912 | Bacteria | 1670 |
| 660 | Ga0496109_0584030 | 3300048912 | Bacteria | 1053 |
| 661 | Ga0496109_0836322 | 3300048912 | Bacteria | 858 |
| 662 | Ga0496109_1686573 | 3300048912 | Unclassified | 567 |
| 663 | Ga0496110_0004582 | 3300048913 | Bacteria | 10738 |
| 664 | Ga0496110_0006002 | 3300048913 | Bacteria | 9563 |
| 665 | Ga0496110_0035999 | 3300048913 | Bacteria | 4297 |
| 666 | Ga0496110_0193662 | 3300048913 | Bacteria | 1846 |
| 667 | Ga0496110_0260794 | 3300048913 | Unclassified | 1577 |
| 668 | Ga0496110_0535284 | 3300048913 | Bacteria | 1065 |
| 669 | Ga0496110_0675633 | 3300048913 | Bacteria | 933 |
| 670 | Ga0496111_0000714 | 3300048914 | Bacteria | 17654 |
| 671 | Ga0496111_0045482 | 3300048914 | Bacteria | 3159 |
| 672 | Ga0496112_0017751 | 3300048915 | Bacteria | 6697 |
| 673 | Ga0496112_0019660 | 3300048915 | Bacteria | 6380 |
| 674 | Ga0496112_0145987 | 3300048915 | Bacteria | 2334 |
| 675 | Ga0496112_0275741 | 3300048915 | Bacteria | 1629 |
| 676 | Ga0496113_0139436 | 3300048916 | Bacteria | 1907 |
| 677 | Ga0496113_0192023 | 3300048916 | Bacteria | 1621 |
| 678 | Ga0496113_0355608 | 3300048916 | Bacteria | 1175 |
| 679 | Ga0496114_0025914 | 3300048917 | Bacteria | 4797 |
| 680 | Ga0496114_0039353 | 3300048917 | Bacteria | 3912 |
| 681 | Ga0496114_0071618 | 3300048917 | Bacteria | 2913 |
| 682 | Ga0496114_0072801 | 3300048917 | Bacteria | 2891 |
| 683 | Ga0496114_0157733 | 3300048917 | Bacteria | 1971 |
| 684 | Ga0496114_0571175 | 3300048917 | Unclassified | 998 |
| 685 | Ga0496115_0032869 | 3300048918 | Bacteria | 4095 |
| 686 | Ga0496115_0072063 | 3300048918 | Bacteria | 2803 |
| 687 | Ga0496115_0073089 | 3300048918 | Bacteria | 2783 |
| 688 | Ga0496115_0275566 | 3300048918 | Bacteria | 1381 |
| 689 | Ga0496115_0381335 | 3300048918 | Unclassified | 1146 |
| 690 | Ga0496115_0448039 | 3300048918 | Bacteria | 1043 |
| 691 | Ga0501291_092589 | 3300049514 | Bacteria | 619 |
| 692 | Ga0501031_0004013 | 3300049568 | Bacteria | 9496 |
| 693 | Ga0501031_0137391 | 3300049568 | Bacteria | 1597 |
| 694 | Ga0501031_0302058 | 3300049568 | Bacteria | 1037 |
| 695 | Ga0501031_0970333 | 3300049568 | Bacteria | 543 |
| 696 | Ga0501032_0024945 | 3300049569 | Bacteria | 4125 |
| 697 | Ga0501032_0137322 | 3300049569 | Bacteria | 1611 |
| 698 | Ga0501033_0027299 | 3300049570 | Bacteria | 4292 |
| 699 | Ga0501033_0464735 | 3300049570 | Bacteria | 878 |
| 700 | Ga0501034_0208451 | 3300049571 | Bacteria | 1910 |
| 701 | Ga0501036_0000261 | 3300049572 | Bacteria | 35846 |
| 702 | Ga0501036_0005893 | 3300049572 | Bacteria | 9930 |
| 703 | Ga0501036_0086238 | 3300049572 | Bacteria | 2654 |
| 704 | Ga0501036_0774440 | 3300049572 | Bacteria | 791 |
| 705 | Ga0501036_1674933 | 3300049572 | Bacteria | 513 |
| 706 | Ga0501037_0026288 | 3300049573 | Bacteria | 4302 |
| 707 | Ga0501037_0190592 | 3300049573 | Bacteria | 1452 |
| 708 | Ga0501037_0769356 | 3300049573 | Bacteria | 637 |
| 709 | Ga0501037_0854191 | 3300049573 | Bacteria | 598 |
| 710 | Ga0501038_0023050 | 3300049574 | Bacteria | 5571 |
| 711 | Ga0501038_0081648 | 3300049574 | Bacteria | 2724 |
| 712 | Ga0501038_0094569 | 3300049574 | Bacteria | 2498 |
| 713 | Ga0501038_0364341 | 3300049574 | Bacteria | 1124 |
| 714 | Ga0501039_0011079 | 3300049575 | Bacteria | 6871 |
| 715 | Ga0501039_0026396 | 3300049575 | Bacteria | 4463 |
| 716 | Ga0501039_0691977 | 3300049575 | Bacteria | 797 |
| 717 | Ga0501039_0770514 | 3300049575 | Bacteria | 751 |
| 718 | Ga0501040_0000344 | 3300049576 | Bacteria | 27241 |
| 719 | Ga0501040_0195824 | 3300049576 | Bacteria | 1434 |
| 720 | Ga0501040_0765727 | 3300049576 | Bacteria | 698 |
| 721 | Ga0501040_1169949 | 3300049576 | Bacteria | 558 |
| 722 | Ga0501040_1317346 | 3300049576 | Bacteria | 524 |
| 723 | Ga0501041_0001411 | 3300049577 | Bacteria | 13273 |
| 724 | Ga0501041_0006031 | 3300049577 | Bacteria | 7089 |
| 725 | Ga0501041_0092786 | 3300049577 | Bacteria | 1864 |
| 726 | Ga0501041_0674737 | 3300049577 | Bacteria | 661 |
| 727 | Ga0501042_0000265 | 3300049578 | Bacteria | 25490 |
| 728 | Ga0501042_0139579 | 3300049578 | Bacteria | 1747 |
| 729 | Ga0501042_0190046 | 3300049578 | Bacteria | 1481 |
| 730 | Ga0501042_0660584 | 3300049578 | Bacteria | 760 |
| 731 | Ga0501042_0720410 | 3300049578 | Bacteria | 725 |
| 732 | Ga0501042_0852186 | 3300049578 | Bacteria | 663 |
| 733 | Ga0501043_0368043 | 3300049579 | Bacteria | 1090 |
| 734 | Ga0501043_0643354 | 3300049579 | Bacteria | 779 |
| 735 | Ga0501046_0001305 | 3300049580 | Bacteria | 24139 |
| 736 | Ga0501046_0006023 | 3300049580 | Bacteria | 10784 |
| 737 | Ga0501046_0082969 | 3300049580 | Bacteria | 2475 |
| 738 | Ga0501046_0180111 | 3300049580 | Bacteria | 1581 |
| 739 | Ga0501046_0192481 | 3300049580 | Bacteria | 1521 |
| 740 | Ga0501046_0309655 | 3300049580 | Bacteria | 1152 |
| 741 | Ga0501046_0325596 | 3300049580 | Bacteria | 1119 |
| 742 | Ga0501047_0000626 | 3300049581 | Bacteria | 37305 |
| 743 | Ga0501047_0165518 | 3300049581 | Bacteria | 2082 |
| 744 | Ga0501048_0061476 | 3300049582 | Bacteria | 2659 |
| 745 | Ga0501048_0121681 | 3300049582 | Bacteria | 1844 |
| 746 | Ga0501048_0170089 | 3300049582 | Bacteria | 1543 |
| 747 | Ga0501048_0623507 | 3300049582 | Bacteria | 774 |
| 748 | Ga0501067_0000208 | 3300049583 | Bacteria | 32744 |
| 749 | Ga0501067_0013438 | 3300049583 | Bacteria | 4536 |
| 750 | Ga0501067_0147031 | 3300049583 | Bacteria | 1313 |
| 751 | Ga0501067_0168737 | 3300049583 | Bacteria | 1219 |
| 752 | Ga0501068_0017059 | 3300049584 | Bacteria | 4196 |
| 753 | Ga0501068_0033981 | 3300049584 | Bacteria | 3040 |
| 754 | Ga0501068_0066233 | 3300049584 | Bacteria | 2200 |
| 755 | Ga0501069_0000901 | 3300049585 | Bacteria | 14162 |
| 756 | Ga0501069_0035587 | 3300049585 | Bacteria | 2744 |
| 757 | Ga0501069_0067443 | 3300049585 | Bacteria | 2001 |
| 758 | Ga0501070_0005080 | 3300049586 | Bacteria | 11215 |
| 759 | Ga0501070_0067184 | 3300049586 | Bacteria | 2969 |
| 760 | Ga0501070_0435656 | 3300049586 | Bacteria | 1058 |
| 761 | Ga0501070_0475512 | 3300049586 | Bacteria | 1006 |
| 762 | Ga0501070_0513897 | 3300049586 | Bacteria | 961 |
| 763 | Ga0501070_1173828 | 3300049586 | Bacteria | 590 |
| 764 | Ga0501071_0000430 | 3300049587 | Bacteria | 20980 |
| 765 | Ga0501071_0101081 | 3300049587 | Bacteria | 2126 |
| 766 | Ga0501071_0138107 | 3300049587 | Bacteria | 1814 |
| 767 | Ga0501071_0204961 | 3300049587 | Bacteria | 1482 |
| 768 | Ga0501071_0296679 | 3300049587 | Bacteria | 1225 |
| 769 | Ga0501072_0000897 | 3300049588 | Bacteria | 21843 |
| 770 | Ga0501072_0008013 | 3300049588 | Bacteria | 8018 |
| 771 | Ga0501072_0451814 | 3300049588 | Bacteria | 1018 |
| 772 | Ga0501072_0618420 | 3300049588 | Bacteria | 853 |
| 773 | Ga0501072_0731388 | 3300049588 | Bacteria | 777 |
| 774 | Ga0501072_0799019 | 3300049588 | Bacteria | 739 |
| 775 | Ga0501073_0357468 | 3300049589 | Bacteria | 1009 |
| 776 | Ga0501073_0541459 | 3300049589 | Bacteria | 804 |
| 777 | Ga0501074_0019812 | 3300049590 | Bacteria | 4886 |
| 778 | Ga0501074_0110593 | 3300049590 | Bacteria | 1966 |
| 779 | Ga0501074_0209579 | 3300049590 | Bacteria | 1389 |
| 780 | Ga0501075_0001217 | 3300049591 | Bacteria | 16683 |
| 781 | Ga0501075_0012185 | 3300049591 | Bacteria | 6104 |
| 782 | Ga0501075_0213797 | 3300049591 | Bacteria | 1471 |
| 783 | Ga0501075_0695797 | 3300049591 | Bacteria | 774 |
| 784 | Ga0501076_0000330 | 3300049592 | Bacteria | 29312 |
| 785 | Ga0501076_0003143 | 3300049592 | Bacteria | 11515 |
| 786 | Ga0501076_0003676 | 3300049592 | Bacteria | 10783 |
| 787 | Ga0501076_0077398 | 3300049592 | Bacteria | 2669 |
| 788 | Ga0501076_0099466 | 3300049592 | Bacteria | 2343 |
| 789 | Ga0501076_0112296 | 3300049592 | Bacteria | 2204 |
| 790 | Ga0501076_0503340 | 3300049592 | Bacteria | 998 |
| 791 | Ga0501076_0730983 | 3300049592 | Bacteria | 817 |
| 792 | Ga0501076_1420149 | 3300049592 | Bacteria | 570 |
| 793 | Ga0501077_0002421 | 3300049593 | Bacteria | 11194 |
| 794 | Ga0501077_0008570 | 3300049593 | Bacteria | 6337 |
| 795 | Ga0501077_0347567 | 3300049593 | Bacteria | 946 |
| 796 | Ga0501077_0647952 | 3300049593 | Bacteria | 679 |
| 797 | Ga0501077_0811570 | 3300049593 | Bacteria | 602 |
| 798 | Ga0501202_013010 | 3300049652 | Bacteria | 1579 |
| 799 | Ga0501079_0030332 | 3300049741 | Bacteria | 4154 |
| 800 | Ga0501079_0296199 | 3300049741 | Bacteria | 1265 |
| 801 | Ga0501079_0640027 | 3300049741 | Bacteria | 837 |
| 802 | Ga0501079_1367389 | 3300049741 | Bacteria | 557 |
| 803 | Ga0501080_0000229 | 3300049742 | Bacteria | 42083 |
| 804 | Ga0501080_0011873 | 3300049742 | Bacteria | 7979 |
| 805 | Ga0501080_0126577 | 3300049742 | Bacteria | 2366 |
| 806 | Ga0501080_0543843 | 3300049742 | Bacteria | 1035 |
| 807 | Ga0501080_0794982 | 3300049742 | Bacteria | 830 |
| 808 | Ga0501080_1141874 | 3300049742 | Bacteria | 671 |
| 809 | Ga0501081_0001194 | 3300049743 | Bacteria | 15741 |
| 810 | Ga0501081_0014696 | 3300049743 | Bacteria | 5164 |
| 811 | Ga0501081_0569123 | 3300049743 | Bacteria | 847 |
| 812 | Ga0501081_0617650 | 3300049743 | Bacteria | 812 |
| 813 | Ga0501081_0656179 | 3300049743 | Bacteria | 787 |
| 814 | Ga0501081_0974520 | 3300049743 | Unclassified | 640 |
| 815 | Ga0501083_0060454 | 3300049744 | Bacteria | 2531 |
| 816 | Ga0501083_0376056 | 3300049744 | Bacteria | 924 |
| 817 | Ga0501083_0419644 | 3300049744 | Bacteria | 871 |
| 818 | Ga0501035_0014888 | 3300049822 | Bacteria | 7178 |
| 819 | Ga0501035_0041239 | 3300049822 | Bacteria | 4168 |
| 820 | Ga0501035_0055632 | 3300049822 | Bacteria | 3532 |
| 821 | Ga0501035_0716020 | 3300049822 | Bacteria | 806 |
| 822 | Ga0501035_0958680 | 3300049822 | Bacteria | 675 |
| 823 | Ga0501035_1451407 | 3300049822 | Bacteria | 524 |
| 824 | Ga0501044_0036435 | 3300049823 | Bacteria | 5147 |
| 825 | Ga0501044_0685786 | 3300049823 | Bacteria | 911 |
| 826 | Ga0501044_1202437 | 3300049823 | Bacteria | 626 |
| 827 | Ga0501045_0000784 | 3300049824 | Bacteria | 20425 |
| 828 | Ga0501045_0002106 | 3300049824 | Bacteria | 13459 |
| 829 | Ga0501045_0547023 | 3300049824 | Bacteria | 859 |
| 830 | nmdc:mga00v17_406743_c1 | 3300050491 | Bacteria | 884 |
| 831 | nmdc:mga05p37_17839_c1 | 3300050507 | Bacteria | 8568 |
| 832 | nmdc:mga09592_13054_c1 | 3300050508 | Bacteria | 6781 |
| 833 | nmdc:mga09592_440909_c1 | 3300050508 | Bacteria | 1124 |
| 834 | nmdc:mga06r32_321459_c1 | 3300050510 | Bacteria | 1533 |
| 835 | nmdc:mga08y16_22195_c1 | 3300050511 | Bacteria | 6699 |
| 836 | nmdc:mga08y16_25978_c1 | 3300050511 | Bacteria | 6178 |
| 837 | nmdc:mga08y16_318462_c1 | 3300050511 | Bacteria | 1601 |
| 838 | nmdc:mga0n895_1717573_c1 | 3300050512 | Bacteria | 590 |
| 839 | nmdc:mga0rr50_113920_c1 | 3300050513 | Bacteria | 2143 |
| 840 | nmdc:mga0rr50_521026_c1 | 3300050513 | Bacteria | 1011 |
| 841 | nmdc:mga0a205_171875_c1 | 3300050515 | Bacteria | 2063 |
| 842 | Ga0495601_0029046 | 3300053077 | Bacteria | 3427 |
| 843 | Ga0495601_0564203 | 3300053077 | Bacteria | 732 |
| 844 | Ga0495655_0122949 | 3300053083 | Bacteria | 792 |
| 845 | Ga0495595_0041335 | 3300053084 | Bacteria | 2109 |
| 846 | Ga0495595_0309145 | 3300053084 | Bacteria | 796 |
| 847 | Ga0495595_0386186 | 3300053084 | Bacteria | 709 |
| 848 | Ga0495619_0017348 | 3300053085 | Bacteria | 4558 |
| 849 | Ga0495619_0156365 | 3300053085 | Bacteria | 1573 |
| 850 | Ga0495619_0481271 | 3300053085 | Bacteria | 854 |
| 851 | Ga0501084_0000982 | 3300054114 | Bacteria | 22117 |
| 852 | Ga0501084_0001732 | 3300054114 | Bacteria | 17318 |
| 853 | Ga0501084_0005384 | 3300054114 | Bacteria | 10491 |
| 854 | Ga0501084_0194739 | 3300054114 | Bacteria | 1710 |
| 855 | Ga0501084_0652068 | 3300054114 | Bacteria | 889 |
| 856 | Ga0501084_0801616 | 3300054114 | Bacteria | 793 |
| 857 | Ga0501084_1114147 | 3300054114 | Bacteria | 663 |
| 858 | Ga0501084_1387061 | 3300054114 | Bacteria | 589 |
| 859 | Ga0501082_0003519 | 3300060353 | Bacteria | 13680 |
| 860 | Ga0501082_0035686 | 3300060353 | Bacteria | 4285 |
| 861 | Ga0501082_0655498 | 3300060353 | Bacteria | 919 |
| 862 | Ga0501082_0781169 | 3300060353 | Bacteria | 835 |
| 863 | Ga0501082_1647279 | 3300060353 | Bacteria | 560 |
| 864 | Ga0466962_0145108 | 3300061719 | Bacteria | 1151 |
| 865 | Ga0530510_0006712 | 3300061734 | Bacteria | 8023 |
| 866 | Ga0530510_0056602 | 3300061734 | Bacteria | 2833 |
| 867 | Ga0530510_0159086 | 3300061734 | Bacteria | 1670 |
| 868 | Ga0530510_0694871 | 3300061734 | Unclassified | 775 |
| 869 | Ga0530510_0729563 | 3300061734 | Bacteria | 755 |
| 870 | Ga0530510_1415848 | 3300061734 | Bacteria | 533 |
| 871 | Ga0206354_10187001 | |||
| 872 | JGI24743J22301_10001015 | |||
| 873 | JGI24738J21930_10000561 | |||
| 874 | JGI24744J21845_10022255 | |||
| 875 | JGI24742J22300_10004961 | |||
| 876 | JGI25407J50210_10079309 | |||
| 877 | Ga0070658_10003404 | |||
| 878 | Ga0070658_11084318 | |||
| 879 | Ga0070683_100007373 | |||
| 880 | Ga0070683_100025155 | |||
| 881 | Ga0070683_100060728 | |||
| 882 | Ga0070683_100682237 | |||
| 883 | Ga0070683_100961769 | |||
| 884 | Ga0070680_100018180 | |||
| 885 | Ga0070680_100241893 | |||
| 886 | Ga0070682_100010912 | |||
| 887 | Ga0068868_100030465 | |||
| 888 | Ga0068868_100556115 | |||
| 889 | Ga0070660_100003349 | |||
| 890 | Ga0070689_100110319 | |||
| 891 | Ga0070691_10000980 | |||
| 892 | Ga0070687_100620347 | |||
| 893 | Ga0070661_100021829 | |||
| 894 | Ga0070661_100046249 | |||
| 895 | Ga0070692_10000477 | |||
| 896 | Ga0070692_10040248 | |||
| 897 | Ga0070692_10287720 | |||
| 898 | Ga0070668_101462437 | |||
| 899 | Ga0070669_100207080 | |||
| 900 | Ga0070675_100011418 | |||
| 901 | Ga0070675_100185784 | |||
| 902 | Ga0070675_100745130 | |||
| 903 | Ga0070675_100935605 | |||
| 904 | Ga0070671_100344479 | |||
| 905 | Ga0070671_100880534 | |||
| 906 | Ga0070674_100068163 | |||
| 907 | Ga0070674_100950243 | |||
| 908 | Ga0070673_100073667 | |||
| 909 | Ga0070688_100094107 | |||
| 910 | Ga0070659_100002964 | |||
| 911 | Ga0070659_100026771 | |||
| 912 | Ga0070659_100150140 | |||
| 913 | Ga0070659_100379824 | |||
| 914 | Ga0070667_100416374 | |||
| 915 | Ga0070667_101416387 | |||
| 916 | Ga0070714_100070767 | |||
| 917 | Ga0070701_10154063 | |||
| 918 | Ga0070711_101872540 | |||
| 919 | Ga0070700_100029006 | |||
| 920 | Ga0070700_100196883 | |||
| 921 | Ga0070700_100566980 | |||
| 922 | Ga0070700_100678360 | |||
| 923 | Ga0070694_100133061 | |||
| 924 | Ga0070694_101313765 | |||
| 925 | Ga0070708_100057642 | |||
| 926 | Ga0070663_100278212 | |||
| 927 | Ga0070678_100180491 | |||
| 928 | Ga0070678_100250142 | |||
| 929 | Ga0070662_100050553 | |||
| 930 | Ga0070662_100156845 | |||
| 931 | Ga0070681_10011671 | |||
| 932 | Ga0070681_10086307 | |||
| 933 | Ga0068867_100049857 | |||
| 934 | Ga0068867_100710780 | |||
| 935 | Ga0068867_101204167 | |||
| 936 | Ga0070706_100887566 | |||
| 937 | Ga0070707_100824090 | |||
| 938 | Ga0070698_100685030 | |||
| 939 | Ga0070679_100002041 | |||
| 940 | Ga0070679_100023415 | |||
| 941 | Ga0070679_100560834 | |||
| 942 | Ga0070684_100019209 | |||
| 943 | Ga0070684_100050016 | |||
| 944 | Ga0070684_100067255 | |||
| 945 | Ga0070684_100069280 | |||
| 946 | Ga0070684_100178815 | |||
| 947 | Ga0070684_100236976 | |||
| 948 | Ga0070684_100751047 | |||
| 949 | Ga0070684_100822865 | |||
| 950 | Ga0070684_101988762 | |||
| 951 | Ga0070697_100534033 | |||
| 952 | Ga0068853_100009437 | |||
| 953 | Ga0068853_100091817 | |||
| 954 | Ga0068853_101208470 | |||
| 955 | Ga0070672_100004959 | |||
| 956 | Ga0070672_100029322 | |||
| 957 | Ga0070686_100117155 | |||
| 958 | Ga0070686_100121172 | |||
| 959 | Ga0070693_100023150 | |||
| 960 | Ga0070693_100044765 | |||
| 961 | Ga0070693_100216026 | |||
| 962 | Ga0070704_100070968 | |||
| 963 | Ga0068855_100033066 | |||
| 964 | Ga0068855_100040111 | |||
| 965 | Ga0068855_100064998 | |||
| 966 | Ga0068855_100114289 | |||
| 967 | Ga0068855_100271074 | |||
| 968 | Ga0068855_100849270 | |||
| 969 | Ga0068855_100988693 | |||
| 970 | Ga0070664_100006431 | |||
| 971 | Ga0070664_100137962 | |||
| 972 | Ga0070664_101247665 | |||
| 973 | Ga0068857_100003198 | |||
| 974 | Ga0068857_100083105 | |||
| 975 | Ga0068857_100416031 | |||
| 976 | Ga0068857_100573423 | |||
| 977 | Ga0068854_100003631 | |||
| 978 | Ga0068854_100985063 | |||
| 979 | Ga0068854_101174601 | |||
| 980 | Ga0068856_100048087 | |||
| 981 | Ga0068856_100792087 | |||
| 982 | Ga0068856_100818462 | |||
| 983 | Ga0070702_100670545 | |||
| 984 | Ga0068852_100006341 | |||
| 985 | Ga0068852_100007514 | |||
| 986 | Ga0068864_100118253 | |||
| 987 | Ga0068864_100391711 | |||
| 988 | Ga0068864_100879837 | |||
| 989 | Ga0068866_10229632 | |||
| 990 | Ga0068866_10534122 | |||
| 991 | Ga0068861_100032453 | |||
| 992 | Ga0068851_10029379 | |||
| 993 | Ga0068870_10083612 | |||
| 994 | Ga0068860_100395802 | |||
| 995 | Ga0068862_100287082 | |||
| 996 | Ga0081455_10038253 | |||
| 997 | Ga0081538_10011208 | |||
| 998 | Ga0081538_10052606 | |||
| 999 | Ga0081538_10164876 | |||
| 1000 | Ga0081539_10222587 | |||
| 1001 | Ga0070717_10635550 | |||
| 1002 | Ga0070717_10744935 | |||
| 1003 | Ga0075432_10013630 | |||
| 1004 | Ga0070716_101747322 | |||
| 1005 | Ga0097621_100058416 | |||
| 1006 | Ga0075428_100004576 | |||
| 1007 | Ga0075433_10046058 | |||
| 1008 | Ga0075429_100009096 | |||
| 1009 | Ga0075429_100298014 | |||
| 1010 | Ga0068865_100002718 | |||
| 1011 | Ga0068865_100016943 | |||
| 1012 | Ga0068865_101401912 | |||
| 1013 | Ga0105240_10061243 | |||
| 1014 | Ga0105240_10599783 | |||
| 1015 | Ga0111539_10008396 | |||
| 1016 | Ga0111539_10718411 | |||
| 1017 | Ga0111539_10746370 | |||
| 1018 | Ga0111539_11875920 | |||
| 1019 | Ga0105245_10009579 | |||
| 1020 | Ga0105245_10022466 | |||
| 1021 | Ga0105245_10961608 | |||
| 1022 | Ga0105245_11245428 | |||
| 1023 | Ga0105245_11527726 | |||
| 1024 | Ga0114129_10137571 | |||
| 1025 | Ga0105243_10002349 | |||
| 1026 | Ga0105243_10021154 | |||
| 1027 | Ga0105243_10059994 | |||
| 1028 | Ga0105243_10537991 | |||
| 1029 | Ga0105243_10619454 | |||
| 1030 | Ga0105243_11552037 | |||
| 1031 | Ga0105242_10007255 | |||
| 1032 | Ga0105242_10022851 | |||
| 1033 | Ga0105242_11101367 | |||
| 1034 | Ga0105248_10155979 | |||
| 1035 | Ga0105237_10560110 | |||
| 1036 | Ga0105238_10013752 | |||
| 1037 | Ga0105238_10207211 | |||
| 1038 | Ga0105249_10444536 | |||
| 1039 | Ga0105239_10114244 | |||
| 1040 | Ga0105239_10166053 | |||
| 1041 | Ga0105239_10436726 | |||
| 1042 | Ga0105239_10683883 | |||
| 1043 | Ga0105239_10868155 | |||
| 1044 | Ga0105246_10007974 | |||
| 1045 | Ga0105246_10040527 | |||
| 1046 | Ga0157345_1028764 | |||
| 1047 | Ga0157342_1016664 | |||
| 1048 | Ga0157315_1014579 | |||
| 1049 | Ga0157316_1002252 | |||
| 1050 | Ga0157373_10152227 | |||
| 1051 | Ga0157371_10024922 | |||
| 1052 | Ga0157371_10095050 | |||
| 1053 | Ga0157370_10025745 | |||
| 1054 | Ga0157370_10075071 | |||
| 1055 | Ga0157370_10142380 | |||
| 1056 | Ga0157370_10478132 | |||
| 1057 | Ga0157370_11224551 | |||
| 1058 | Ga0157370_11969259 | |||
| 1059 | Ga0157369_10040655 | |||
| 1060 | Ga0157369_10697373 | |||
| 1061 | Ga0157374_10211517 | |||
| 1062 | Ga0157374_10273224 | |||
| 1063 | Ga0157374_12032555 | |||
| 1064 | Ga0163162_10199870 | |||
| 1065 | Ga0163162_10418708 | |||
| 1066 | Ga0163162_11316294 | |||
| 1067 | Ga0157372_10056390 | |||
| 1068 | Ga0157372_12133101 | |||
| 1069 | Ga0157375_10011579 | |||
| 1070 | Ga0157375_10146467 | |||
| 1071 | Ga0157375_10551533 | |||
| 1072 | Ga0157375_11104659 | |||
| 1073 | Ga0157375_11334478 | |||
| 1074 | Ga0163163_10065425 | |||
| 1075 | Ga0163163_10276187 | |||
| 1076 | Ga0157380_10015681 | |||
| 1077 | Ga0157380_10049173 | |||
| 1078 | Ga0157380_11319566 | |||
| 1079 | Ga0157380_12248403 | |||
| 1080 | Ga0157377_10016746 | |||
| 1081 | Ga0157377_10203492 | |||
| 1082 | Ga0157377_10215786 | |||
| 1083 | Ga0197907_11327233 | |||
| 1084 | Ga0206356_11587627 | |||
| 1085 | Ga0206356_11795520 | |||
| 1086 | Ga0206354_11345423 | |||
| 1087 | Ga0206353_11282731 | |||
| 1088 | Ga0213873_10121022 | |||
| 1089 | Ga0213874_10084666 | |||
| 1090 | Ga0213876_10283665 | |||
| 1091 | Ga0213875_10200104 | |||
| 1092 | Ga0207656_10004007 | |||
| 1093 | Ga0207692_10009278 | |||
| 1094 | Ga0207692_10292100 | |||
| 1095 | Ga0207642_10115513 | |||
| 1096 | Ga0207642_10460890 | |||
| 1097 | Ga0207642_10519558 | |||
| 1098 | Ga0207688_10005424 | |||
| 1099 | Ga0207688_10038105 | |||
| 1100 | Ga0207688_10640002 | |||
| 1101 | Ga0207685_10066960 | |||
| 1102 | Ga0207699_10006032 | |||
| 1103 | Ga0207699_10346841 | |||
| 1104 | Ga0207643_10070140 | |||
| 1105 | Ga0207705_10026768 | |||
| 1106 | Ga0207705_10201420 | |||
| 1107 | Ga0207705_10913542 | |||
| 1108 | Ga0207705_11092859 | |||
| 1109 | Ga0207684_10401304 | |||
| 1110 | Ga0207654_10018415 | |||
| 1111 | Ga0207707_10057939 | |||
| 1112 | Ga0207695_10155311 | |||
| 1113 | Ga0207695_10431855 | |||
| 1114 | Ga0207671_10474268 | |||
| 1115 | Ga0207693_10457375 | |||
| 1116 | Ga0207693_10600102 | |||
| 1117 | Ga0207693_10898837 | |||
| 1118 | Ga0207693_11216837 | |||
| 1119 | Ga0207663_10065298 | |||
| 1120 | Ga0207660_10113254 | |||
| 1121 | Ga0207662_10467995 | |||
| 1122 | Ga0207657_10004668 | |||
| 1123 | Ga0207657_10250612 | |||
| 1124 | Ga0207649_10025627 | |||
| 1125 | Ga0207649_10106584 | |||
| 1126 | Ga0207652_10018886 | |||
| 1127 | Ga0207652_10112947 | |||
| 1128 | Ga0207652_10505048 | |||
| 1129 | Ga0207694_10028677 | |||
| 1130 | Ga0207694_10296202 | |||
| 1131 | Ga0207694_11286312 | |||
| 1132 | Ga0207650_10611063 | |||
| 1133 | Ga0207659_10113986 | |||
| 1134 | Ga0207659_10129452 | |||
| 1135 | Ga0207659_10408800 | |||
| 1136 | Ga0207659_10531804 | |||
| 1137 | Ga0207687_10071190 | |||
| 1138 | Ga0207687_10242536 | |||
| 1139 | Ga0207687_10814423 | |||
| 1140 | Ga0207700_10000004 | |||
| 1141 | Ga0207700_10511731 | |||
| 1142 | Ga0207700_10947902 | |||
| 1143 | Ga0207664_10078154 | |||
| 1144 | Ga0207664_10308604 | |||
| 1145 | Ga0207664_10461380 | |||
| 1146 | Ga0207644_10068646 | |||
| 1147 | Ga0207644_10145182 | |||
| 1148 | Ga0207644_11018429 | |||
| 1149 | Ga0207690_10004794 | |||
| 1150 | Ga0207690_10038365 | |||
| 1151 | Ga0207690_10231868 | |||
| 1152 | Ga0207690_11318112 | |||
| 1153 | Ga0207706_10024437 | |||
| 1154 | Ga0207706_10055523 | |||
| 1155 | Ga0207706_10986069 | |||
| 1156 | Ga0207686_10020992 | |||
| 1157 | Ga0207686_10967353 | |||
| 1158 | Ga0207709_10006589 | |||
| 1159 | Ga0207709_10024537 | |||
| 1160 | Ga0207709_10598392 | |||
| 1161 | Ga0207669_10027065 | |||
| 1162 | Ga0207669_10283600 | |||
| 1163 | Ga0207669_10694209 | |||
| 1164 | Ga0207669_11008132 | |||
| 1165 | Ga0207704_10009496 | |||
| 1166 | Ga0207704_11059989 | |||
| 1167 | Ga0207665_10004341 | |||
| 1168 | Ga0207665_10019278 | |||
| 1169 | Ga0207691_10012070 | |||
| 1170 | Ga0207691_10056012 | |||
| 1171 | Ga0207711_10048669 | |||
| 1172 | Ga0207689_10121793 | |||
| 1173 | Ga0207689_10214092 | |||
| 1174 | Ga0207661_10004390 | |||
| 1175 | Ga0207661_10008323 | |||
| 1176 | Ga0207661_10025210 | |||
| 1177 | Ga0207661_10474087 | |||
| 1178 | Ga0207661_11200653 | |||
| 1179 | Ga0207679_10280865 | |||
| 1180 | Ga0207679_10376285 | |||
| 1181 | Ga0207679_10672122 | |||
| 1182 | Ga0207679_10802136 | |||
| 1183 | Ga0207679_11921651 | |||
| 1184 | Ga0207667_10027576 | |||
| 1185 | Ga0207667_10048354 | |||
| 1186 | Ga0207667_10228697 | |||
| 1187 | Ga0207667_10302530 | |||
| 1188 | Ga0207651_10501578 | |||
| 1189 | Ga0207651_10595407 | |||
| 1190 | Ga0207651_11034503 | |||
| 1191 | Ga0207668_10635453 | |||
| 1192 | Ga0207640_10013370 | |||
| 1193 | Ga0207658_10156723 | |||
| 1194 | Ga0207658_11074400 | |||
| 1195 | Ga0207677_10052239 | |||
| 1196 | Ga0207703_10846506 | |||
| 1197 | Ga0207639_10004159 | |||
| 1198 | Ga0207639_10168482 | |||
| 1199 | Ga0207639_10922965 | |||
| 1200 | Ga0207678_10026025 | |||
| 1201 | Ga0207678_10501133 | |||
| 1202 | Ga0207708_10088736 | |||
| 1203 | Ga0207708_10283439 | |||
| 1204 | Ga0207708_10320189 | |||
| 1205 | Ga0207702_10006447 | |||
| 1206 | Ga0207702_11542110 | |||
| 1207 | Ga0207648_10056797 | |||
| 1208 | Ga0207648_10146792 | |||
| 1209 | Ga0207648_10381319 | |||
| 1210 | Ga0207676_10740717 | |||
| 1211 | Ga0207674_10000908 | |||
| 1212 | Ga0207674_10068814 | |||
| 1213 | Ga0207674_10180577 | |||
| 1214 | Ga0207674_10336264 | |||
| 1215 | Ga0207674_11428941 | |||
| 1216 | Ga0207683_10003261 | |||
| 1217 | Ga0207683_10143088 | |||
| 1218 | Ga0207683_11512645 | |||
| 1219 | Ga0207698_10003693 | |||
| 1220 | Ga0207698_10043082 | |||
| 1221 | Ga0207428_10000196 | |||
| 1222 | Ga0207428_10105489 | |||
| 1223 | Ga0268265_10341324 | |||
| 1224 | Ga0268264_10574236 | |||
| 1225 | Ga0265334_10021845 | |||
| 1226 | Ga0265318_10084152 | |||
| 1227 | Ga0265338_10011841 | |||
| 1228 | Ga0265338_10223519 | |||
| 1229 | Ga0265338_10427410 | |||
| 1230 | Ga0265332_10035849 | |||
| 1231 | Ga0265340_10188077 | |||
| 1232 | Ga0265327_10005943 | |||
| 1233 | Ga0265327_10031508 | |||
| 1234 | Ga0265327_10094757 | |||
| 1235 | Ga0265316_10009243 | |||
| 1236 | Ga0307408_100205568 | |||
| 1237 | Ga0307408_101775594 | |||
| 1238 | Ga0265314_10015582 | |||
| 1239 | Ga0265342_10022153 | |||
| 1240 | Ga0307410_10028827 | |||
| 1241 | Ga0307406_10050402 | |||
| 1242 | Ga0307406_10688106 | |||
| 1243 | Ga0307407_10006312 | |||
| 1244 | Ga0307412_10008378 | |||
| 1245 | Ga0307409_100029775 | |||
| 1246 | Ga0307409_100086349 | |||
| 1247 | Ga0307409_100296476 | |||
| 1248 | Ga0307416_100074817 | |||
| 1249 | Ga0307416_100299997 | |||
| 1250 | Ga0307416_100351275 | |||
| 1251 | Ga0307416_101473583 | |||
| 1252 | Ga0307414_10103059 | |||
| 1253 | Ga0307411_10005379 | |||
| 1254 | Ga0307415_100044505 | |||
| 1255 | Ga0373930_0046004 | |||
| 1256 | Ga0373958_0019363 | |||
| 1257 | Ga0373959_0016418 | |||
| 1258 | Ga0373926_0020105 | |||
| 1259 | Ga0373926_0130905 | |||
| 1260 | Ga0373929_0032866 | |||
| 1261 | Ga0373944_0034076 | |||
| 1262 | Ga0373944_0404396 | |||
| 1263 | Ga0373949_0003223 | |||
| 1264 | Ga0373952_0010253 | |||
| 1265 | Ga0373936_0002175 | |||
| 1266 | Ga0373936_0639975 | |||
| 1267 | Ga0373939_0103485 | |||
| 1268 | Ga0373939_0223339 | |||
| 1269 | Ga0373941_0105576 | |||
| 1270 | Ga0373945_0006186 | |||
| 1271 | Ga0373945_0021864 | |||
| 1272 | Ga0373943_0006651 | |||
| 1273 | Ga0373943_0045871 | |||
| 1274 | Ga0373943_0228180 | |||
| 1275 | Ga0373946_0037940 | |||
| 1276 | Ga0373946_0082053 | |||
| 1277 | Ga0373942_0022456 | |||
| 1278 | Ga0373961_0018428 | |||
| 1279 | Ga0373931_0149048 | |||
| 1280 | Ga0373931_0199933 | |||
| 1281 | Ga0373935_0070646 | |||
| 1282 | Ga0373927_0026206 | |||
| 1283 | Ga0373927_0122077 | |||
| 1284 | Ga0373947_0002323 | |||
| 1285 | Ga0373947_0006531 | |||
| 1286 | Ga0373947_0031564 | |||
| 1287 | Ga0373925_0005408 | |||
| 1288 | Ga0373925_0040621 | |||
| 1289 | Ga0373925_0073230 | |||
| 1290 | Ga0395899_0002477 | |||
| 1291 | Ga0395900_0003203 | |||
| 1292 | Ga0395900_0011833 | |||
| 1293 | Ga0395900_0017025 | |||
| 1294 | Ga0395900_0023261 | |||
| 1295 | Ga0395900_0025838 | |||
| 1296 | Ga0395900_0111228 | |||
| 1297 | Ga0395900_0917959 | |||
| 1298 | Ga0395900_1834881 | |||
| 1299 | Ga0395898_0003460 | |||
| 1300 | Ga0395898_0006664 | |||
| 1301 | Ga0395898_0040304 | |||
| 1302 | Ga0395898_0059292 | |||
| 1303 | Ga0395898_0099800 | |||
| 1304 | Ga0395898_0106519 | |||
| 1305 | Ga0395898_0324028 | |||
| 1306 | Ga0395898_1495342 | |||
| 1307 | Ga0395898_1620611 | |||
| 1308 | Ga0395905_0000568 | |||
| 1309 | Ga0395905_0022975 | |||
| 1310 | Ga0395905_0058215 | |||
| 1311 | Ga0395905_0099899 | |||
| 1312 | Ga0395905_0137375 | |||
| 1313 | Ga0395905_0416699 | |||
| 1314 | Ga0395901_0003134 | |||
| 1315 | Ga0395901_0006480 | |||
| 1316 | Ga0395901_0007746 | |||
| 1317 | Ga0395901_0021584 | |||
| 1318 | Ga0395901_0039014 | |||
| 1319 | Ga0395901_0241483 | |||
| 1320 | Ga0395901_0313505 | |||
| 1321 | Ga0395901_0467595 | |||
| 1322 | Ga0395901_0503809 | |||
| 1323 | Ga0395901_0537933 | |||
| 1324 | Ga0395901_0573132 | |||
| 1325 | Ga0395901_1269381 | |||
| 1326 | Ga0395901_2144784 | |||
| 1327 | Ga0436365_1309694 | |||
| 1328 | Ga0436365_1590357 | |||
| 1329 | Ga0436365_1645992 | |||
| 1330 | Ga0436360_0600304 | |||
| 1331 | Ga0436363_0474779 | |||
| 1332 | Ga0436363_1043056 | |||
| 1333 | Ga0436362_0795226 | |||
| 1334 | Ga0436362_0863784 | |||
| 1335 | Ga0451807_0559972 | |||
| 1336 | Ga0451807_2695406 | |||
| 1337 | Ga0451847_0526676 | |||
| 1338 | Ga0451851_0311280 | |||
| 1339 | Ga0439451_095896 | |||
| 1340 | Ga0450920_027224 | |||
| 1341 | Ga0450906_016764 | |||
| 1342 | Ga0439460_0136724 | |||
| 1343 | Ga0466965_0789457 | |||
| 1344 | Ga0466966_0002628 | |||
| 1345 | Ga0466966_0059879 | |||
| 1346 | Ga0466963_0021132 | |||
| 1347 | Ga0466963_0022468 | |||
| 1348 | Ga0466963_0110438 | |||
| 1349 | Ga0466963_0117871 | |||
| 1350 | Ga0466964_0013409 | |||
| 1351 | Ga0466964_0626680 | |||
| 1352 | Ga0466971_0092849 | |||
| 1353 | Ga0466968_0077628 | |||
| 1354 | Ga0466957_0096139 | |||
| 1355 | Ga0466957_0343419 | |||
| 1356 | Ga0466959_0000435 | |||
| 1357 | Ga0451576_0013003 | |||
| 1358 | Ga0451576_0411458 | |||
| 1359 | Ga0466967_0003034 | |||
| 1360 | Ga0466967_0009902 | |||
| 1361 | Ga0466967_0015693 | |||
| 1362 | Ga0466967_0021416 | |||
| 1363 | Ga0466967_0036149 | |||
| 1364 | Ga0466967_0054410 | |||
| 1365 | Ga0466967_0329528 | |||
| 1366 | Ga0466967_0382504 | |||
| 1367 | Ga0466967_0857054 | |||
| 1368 | Ga0466967_1874834 | |||
| 1369 | Ga0495592_0534939 | |||
| 1370 | Ga0495603_0008050 | |||
| 1371 | Ga0495603_0244515 | |||
| 1372 | Ga0495591_082904 | |||
| 1373 | Ga0495629_0000880 | |||
| 1374 | Ga0495629_0392454 | |||
| 1375 | Ga0495641_0000552 | |||
| 1376 | Ga0495641_0023759 | |||
| 1377 | Ga0495641_0138300 | |||
| 1378 | Ga0495653_0079703 | |||
| 1379 | Ga0495653_0628082 | |||
| 1380 | Ga0495580_0364784 | |||
| 1381 | Ga0495582_0000240 | |||
| 1382 | Ga0495582_0243312 | |||
| 1383 | Ga0495605_0042478 | |||
| 1384 | Ga0495605_0052876 | |||
| 1385 | Ga0495605_0075135 | |||
| 1386 | Ga0495639_0000921 | |||
| 1387 | Ga0495639_0097698 | |||
| 1388 | Ga0495662_0002056 | |||
| 1389 | Ga0495662_0097845 | |||
| 1390 | Ga0495662_0347433 | |||
| 1391 | Ga0495662_0582081 | |||
| 1392 | Ga0495584_0045758 | |||
| 1393 | Ga0495584_0413429 | |||
| 1394 | Ga0495594_0393734 | |||
| 1395 | Ga0495594_0554674 | |||
| 1396 | Ga0495596_0277680 | |||
| 1397 | Ga0495583_0258679 | |||
| 1398 | Ga0495608_0503259 | |||
| 1399 | Ga0495616_0126063 | |||
| 1400 | Ga0495618_0115788 | |||
| 1401 | Ga0495620_0067909 | |||
| 1402 | Ga0495628_0164400 | |||
| 1403 | Ga0495628_0620029 | |||
| 1404 | Ga0495630_0004569 | |||
| 1405 | Ga0495630_0023500 | |||
| 1406 | Ga0495630_0941337 | |||
| 1407 | Ga0495630_1150797 | |||
| 1408 | Ga0495637_0055098 | |||
| 1409 | Ga0495637_0058413 | |||
| 1410 | Ga0495637_0059009 | |||
| 1411 | Ga0495644_0042535 | |||
| 1412 | Ga0495663_0116679 | |||
| 1413 | Ga0495663_0132466 | |||
| 1414 | Ga0495666_0166611 | |||
| 1415 | Ga0495642_0103561 | |||
| 1416 | Ga0495652_0084917 | |||
| 1417 | Ga0495665_0000685 | |||
| 1418 | Ga0495665_0176357 | |||
| 1419 | Ga0495640_0141210 | |||
| 1420 | Ga0495586_0097032 | |||
| 1421 | Ga0495598_0009016 | |||
| 1422 | Ga0495609_0039123 | |||
| 1423 | Ga0495597_0076075 | |||
| 1424 | Ga0495667_0440134 | |||
| 1425 | Ga0495667_0688033 | |||
| 1426 | Ga0495656_0118444 | |||
| 1427 | Ga0495656_0158088 | |||
| 1428 | Ga0495656_0195269 | |||
| 1429 | Ga0495656_0264265 | |||
| 1430 | Ga0495656_0643913 | |||
| 1431 | Ga0495634_0040086 | |||
| 1432 | Ga0495634_0099953 | |||
| 1433 | Ga0495634_0529696 | |||
| 1434 | Ga0495611_0582781 | |||
| 1435 | Ga0495635_0185631 | |||
| 1436 | Ga0495635_0230776 | |||
| 1437 | Ga0495659_0049432 | |||
| 1438 | Ga0495659_0070793 | |||
| 1439 | Ga0495659_0198551 | |||
| 1440 | Ga0495661_0274858 | |||
| 1441 | Ga0495588_0176569 | |||
| 1442 | Ga0495588_0458185 | |||
| 1443 | Ga0495657_0092151 | |||
| 1444 | Ga0495657_0902272 | |||
| 1445 | Ga0495599_0234170 | |||
| 1446 | Ga0495623_0297505 | |||
| 1447 | Ga0495623_0331810 | |||
| 1448 | Ga0495646_0075818 | |||
| 1449 | Ga0495647_0064877 | |||
| 1450 | Ga0495647_0355671 | |||
| 1451 | Ga0495658_0000748 | |||
| 1452 | Ga0495658_0007224 | |||
| 1453 | Ga0495669_0010055 | |||
| 1454 | Ga0495669_0046327 | |||
| 1455 | Ga0495669_0139124 | |||
| 1456 | Ga0495613_0003539 | |||
| 1457 | Ga0495613_0068019 | |||
| 1458 | Ga0495624_0003367 | |||
| 1459 | Ga0495624_0742785 | |||
| 1460 | Ga0495670_0392093 | |||
| 1461 | Ga0495670_0565963 | |||
| 1462 | Ga0495649_0220557 | |||
| 1463 | Ga0495589_0085413 | |||
| 1464 | Ga0495600_0082102 | |||
| 1465 | Ga0495600_0499657 | |||
| 1466 | Ga0495660_0084759 | |||
| 1467 | Ga0495660_0114285 | |||
| 1468 | Ga0495581_0000754 | |||
| 1469 | Ga0495581_0009125 | |||
| 1470 | Ga0495604_0040460 | |||
| 1471 | Ga0495674_0114605 | |||
| 1472 | Ga0495674_0173960 | |||
| 1473 | Ga0495674_0192628 | |||
| 1474 | Ga0495674_0570754 | |||
| 1475 | Ga0495676_0000116 | |||
| 1476 | Ga0495676_0041281 | |||
| 1477 | Ga0495676_0431137 | |||
| 1478 | Ga0495680_0016577 | |||
| 1479 | Ga0495680_0065797 | |||
| 1480 | Ga0495680_0555387 | |||
| 1481 | Ga0495675_0270477 | |||
| 1482 | Ga0495677_0053595 | |||
| 1483 | Ga0495677_0161390 | |||
| 1484 | Ga0495681_0313862 | |||
| 1485 | Ga0495684_0009574 | |||
| 1486 | Ga0495684_0013921 | |||
| 1487 | Ga0495684_0439210 | |||
| 1488 | Ga0495684_0872654 | |||
| 1489 | Ga0495686_0000008 | |||
| 1490 | Ga0495593_0001321 | |||
| 1491 | Ga0495593_0201840 | |||
| 1492 | Ga0495614_0011682 | |||
| 1493 | Ga0495614_0111009 | |||
| 1494 | Ga0495626_0100314 | |||
| 1495 | Ga0496100_0074139 | |||
| 1496 | Ga0496100_0442345 | |||
| 1497 | Ga0496100_0467128 | |||
| 1498 | Ga0496100_1363828 | |||
| 1499 | Ga0496101_0017939 | |||
| 1500 | Ga0496101_0149472 | |||
| 1501 | Ga0496101_0149823 | |||
| 1502 | Ga0496101_0250113 | |||
| 1503 | Ga0496101_0771402 | |||
| 1504 | Ga0496102_0007514 | |||
| 1505 | Ga0496102_0082066 | |||
| 1506 | Ga0496102_0197345 | |||
| 1507 | Ga0496103_0014063 | |||
| 1508 | Ga0496104_0002950 | |||
| 1509 | Ga0496104_0025579 | |||
| 1510 | Ga0496104_0096154 | |||
| 1511 | Ga0496104_0160845 | |||
| 1512 | Ga0496104_0473474 | |||
| 1513 | Ga0496104_0579691 | |||
| 1514 | Ga0496105_0005481 | |||
| 1515 | Ga0496105_0090879 | |||
| 1516 | Ga0496105_0098528 | |||
| 1517 | Ga0496106_0061677 | |||
| 1518 | Ga0496106_0474082 | |||
| 1519 | Ga0496106_0583865 | |||
| 1520 | Ga0496107_0023113 | |||
| 1521 | Ga0496107_1139089 | |||
| 1522 | Ga0496108_0389596 | |||
| 1523 | Ga0496108_0404629 | |||
| 1524 | Ga0496108_0666672 | |||
| 1525 | Ga0496108_1002165 | |||
| 1526 | Ga0496109_0129935 | |||
| 1527 | Ga0496109_0131966 | |||
| 1528 | Ga0496109_0155202 | |||
| 1529 | Ga0496109_0249902 | |||
| 1530 | Ga0496109_0584030 | |||
| 1531 | Ga0496109_0836322 | |||
| 1532 | Ga0496109_1686573 | |||
| 1533 | Ga0496110_0004582 | |||
| 1534 | Ga0496110_0006002 | |||
| 1535 | Ga0496110_0035999 | |||
| 1536 | Ga0496110_0193662 | |||
| 1537 | Ga0496110_0260794 | |||
| 1538 | Ga0496110_0535284 | |||
| 1539 | Ga0496110_0675633 | |||
| 1540 | Ga0496111_0000714 | |||
| 1541 | Ga0496111_0045482 | |||
| 1542 | Ga0496112_0017751 | |||
| 1543 | Ga0496112_0019660 | |||
| 1544 | Ga0496112_0145987 | |||
| 1545 | Ga0496112_0275741 | |||
| 1546 | Ga0496113_0139436 | |||
| 1547 | Ga0496113_0192023 | |||
| 1548 | Ga0496113_0355608 | |||
| 1549 | Ga0496114_0025914 | |||
| 1550 | Ga0496114_0039353 | |||
| 1551 | Ga0496114_0071618 | |||
| 1552 | Ga0496114_0072801 | |||
| 1553 | Ga0496114_0157733 | |||
| 1554 | Ga0496114_0571175 | |||
| 1555 | Ga0496115_0032869 | |||
| 1556 | Ga0496115_0072063 | |||
| 1557 | Ga0496115_0073089 | |||
| 1558 | Ga0496115_0275566 | |||
| 1559 | Ga0496115_0381335 | |||
| 1560 | Ga0496115_0448039 | |||
| 1561 | Ga0501291_092589 | |||
| 1562 | Ga0501031_0004013 | |||
| 1563 | Ga0501031_0137391 | |||
| 1564 | Ga0501031_0302058 | |||
| 1565 | Ga0501031_0970333 | |||
| 1566 | Ga0501032_0024945 | |||
| 1567 | Ga0501032_0137322 | |||
| 1568 | Ga0501033_0027299 | |||
| 1569 | Ga0501033_0464735 | |||
| 1570 | Ga0501034_0208451 | |||
| 1571 | Ga0501036_0000261 | |||
| 1572 | Ga0501036_0005893 | |||
| 1573 | Ga0501036_0086238 | |||
| 1574 | Ga0501036_0774440 | |||
| 1575 | Ga0501036_1674933 | |||
| 1576 | Ga0501037_0026288 | |||
| 1577 | Ga0501037_0190592 | |||
| 1578 | Ga0501037_0769356 | |||
| 1579 | Ga0501037_0854191 | |||
| 1580 | Ga0501038_0023050 | |||
| 1581 | Ga0501038_0081648 | |||
| 1582 | Ga0501038_0094569 | |||
| 1583 | Ga0501038_0364341 | |||
| 1584 | Ga0501039_0011079 | |||
| 1585 | Ga0501039_0026396 | |||
| 1586 | Ga0501039_0691977 | |||
| 1587 | Ga0501039_0770514 | |||
| 1588 | Ga0501040_0000344 | |||
| 1589 | Ga0501040_0195824 | |||
| 1590 | Ga0501040_0765727 | |||
| 1591 | Ga0501040_1169949 | |||
| 1592 | Ga0501040_1317346 | |||
| 1593 | Ga0501041_0001411 | |||
| 1594 | Ga0501041_0006031 | |||
| 1595 | Ga0501041_0092786 | |||
| 1596 | Ga0501041_0674737 | |||
| 1597 | Ga0501042_0000265 | |||
| 1598 | Ga0501042_0139579 | |||
| 1599 | Ga0501042_0190046 | |||
| 1600 | Ga0501042_0660584 | |||
| 1601 | Ga0501042_0720410 | |||
| 1602 | Ga0501042_0852186 | |||
| 1603 | Ga0501043_0368043 | |||
| 1604 | Ga0501043_0643354 | |||
| 1605 | Ga0501046_0001305 | |||
| 1606 | Ga0501046_0006023 | |||
| 1607 | Ga0501046_0082969 | |||
| 1608 | Ga0501046_0180111 | |||
| 1609 | Ga0501046_0192481 | |||
| 1610 | Ga0501046_0309655 | |||
| 1611 | Ga0501046_0325596 | |||
| 1612 | Ga0501047_0000626 | |||
| 1613 | Ga0501047_0165518 | |||
| 1614 | Ga0501048_0061476 | |||
| 1615 | Ga0501048_0121681 | |||
| 1616 | Ga0501048_0170089 | |||
| 1617 | Ga0501048_0623507 | |||
| 1618 | Ga0501067_0000208 | |||
| 1619 | Ga0501067_0013438 | |||
| 1620 | Ga0501067_0147031 | |||
| 1621 | Ga0501067_0168737 | |||
| 1622 | Ga0501068_0017059 | |||
| 1623 | Ga0501068_0033981 | |||
| 1624 | Ga0501068_0066233 | |||
| 1625 | Ga0501069_0000901 | |||
| 1626 | Ga0501069_0035587 | |||
| 1627 | Ga0501069_0067443 | |||
| 1628 | Ga0501070_0005080 | |||
| 1629 | Ga0501070_0067184 | |||
| 1630 | Ga0501070_0435656 | |||
| 1631 | Ga0501070_0475512 | |||
| 1632 | Ga0501070_0513897 | |||
| 1633 | Ga0501070_1173828 | |||
| 1634 | Ga0501071_0000430 | |||
| 1635 | Ga0501071_0101081 | |||
| 1636 | Ga0501071_0138107 | |||
| 1637 | Ga0501071_0204961 | |||
| 1638 | Ga0501071_0296679 | |||
| 1639 | Ga0501072_0000897 | |||
| 1640 | Ga0501072_0008013 | |||
| 1641 | Ga0501072_0451814 | |||
| 1642 | Ga0501072_0618420 | |||
| 1643 | Ga0501072_0731388 | |||
| 1644 | Ga0501072_0799019 | |||
| 1645 | Ga0501073_0357468 | |||
| 1646 | Ga0501073_0541459 | |||
| 1647 | Ga0501074_0019812 | |||
| 1648 | Ga0501074_0110593 | |||
| 1649 | Ga0501074_0209579 | |||
| 1650 | Ga0501075_0001217 | |||
| 1651 | Ga0501075_0012185 | |||
| 1652 | Ga0501075_0213797 | |||
| 1653 | Ga0501075_0695797 | |||
| 1654 | Ga0501076_0000330 | |||
| 1655 | Ga0501076_0003143 | |||
| 1656 | Ga0501076_0003676 | |||
| 1657 | Ga0501076_0077398 | |||
| 1658 | Ga0501076_0099466 | |||
| 1659 | Ga0501076_0112296 | |||
| 1660 | Ga0501076_0503340 | |||
| 1661 | Ga0501076_0730983 | |||
| 1662 | Ga0501076_1420149 | |||
| 1663 | Ga0501077_0002421 | |||
| 1664 | Ga0501077_0008570 | |||
| 1665 | Ga0501077_0347567 | |||
| 1666 | Ga0501077_0647952 | |||
| 1667 | Ga0501077_0811570 | |||
| 1668 | Ga0501202_013010 | |||
| 1669 | Ga0501079_0030332 | |||
| 1670 | Ga0501079_0296199 | |||
| 1671 | Ga0501079_0640027 | |||
| 1672 | Ga0501079_1367389 | |||
| 1673 | Ga0501080_0000229 | |||
| 1674 | Ga0501080_0011873 | |||
| 1675 | Ga0501080_0126577 | |||
| 1676 | Ga0501080_0543843 | |||
| 1677 | Ga0501080_0794982 | |||
| 1678 | Ga0501080_1141874 | |||
| 1679 | Ga0501081_0001194 | |||
| 1680 | Ga0501081_0014696 | |||
| 1681 | Ga0501081_0569123 | |||
| 1682 | Ga0501081_0617650 | |||
| 1683 | Ga0501081_0656179 | |||
| 1684 | Ga0501081_0974520 | |||
| 1685 | Ga0501083_0060454 | |||
| 1686 | Ga0501083_0376056 | |||
| 1687 | Ga0501083_0419644 | |||
| 1688 | Ga0501035_0014888 | |||
| 1689 | Ga0501035_0041239 | |||
| 1690 | Ga0501035_0055632 | |||
| 1691 | Ga0501035_0716020 | |||
| 1692 | Ga0501035_0958680 | |||
| 1693 | Ga0501035_1451407 | |||
| 1694 | Ga0501044_0036435 | |||
| 1695 | Ga0501044_0685786 | |||
| 1696 | Ga0501044_1202437 | |||
| 1697 | Ga0501045_0000784 | |||
| 1698 | Ga0501045_0002106 | |||
| 1699 | Ga0501045_0547023 | |||
| 1700 | nmdc:mga00v17_406743_c1 | |||
| 1701 | nmdc:mga05p37_17839_c1 | |||
| 1702 | nmdc:mga09592_13054_c1 | |||
| 1703 | nmdc:mga09592_440909_c1 | |||
| 1704 | nmdc:mga06r32_321459_c1 | |||
| 1705 | nmdc:mga08y16_22195_c1 | |||
| 1706 | nmdc:mga08y16_25978_c1 | |||
| 1707 | nmdc:mga08y16_318462_c1 | |||
| 1708 | nmdc:mga0n895_1717573_c1 | |||
| 1709 | nmdc:mga0rr50_113920_c1 | |||
| 1710 | nmdc:mga0rr50_521026_c1 | |||
| 1711 | nmdc:mga0a205_171875_c1 | |||
| 1712 | Ga0495601_0029046 | |||
| 1713 | Ga0495601_0564203 | |||
| 1714 | Ga0495655_0122949 | |||
| 1715 | Ga0495595_0041335 | |||
| 1716 | Ga0495595_0309145 | |||
| 1717 | Ga0495595_0386186 | |||
| 1718 | Ga0495619_0017348 | |||
| 1719 | Ga0495619_0156365 | |||
| 1720 | Ga0495619_0481271 | |||
| 1721 | Ga0501084_0000982 | |||
| 1722 | Ga0501084_0001732 | |||
| 1723 | Ga0501084_0005384 | |||
| 1724 | Ga0501084_0194739 | |||
| 1725 | Ga0501084_0652068 | |||
| 1726 | Ga0501084_0801616 | |||
| 1727 | Ga0501084_1114147 | |||
| 1728 | Ga0501084_1387061 | |||
| 1729 | Ga0501082_0003519 | |||
| 1730 | Ga0501082_0035686 | |||
| 1731 | Ga0501082_0655498 | |||
| 1732 | Ga0501082_0781169 | |||
| 1733 | Ga0501082_1647279 | |||
| 1734 | Ga0466962_0145108 | |||
| 1735 | Ga0530510_0006712 | |||
| 1736 | Ga0530510_0056602 | |||
| 1737 | Ga0530510_0159086 | |||
| 1738 | Ga0530510_0694871 | |||
| 1739 | Ga0530510_0729563 | |||
| 1740 | Ga0530510_1415848 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.8179 | 1 | 123 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.8138 | 1 | 124 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.8017 | 1 | 124 |
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.7999 | 1 | 123 |
| 1xm5-assembly1.cif.gz_A | crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 | 0.7972 | 1 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8629 | 3 | 122 | 3.40.390.30 |
| af_Q4DNU0_12_187_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.842 | 17 | 124 | 3.40.390.30 |
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8236 | 3 | 122 | 3.40.390.30 |
| 1oz9A00 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8179 | 1 | 123 | 3.40.390.30 |
| af_A4IA97_11_196_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8089 | 13 | 123 | 3.40.390.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538CZG4-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9899 | 1 | 125 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A1Q6XH06-F1-model_v4 | rRNA maturation RNase YbeY | 0.977 | 14 | 125 |
GO:0004222
GO:0004519 GO:0006364 GO:0046872 |
| AF-A0A538KXI9-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9714 | 2 | 125 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A1Q6XH06-F1-model_v4 | rRNA maturation RNase YbeY | 0.9685 | 14 | 125 |
GO:0004222
GO:0004519 GO:0006364 GO:0046872 |
| AF-A0A538KXI9-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9563 | 2 | 125 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |