F484123

General Info

Members Datasets Scaffolds Average Seq Length
869 567 1738 214

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0283256|Ga0373947_0283256_50_694
Length 214
Sequence MPSYRLHYFPESGNSYKLALMLTLCGQRFEPVWTDFGGGVTRTPEWRRDVNEMGEIPVLEVDGERLTQTAPILLKLAKQFGRFGGETEQEQFELLRWLFWDNHKLTGYMATYRYYRFTPSPDEHVLKHFRRRLDDFLSILDQHMQKNAFAIGERPTVADISMMAYLHYPADETGYDLAASHPAINAWLGRMAQLPGWKSAYDLLPGKRLTHYAK

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
106 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
107 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
177 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
350 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
356 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
357 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
362 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
363 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
364 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
365 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
368 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
369 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
370 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
376 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
377 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
378 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
379 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
382 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
385 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
386 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
389 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
390 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
391 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
392 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
393 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
394 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
395 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
396 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
397 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
398 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
399 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
400 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
401 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
402 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
403 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
404 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
405 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
406 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
407 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
408 2791355199
409 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
410 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
411 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
412 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
413 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
414 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
415 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
416 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
417 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
418 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
419 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
420 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
421 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
422 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
423 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
424 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
425 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
426 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
427 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
428 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
429 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
430 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
431 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
432 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
433 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
434 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
435 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
436 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
437 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
438 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
439 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
440 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
441 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
442 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
443 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
444 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
445 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
446 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
447 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
448 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
449 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
450 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
451 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
452 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
453 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
454 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
455 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
456 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
457 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
458 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
459 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
460 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
461 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
462 2904699407
463 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
464 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
465 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
466 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
467 2922368715
468 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
469 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
470 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
471 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
472 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
473 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
474 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
475 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
476 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
477 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
478 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
479 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
480 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
481 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
482 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
483 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
484 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
485 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
486 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
487 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
488 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
489 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
490 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
491 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
492 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
493 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
494 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
495 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
496 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
497 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
498 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
499 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
500 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
501 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
502 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
503 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
504 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
505 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
506 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
507 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
508 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
509 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
510 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
511 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
512 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
513 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
514 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
515 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
516 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
517 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
518 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
519 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
520 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
521 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
522 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
523 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
524 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
525 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
526 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
527 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
528 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
529 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
530 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
531 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
532 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
533 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
534 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
535 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
536 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
537 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
538 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
539 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
540 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
541 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
542 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
543 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
544 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
545 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
546 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
547 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
548 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
549 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
550 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
551 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
552 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
553 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
554 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
555 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
556 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
557 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
558 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
559 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
560 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
561 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
562 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
563 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
564 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
565 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
566 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
567 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.68
Metatranscriptomes 0
Isolates 20.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 16.92
Rhizoplane 4.03
Rhizosphere 53.86
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0283256 3300035725 Bacteria 1102
2 JGI25406J46586_10003527 3300003203 Bacteria 7346
3 JGI25153J46596_10000804 3300003215 Bacteria 19173
4 JGI25153J46596_10004657 3300003215 Bacteria 7334
5 JGI25160J50197_1002140 3300003354 Bacteria 9355
6 JGI25404J52841_10027158 3300003659 Bacteria 1231
7 Ga0055526_1054969 3300003771 Bacteria 881
8 Ga0055531_10006037 3300003794 Bacteria 6946
9 Ga0065165_1001866 3300005262 Bacteria 20445
10 Ga0065165_1008097 3300005262 Bacteria 5009
11 Ga0065165_1035680 3300005262 Bacteria 1524
12 Ga0070658_10033074 3300005327 Bacteria 4159
13 Ga0068869_100170554 3300005334 Bacteria 1699
14 Ga0068869_100290784 3300005334 Bacteria 1316
15 Ga0070666_10132953 3300005335 Bacteria 1729
16 Ga0070682_100102760 3300005337 Bacteria 1889
17 Ga0070682_100488034 3300005337 Bacteria 952
18 Ga0068868_100589577 3300005338 Bacteria 984
19 Ga0070692_10493867 3300005345 Bacteria 792
20 Ga0070668_100020794 3300005347 Bacteria 4957
21 Ga0070668_100118161 3300005347 Bacteria 2116
22 Ga0070668_100674838 3300005347 Bacteria 910
23 Ga0070675_100488937 3300005354 Bacteria 1108
24 Ga0070671_100523024 3300005355 Bacteria 1022
25 Ga0070674_100040739 3300005356 Bacteria 3144
26 Ga0070673_100157353 3300005364 Bacteria 1929
27 Ga0070688_100147476 3300005365 Bacteria 1605
28 Ga0070659_100711827 3300005366 Bacteria 869
29 Ga0070667_100256472 3300005367 Bacteria 1565
30 Ga0070667_100312928 3300005367 Bacteria 1416
31 Ga0070667_100321186 3300005367 Bacteria 1397
32 Ga0070714_100006900 3300005435 Bacteria 8804
33 Ga0070713_100012599 3300005436 Bacteria 6210
34 Ga0070713_100022059 3300005436 Bacteria 4913
35 Ga0070713_100249746 3300005436 Bacteria 1618
36 Ga0070710_10000985 3300005437 Bacteria 13535
37 Ga0070701_10298426 3300005438 Bacteria 990
38 Ga0070711_100001389 3300005439 Bacteria 13224
39 Ga0070708_100454697 3300005445 Bacteria 1208
40 Ga0070663_100060619 3300005455 Bacteria 2722
41 Ga0070663_100156032 3300005455 Bacteria 1754
42 Ga0070663_100179694 3300005455 Bacteria 1640
43 Ga0070663_100234029 3300005455 Bacteria 1448
44 Ga0070663_100336872 3300005455 Bacteria 1217
45 Ga0070678_100079797 3300005456 Bacteria 2476
46 Ga0070678_100200987 3300005456 Bacteria 1645
47 Ga0070678_100329377 3300005456 Bacteria 1306
48 Ga0070678_100369869 3300005456 Bacteria 1237
49 Ga0070678_100830848 3300005456 Bacteria 840
50 Ga0070662_100282941 3300005457 Bacteria 1343
51 Ga0068867_100620255 3300005459 Bacteria 945
52 Ga0070698_100220956 3300005471 Bacteria 1828
53 Ga0070698_100470934 3300005471 Bacteria 1192
54 Ga0070679_100062148 3300005530 Bacteria 3723
55 Ga0070684_100481424 3300005535 Bacteria 1149
56 Ga0068853_100061443 3300005539 Bacteria 3250
57 Ga0068853_100062766 3300005539 Bacteria 3216
58 Ga0068853_100753632 3300005539 Bacteria 931
59 Ga0070672_100307103 3300005543 Bacteria 1346
60 Ga0070672_100663062 3300005543 Bacteria 912
61 Ga0070686_100011677 3300005544 Bacteria 4989
62 Ga0070695_100622364 3300005545 Bacteria 850
63 Ga0070665_100009974 3300005548 Bacteria 9607
64 Ga0070665_100014483 3300005548 Bacteria 7909
65 Ga0070665_100032611 3300005548 Bacteria 5242
66 Ga0070665_100152481 3300005548 Bacteria 2313
67 Ga0068855_100060656 3300005563 Bacteria 4422
68 Ga0070664_100209469 3300005564 Bacteria 1742
69 Ga0070664_100339270 3300005564 Bacteria 1365
70 Ga0068854_100098850 3300005578 Bacteria 2185
71 Ga0068854_100183312 3300005578 Bacteria 1637
72 Ga0068856_100000255 3300005614 Bacteria 58233
73 Ga0068856_100260153 3300005614 Bacteria 1751
74 Ga0068856_100660647 3300005614 Bacteria 1066
75 Ga0068852_100284107 3300005616 Bacteria 1596
76 Ga0068859_100066697 3300005617 Bacteria 3634
77 Ga0068859_100208030 3300005617 Bacteria 2042
78 Ga0068864_100300146 3300005618 Bacteria 1503
79 Ga0068864_101006792 3300005618 Bacteria 827
80 Ga0068866_10058854 3300005718 Bacteria 1986
81 Ga0068861_100047153 3300005719 Bacteria 3251
82 Ga0068861_100050843 3300005719 Bacteria 3144
83 Ga0068861_100063396 3300005719 Bacteria 2841
84 Ga0068870_10097789 3300005840 Bacteria 1653
85 Ga0068863_100185758 3300005841 Bacteria 1996
86 Ga0068863_100362732 3300005841 Bacteria 1413
87 Ga0068858_100030954 3300005842 Bacteria 4969
88 Ga0068858_100099285 3300005842 Bacteria 2714
89 Ga0068860_100004336 3300005843 Bacteria 14502
90 Ga0068860_100071820 3300005843 Bacteria 3288
91 Ga0068860_100145233 3300005843 Bacteria 2282
92 Ga0068860_100171966 3300005843 Bacteria 2093
93 Ga0068860_100908756 3300005843 Bacteria 897
94 Ga0068862_100124897 3300005844 Bacteria 2271
95 Ga0068862_100247422 3300005844 Bacteria 1623
96 Ga0068862_100546608 3300005844 Bacteria 1105
97 Ga0081455_10007311 3300005937 Bacteria 11650
98 Ga0081455_10012691 3300005937 Bacteria 8385
99 Ga0081455_10032995 3300005937 Bacteria 4657
100 Ga0081455_10051396 3300005937 Bacteria 3536
101 Ga0081455_10095512 3300005937 Bacteria 2399
102 Ga0081540_1001944 3300005983 Bacteria 17290
103 Ga0081540_1004361 3300005983 Bacteria 10821
104 Ga0081540_1011877 3300005983 Bacteria 5783
105 Ga0081540_1022136 3300005983 Bacteria 3757
106 Ga0081539_10000040 3300005985 Bacteria 292753
107 Ga0081539_10001677 3300005985 Bacteria 35838
108 Ga0081539_10030460 3300005985 Bacteria 3348
109 Ga0081539_10061754 3300005985 Bacteria 2051
110 Ga0070717_10008052 3300006028 Bacteria 7858
111 Ga0070717_10010552 3300006028 Bacteria 6979
112 Ga0070717_10205250 3300006028 Bacteria 1728
113 Ga0070717_10424673 3300006028 Bacteria 1196
114 Ga0075365_10011730 3300006038 Bacteria 5166
115 Ga0075365_10024598 3300006038 Bacteria 3801
116 Ga0075365_10217777 3300006038 Bacteria 1339
117 Ga0075365_10367564 3300006038 Bacteria 1014
118 Ga0075365_10410399 3300006038 Bacteria 956
119 Ga0075368_10008747 3300006042 Bacteria 3621
120 Ga0075363_100003286 3300006048 Bacteria 6845
121 Ga0075363_100082799 3300006048 Bacteria 1757
122 Ga0075364_10015563 3300006051 Bacteria 4718
123 Ga0075432_10065193 3300006058 Bacteria 1302
124 Ga0070715_10006919 3300006163 Bacteria 3880
125 Ga0070715_10075894 3300006163 Unclassified 1513
126 Ga0070716_100007630 3300006173 Bacteria 5336
127 Ga0070712_100023469 3300006175 Bacteria 4076
128 Ga0070712_100108350 3300006175 Bacteria 2068
129 Ga0070712_100445273 3300006175 Unclassified 1078
130 Ga0075367_10042303 3300006178 Bacteria 2665
131 Ga0075367_10098661 3300006178 Bacteria 1784
132 Ga0075369_10032355 3300006186 Bacteria 2213
133 Ga0075369_10043597 3300006186 Bacteria 1925
134 Ga0075366_10143462 3300006195 Bacteria 1444
135 Ga0097621_100038292 3300006237 Bacteria 3847
136 Ga0075370_10029169 3300006353 Bacteria 3071
137 Ga0075370_10085263 3300006353 Bacteria 1819
138 Ga0075370_10120530 3300006353 Bacteria 1527
139 Ga0075370_10147584 3300006353 Bacteria 1377
140 Ga0068871_100046261 3300006358 Bacteria 3504
141 Ga0075428_100063057 3300006844 Bacteria 4058
142 Ga0068865_100024442 3300006881 Bacteria 3964
143 Ga0097620_100066697 3300006931 Bacteria 3634
144 Ga0097620_100208030 3300006931 Bacteria 2042
145 Ga0097620_100403676 3300006931 Bacteria 1463
146 Ga0099824_1013587 3300006942 Bacteria 8401
147 Ga0099824_1036725 3300006942 Bacteria 1403
148 Ga0075435_100090961 3300007076 Bacteria 2518
149 Ga0099795_10055835 3300007788 Bacteria 1451
150 Ga0099795_10225523 3300007788 Bacteria 799
151 Ga0105240_10013504 3300009093 Bacteria 11216
152 Ga0105240_10192405 3300009093 Bacteria 2398
153 Ga0111539_10044589 3300009094 Bacteria 5312
154 Ga0105245_10236223 3300009098 Bacteria 1770
155 Ga0105245_10321124 3300009098 Bacteria 1525
156 Ga0105247_10013762 3300009101 Bacteria 4851
157 Ga0105247_10136710 3300009101 Bacteria 1602
158 Ga0105247_10263927 3300009101 Bacteria 1182
159 Ga0105247_10656921 3300009101 Bacteria 784
160 Ga0114129_10923858 3300009147 Bacteria 1104
161 Ga0105243_10260205 3300009148 Bacteria 1553
162 Ga0105243_10398700 3300009148 Bacteria 1277
163 Ga0105243_10573475 3300009148 Bacteria 1082
164 Ga0105241_10403616 3300009174 Bacteria 1199
165 Ga0105242_10116776 3300009176 Bacteria 2283
166 Ga0105242_10229592 3300009176 Bacteria 1663
167 Ga0105248_10061314 3300009177 Bacteria 4223
168 Ga0105248_10784766 3300009177 Bacteria 1075
169 Ga0105237_10147096 3300009545 Bacteria 2351
170 Ga0105237_10376023 3300009545 Bacteria 1425
171 Ga0105238_10043160 3300009551 Bacteria 4563
172 Ga0105249_10064778 3300009553 Bacteria 3361
173 Ga0105249_10352847 3300009553 Bacteria 1490
174 Ga0105239_10026747 3300010375 Bacteria 6349
175 Ga0105239_10310861 3300010375 Bacteria 1776
176 Ga0105239_10565041 3300010375 Bacteria 1296
177 Ga0105239_10945532 3300010375 Bacteria 990
178 Ga0105239_11087767 3300010375 Bacteria 920
179 Ga0105239_11407271 3300010375 Bacteria 805
180 Ga0105246_10192099 3300011119 Bacteria 1581
181 Ga0105246_10316956 3300011119 Bacteria 1265
182 Ga0157370_10435431 3300013104 Bacteria 1206
183 Ga0157369_10204879 3300013105 Bacteria 2069
184 Ga0157374_10048242 3300013296 Bacteria 3951
185 Ga0157378_10146820 3300013297 Bacteria 2194
186 Ga0157378_10908582 3300013297 Bacteria 911
187 Ga0163162_10372304 3300013306 Bacteria 1561
188 Ga0163162_10609782 3300013306 Bacteria 1217
189 Ga0157375_10359141 3300013308 Bacteria 1623
190 Ga0157375_10742026 3300013308 Bacteria 1134
191 Ga0163163_10048542 3300014325 Bacteria 4175
192 Ga0163163_10214613 3300014325 Bacteria 1973
193 Ga0163163_11166738 3300014325 Bacteria 833
194 Ga0157380_10090664 3300014326 Bacteria 2522
195 Ga0157380_10093935 3300014326 Bacteria 2481
196 Ga0157377_10047764 3300014745 Bacteria 2399
197 Ga0157377_10059988 3300014745 Bacteria 2171
198 Ga0157379_10063838 3300014968 Bacteria 3292
199 Ga0157376_10026550 3300014969 Bacteria 4578
200 Ga0157376_10974515 3300014969 Bacteria 869
201 Ga0163161_10456015 3300017792 Bacteria 1034
202 Ga0214544_1000578 3300021320 Bacteria 68951
203 Ga0214544_1024853 3300021320 Bacteria 3004
204 Ga0214542_1000338 3300021321 Bacteria 80765
205 Ga0214545_1000186 3300021324 Bacteria 80765
206 Ga0214543_1000271 3300021327 Bacteria 80766
207 Ga0214543_1042400 3300021327 Bacteria 1137
208 Ga0213875_10061645 3300021388 Bacteria 1754
209 Ga0209563_104543 3300025230 Bacteria 2638
210 Ga0207425_1023400 3300025245 Bacteria 1293
211 Ga0209677_108790 3300025253 Bacteria 1900
212 Ga0209148_1000527 3300025254 Bacteria 37706
213 Ga0209675_1001588 3300025291 Bacteria 12846
214 Ga0209564_1003631 3300025295 Bacteria 10246
215 Ga0209564_1012578 3300025295 Bacteria 3676
216 Ga0209758_1000109 3300025297 Bacteria 214759
217 Ga0209758_1000416 3300025297 Bacteria 72312
218 Ga0209758_1001031 3300025297 Bacteria 36557
219 Ga0209758_1003256 3300025297 Bacteria 15056
220 Ga0209758_1009629 3300025297 Bacteria 5958
221 Ga0209256_1003527 3300025299 Bacteria 10889
222 Ga0207426_1000635 3300025302 Bacteria 44397
223 Ga0207426_1035153 3300025302 Bacteria 1601
224 Ga0207426_1059526 3300025302 Bacteria 1104
225 Ga0209257_1000781 3300025304 Bacteria 46905
226 Ga0209257_1050194 3300025304 Bacteria 1182
227 Ga0207697_10035121 3300025315 Bacteria 2052
228 Ga0207692_10006957 3300025898 Bacteria 4614
229 Ga0207692_10021510 3300025898 Bacteria 2952
230 Ga0207642_10381049 3300025899 Bacteria 839
231 Ga0207710_10046840 3300025900 Bacteria 1931
232 Ga0207710_10172366 3300025900 Bacteria 1058
233 Ga0207688_10015147 3300025901 Bacteria 4183
234 Ga0207647_10093723 3300025904 Bacteria 1789
235 Ga0207685_10012791 3300025905 Bacteria 2574
236 Ga0207685_10041407 3300025905 Unclassified 1723
237 Ga0207699_10190679 3300025906 Bacteria 1383
238 Ga0207645_10025822 3300025907 Bacteria 3800
239 Ga0207643_10105920 3300025908 Bacteria 1653
240 Ga0207684_10284184 3300025910 Bacteria 1427
241 Ga0207684_10344333 3300025910 Bacteria 1284
242 Ga0207654_10073291 3300025911 Bacteria 2040
243 Ga0207654_10165564 3300025911 Bacteria 1431
244 Ga0207654_10180878 3300025911 Bacteria 1376
245 Ga0207707_10106035 3300025912 Bacteria 2456
246 Ga0207695_10000556 3300025913 Bacteria 76837
247 Ga0207695_10151240 3300025913 Bacteria 2260
248 Ga0207671_10006195 3300025914 Bacteria 10740
249 Ga0207671_10139473 3300025914 Bacteria 1867
250 Ga0207693_10005960 3300025915 Bacteria 10111
251 Ga0207693_10050407 3300025915 Bacteria 3269
252 Ga0207663_10000089 3300025916 Bacteria 43605
253 Ga0207660_10056400 3300025917 Bacteria 2811
254 Ga0207662_10060531 3300025918 Bacteria 2271
255 Ga0207657_10092431 3300025919 Bacteria 2521
256 Ga0207649_10121739 3300025920 Bacteria 1760
257 Ga0207694_10914184 3300025924 Bacteria 742
258 Ga0207650_10342905 3300025925 Bacteria 1227
259 Ga0207659_10409138 3300025926 Bacteria 1136
260 Ga0207687_10148047 3300025927 Bacteria 1788
261 Ga0207700_10004769 3300025928 Bacteria 8042
262 Ga0207700_10166132 3300025928 Bacteria 1836
263 Ga0207700_10248808 3300025928 Bacteria 1518
264 Ga0207664_10046793 3300025929 Bacteria 3397
265 Ga0207664_10180757 3300025929 Bacteria 1811
266 Ga0207664_10226326 3300025929 Bacteria 1624
267 Ga0207644_10321198 3300025931 Bacteria 1252
268 Ga0207644_10528195 3300025931 Bacteria 975
269 Ga0207706_10029690 3300025933 Bacteria 4880
270 Ga0207706_10142275 3300025933 Bacteria 2110
271 Ga0207706_10433813 3300025933 Bacteria 1138
272 Ga0207686_10318457 3300025934 Bacteria 1161
273 Ga0207709_10031727 3300025935 Bacteria 3089
274 Ga0207709_10215778 3300025935 Bacteria 1380
275 Ga0207669_10089343 3300025937 Bacteria 2000
276 Ga0207704_10399860 3300025938 Bacteria 1084
277 Ga0207665_10000550 3300025939 Bacteria 25283
278 Ga0207665_10292055 3300025939 Bacteria 1216
279 Ga0207665_10570754 3300025939 Bacteria 881
280 Ga0207691_10304301 3300025940 Bacteria 1369
281 Ga0207711_10079924 3300025941 Bacteria 2855
282 Ga0207711_10305908 3300025941 Bacteria 1467
283 Ga0207689_10107133 3300025942 Bacteria 2297
284 Ga0207689_10161012 3300025942 Bacteria 1849
285 Ga0207689_10168531 3300025942 Bacteria 1805
286 Ga0207679_10281187 3300025945 Bacteria 1427
287 Ga0207667_10026502 3300025949 Bacteria 6332
288 Ga0207651_10057524 3300025960 Bacteria 2682
289 Ga0207651_10530720 3300025960 Bacteria 1021
290 Ga0207712_10071431 3300025961 Bacteria 2496
291 Ga0207668_10022562 3300025972 Bacteria 4032
292 Ga0207668_10336042 3300025972 Bacteria 1258
293 Ga0207640_10028796 3300025981 Bacteria 3401
294 Ga0207640_10208830 3300025981 Bacteria 1486
295 Ga0207658_10154494 3300025986 Bacteria 1874
296 Ga0207658_10237201 3300025986 Bacteria 1543
297 Ga0207677_10008866 3300026023 Bacteria 5638
298 Ga0207703_10032981 3300026035 Bacteria 4102
299 Ga0207703_10071983 3300026035 Bacteria 2857
300 Ga0207703_10426210 3300026035 Bacteria 1235
301 Ga0207703_10510464 3300026035 Bacteria 1129
302 Ga0207639_10404414 3300026041 Bacteria 1230
303 Ga0207678_10014738 3300026067 Bacteria 6879
304 Ga0207678_10027275 3300026067 Bacteria 4980
305 Ga0207678_10096298 3300026067 Bacteria 2529
306 Ga0207678_10131280 3300026067 Bacteria 2137
307 Ga0207678_10251361 3300026067 Bacteria 1514
308 Ga0207678_10453538 3300026067 Bacteria 1115
309 Ga0207702_10000390 3300026078 Bacteria 50020
310 Ga0207702_10107555 3300026078 Bacteria 2474
311 Ga0207702_10122555 3300026078 Bacteria 2329
312 Ga0207702_10413577 3300026078 Bacteria 1303
313 Ga0207702_10875742 3300026078 Bacteria 889
314 Ga0207641_10583706 3300026088 Bacteria 1093
315 Ga0207648_10014289 3300026089 Bacteria 7338
316 Ga0207648_10324616 3300026089 Bacteria 1384
317 Ga0207676_10196924 3300026095 Bacteria 1777
318 Ga0207674_10029338 3300026116 Bacteria 5791
319 Ga0207674_10266858 3300026116 Bacteria 1659
320 Ga0207675_100049801 3300026118 Bacteria 3908
321 Ga0207675_100119496 3300026118 Bacteria 2493
322 Ga0207683_10042375 3300026121 Bacteria 3976
323 Ga0207683_10062406 3300026121 Bacteria 3282
324 Ga0207683_10065293 3300026121 Bacteria 3208
325 Ga0207683_10077842 3300026121 Bacteria 2937
326 Ga0207683_10165765 3300026121 Bacteria 1999
327 Ga0207698_10169346 3300026142 Bacteria 1921
328 Ga0207698_10344299 3300026142 Bacteria 1405
329 Ga0209389_1000045 3300027296 Bacteria 118598
330 Ga0209389_1000407 3300027296 Bacteria 25557
331 Ga0209589_1004020 3300027357 Bacteria 25558
332 Ga0209489_100110 3300027361 Bacteria 117680
333 Ga0209489_100210 3300027361 Bacteria 96217
334 Ga0209700_100116 3300027363 Bacteria 115661
335 Ga0209588_1039988 3300027671 Bacteria 1513
336 Ga0268266_10084213 3300028379 Bacteria 2776
337 Ga0268265_10231714 3300028380 Bacteria 1623
338 Ga0268265_10388951 3300028380 Bacteria 1285
339 Ga0268265_10503624 3300028380 Bacteria 1141
340 Ga0268264_10000403 3300028381 Bacteria 61631
341 Ga0268264_10000429 3300028381 Bacteria 58174
342 Ga0268264_10274856 3300028381 Bacteria 1575
343 Ga0307515_10023103 3300028794 Bacteria 10921
344 Ga0307515_10264488 3300028794 Bacteria 1451
345 Ga0307515_10341912 3300028794 Bacteria 1148
346 Ga0307515_10417035 3300028794 Bacteria 964
347 Ga0265328_10035807 3300031239 Bacteria 1835
348 Ga0265325_10011557 3300031241 Bacteria 5072
349 Ga0265340_10169407 3300031247 Bacteria 990
350 Ga0265339_10004022 3300031249 Bacteria 10163
351 Ga0265331_10138568 3300031250 Bacteria 1107
352 Ga0307513_10024180 3300031456 Bacteria 7074
353 Ga0307513_10308046 3300031456 Bacteria 1347
354 Ga0307508_10416655 3300031616 Bacteria 935
355 Ga0265314_10003812 3300031711 Bacteria 14407
356 Ga0307516_10021548 3300031730 Bacteria 6627
357 Ga0307516_10070433 3300031730 Bacteria 3360
358 Ga0307405_10403468 3300031731 Bacteria 1071
359 Ga0307405_10488843 3300031731 Bacteria 984
360 Ga0307410_10053108 3300031852 Bacteria 2741
361 Ga0307409_100167209 3300031995 Bacteria 1931
362 Ga0307416_100867056 3300032002 Bacteria 1002
363 Ga0307411_10371106 3300032005 Bacteria 1174
364 Ga0307415_100038263 3300032126 Bacteria 3160
365 Ga0307510_10009024 3300033180 Bacteria 11872
366 Ga0307510_10016162 3300033180 Bacteria 8815
367 Ga0307510_10096315 3300033180 Bacteria 2775
368 Ga0373923_0070198 3300035111 Bacteria 1503
369 Ga0373936_0064189 3300035113 Bacteria 1504
370 Ga0373939_0051108 3300035114 Bacteria 1284
371 Ga0373943_0000900 3300035170 Bacteria 13105
372 Ga0373935_0001140 3300035692 Bacteria 14517
373 Ga0373927_0001032 3300035695 Bacteria 21199
374 Ga0373933_0291660 3300035724 Bacteria 1055
375 Ga0373947_0001159 3300035725 Bacteria 16176
376 Ga0373937_0071190 3300036401 Bacteria 3207
377 Ga0373937_0084191 3300036401 Bacteria 2942
378 Ga0373925_0002484 3300037068 Bacteria 14744
379 Ga0395905_0000548 3300037471 Bacteria 51350
380 Ga0395905_0528292 3300037471 Bacteria 1080
381 Ga0436364_0694903 3300037853 Bacteria 6346
382 Ga0436365_1163705 3300039437 Bacteria 855
383 Ga0436360_0362594 3300039438 Bacteria 865
384 Ga0436363_1027013 3300039450 Bacteria 2598
385 Ga0451791_0937200 3300041451 Bacteria 2153
386 Ga0451791_1898257 3300041451 Bacteria 1237
387 Ga0451797_0057169 3300041453 Bacteria 1751
388 Ga0451800_0572312 3300041459 Bacteria 715
389 Ga0451833_0058416 3300041491 Bacteria 823
390 Ga0451839_0669925 3300041496 Bacteria 885
391 Ga0451841_0120060 3300041498 Bacteria 1319
392 Ga0451845_0200458 3300041501 Bacteria 754
393 Ga0451849_0708481 3300041505 Bacteria 1038
394 Ga0451855_0785138 3300041511 Bacteria 730
395 Ga0466969_0039684 3300044656 Bacteria 2363
396 Ga0466966_0000149 3300044684 Bacteria 44757
397 Ga0466961_0070318 3300044693 Bacteria 2222
398 Ga0466963_0122602 3300044694 Bacteria 1790
399 Ga0466960_0078574 3300044901 Bacteria 1657
400 Ga0466959_0014967 3300045049 Bacteria 5653
401 Ga0466959_0403313 3300045049 Bacteria 929
402 Ga0466967_0069841 3300045976 Bacteria 3141
403 Ga0466967_0071471 3300045976 Bacteria 3107
404 Ga0495617_055929 3300046452 Bacteria 1308
405 Ga0495592_0044212 3300046454 Bacteria 3329
406 Ga0495603_0000209 3300046455 Bacteria 30220
407 Ga0495603_0028194 3300046455 Bacteria 3387
408 Ga0495603_0050822 3300046455 Bacteria 2464
409 Ga0495603_0072684 3300046455 Bacteria 2021
410 Ga0495629_0001586 3300046459 Bacteria 17875
411 Ga0495629_0015792 3300046459 Bacteria 5422
412 Ga0495641_0106682 3300046461 Bacteria 1250
413 Ga0495651_0002862 3300046462 Bacteria 13364
414 Ga0495651_0080751 3300046462 Bacteria 2456
415 Ga0495653_0053929 3300046463 Bacteria 3074
416 Ga0495580_0001676 3300046472 Bacteria 19446
417 Ga0495582_0000152 3300046473 Bacteria 37542
418 Ga0495582_0325323 3300046473 Bacteria 885
419 Ga0495605_0093533 3300046474 Bacteria 1390
420 Ga0495639_0000087 3300046475 Bacteria 44546
421 Ga0495664_0025112 3300046477 Bacteria 3468
422 Ga0495584_0138113 3300046491 Bacteria 1237
423 Ga0495585_0066161 3300046492 Bacteria 1979
424 Ga0495585_0211946 3300046492 Bacteria 981
425 Ga0495585_0229301 3300046492 Bacteria 934
426 Ga0495594_0000129 3300046499 Bacteria 35623
427 Ga0495594_0012879 3300046499 Bacteria 4361
428 Ga0495594_0136923 3300046499 Bacteria 1388
429 Ga0495607_0139673 3300046501 Bacteria 1251
430 Ga0495607_0147766 3300046501 Bacteria 1206
431 Ga0495606_0052828 3300046507 Bacteria 2639
432 Ga0495606_0191334 3300046507 Bacteria 1173
433 Ga0495608_0102977 3300046511 Bacteria 1840
434 Ga0495610_0142445 3300046512 Bacteria 1030
435 Ga0495616_0095806 3300046513 Bacteria 1398
436 Ga0495620_0031193 3300046515 Bacteria 2445
437 Ga0495628_0013637 3300046516 Bacteria 6830
438 Ga0495628_0230719 3300046516 Bacteria 1388
439 Ga0495628_0541555 3300046516 Bacteria 837
440 Ga0495628_0550136 3300046516 Bacteria 829
441 Ga0495630_0010943 3300046517 Bacteria 6555
442 Ga0495631_0103288 3300046518 Bacteria 1226
443 Ga0495643_0068158 3300046522 Bacteria 1873
444 Ga0495643_0129071 3300046522 Bacteria 1271
445 Ga0495644_0089475 3300046523 Bacteria 1162
446 Ga0495644_0123310 3300046523 Bacteria 986
447 Ga0495644_0173119 3300046523 Bacteria 829
448 Ga0495648_0027645 3300046524 Bacteria 3793
449 Ga0495666_0013319 3300046526 Bacteria 4101
450 Ga0495666_0036784 3300046526 Bacteria 2384
451 Ga0495652_0014738 3300046529 Bacteria 7009
452 Ga0495652_0176795 3300046529 Bacteria 1642
453 Ga0495654_0090057 3300046530 Bacteria 1425
454 Ga0495665_0000124 3300046531 Bacteria 36916
455 Ga0495665_0328268 3300046531 Bacteria 781
456 Ga0495640_0006588 3300046533 Bacteria 9171
457 Ga0495640_0054387 3300046533 Bacteria 2742
458 Ga0495640_0121459 3300046533 Bacteria 1698
459 Ga0495587_0058129 3300046536 Bacteria 2272
460 Ga0495587_0085434 3300046536 Bacteria 1827
461 Ga0495609_0085440 3300046538 Bacteria 1376
462 Ga0495645_0153053 3300046543 Bacteria 1600
463 Ga0495622_0008334 3300046557 Bacteria 4802
464 Ga0495622_0077481 3300046557 Bacteria 1532
465 Ga0495633_0024748 3300046558 Bacteria 2963
466 Ga0495667_0004129 3300046559 Bacteria 9766
467 Ga0495656_0011310 3300046615 Bacteria 3274
468 Ga0495656_0018319 3300046615 Bacteria 2686
469 Ga0495656_0026931 3300046615 Bacteria 2292
470 Ga0495656_0048014 3300046615 Bacteria 1812
471 Ga0495656_0239296 3300046615 Bacteria 913
472 Ga0495668_0084785 3300046616 Bacteria 1737
473 Ga0495634_0000599 3300046642 Bacteria 34949
474 Ga0495634_0019453 3300046642 Bacteria 4825
475 Ga0495625_0098448 3300046660 Bacteria 2012
476 Ga0495625_0110893 3300046660 Bacteria 1875
477 Ga0495625_0151026 3300046660 Bacteria 1562
478 Ga0495625_0272977 3300046660 Bacteria 1090
479 Ga0495635_0003181 3300046663 Bacteria 11316
480 Ga0495635_0020433 3300046663 Bacteria 4612
481 Ga0495635_0029033 3300046663 Bacteria 3845
482 Ga0495635_0079691 3300046663 Bacteria 2241
483 Ga0495659_0184159 3300046664 Bacteria 851
484 Ga0495588_0001335 3300046674 Bacteria 10537
485 Ga0495588_0009500 3300046674 Bacteria 4497
486 Ga0495657_0013894 3300046675 Bacteria 5921
487 Ga0495657_0184381 3300046675 Bacteria 1279
488 Ga0495657_0220835 3300046675 Bacteria 1149
489 Ga0495599_0022859 3300046678 Bacteria 3905
490 Ga0495599_0042747 3300046678 Bacteria 2844
491 Ga0495646_0030055 3300046680 Bacteria 3394
492 Ga0495647_0053070 3300046681 Bacteria 1580
493 Ga0495658_0001819 3300046683 Bacteria 10931
494 Ga0495669_0003485 3300046684 Bacteria 6487
495 Ga0495669_0110054 3300046684 Bacteria 1286
496 Ga0495613_0016955 3300046689 Bacteria 5423
497 Ga0495613_0045951 3300046689 Bacteria 3229
498 Ga0495624_0001738 3300046690 Bacteria 16643
499 Ga0495624_0071915 3300046690 Bacteria 2152
500 Ga0495624_0527015 3300046690 Bacteria 706
501 Ga0495670_0238261 3300046691 Bacteria 968
502 Ga0495670_0243177 3300046691 Bacteria 958
503 Ga0495589_0169423 3300046794 Bacteria 1038
504 Ga0495589_0176797 3300046794 Bacteria 1013
505 Ga0495600_0286463 3300046809 Bacteria 1042
506 Ga0495660_0233715 3300046810 Bacteria 860
507 Ga0495581_0000176 3300047315 Bacteria 29110
508 Ga0495604_0010452 3300047317 Bacteria 7354
509 Ga0495604_0028911 3300047317 Bacteria 4410
510 Ga0495604_0103157 3300047317 Bacteria 2093
511 Ga0495604_0127435 3300047317 Bacteria 1833
512 Ga0495636_0078257 3300047318 Bacteria 1420
513 Ga0495674_0002170 3300047319 Bacteria 19272
514 Ga0495674_0053358 3300047319 Bacteria 3554
515 Ga0495674_0099599 3300047319 Bacteria 2474
516 Ga0495672_0140337 3300047320 Bacteria 1263
517 Ga0495676_0005172 3300047321 Bacteria 11944
518 Ga0495676_0167654 3300047321 Bacteria 1548
519 Ga0495676_0266096 3300047321 Bacteria 1165
520 Ga0495676_0319621 3300047321 Bacteria 1043
521 Ga0495680_0176978 3300047322 Bacteria 1542
522 Ga0495675_0067186 3300047444 Bacteria 2265
523 Ga0495677_0059549 3300047445 Bacteria 1414
524 Ga0495685_066301 3300047447 Bacteria 1213
525 Ga0495673_0030354 3300047469 Bacteria 2539
526 Ga0495673_0042610 3300047469 Bacteria 2036
527 Ga0495684_0022619 3300047471 Bacteria 4834
528 Ga0495684_0073325 3300047471 Bacteria 2601
529 Ga0495686_0044204 3300047472 Bacteria 2820
530 Ga0495686_0095401 3300047472 Bacteria 1801
531 Ga0495593_0000022 3300047673 Bacteria 69741
532 Ga0495602_0004419 3300048088 Bacteria 14670
533 Ga0495602_0256428 3300048088 Bacteria 1300
534 Ga0496100_0114361 3300048903 Bacteria 1880
535 Ga0496101_0139166 3300048904 Bacteria 1849
536 Ga0496101_0237018 3300048904 Bacteria 1419
537 Ga0496102_0113576 3300048905 Bacteria 2527
538 Ga0496102_0184842 3300048905 Bacteria 1964
539 Ga0496103_0055994 3300048906 Bacteria 2447
540 Ga0496103_0079247 3300048906 Bacteria 2064
541 Ga0496104_0002297 3300048907 Bacteria 16493
542 Ga0496104_0363323 3300048907 Bacteria 1360
543 Ga0496104_0368431 3300048907 Bacteria 1349
544 Ga0496105_0011874 3300048908 Bacteria 6898
545 Ga0496105_0325858 3300048908 Bacteria 1230
546 Ga0496106_0050733 3300048909 Bacteria 3127
547 Ga0496106_0693086 3300048909 Bacteria 812
548 Ga0496107_0239976 3300048910 Bacteria 1349
549 Ga0496108_0043527 3300048911 Bacteria 3750
550 Ga0496108_0772658 3300048911 Bacteria 830
551 Ga0496109_0309086 3300048912 Bacteria 1491
552 Ga0496110_0052324 3300048913 Bacteria 3589
553 Ga0496110_0457130 3300048913 Bacteria 1163
554 Ga0496110_0714244 3300048913 Bacteria 904
555 Ga0496112_0000029 3300048915 Bacteria 122291
556 Ga0496112_0036843 3300048915 Bacteria 4772
557 Ga0496112_0178369 3300048915 Bacteria 2088
558 Ga0496112_0246812 3300048915 Bacteria 1737
559 Ga0496112_0982949 3300048915 Bacteria 764
560 Ga0496113_0029552 3300048916 Bacteria 3960
561 Ga0496113_0561323 3300048916 Bacteria 915
562 Ga0496114_0130984 3300048917 Bacteria 2166
563 Ga0496115_0264094 3300048918 Bacteria 1415
564 Ga0496115_0387101 3300048918 Bacteria 1136
565 Ga0496116_0141912 3300048919 Bacteria 1349
566 Ga0496118_0147270 3300048921 Bacteria 1480
567 Ga0496119_0018813 3300048922 Bacteria 5118
568 Ga0496119_0150670 3300048922 Bacteria 1247
569 Ga0496120_0037105 3300048923 Bacteria 2895
570 Ga0496121_0006171 3300048924 Bacteria 15033
571 Ga0496121_0028534 3300048924 Bacteria 5191
572 Ga0496121_0082066 3300048924 Bacteria 2550
573 Ga0496121_0120235 3300048924 Bacteria 1985
574 Ga0496121_0167721 3300048924 Bacteria 1598
575 Ga0496121_0243857 3300048924 Bacteria 1250
576 Ga0496121_0336235 3300048924 Bacteria 1011
577 Ga0496121_0336483 3300048924 Bacteria 1010
578 Ga0496121_0462115 3300048924 Bacteria 815
579 Ga0496122_0121296 3300048925 Bacteria 1685
580 Ga0496124_0075335 3300048927 Bacteria 2788
581 Ga0496125_0085715 3300048928 Bacteria 2386
582 Ga0496125_0085752 3300048928 Bacteria 2385
583 Ga0496125_0159594 3300048928 Bacteria 1534
584 Ga0496125_0190052 3300048928 Bacteria 1357
585 Ga0496126_0035912 3300048929 Bacteria 4639
586 Ga0496126_0038002 3300048929 Bacteria 4482
587 Ga0496126_0045539 3300048929 Bacteria 4031
588 Ga0496126_0045572 3300048929 Bacteria 4029
589 Ga0496126_0095750 3300048929 Bacteria 2603
590 Ga0496126_0097325 3300048929 Bacteria 2579
591 Ga0496126_0191140 3300048929 Bacteria 1734
592 Ga0496126_0296882 3300048929 Bacteria 1334
593 Ga0496126_0544582 3300048929 Bacteria 922
594 Ga0496126_0773073 3300048929 Bacteria 739
595 Ga0495682_0027171 3300049460 Bacteria 2123
596 Ga0495682_0122904 3300049460 Bacteria 929
597 Ga0501041_0310020 3300049577 Bacteria 995
598 Ga0501042_0051672 3300049578 Bacteria 2932
599 Ga0501071_0149651 3300049587 Bacteria 1741
600 Ga0501076_0119249 3300049592 Bacteria 2136
601 Ga0501035_0415264 3300049822 Bacteria 1118
602 Ga0501044_0391675 3300049823 Bacteria 1303
603 nmdc:mga03683_103566_c1 3300050489 Bacteria 1252
604 nmdc:mga03n38_198642_c1 3300050490 Bacteria 1037
605 nmdc:mga03n38_3956_c1 3300050490 Bacteria 4836
606 nmdc:mga00v17_347315_c1 3300050491 Bacteria 965
607 nmdc:mga0yw44_151523_c1 3300050492 Bacteria 1513
608 nmdc:mga0yw44_157718_c1 3300050492 Bacteria 1484
609 nmdc:mga0yw44_185898_c1 3300050492 Bacteria 1369
610 nmdc:mga0yw44_56080_c1 3300050492 Bacteria 2399
611 nmdc:mga0yw44_67821_c1 3300050492 Bacteria 2206
612 nmdc:mga07m45_12163_c1 3300050496 Bacteria 4121
613 nmdc:mga07m45_134268_c1 3300050496 Bacteria 1432
614 nmdc:mga07m45_16903_c1 3300050496 Bacteria 3910
615 nmdc:mga05p37_45558_c1 3300050507 Bacteria 5393
616 nmdc:mga0qj67_579559_c1 3300050509 Bacteria 898
617 nmdc:mga0n895_376704_c1 3300050512 Bacteria 1436
618 nmdc:mga0rr50_541282_c1 3300050513 Bacteria 991
619 nmdc:mga0a205_71136_c1 3300050515 Bacteria 3359
620 Ga0495601_0093391 3300053077 Bacteria 1938
621 Ga0495601_0441366 3300053077 Bacteria 842
622 Ga0500610_0168601 3300053079 Bacteria 1083
623 Ga0500635_0025469 3300053080 Bacteria 1864
624 Ga0495655_0068909 3300053083 Bacteria 984
625 Ga0495655_0133483 3300053083 Bacteria 767
626 Ga0500643_000013 3300053087 Bacteria 324296
627 Ga0500647_0006242 3300053091 Bacteria 5023
628 Ga0500647_0048439 3300053091 Bacteria 2043
629 Ga0500583_0154534 3300053092 Bacteria 1142
630 Ga0500566_0000281 3300053094 Bacteria 27613
631 Ga0500566_0002431 3300053094 Bacteria 11041
632 Ga0500566_0003668 3300053094 Bacteria 9167
633 Ga0500566_0092603 3300053094 Bacteria 1669
634 Ga0500566_0143549 3300053094 Bacteria 1264
635 Ga0500640_000538 3300053095 Bacteria 9592
636 Ga0500641_0023293 3300053096 Bacteria 2380
637 Ga0500556_0070268 3300053104 Bacteria 1306
638 Ga0500557_000070 3300053105 Bacteria 39472
639 Ga0500562_010585 3300053108 Bacteria 2340
640 Ga0500562_020378 3300053108 Bacteria 1721
641 Ga0500572_000288 3300053111 Bacteria 18169
642 Ga0500595_010468 3300053119 Bacteria 3685
643 Ga0500595_016884 3300053119 Bacteria 2709
644 Ga0500595_079437 3300053119 Bacteria 962
645 Ga0500607_024759 3300053121 Bacteria 3346
646 Ga0500608_158951 3300053122 Bacteria 981
647 Ga0500614_025543 3300053123 Bacteria 1405
648 Ga0500642_0000089 3300053130 Bacteria 47311
649 Ga0500655_024975 3300053133 Bacteria 1133
650 Ga0500658_0234016 3300053134 Bacteria 843
651 Ga0500658_0321128 3300053134 Bacteria 712
652 Ga0500559_0001168 3300053136 Bacteria 15761
653 Ga0500559_0020322 3300053136 Bacteria 2807
654 Ga0500559_0113448 3300053136 Bacteria 1257
655 Ga0500568_0139377 3300053139 Bacteria 899
656 Ga0500588_0230127 3300053146 Bacteria 693
657 Ga0500589_084481 3300053147 Bacteria 1411
658 Ga0500590_032501 3300053148 Bacteria 2707
659 Ga0500590_082378 3300053148 Bacteria 1578
660 Ga0500603_000279 3300053150 Bacteria 13473
661 Ga0500603_000677 3300053150 Bacteria 8300
662 Ga0500603_011697 3300053150 Bacteria 2003
663 Ga0500616_0003426 3300053153 Bacteria 12139
664 Ga0500616_0026961 3300053153 Bacteria 3176
665 Ga0500620_009123 3300053155 Bacteria 2545
666 Ga0500620_014907 3300053155 Bacteria 2184
667 Ga0500622_0068889 3300053156 Bacteria 1792
668 Ga0500627_0091920 3300053158 Bacteria 1358
669 Ga0500630_000525 3300053159 Bacteria 17180
670 Ga0500633_0056603 3300053160 Bacteria 1369
671 Ga0500633_0111603 3300053160 Bacteria 1013
672 Ga0500638_060690 3300053162 Bacteria 1818
673 Ga0500639_000013 3300053163 Bacteria 123899
674 Ga0500636_0000263 3300053177 Bacteria 29138
675 Ga0500636_0074190 3300053177 Bacteria 1969
676 Ga0500636_0250123 3300053177 Bacteria 904
677 Ga0500636_0382543 3300053177 Bacteria 659
678 Ga0500637_0000490 3300053178 Bacteria 15336
679 Ga0500637_0004706 3300053178 Bacteria 6521
680 Ga0500637_0344302 3300053178 Bacteria 796
681 Ga0500611_064218 3300053727 Bacteria 878
682 Ga0500625_013203 3300053729 Bacteria 3793
683 Ga0500645_007198 3300053730 Bacteria 3898
684 Ga0500645_031652 3300053730 Bacteria 1589
685 Ga0500596_005386 3300053735 Bacteria 2259
686 Ga0500599_018702 3300053736 Bacteria 970
687 Ga0500601_000145 3300053737 Bacteria 14635
688 Ga0501084_0669084 3300054114 Bacteria 876
689 Ga0500661_001026 3300055283 Bacteria 5265
690 Ga0500661_029215 3300055283 Bacteria 972
691 2507511751 2507262055 Bacteria 8048963
692 2508545416 2508501009 Bacteria 7784016
693 2508694233 2508501042 Bacteria 8719808
694 2511396068 2511231028 Bacteria 8046582
695 2513627283 2513237092 Bacteria 8341956
696 2513698203 2513237101 Bacteria 7952346
697 2513702672 2513237102 Bacteria 7703324
698 2513723915 2513237104 Bacteria 10034502
699 2513875172 2513237139 Bacteria 8737671
700 2513892320 2513237141 Bacteria 8496279
701 2514013315 2513237161 Bacteria 8871253
702 2515624841 2515154112 Bacteria 8294334
703 2517106090 2517093001 Bacteria 9002274
704 2528854581 2528768022 Bacteria 10457665
705 2617349493 2617270735 Bacteria 9163226
706 2617375125 2617270741 Bacteria 8201522
707 2723848529 2721755755 Bacteria 8322773
708 2745077382 2744054633 Bacteria 8678936
709 2793059764 2791355196 Bacteria 7323613
710 2793077595
711 2805919542 2802429603 Bacteria 8777136
712 2824609208 2824600985 Bacteria 8488197
713 2824616441 2824609381 Bacteria 8672835
714 2824626354 2824617872 Bacteria 8814715
715 2824633484 2824626560 Bacteria 8813858
716 2824643649 2824635225 Bacteria 8785348
717 2824652222 2824644064 Bacteria 8743947
718 2824661223 2824653114 Bacteria 8493680
719 2824675453 2824671348 Bacteria 8369588
720 2824686043 2824679649 Bacteria 8248951
721 2824692269 2824687955 Bacteria 8360029
722 2824699998 2824696289 Bacteria 8335049
723 2824713723 2824704595 Bacteria 9667483
724 2824722631 2824714736 Bacteria 8717648
725 2824732203 2824723954 Bacteria 8758240
726 2824738102 2824732956 Bacteria 7810675
727 2824750747 2824746037 Bacteria 7911610
728 2824761183 2824753945 Bacteria 9787441
729 2824770642 2824763712 Bacteria 9792355
730 2824777966 2824773399 Bacteria 8360218
731 2838128261 2838122688 Bacteria 8803140
732 2841942118 2841941048 Bacteria 8688029
733 2841955410 2841949485 Bacteria 8680857
734 2841971348 2841966195 Bacteria 8673214
735 2841982796 2841974524 Bacteria 8931498
736 2841987031 2841983080 Bacteria 8395090
737 2842042124 2842038055 Bacteria 8002051
738 2842050167 2842045827 Bacteria 8006841
739 2847932523 2847930680 Bacteria 9342022
740 2847943668 2847939898 Bacteria 8606328
741 2849077438 2849076700 Bacteria 7039503
742 2874593592 2874590934 Bacteria 8299676
743 2874606293 2874604998 Bacteria 7834745
744 2874617123 2874612657 Bacteria 8252029
745 2874625003 2874620515 Bacteria 8290088
746 2874633968 2874628541 Bacteria 8630250
747 2874648395 2874645413 Bacteria 8214782
748 2876774653 2876771140 Bacteria 8287509
749 2876818357 2876808645 Bacteria 8824342
750 2876821444 2876818435 Bacteria 8274608
751 2879079221 2879074833 Bacteria 8279565
752 2879090239 2879083081 Bacteria 8587928
753 2879102129 2879099564 Bacteria 10442239
754 2879113226 2879110137 Bacteria 8907982
755 2879131222 2879127579 Bacteria 8294491
756 2879144995 2879142872 Bacteria 8267021
757 2881667881 2881665667 Bacteria 8175609
758 2885374179 2885366525 Bacteria 8326213
759 2885415753 2885409591 Bacteria 9235467
760 2888391949 2888388044 Bacteria 7304136
761 2888426487 2888419890 Bacteria 7857137
762 2889036888 2889033259 Bacteria 9099371
763 2904669022 2904666416 Bacteria 8226587
764 2904699966
765 2904715644 2904711408 Bacteria 9771557
766 2906652289 2906643746 Bacteria 8722424
767 2908782591 2908775508 Bacteria 8092255
768 2922363707 2922361189 Bacteria 7436256
769 2922376971
770 2922389737 2922386360 Bacteria 7017218
771 2922396120 2922393267 Bacteria 8285685
772 2929620370 2929615660 Bacteria 9193770
773 2929632967 2929624759 Bacteria 9339455
774 2932790079 2932784394 Bacteria 9704911
775 2932799404 2932794094 Bacteria 7915132
776 2932802197 2932801729 Bacteria 7987968
777 2932817820 2932809354 Bacteria 9135765
778 2932823943 2932818245 Bacteria 9955613
779 2932833467 2932828146 Bacteria 9745859
780 2933582289 2933577622 Bacteria 9116884
781 2935613607 2935608549 Bacteria 8203142
782 2935621260 2935616580 Bacteria 9032984
783 2935643420 2935638405 Bacteria 10015038
784 2935650600 2935648319 Bacteria 8801166
785 2935661980 2935656913 Bacteria 8965014
786 2935671257 2935665750 Bacteria 9571747
787 2935681137 2935675223 Bacteria 9928132
788 2935689524 2935684952 Bacteria 9590419
789 2935700096 2935694250 Bacteria 9291695
790 2935710695 2935703347 Bacteria 10242284
791 2935720775 2935713505 Bacteria 9608509
792 2935727914 2935722832 Bacteria 9608746
793 2935737490 2935732158 Bacteria 9706831
794 2935746449 2935741537 Bacteria 9707219
795 2935757416 2935750917 Bacteria 9590372
796 2935763794 2935760218 Bacteria 9817913
797 2935772396 2935769743 Bacteria 7878163
798 2935781347 2935777560 Bacteria 8077691
799 2935787847 2935785616 Bacteria 7962367
800 2935793596 2935793552 Bacteria 8012592
801 2935807774 2935801545 Bacteria 9301974
802 2935818323 2935810662 Bacteria 9401221
803 2935824540 2935819856 Bacteria 8261050
804 2935832943 2935827899 Bacteria 10038562
805 2935844391 2935837841 Bacteria 9454360
806 2935851759 2935847175 Bacteria 8228321
807 2935859547 2935855204 Bacteria 9035059
808 2935871388 2935864058 Bacteria 9784707
809 2935879131 2935873716 Bacteria 9632195
810 2935889563 2935883170 Bacteria 7964738
811 2935911111 2935908558 Bacteria 8568796
812 2935920615 2935916978 Bacteria 9113783
813 2935928140 2935926038 Bacteria 8601059
814 2935937785 2935934488 Bacteria 8602579
815 2935945067 2935942939 Bacteria 8599779
816 2935954428 2935951376 Bacteria 8602333
817 2935971305 2935967501 Bacteria 8603075
818 2935983082 2935975950 Bacteria 8347125
819 2935991005 2935984226 Bacteria 8302647
820 2935996774 2935992306 Bacteria 9802711
821 2936008650 2936002035 Bacteria 9362176
822 2936016439 2936011229 Bacteria 8801034
823 2936024914 2936019824 Bacteria 8804134
824 2936033743 2936028420 Bacteria 8965941
825 2936044859 2936037263 Bacteria 9446081
826 2936050823 2936046547 Bacteria 8903709
827 2936061470 2936055302 Bacteria 8785755
828 2940563760 2940556831 Bacteria 9590747
829 2941537732 2941531003 Bacteria 7653939
830 2941542723 2941538514 Bacteria 9402094
831 3005487613 3005483717 Bacteria 7877331
832 3005507021 3005506211 Bacteria 6943378
833 3005592498 3005587118 Bacteria 7794411
834 3005601251 3005594810 Bacteria 8716512
835 3005716727 3005710791 Bacteria 7622528
836 3005723997 3005718088 Bacteria 8283608
837 8006926909 8006926726 Bacteria 6749210
838 8006968589 8006964411 Bacteria 8966052
839 8006988255 8006984368 Bacteria 9651211
840 8006999501 8006994254 Bacteria 8309700
841 8016519628 8016511872 Bacteria 9921665
842 8016524734 8016522445 Bacteria 8156687
843 8016538303 8016530956 Bacteria 8155261
844 8016542580 8016539877 Bacteria 8155419
845 8016550693 8016548790 Bacteria 8155074
846 8016559109 8016557553 Bacteria 8154380
847 8016567967 8016566248 Bacteria 8158151
848 8016580650 8016575299 Bacteria 8154085
849 8016597067 8016595262 Bacteria 8149947
850 8016607977 8016603502 Bacteria 8731218
851 8016624356 8016622563 Bacteria 7999408
852 8016637344 8016630954 Bacteria 9217207
853 8017065901 8017057580 Bacteria 10023680
854 8019537974 8019530166 Bacteria 8155624
855 8019551373 8019547302 Bacteria 7996444
856 8019578748 8019576017 Bacteria 10049540
857 8019596790 8019586578 Bacteria 10212056
858 8019604898 8019597564 Bacteria 10041141
859 8019613631 8019608314 Bacteria 10042931
860 8019624291 8019619141 Bacteria 9218857
861 8019637715 8019629233 Bacteria 8687553
862 8019653835 8019648815 Bacteria 10014479
863 8019665650 8019659431 Bacteria 8577854
864 8019675185 8019668869 Bacteria 8791617
865 8019680922 8019678201 Bacteria 8863603
866 8019694861 8019687851 Bacteria 8712826
867 8055749873 8055742211 Bacteria 9226248
868 8056676512 8056673599 Bacteria 7871253
869 8056969805 8056967851 Bacteria 9038162
870 Ga0373947_0283256
871 JGI25406J46586_10003527
872 JGI25153J46596_10000804
873 JGI25153J46596_10004657
874 JGI25160J50197_1002140
875 JGI25404J52841_10027158
876 Ga0055526_1054969
877 Ga0055531_10006037
878 Ga0065165_1001866
879 Ga0065165_1008097
880 Ga0065165_1035680
881 Ga0070658_10033074
882 Ga0068869_100170554
883 Ga0068869_100290784
884 Ga0070666_10132953
885 Ga0070682_100102760
886 Ga0070682_100488034
887 Ga0068868_100589577
888 Ga0070692_10493867
889 Ga0070668_100020794
890 Ga0070668_100118161
891 Ga0070668_100674838
892 Ga0070675_100488937
893 Ga0070671_100523024
894 Ga0070674_100040739
895 Ga0070673_100157353
896 Ga0070688_100147476
897 Ga0070659_100711827
898 Ga0070667_100256472
899 Ga0070667_100312928
900 Ga0070667_100321186
901 Ga0070714_100006900
902 Ga0070713_100012599
903 Ga0070713_100022059
904 Ga0070713_100249746
905 Ga0070710_10000985
906 Ga0070701_10298426
907 Ga0070711_100001389
908 Ga0070708_100454697
909 Ga0070663_100060619
910 Ga0070663_100156032
911 Ga0070663_100179694
912 Ga0070663_100234029
913 Ga0070663_100336872
914 Ga0070678_100079797
915 Ga0070678_100200987
916 Ga0070678_100329377
917 Ga0070678_100369869
918 Ga0070678_100830848
919 Ga0070662_100282941
920 Ga0068867_100620255
921 Ga0070698_100220956
922 Ga0070698_100470934
923 Ga0070679_100062148
924 Ga0070684_100481424
925 Ga0068853_100061443
926 Ga0068853_100062766
927 Ga0068853_100753632
928 Ga0070672_100307103
929 Ga0070672_100663062
930 Ga0070686_100011677
931 Ga0070695_100622364
932 Ga0070665_100009974
933 Ga0070665_100014483
934 Ga0070665_100032611
935 Ga0070665_100152481
936 Ga0068855_100060656
937 Ga0070664_100209469
938 Ga0070664_100339270
939 Ga0068854_100098850
940 Ga0068854_100183312
941 Ga0068856_100000255
942 Ga0068856_100260153
943 Ga0068856_100660647
944 Ga0068852_100284107
945 Ga0068859_100066697
946 Ga0068859_100208030
947 Ga0068864_100300146
948 Ga0068864_101006792
949 Ga0068866_10058854
950 Ga0068861_100047153
951 Ga0068861_100050843
952 Ga0068861_100063396
953 Ga0068870_10097789
954 Ga0068863_100185758
955 Ga0068863_100362732
956 Ga0068858_100030954
957 Ga0068858_100099285
958 Ga0068860_100004336
959 Ga0068860_100071820
960 Ga0068860_100145233
961 Ga0068860_100171966
962 Ga0068860_100908756
963 Ga0068862_100124897
964 Ga0068862_100247422
965 Ga0068862_100546608
966 Ga0081455_10007311
967 Ga0081455_10012691
968 Ga0081455_10032995
969 Ga0081455_10051396
970 Ga0081455_10095512
971 Ga0081540_1001944
972 Ga0081540_1004361
973 Ga0081540_1011877
974 Ga0081540_1022136
975 Ga0081539_10000040
976 Ga0081539_10001677
977 Ga0081539_10030460
978 Ga0081539_10061754
979 Ga0070717_10008052
980 Ga0070717_10010552
981 Ga0070717_10205250
982 Ga0070717_10424673
983 Ga0075365_10011730
984 Ga0075365_10024598
985 Ga0075365_10217777
986 Ga0075365_10367564
987 Ga0075365_10410399
988 Ga0075368_10008747
989 Ga0075363_100003286
990 Ga0075363_100082799
991 Ga0075364_10015563
992 Ga0075432_10065193
993 Ga0070715_10006919
994 Ga0070715_10075894
995 Ga0070716_100007630
996 Ga0070712_100023469
997 Ga0070712_100108350
998 Ga0070712_100445273
999 Ga0075367_10042303
1000 Ga0075367_10098661
1001 Ga0075369_10032355
1002 Ga0075369_10043597
1003 Ga0075366_10143462
1004 Ga0097621_100038292
1005 Ga0075370_10029169
1006 Ga0075370_10085263
1007 Ga0075370_10120530
1008 Ga0075370_10147584
1009 Ga0068871_100046261
1010 Ga0075428_100063057
1011 Ga0068865_100024442
1012 Ga0097620_100066697
1013 Ga0097620_100208030
1014 Ga0097620_100403676
1015 Ga0099824_1013587
1016 Ga0099824_1036725
1017 Ga0075435_100090961
1018 Ga0099795_10055835
1019 Ga0099795_10225523
1020 Ga0105240_10013504
1021 Ga0105240_10192405
1022 Ga0111539_10044589
1023 Ga0105245_10236223
1024 Ga0105245_10321124
1025 Ga0105247_10013762
1026 Ga0105247_10136710
1027 Ga0105247_10263927
1028 Ga0105247_10656921
1029 Ga0114129_10923858
1030 Ga0105243_10260205
1031 Ga0105243_10398700
1032 Ga0105243_10573475
1033 Ga0105241_10403616
1034 Ga0105242_10116776
1035 Ga0105242_10229592
1036 Ga0105248_10061314
1037 Ga0105248_10784766
1038 Ga0105237_10147096
1039 Ga0105237_10376023
1040 Ga0105238_10043160
1041 Ga0105249_10064778
1042 Ga0105249_10352847
1043 Ga0105239_10026747
1044 Ga0105239_10310861
1045 Ga0105239_10565041
1046 Ga0105239_10945532
1047 Ga0105239_11087767
1048 Ga0105239_11407271
1049 Ga0105246_10192099
1050 Ga0105246_10316956
1051 Ga0157370_10435431
1052 Ga0157369_10204879
1053 Ga0157374_10048242
1054 Ga0157378_10146820
1055 Ga0157378_10908582
1056 Ga0163162_10372304
1057 Ga0163162_10609782
1058 Ga0157375_10359141
1059 Ga0157375_10742026
1060 Ga0163163_10048542
1061 Ga0163163_10214613
1062 Ga0163163_11166738
1063 Ga0157380_10090664
1064 Ga0157380_10093935
1065 Ga0157377_10047764
1066 Ga0157377_10059988
1067 Ga0157379_10063838
1068 Ga0157376_10026550
1069 Ga0157376_10974515
1070 Ga0163161_10456015
1071 Ga0214544_1000578
1072 Ga0214544_1024853
1073 Ga0214542_1000338
1074 Ga0214545_1000186
1075 Ga0214543_1000271
1076 Ga0214543_1042400
1077 Ga0213875_10061645
1078 Ga0209563_104543
1079 Ga0207425_1023400
1080 Ga0209677_108790
1081 Ga0209148_1000527
1082 Ga0209675_1001588
1083 Ga0209564_1003631
1084 Ga0209564_1012578
1085 Ga0209758_1000109
1086 Ga0209758_1000416
1087 Ga0209758_1001031
1088 Ga0209758_1003256
1089 Ga0209758_1009629
1090 Ga0209256_1003527
1091 Ga0207426_1000635
1092 Ga0207426_1035153
1093 Ga0207426_1059526
1094 Ga0209257_1000781
1095 Ga0209257_1050194
1096 Ga0207697_10035121
1097 Ga0207692_10006957
1098 Ga0207692_10021510
1099 Ga0207642_10381049
1100 Ga0207710_10046840
1101 Ga0207710_10172366
1102 Ga0207688_10015147
1103 Ga0207647_10093723
1104 Ga0207685_10012791
1105 Ga0207685_10041407
1106 Ga0207699_10190679
1107 Ga0207645_10025822
1108 Ga0207643_10105920
1109 Ga0207684_10284184
1110 Ga0207684_10344333
1111 Ga0207654_10073291
1112 Ga0207654_10165564
1113 Ga0207654_10180878
1114 Ga0207707_10106035
1115 Ga0207695_10000556
1116 Ga0207695_10151240
1117 Ga0207671_10006195
1118 Ga0207671_10139473
1119 Ga0207693_10005960
1120 Ga0207693_10050407
1121 Ga0207663_10000089
1122 Ga0207660_10056400
1123 Ga0207662_10060531
1124 Ga0207657_10092431
1125 Ga0207649_10121739
1126 Ga0207694_10914184
1127 Ga0207650_10342905
1128 Ga0207659_10409138
1129 Ga0207687_10148047
1130 Ga0207700_10004769
1131 Ga0207700_10166132
1132 Ga0207700_10248808
1133 Ga0207664_10046793
1134 Ga0207664_10180757
1135 Ga0207664_10226326
1136 Ga0207644_10321198
1137 Ga0207644_10528195
1138 Ga0207706_10029690
1139 Ga0207706_10142275
1140 Ga0207706_10433813
1141 Ga0207686_10318457
1142 Ga0207709_10031727
1143 Ga0207709_10215778
1144 Ga0207669_10089343
1145 Ga0207704_10399860
1146 Ga0207665_10000550
1147 Ga0207665_10292055
1148 Ga0207665_10570754
1149 Ga0207691_10304301
1150 Ga0207711_10079924
1151 Ga0207711_10305908
1152 Ga0207689_10107133
1153 Ga0207689_10161012
1154 Ga0207689_10168531
1155 Ga0207679_10281187
1156 Ga0207667_10026502
1157 Ga0207651_10057524
1158 Ga0207651_10530720
1159 Ga0207712_10071431
1160 Ga0207668_10022562
1161 Ga0207668_10336042
1162 Ga0207640_10028796
1163 Ga0207640_10208830
1164 Ga0207658_10154494
1165 Ga0207658_10237201
1166 Ga0207677_10008866
1167 Ga0207703_10032981
1168 Ga0207703_10071983
1169 Ga0207703_10426210
1170 Ga0207703_10510464
1171 Ga0207639_10404414
1172 Ga0207678_10014738
1173 Ga0207678_10027275
1174 Ga0207678_10096298
1175 Ga0207678_10131280
1176 Ga0207678_10251361
1177 Ga0207678_10453538
1178 Ga0207702_10000390
1179 Ga0207702_10107555
1180 Ga0207702_10122555
1181 Ga0207702_10413577
1182 Ga0207702_10875742
1183 Ga0207641_10583706
1184 Ga0207648_10014289
1185 Ga0207648_10324616
1186 Ga0207676_10196924
1187 Ga0207674_10029338
1188 Ga0207674_10266858
1189 Ga0207675_100049801
1190 Ga0207675_100119496
1191 Ga0207683_10042375
1192 Ga0207683_10062406
1193 Ga0207683_10065293
1194 Ga0207683_10077842
1195 Ga0207683_10165765
1196 Ga0207698_10169346
1197 Ga0207698_10344299
1198 Ga0209389_1000045
1199 Ga0209389_1000407
1200 Ga0209589_1004020
1201 Ga0209489_100110
1202 Ga0209489_100210
1203 Ga0209700_100116
1204 Ga0209588_1039988
1205 Ga0268266_10084213
1206 Ga0268265_10231714
1207 Ga0268265_10388951
1208 Ga0268265_10503624
1209 Ga0268264_10000403
1210 Ga0268264_10000429
1211 Ga0268264_10274856
1212 Ga0307515_10023103
1213 Ga0307515_10264488
1214 Ga0307515_10341912
1215 Ga0307515_10417035
1216 Ga0265328_10035807
1217 Ga0265325_10011557
1218 Ga0265340_10169407
1219 Ga0265339_10004022
1220 Ga0265331_10138568
1221 Ga0307513_10024180
1222 Ga0307513_10308046
1223 Ga0307508_10416655
1224 Ga0265314_10003812
1225 Ga0307516_10021548
1226 Ga0307516_10070433
1227 Ga0307405_10403468
1228 Ga0307405_10488843
1229 Ga0307410_10053108
1230 Ga0307409_100167209
1231 Ga0307416_100867056
1232 Ga0307411_10371106
1233 Ga0307415_100038263
1234 Ga0307510_10009024
1235 Ga0307510_10016162
1236 Ga0307510_10096315
1237 Ga0373923_0070198
1238 Ga0373936_0064189
1239 Ga0373939_0051108
1240 Ga0373943_0000900
1241 Ga0373935_0001140
1242 Ga0373927_0001032
1243 Ga0373933_0291660
1244 Ga0373947_0001159
1245 Ga0373937_0071190
1246 Ga0373937_0084191
1247 Ga0373925_0002484
1248 Ga0395905_0000548
1249 Ga0395905_0528292
1250 Ga0436364_0694903
1251 Ga0436365_1163705
1252 Ga0436360_0362594
1253 Ga0436363_1027013
1254 Ga0451791_0937200
1255 Ga0451791_1898257
1256 Ga0451797_0057169
1257 Ga0451800_0572312
1258 Ga0451833_0058416
1259 Ga0451839_0669925
1260 Ga0451841_0120060
1261 Ga0451845_0200458
1262 Ga0451849_0708481
1263 Ga0451855_0785138
1264 Ga0466969_0039684
1265 Ga0466966_0000149
1266 Ga0466961_0070318
1267 Ga0466963_0122602
1268 Ga0466960_0078574
1269 Ga0466959_0014967
1270 Ga0466959_0403313
1271 Ga0466967_0069841
1272 Ga0466967_0071471
1273 Ga0495617_055929
1274 Ga0495592_0044212
1275 Ga0495603_0000209
1276 Ga0495603_0028194
1277 Ga0495603_0050822
1278 Ga0495603_0072684
1279 Ga0495629_0001586
1280 Ga0495629_0015792
1281 Ga0495641_0106682
1282 Ga0495651_0002862
1283 Ga0495651_0080751
1284 Ga0495653_0053929
1285 Ga0495580_0001676
1286 Ga0495582_0000152
1287 Ga0495582_0325323
1288 Ga0495605_0093533
1289 Ga0495639_0000087
1290 Ga0495664_0025112
1291 Ga0495584_0138113
1292 Ga0495585_0066161
1293 Ga0495585_0211946
1294 Ga0495585_0229301
1295 Ga0495594_0000129
1296 Ga0495594_0012879
1297 Ga0495594_0136923
1298 Ga0495607_0139673
1299 Ga0495607_0147766
1300 Ga0495606_0052828
1301 Ga0495606_0191334
1302 Ga0495608_0102977
1303 Ga0495610_0142445
1304 Ga0495616_0095806
1305 Ga0495620_0031193
1306 Ga0495628_0013637
1307 Ga0495628_0230719
1308 Ga0495628_0541555
1309 Ga0495628_0550136
1310 Ga0495630_0010943
1311 Ga0495631_0103288
1312 Ga0495643_0068158
1313 Ga0495643_0129071
1314 Ga0495644_0089475
1315 Ga0495644_0123310
1316 Ga0495644_0173119
1317 Ga0495648_0027645
1318 Ga0495666_0013319
1319 Ga0495666_0036784
1320 Ga0495652_0014738
1321 Ga0495652_0176795
1322 Ga0495654_0090057
1323 Ga0495665_0000124
1324 Ga0495665_0328268
1325 Ga0495640_0006588
1326 Ga0495640_0054387
1327 Ga0495640_0121459
1328 Ga0495587_0058129
1329 Ga0495587_0085434
1330 Ga0495609_0085440
1331 Ga0495645_0153053
1332 Ga0495622_0008334
1333 Ga0495622_0077481
1334 Ga0495633_0024748
1335 Ga0495667_0004129
1336 Ga0495656_0011310
1337 Ga0495656_0018319
1338 Ga0495656_0026931
1339 Ga0495656_0048014
1340 Ga0495656_0239296
1341 Ga0495668_0084785
1342 Ga0495634_0000599
1343 Ga0495634_0019453
1344 Ga0495625_0098448
1345 Ga0495625_0110893
1346 Ga0495625_0151026
1347 Ga0495625_0272977
1348 Ga0495635_0003181
1349 Ga0495635_0020433
1350 Ga0495635_0029033
1351 Ga0495635_0079691
1352 Ga0495659_0184159
1353 Ga0495588_0001335
1354 Ga0495588_0009500
1355 Ga0495657_0013894
1356 Ga0495657_0184381
1357 Ga0495657_0220835
1358 Ga0495599_0022859
1359 Ga0495599_0042747
1360 Ga0495646_0030055
1361 Ga0495647_0053070
1362 Ga0495658_0001819
1363 Ga0495669_0003485
1364 Ga0495669_0110054
1365 Ga0495613_0016955
1366 Ga0495613_0045951
1367 Ga0495624_0001738
1368 Ga0495624_0071915
1369 Ga0495624_0527015
1370 Ga0495670_0238261
1371 Ga0495670_0243177
1372 Ga0495589_0169423
1373 Ga0495589_0176797
1374 Ga0495600_0286463
1375 Ga0495660_0233715
1376 Ga0495581_0000176
1377 Ga0495604_0010452
1378 Ga0495604_0028911
1379 Ga0495604_0103157
1380 Ga0495604_0127435
1381 Ga0495636_0078257
1382 Ga0495674_0002170
1383 Ga0495674_0053358
1384 Ga0495674_0099599
1385 Ga0495672_0140337
1386 Ga0495676_0005172
1387 Ga0495676_0167654
1388 Ga0495676_0266096
1389 Ga0495676_0319621
1390 Ga0495680_0176978
1391 Ga0495675_0067186
1392 Ga0495677_0059549
1393 Ga0495685_066301
1394 Ga0495673_0030354
1395 Ga0495673_0042610
1396 Ga0495684_0022619
1397 Ga0495684_0073325
1398 Ga0495686_0044204
1399 Ga0495686_0095401
1400 Ga0495593_0000022
1401 Ga0495602_0004419
1402 Ga0495602_0256428
1403 Ga0496100_0114361
1404 Ga0496101_0139166
1405 Ga0496101_0237018
1406 Ga0496102_0113576
1407 Ga0496102_0184842
1408 Ga0496103_0055994
1409 Ga0496103_0079247
1410 Ga0496104_0002297
1411 Ga0496104_0363323
1412 Ga0496104_0368431
1413 Ga0496105_0011874
1414 Ga0496105_0325858
1415 Ga0496106_0050733
1416 Ga0496106_0693086
1417 Ga0496107_0239976
1418 Ga0496108_0043527
1419 Ga0496108_0772658
1420 Ga0496109_0309086
1421 Ga0496110_0052324
1422 Ga0496110_0457130
1423 Ga0496110_0714244
1424 Ga0496112_0000029
1425 Ga0496112_0036843
1426 Ga0496112_0178369
1427 Ga0496112_0246812
1428 Ga0496112_0982949
1429 Ga0496113_0029552
1430 Ga0496113_0561323
1431 Ga0496114_0130984
1432 Ga0496115_0264094
1433 Ga0496115_0387101
1434 Ga0496116_0141912
1435 Ga0496118_0147270
1436 Ga0496119_0018813
1437 Ga0496119_0150670
1438 Ga0496120_0037105
1439 Ga0496121_0006171
1440 Ga0496121_0028534
1441 Ga0496121_0082066
1442 Ga0496121_0120235
1443 Ga0496121_0167721
1444 Ga0496121_0243857
1445 Ga0496121_0336235
1446 Ga0496121_0336483
1447 Ga0496121_0462115
1448 Ga0496122_0121296
1449 Ga0496124_0075335
1450 Ga0496125_0085715
1451 Ga0496125_0085752
1452 Ga0496125_0159594
1453 Ga0496125_0190052
1454 Ga0496126_0035912
1455 Ga0496126_0038002
1456 Ga0496126_0045539
1457 Ga0496126_0045572
1458 Ga0496126_0095750
1459 Ga0496126_0097325
1460 Ga0496126_0191140
1461 Ga0496126_0296882
1462 Ga0496126_0544582
1463 Ga0496126_0773073
1464 Ga0495682_0027171
1465 Ga0495682_0122904
1466 Ga0501041_0310020
1467 Ga0501042_0051672
1468 Ga0501071_0149651
1469 Ga0501076_0119249
1470 Ga0501035_0415264
1471 Ga0501044_0391675
1472 nmdc:mga03683_103566_c1
1473 nmdc:mga03n38_198642_c1
1474 nmdc:mga03n38_3956_c1
1475 nmdc:mga00v17_347315_c1
1476 nmdc:mga0yw44_151523_c1
1477 nmdc:mga0yw44_157718_c1
1478 nmdc:mga0yw44_185898_c1
1479 nmdc:mga0yw44_56080_c1
1480 nmdc:mga0yw44_67821_c1
1481 nmdc:mga07m45_12163_c1
1482 nmdc:mga07m45_134268_c1
1483 nmdc:mga07m45_16903_c1
1484 nmdc:mga05p37_45558_c1
1485 nmdc:mga0qj67_579559_c1
1486 nmdc:mga0n895_376704_c1
1487 nmdc:mga0rr50_541282_c1
1488 nmdc:mga0a205_71136_c1
1489 Ga0495601_0093391
1490 Ga0495601_0441366
1491 Ga0500610_0168601
1492 Ga0500635_0025469
1493 Ga0495655_0068909
1494 Ga0495655_0133483
1495 Ga0500643_000013
1496 Ga0500647_0006242
1497 Ga0500647_0048439
1498 Ga0500583_0154534
1499 Ga0500566_0000281
1500 Ga0500566_0002431
1501 Ga0500566_0003668
1502 Ga0500566_0092603
1503 Ga0500566_0143549
1504 Ga0500640_000538
1505 Ga0500641_0023293
1506 Ga0500556_0070268
1507 Ga0500557_000070
1508 Ga0500562_010585
1509 Ga0500562_020378
1510 Ga0500572_000288
1511 Ga0500595_010468
1512 Ga0500595_016884
1513 Ga0500595_079437
1514 Ga0500607_024759
1515 Ga0500608_158951
1516 Ga0500614_025543
1517 Ga0500642_0000089
1518 Ga0500655_024975
1519 Ga0500658_0234016
1520 Ga0500658_0321128
1521 Ga0500559_0001168
1522 Ga0500559_0020322
1523 Ga0500559_0113448
1524 Ga0500568_0139377
1525 Ga0500588_0230127
1526 Ga0500589_084481
1527 Ga0500590_032501
1528 Ga0500590_082378
1529 Ga0500603_000279
1530 Ga0500603_000677
1531 Ga0500603_011697
1532 Ga0500616_0003426
1533 Ga0500616_0026961
1534 Ga0500620_009123
1535 Ga0500620_014907
1536 Ga0500622_0068889
1537 Ga0500627_0091920
1538 Ga0500630_000525
1539 Ga0500633_0056603
1540 Ga0500633_0111603
1541 Ga0500638_060690
1542 Ga0500639_000013
1543 Ga0500636_0000263
1544 Ga0500636_0074190
1545 Ga0500636_0250123
1546 Ga0500636_0382543
1547 Ga0500637_0000490
1548 Ga0500637_0004706
1549 Ga0500637_0344302
1550 Ga0500611_064218
1551 Ga0500625_013203
1552 Ga0500645_007198
1553 Ga0500645_031652
1554 Ga0500596_005386
1555 Ga0500599_018702
1556 Ga0500601_000145
1557 Ga0501084_0669084
1558 Ga0500661_001026
1559 Ga0500661_029215
1560 2507511751
1561 2508545416
1562 2508694233
1563 2511396068
1564 2513627283
1565 2513698203
1566 2513702672
1567 2513723915
1568 2513875172
1569 2513892320
1570 2514013315
1571 2515624841
1572 2517106090
1573 2528854581
1574 2617349493
1575 2617375125
1576 2723848529
1577 2745077382
1578 2793059764
1579 2793077595
1580 2805919542
1581 2824609208
1582 2824616441
1583 2824626354
1584 2824633484
1585 2824643649
1586 2824652222
1587 2824661223
1588 2824675453
1589 2824686043
1590 2824692269
1591 2824699998
1592 2824713723
1593 2824722631
1594 2824732203
1595 2824738102
1596 2824750747
1597 2824761183
1598 2824770642
1599 2824777966
1600 2838128261
1601 2841942118
1602 2841955410
1603 2841971348
1604 2841982796
1605 2841987031
1606 2842042124
1607 2842050167
1608 2847932523
1609 2847943668
1610 2849077438
1611 2874593592
1612 2874606293
1613 2874617123
1614 2874625003
1615 2874633968
1616 2874648395
1617 2876774653
1618 2876818357
1619 2876821444
1620 2879079221
1621 2879090239
1622 2879102129
1623 2879113226
1624 2879131222
1625 2879144995
1626 2881667881
1627 2885374179
1628 2885415753
1629 2888391949
1630 2888426487
1631 2889036888
1632 2904669022
1633 2904699966
1634 2904715644
1635 2906652289
1636 2908782591
1637 2922363707
1638 2922376971
1639 2922389737
1640 2922396120
1641 2929620370
1642 2929632967
1643 2932790079
1644 2932799404
1645 2932802197
1646 2932817820
1647 2932823943
1648 2932833467
1649 2933582289
1650 2935613607
1651 2935621260
1652 2935643420
1653 2935650600
1654 2935661980
1655 2935671257
1656 2935681137
1657 2935689524
1658 2935700096
1659 2935710695
1660 2935720775
1661 2935727914
1662 2935737490
1663 2935746449
1664 2935757416
1665 2935763794
1666 2935772396
1667 2935781347
1668 2935787847
1669 2935793596
1670 2935807774
1671 2935818323
1672 2935824540
1673 2935832943
1674 2935844391
1675 2935851759
1676 2935859547
1677 2935871388
1678 2935879131
1679 2935889563
1680 2935911111
1681 2935920615
1682 2935928140
1683 2935937785
1684 2935945067
1685 2935954428
1686 2935971305
1687 2935983082
1688 2935991005
1689 2935996774
1690 2936008650
1691 2936016439
1692 2936024914
1693 2936033743
1694 2936044859
1695 2936050823
1696 2936061470
1697 2940563760
1698 2941537732
1699 2941542723
1700 3005487613
1701 3005507021
1702 3005592498
1703 3005601251
1704 3005716727
1705 3005723997
1706 8006926909
1707 8006968589
1708 8006988255
1709 8006999501
1710 8016519628
1711 8016524734
1712 8016538303
1713 8016542580
1714 8016550693
1715 8016559109
1716 8016567967
1717 8016580650
1718 8016597067
1719 8016607977
1720 8016624356
1721 8016637344
1722 8017065901
1723 8019537974
1724 8019551373
1725 8019578748
1726 8019596790
1727 8019604898
1728 8019613631
1729 8019624291
1730 8019637715
1731 8019653835
1732 8019665650
1733 8019675185
1734 8019680922
1735 8019694861
1736 8055749873
1737 8056676512
1738 8056969805

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

87

0.94

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

103

200

0.9

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

123

190

0.89

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

12

79

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

104

195

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.8971 4 203
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8895 4 201
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.8845 4 203
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.8814 3 203
4f0c-assembly1.cif.gz_A-2 crystal structure of the glutathione transferase ure2p5 from phanerochaete chrysosporium 0.8806 1 197
ID Description Score Start End Superfamily
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9185 91 196 1.20.1050.130
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9121 85 196 1.20.1050.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9112 85 191 1.20.1050.10
af_Q5ZC86_103_225_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9052 85 196 1.20.1050.10
af_E1JJS1_124_267_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8998 86 192 1.20.1050.10
ID Description Score Start End GO Terms
AF-H0TM37-F1-model_v4 Putative Glutathione S-transferase 0.9621 1 214 GO:0016740
AF-A0A1N6I0Z3-F1-model_v4 deleted 0.9614 1 214
AF-A0A6J4P5P9-F1-model_v4 Maleylacetoacetate isomerase / Glutathione S-transferase (EC 5.2.1.2) 0.9605 65 212 GO:0016034
GO:0016740
AF-A0A1I3LSM8-F1-model_v4 Glutathione S-transferase 0.9578 1 212 GO:0016740
AF-H0TM37-F1-model_v4 Putative Glutathione S-transferase 0.9578 1 214 GO:0016740

Map