metagRoot

F484110

General Info

Members	Datasets	Scaffolds	Average Seq Length
869	548	644	168

Family's Representative Sequence

Representative Sequence	3300005340\|Ga0070689_100676291\|Ga0070689_1006762912
Length	201
Sequence	MSRASGCRYRDKGCAQAAGRLNGARPLYNFRMKIIGIAGFSGSGKTTLVEKVIPLLVAEGLRVSLIKHAHHEFDVDQPGKDSYRHRHAGASEVLVSSSKRWALMHELRGAAEPTLEDQLKQLSPCDVVLVEGYKTAPIPKVEVHRRDNTTPLLYPEDEHVVAVATDEALDTTLPQLDIDDAPAVARFIIQHLGLNRARLVR

Samples

	Sample ID	Description	Type	Environment
1	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
2	2509276019	Ensifer aridi TW10	Isolate	Nodule
3	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
4	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
5	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
6	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
7	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
8	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
9	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
10	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
11	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
12	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
13	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
14	2516143018	Ensifer sp. BR816	Isolate	Nodule
15	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
16	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
17	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
18	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
19	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
20	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
21	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
22	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
23	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
24	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
25	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
26	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
27	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
28	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
29	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
30	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
31	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
32	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
33	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
34	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
35	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
36	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
37	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
38	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
39	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
40	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
41	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
42	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
43	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
44	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
45	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
46	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
47	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
48	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
49	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
50	2857576091	Pigmentiphaga sp. R-72090	Isolate	Unclassified
51	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
52	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
53	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
54	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
55	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
56	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
57	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
58	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
59	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
60	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
61	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
62	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
63	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
64	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
65	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
66	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
67	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
68	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
69	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
70	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
71	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
72	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
73	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
74	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
75	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
76	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
77	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
78	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
79	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
80	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
81	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
82	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
83	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
84	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
85	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
86	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
87	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
88	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
89	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
90	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
91	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
92	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
93	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
94	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
95	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
96	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
97	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
98	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
99	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
100	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
101	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
102	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
103	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
104	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
105	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
106	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
107	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
108	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
109	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
110	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
111	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
112	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
113	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
114	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
115	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
116	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
117	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
118	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
119	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
120	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
121	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
122	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
123	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
124	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
125	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
126	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
127	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
128	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
129	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
130	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
131	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
132	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
133	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
134	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
135	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
136	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
137	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
138	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
139	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
140	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
141	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
142	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
143	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
144	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
145	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
146	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
147	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
148	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
149	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
150	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
151	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
152	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
153	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
154	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
155	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
156	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
157	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
158	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
159	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
160	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
161	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
162	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
163	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
164	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
165	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
166	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
167	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
168	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
169	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
170	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
171	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
172	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
173	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
174	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
175	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
176	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
177	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
178	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
179	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
180	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
181	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
182	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
183	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
184	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
185	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
186	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
187	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
188	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
189	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
190	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
191	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
192	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
193	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
194	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
195	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
196	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
197	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
198	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
199	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
200	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
201	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
202	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
203	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
204	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
205	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
206	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
207	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
208	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
209	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
210	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
211	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
212	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
213	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
214	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
215	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
216	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
217	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
218	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
219	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
220	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
221	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
222	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
223	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
224	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
225	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
226	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
227	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
228	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
229	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
230	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
231	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
232	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
233	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
234	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
235	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
236	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
237	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
238	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
239	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
240	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
241	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
242	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
243	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
244	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
245	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
246	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
247	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
248	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
249	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
250	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
251	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
252	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
253	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
254	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
255	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
256	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
257	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
258	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
259	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
260	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
261	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
262	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
263	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
264	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
265	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
266	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
267	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
268	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
269	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
270	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
271	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
272	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
273	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
274	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
275	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
276	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
277	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
278	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
279	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
280	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
281	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
282	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
283	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
284	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
285	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
286	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
287	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
288	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
289	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
290	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
291	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
292	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
293	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
294	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
295	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
296	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
297	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
298	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
299	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
300	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
301	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
302	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
303	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
304	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
305	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
306	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
307	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
308	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
309	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
310	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
311	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
312	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
313	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
314	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
315	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
316	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
317	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
318	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
319	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
320	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
321	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
322	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
323	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
324	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
325	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
326	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
327	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
328	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
329	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
330	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
331	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
332	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
333	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
334	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
335	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
336	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
337	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
338	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
389	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
396	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
399	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
401	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
402	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
403	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
404	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
405	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
406	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
407	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
408	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
409	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
410	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
411	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
412	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
413	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
414	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
415	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
416	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
417	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
418	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
419	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
420	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
421	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
422	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
423	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
424	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
425	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
426	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
427	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
428	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
429	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
430	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
431	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
432	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
433	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
434	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
435	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
436	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
437	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
438	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
439	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
440	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
441	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
442	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
443	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
444	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
445	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
446	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
447	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
448	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
449	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
450	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
451	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
452	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
453	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
454	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
455	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
456	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
457	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
458	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
459	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
460	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
461	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
462	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
463	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
464	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
465	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
466	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
467	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
468	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
469	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
470	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
471	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
472	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
473	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
474	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
475	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
476	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
477	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
478	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
479	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
480	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
481	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
482	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
483	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
484	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
485	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
486	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
487	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
488	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
489	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
490	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
491	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
492	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
493	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
494	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
495	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
496	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
497	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
498	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
499	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
500	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
501	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
502	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
503	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
506	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
507	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
508	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
510	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
513	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
514	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
515	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
516	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
517	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
519	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
520	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
521	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
522	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
523	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
524	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
525	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
526	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
527	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
528	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
529	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
530	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
531	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
532	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
533	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
534	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
535	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
536	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
537	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
538	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
539	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
540	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
541	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
542	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
543	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
544	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
545	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
546	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
547	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
548	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	74.11
Metatranscriptomes	0
Isolates	25.89

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.58
Nodule	25.89
Rhizoplane	0.12
Rhizosphere	71.46
Stem	0
Stem Tuber	0
Unclassified	1.96

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24742J22300_10070681	3300002244	Bacteria	650
2	Ga0065712_10122077	3300005290	Bacteria	1656
3	Ga0065707_10538935	3300005295	Bacteria	729
4	Ga0070658_10010004	3300005327	Bacteria	7618
5	Ga0070658_10075444	3300005327	Bacteria	2766
6	Ga0070658_11377934	3300005327	Bacteria	612
7	Ga0070676_10794085	3300005328	Bacteria	698
8	Ga0070683_100135633	3300005329	Bacteria	2330
9	Ga0070690_100000148	3300005330	Bacteria	35769
10	Ga0070690_100071630	3300005330	Bacteria	2252
11	Ga0070670_100480948	3300005331	Bacteria	1103
12	Ga0070670_100704208	3300005331	Bacteria	908
13	Ga0070677_10527158	3300005333	Bacteria	644
14	Ga0068869_100000103	3300005334	Bacteria	39927
15	Ga0068869_100063869	3300005334	Bacteria	2707
16	Ga0070680_100000882	3300005336	Bacteria	21272
17	Ga0070682_100008721	3300005337	Bacteria	5719
18	Ga0070682_100931071	3300005337	Bacteria	716
19	Ga0068868_100001076	3300005338	Bacteria	18727
20	Ga0068868_100270401	3300005338	Bacteria	1436
21	Ga0068868_100413471	3300005338	Bacteria	1166
22	Ga0070660_100428494	3300005339	Bacteria	1096
23	Ga0070689_100002361	3300005340	Bacteria	12297
24	Ga0070689_100108737	3300005340	Bacteria	2203
25	Ga0070689_100160901	3300005340	Bacteria	1815
26	Ga0070689_100170739	3300005340	Bacteria	1762
27	Ga0070689_100676291	3300005340	Bacteria	900
28	Ga0070691_10003035	3300005341	Bacteria	7519
29	Ga0070691_10160365	3300005341	Bacteria	1159
30	Ga0070691_10442088	3300005341	Bacteria	741
31	Ga0070687_100000105	3300005343	Bacteria	28128
32	Ga0070687_100024661	3300005343	Bacteria	2875
33	Ga0070687_100126534	3300005343	Bacteria	1469
34	Ga0070692_10005261	3300005345	Bacteria	5494
35	Ga0070692_10028792	3300005345	Bacteria	2764
36	Ga0070668_100009368	3300005347	Bacteria	7263
37	Ga0070668_100016417	3300005347	Bacteria	5536
38	Ga0070669_100002037	3300005353	Bacteria	14620
39	Ga0070669_100405369	3300005353	Bacteria	1116
40	Ga0070675_100036014	3300005354	Bacteria	4025
41	Ga0070671_100264110	3300005355	Bacteria	1463
42	Ga0070671_100435214	3300005355	Bacteria	1124
43	Ga0070674_100056367	3300005356	Bacteria	2725
44	Ga0070674_100059160	3300005356	Bacteria	2667
45	Ga0070673_100273397	3300005364	Bacteria	1479
46	Ga0070673_100352279	3300005364	Bacteria	1307
47	Ga0070673_100532402	3300005364	Bacteria	1066
48	Ga0070688_100052888	3300005365	Bacteria	2539
49	Ga0070688_100171705	3300005365	Bacteria	1497
50	Ga0070659_100264025	3300005366	Bacteria	1429
51	Ga0070703_10362501	3300005406	Bacteria	622
52	Ga0070714_100198431	3300005435	Bacteria	1835
53	Ga0070714_100384122	3300005435	Bacteria	1324
54	Ga0070714_100412585	3300005435	Bacteria	1278
55	Ga0070713_100403414	3300005436	Bacteria	1277
56	Ga0070713_101182719	3300005436	Bacteria	740
57	Ga0070710_10689498	3300005437	Bacteria	720
58	Ga0070701_10182682	3300005438	Bacteria	1229
59	Ga0070701_10204055	3300005438	Bacteria	1170
60	Ga0070701_10656736	3300005438	Bacteria	701
61	Ga0070705_100001061	3300005440	Bacteria	15312
62	Ga0070705_100005767	3300005440	Bacteria	6052
63	Ga0070705_100075917	3300005440	Bacteria	2048
64	Ga0070705_100133086	3300005440	Bacteria	1625
65	Ga0070705_100212680	3300005440	Bacteria	1334
66	Ga0070705_100368473	3300005440	Bacteria	1053
67	Ga0070700_100001887	3300005441	Bacteria	10592
68	Ga0070700_100009399	3300005441	Bacteria	5364
69	Ga0070694_100000110	3300005444	Bacteria	39928
70	Ga0070694_100002797	3300005444	Bacteria	10358
71	Ga0070694_100013506	3300005444	Bacteria	5100
72	Ga0070694_100365442	3300005444	Bacteria	1122
73	Ga0070694_100583412	3300005444	Bacteria	899
74	Ga0070708_100207175	3300005445	Bacteria	1837
75	Ga0070708_100614047	3300005445	Bacteria	1025
76	Ga0070662_100164412	3300005457	Bacteria	1738
77	Ga0070662_101016463	3300005457	Bacteria	710
78	Ga0070681_10118573	3300005458	Bacteria	2583
79	Ga0070681_10211062	3300005458	Bacteria	1858
80	Ga0070681_10301517	3300005458	Bacteria	1512
81	Ga0070681_11321818	3300005458	Bacteria	644
82	Ga0068867_100000441	3300005459	Bacteria	27580
83	Ga0068867_100001737	3300005459	Bacteria	15180
84	Ga0068867_100305924	3300005459	Bacteria	1312
85	Ga0070706_100830358	3300005467	Bacteria	855
86	Ga0070707_100443939	3300005468	Bacteria	1258
87	Ga0070698_100193154	3300005471	Bacteria	1973
88	Ga0070698_100701983	3300005471	Bacteria	954
89	Ga0070699_100046681	3300005518	Bacteria	3748
90	Ga0070699_100154507	3300005518	Bacteria	2030
91	Ga0070699_100379676	3300005518	Bacteria	1276
92	Ga0070679_100057268	3300005530	Bacteria	3885
93	Ga0070684_100020331	3300005535	Bacteria	5508
94	Ga0070684_100478817	3300005535	Bacteria	1152
95	Ga0070684_101019853	3300005535	Bacteria	777
96	Ga0070697_100203191	3300005536	Bacteria	1684
97	Ga0070697_100223627	3300005536	Bacteria	1604
98	Ga0070697_100476188	3300005536	Bacteria	1090
99	Ga0070697_100480525	3300005536	Bacteria	1085
100	Ga0068853_100064747	3300005539	Bacteria	3171
101	Ga0070672_100130429	3300005543	Bacteria	2065
102	Ga0070672_100149330	3300005543	Bacteria	1932
103	Ga0070686_100000563	3300005544	Bacteria	22161
104	Ga0070686_100054520	3300005544	Bacteria	2557
105	Ga0070695_100000512	3300005545	Bacteria	20355
106	Ga0070695_100064882	3300005545	Bacteria	2376
107	Ga0070695_100189216	3300005545	Bacteria	1463
108	Ga0070695_100206318	3300005545	Bacteria	1408
109	Ga0070695_100228624	3300005545	Bacteria	1344
110	Ga0070696_100009252	3300005546	Bacteria	6596
111	Ga0070696_100015140	3300005546	Bacteria	5179
112	Ga0070696_100040726	3300005546	Bacteria	3208
113	Ga0070696_100076603	3300005546	Bacteria	2362
114	Ga0070696_100083654	3300005546	Bacteria	2264
115	Ga0070696_100288699	3300005546	Bacteria	1252
116	Ga0070693_100000101	3300005547	Bacteria	37995
117	Ga0070693_100014688	3300005547	Bacteria	4019
118	Ga0070665_100563839	3300005548	Bacteria	1151
119	Ga0070704_100000220	3300005549	Bacteria	24002
120	Ga0070704_100001535	3300005549	Bacteria	12465
121	Ga0070704_100012096	3300005549	Bacteria	5322
122	Ga0070704_100017031	3300005549	Bacteria	4609
123	Ga0070704_100104157	3300005549	Bacteria	2145
124	Ga0070704_100660563	3300005549	Bacteria	924
125	Ga0068855_100001986	3300005563	Bacteria	25406
126	Ga0068855_100010909	3300005563	Bacteria	10969
127	Ga0068855_100030675	3300005563	Bacteria	6427
128	Ga0068855_100169283	3300005563	Bacteria	2475
129	Ga0068857_100495085	3300005577	Bacteria	1146
130	Ga0068857_100526291	3300005577	Bacteria	1112
131	Ga0068857_101310592	3300005577	Bacteria	703
132	Ga0068854_100005853	3300005578	Bacteria	7787
133	Ga0068854_100812516	3300005578	Bacteria	816
134	Ga0068856_100009739	3300005614	Bacteria	9335
135	Ga0068856_100037843	3300005614	Bacteria	4734
136	Ga0068856_100251353	3300005614	Bacteria	1783
137	Ga0070702_100000096	3300005615	Bacteria	26117
138	Ga0070702_100375112	3300005615	Bacteria	1010
139	Ga0068852_100001888	3300005616	Bacteria	14274
140	Ga0068852_100205376	3300005616	Bacteria	1866
141	Ga0068852_100250388	3300005616	Bacteria	1697
142	Ga0068859_100004200	3300005617	Bacteria	14703
143	Ga0068859_100179362	3300005617	Bacteria	2201
144	Ga0068859_100599324	3300005617	Bacteria	1195
145	Ga0068864_100541723	3300005618	Bacteria	1124
146	Ga0068866_10000893	3300005718	Bacteria	13164
147	Ga0068866_10227104	3300005718	Bacteria	1130
148	Ga0068861_100000826	3300005719	Bacteria	18701
149	Ga0068861_100003187	3300005719	Bacteria	10851
150	Ga0068851_10093381	3300005834	Bacteria	1587
151	Ga0068870_10058985	3300005840	Bacteria	2056
152	Ga0068863_100904215	3300005841	Bacteria	883
153	Ga0068863_101264015	3300005841	Bacteria	745
154	Ga0068858_100002013	3300005842	Bacteria	20783
155	Ga0068858_100007196	3300005842	Bacteria	10790
156	Ga0068860_100001309	3300005843	Bacteria	27054
157	Ga0068862_100001947	3300005844	Bacteria	18715
158	Ga0068862_100006062	3300005844	Bacteria	10066
159	Ga0068862_100569450	3300005844	Bacteria	1084
160	Ga0081539_10001473	3300005985	Bacteria	39944
161	Ga0075364_10255516	3300006051	Bacteria	1191
162	Ga0070715_10019529	3300006163	Bacteria	2601
163	Ga0070715_10052773	3300006163	Bacteria	1755
164	Ga0070712_100396333	3300006175	Bacteria	1139
165	Ga0070712_100642458	3300006175	Bacteria	901
166	Ga0097621_100000106	3300006237	Bacteria	47435
167	Ga0097621_100006960	3300006237	Bacteria	8053
168	Ga0097621_100012268	3300006237	Bacteria	6341
169	Ga0097621_100050892	3300006237	Bacteria	3369
170	Ga0097621_100287557	3300006237	Bacteria	1448
171	Ga0068871_100002446	3300006358	Bacteria	12683
172	Ga0068871_100008532	3300006358	Bacteria	7365
173	Ga0068871_100017675	3300006358	Bacteria	5401
174	Ga0068871_100182020	3300006358	Bacteria	1806
175	Ga0068871_101188804	3300006358	Bacteria	715
176	Ga0075428_100000134	3300006844	Bacteria	65107
177	Ga0075428_100047461	3300006844	Bacteria	4717
178	Ga0075430_100060701	3300006846	Bacteria	3177
179	Ga0075431_100014959	3300006847	Bacteria	7854
180	Ga0075431_100209478	3300006847	Bacteria	1992
181	Ga0075433_10001519	3300006852	Bacteria	17149
182	Ga0075433_10056858	3300006852	Bacteria	3419
183	Ga0075433_10140793	3300006852	Bacteria	2144
184	Ga0075433_10363736	3300006852	Bacteria	1278
185	Ga0075433_10398836	3300006852	Bacteria	1214
186	Ga0075433_10594228	3300006852	Bacteria	972
187	Ga0075433_10692785	3300006852	Bacteria	893
188	Ga0075433_10808494	3300006852	Bacteria	819
189	Ga0075433_10911110	3300006852	Bacteria	767
190	Ga0075434_100000699	3300006871	Bacteria	26231
191	Ga0075434_100000813	3300006871	Bacteria	24754
192	Ga0075434_100134764	3300006871	Bacteria	2489
193	Ga0075434_100348944	3300006871	Bacteria	1501
194	Ga0075429_100000271	3300006880	Bacteria	36263
195	Ga0075429_100000975	3300006880	Bacteria	22709
196	Ga0068865_100000231	3300006881	Bacteria	31031
197	Ga0068865_100057228	3300006881	Bacteria	2719
198	Ga0068865_100717876	3300006881	Bacteria	856
199	Ga0068865_100775400	3300006881	Bacteria	825
200	Ga0068865_100950084	3300006881	Bacteria	750
201	Ga0075436_100002436	3300006914	Bacteria	12815
202	Ga0075436_100004776	3300006914	Bacteria	9305
203	Ga0075436_100006862	3300006914	Bacteria	7787
204	Ga0075436_100012375	3300006914	Bacteria	5849
205	Ga0075436_100016124	3300006914	Bacteria	5115
206	Ga0075436_100076041	3300006914	Bacteria	2325
207	Ga0075436_100291279	3300006914	Bacteria	1169
208	Ga0097620_100004200	3300006931	Bacteria	14703
209	Ga0097620_100179358	3300006931	Bacteria	2201
210	Ga0097620_100599261	3300006931	Bacteria	1195
211	Ga0079104_1007232	3300006946	Bacteria	4062
212	Ga0079104_1008431	3300006946	Bacteria	3605
213	Ga0075435_100002136	3300007076	Bacteria	13025
214	Ga0075435_100035972	3300007076	Bacteria	3932
215	Ga0075435_100083482	3300007076	Bacteria	2627
216	Ga0075435_100134671	3300007076	Bacteria	2069
217	Ga0075435_100672997	3300007076	Bacteria	899
218	Ga0099794_10201826	3300007265	Bacteria	1018
219	Ga0105240_10002895	3300009093	Bacteria	27079
220	Ga0105240_10061715	3300009093	Bacteria	4670
221	Ga0105240_10071509	3300009093	Bacteria	4290
222	Ga0105240_10161885	3300009093	Bacteria	2657
223	Ga0111539_10008776	3300009094	Bacteria	12816
224	Ga0111539_10305362	3300009094	Bacteria	1852
225	Ga0105245_10000347	3300009098	Bacteria	43236
226	Ga0105245_10042334	3300009098	Bacteria	4063
227	Ga0105245_10489525	3300009098	Bacteria	1244
228	Ga0114129_10005561	3300009147	Bacteria	17827
229	Ga0114129_10474621	3300009147	Bacteria	1637
230	Ga0105243_10000535	3300009148	Bacteria	38636
231	Ga0105243_10004257	3300009148	Bacteria	11335
232	Ga0105243_11054664	3300009148	Bacteria	819
233	Ga0105241_10010941	3300009174	Bacteria	6654
234	Ga0105241_10265525	3300009174	Bacteria	1460
235	Ga0105241_11244082	3300009174	Bacteria	707
236	Ga0105242_10000905	3300009176	Bacteria	23036
237	Ga0105242_10001512	3300009176	Bacteria	18280
238	Ga0105242_10002624	3300009176	Bacteria	14100
239	Ga0105242_10013578	3300009176	Bacteria	6301
240	Ga0105242_10017281	3300009176	Bacteria	5618
241	Ga0105242_10136475	3300009176	Bacteria	2124
242	Ga0105242_10777000	3300009176	Bacteria	946
243	Ga0105242_11123883	3300009176	Bacteria	801
244	Ga0105248_10020172	3300009177	Bacteria	7384
245	Ga0105248_10159204	3300009177	Bacteria	2547
246	Ga0105248_10633277	3300009177	Bacteria	1207
247	Ga0105248_10975333	3300009177	Bacteria	957
248	Ga0105238_10020415	3300009551	Bacteria	6744
249	Ga0105238_10140266	3300009551	Bacteria	2394
250	Ga0105249_10005947	3300009553	Bacteria	10571
251	Ga0105249_10032433	3300009553	Bacteria	4726
252	Ga0105249_10124436	3300009553	Bacteria	2454
253	Ga0105249_12034013	3300009553	Bacteria	647
254	Ga0105239_10110995	3300010375	Bacteria	3040
255	Ga0105246_10394906	3300011119	Bacteria	1147
256	Ga0157370_10001416	3300013104	Bacteria	29771
257	Ga0157370_10147777	3300013104	Bacteria	2188
258	Ga0157370_10207967	3300013104	Bacteria	1814
259	Ga0157369_10047888	3300013105	Bacteria	4640
260	Ga0157369_10223677	3300013105	Bacteria	1969
261	Ga0157374_10087241	3300013296	Bacteria	2970
262	Ga0157374_11017934	3300013296	Bacteria	848
263	Ga0157378_10000447	3300013297	Bacteria	39662
264	Ga0157378_10072444	3300013297	Bacteria	3096
265	Ga0157378_10884520	3300013297	Bacteria	923
266	Ga0163162_10085969	3300013306	Bacteria	3222
267	Ga0163162_10169220	3300013306	Bacteria	2309
268	Ga0163162_10658305	3300013306	Bacteria	1171
269	Ga0163162_10936126	3300013306	Bacteria	978
270	Ga0157372_10011227	3300013307	Bacteria	9528
271	Ga0157372_10016533	3300013307	Bacteria	7917
272	Ga0157375_10390359	3300013308	Bacteria	1559
273	Ga0157375_10474713	3300013308	Bacteria	1416
274	Ga0163163_11692111	3300014325	Bacteria	693
275	Ga0157380_10012418	3300014326	Bacteria	6180
276	Ga0157380_10157007	3300014326	Bacteria	1973
277	Ga0157380_10215074	3300014326	Bacteria	1716
278	Ga0157380_10936208	3300014326	Bacteria	895
279	Ga0157377_10126523	3300014745	Bacteria	1555
280	Ga0157379_10035647	3300014968	Bacteria	4436
281	Ga0157379_10380073	3300014968	Bacteria	1296
282	Ga0157376_10002088	3300014969	Bacteria	13437
283	Ga0163161_11204082	3300017792	Unclassified	655
284	Ga0214544_1000158	3300021320	Bacteria	101943
285	Ga0214542_1001567	3300021321	Bacteria	47020
286	Ga0214543_1000011	3300021327	Bacteria	344093
287	Ga0214543_1000234	3300021327	Bacteria	84243
288	Ga0213876_10203956	3300021384	Bacteria	1051
289	Ga0228711_1000007	3300022739	Bacteria	202413
290	Ga0228710_1000007	3300022740	Bacteria	189104
291	Ga0207653_10010388	3300025885	Bacteria	2903
292	Ga0207692_10033185	3300025898	Bacteria	2488
293	Ga0207642_10018538	3300025899	Bacteria	2674
294	Ga0207642_10555749	3300025899	Bacteria	709
295	Ga0207688_10009633	3300025901	Bacteria	5261
296	Ga0207685_10016491	3300025905	Bacteria	2366
297	Ga0207685_10168466	3300025905	Bacteria	1006
298	Ga0207699_10458149	3300025906	Bacteria	916
299	Ga0207645_10653619	3300025907	Bacteria	714
300	Ga0207643_10034065	3300025908	Bacteria	2852
301	Ga0207705_10055223	3300025909	Bacteria	2863
302	Ga0207705_10067749	3300025909	Bacteria	2584
303	Ga0207684_10733100	3300025910	Bacteria	838
304	Ga0207654_10425853	3300025911	Bacteria	927
305	Ga0207695_10003454	3300025913	Bacteria	22268
306	Ga0207695_10148941	3300025913	Bacteria	2281
307	Ga0207660_10065878	3300025917	Bacteria	2619
308	Ga0207660_11153753	3300025917	Bacteria	631
309	Ga0207662_10000109	3300025918	Bacteria	39758
310	Ga0207662_10051386	3300025918	Bacteria	2452
311	Ga0207652_10030375	3300025921	Bacteria	4525
312	Ga0207646_10301703	3300025922	Bacteria	1447
313	Ga0207646_10368302	3300025922	Bacteria	1298
314	Ga0207681_10005710	3300025923	Bacteria	7636
315	Ga0207694_10146947	3300025924	Bacteria	1898
316	Ga0207650_10690226	3300025925	Bacteria	862
317	Ga0207659_10027967	3300025926	Bacteria	3825
318	Ga0207659_10290999	3300025926	Bacteria	1338
319	Ga0207687_10010136	3300025927	Bacteria	6162
320	Ga0207687_10073432	3300025927	Bacteria	2449
321	Ga0207687_10172205	3300025927	Bacteria	1671
322	Ga0207687_10449317	3300025927	Bacteria	1069
323	Ga0207664_10592560	3300025929	Bacteria	995
324	Ga0207690_10082586	3300025932	Bacteria	2248
325	Ga0207706_10088982	3300025933	Bacteria	2714
326	Ga0207706_10131628	3300025933	Bacteria	2200
327	Ga0207686_10001982	3300025934	Bacteria	11281
328	Ga0207686_10018157	3300025934	Bacteria	3977
329	Ga0207686_10086270	3300025934	Bacteria	2061
330	Ga0207686_10100601	3300025934	Bacteria	1929
331	Ga0207686_10190999	3300025934	Bacteria	1460
332	Ga0207686_10628660	3300025934	Bacteria	847
333	Ga0207709_10002130	3300025935	Bacteria	12715
334	Ga0207709_10003201	3300025935	Bacteria	9840
335	Ga0207709_10313750	3300025935	Bacteria	1171
336	Ga0207670_10009930	3300025936	Bacteria	5455
337	Ga0207670_10121748	3300025936	Bacteria	1898
338	Ga0207670_10222450	3300025936	Bacteria	1446
339	Ga0207670_10426811	3300025936	Bacteria	1065
340	Ga0207670_10452459	3300025936	Bacteria	1035
341	Ga0207670_10573986	3300025936	Bacteria	924
342	Ga0207669_10017503	3300025937	Bacteria	3679
343	Ga0207669_10036799	3300025937	Bacteria	2801
344	Ga0207704_10008864	3300025938	Bacteria	4831
345	Ga0207704_10023598	3300025938	Bacteria	3318
346	Ga0207704_10821733	3300025938	Bacteria	777
347	Ga0207704_10872868	3300025938	Bacteria	755
348	Ga0207665_10882135	3300025939	Bacteria	709
349	Ga0207691_10057987	3300025940	Bacteria	3522
350	Ga0207691_10336608	3300025940	Bacteria	1292
351	Ga0207711_10067898	3300025941	Bacteria	3087
352	Ga0207711_10693143	3300025941	Bacteria	950
353	Ga0207689_10000532	3300025942	Bacteria	36122
354	Ga0207689_10044044	3300025942	Bacteria	3689
355	Ga0207661_10093302	3300025944	Bacteria	2512
356	Ga0207667_10026319	3300025949	Bacteria	6358
357	Ga0207667_10091486	3300025949	Bacteria	3143
358	Ga0207667_10296342	3300025949	Bacteria	1652
359	Ga0207667_10370534	3300025949	Bacteria	1459
360	Ga0207667_10709918	3300025949	Bacteria	1007
361	Ga0207712_10003243	3300025961	Bacteria	10338
362	Ga0207712_10065714	3300025961	Bacteria	2590
363	Ga0207712_10188043	3300025961	Bacteria	1628
364	Ga0207712_11481257	3300025961	Bacteria	608
365	Ga0207668_10015526	3300025972	Bacteria	4734
366	Ga0207668_10152942	3300025972	Bacteria	1788
367	Ga0207640_10136945	3300025981	Bacteria	1779
368	Ga0207677_10007130	3300026023	Bacteria	6154
369	Ga0207677_10191492	3300026023	Bacteria	1618
370	Ga0207677_10736880	3300026023	Bacteria	877
371	Ga0207703_10026056	3300026035	Bacteria	4601
372	Ga0207703_10861590	3300026035	Bacteria	867
373	Ga0207703_11321356	3300026035	Bacteria	693
374	Ga0207639_10115403	3300026041	Bacteria	2196
375	Ga0207639_10183033	3300026041	Bacteria	1784
376	Ga0207639_10794125	3300026041	Bacteria	882
377	Ga0207708_10000712	3300026075	Bacteria	25051
378	Ga0207708_10003441	3300026075	Bacteria	11663
379	Ga0207708_10312524	3300026075	Bacteria	1280
380	Ga0207708_10421411	3300026075	Bacteria	1107
381	Ga0207708_10966896	3300026075	Bacteria	739
382	Ga0207702_10009029	3300026078	Bacteria	8396
383	Ga0207702_10040144	3300026078	Bacteria	3923
384	Ga0207702_10146020	3300026078	Bacteria	2146
385	Ga0207641_11149338	3300026088	Bacteria	775
386	Ga0207648_10000505	3300026089	Bacteria	43495
387	Ga0207648_10188736	3300026089	Bacteria	1826
388	Ga0207648_10283810	3300026089	Bacteria	1481
389	Ga0207676_10707698	3300026095	Bacteria	976
390	Ga0207674_10482920	3300026116	Bacteria	1198
391	Ga0207674_10527796	3300026116	Bacteria	1140
392	Ga0207675_100000625	3300026118	Bacteria	34684
393	Ga0207675_100000760	3300026118	Bacteria	32073
394	Ga0207675_100460148	3300026118	Bacteria	1262
395	Ga0207683_10122736	3300026121	Bacteria	2333
396	Ga0207698_10061806	3300026142	Bacteria	2921
397	Ga0207698_10105045	3300026142	Bacteria	2352
398	Ga0209281_1000128	3300027111	Bacteria	199265
399	Ga0209281_1000483	3300027111	Bacteria	55407
400	Ga0209969_1015731	3300027360	Bacteria	1107
401	Ga0209967_1001411	3300027364	Bacteria	3068
402	Ga0209981_1002546	3300027378	Bacteria	2326
403	Ga0209981_1017810	3300027378	Bacteria	1004
404	Ga0210000_1007602	3300027462	Bacteria	1584
405	Ga0209968_1005587	3300027526	Bacteria	1889
406	Ga0209999_1007649	3300027543	Bacteria	1944
407	Ga0209282_1000034	3300027666	Bacteria	140100
408	Ga0209971_1038064	3300027682	Bacteria	1158
409	Ga0209998_10079843	3300027717	Bacteria	792
410	Ga0207428_10004302	3300027907	Bacteria	13600
411	Ga0207428_10170429	3300027907	Bacteria	1649
412	Ga0207428_10221607	3300027907	Bacteria	1418
413	Ga0268265_10004002	3300028380	Bacteria	10375
414	Ga0268265_10034846	3300028380	Bacteria	3672
415	Ga0268264_10015338	3300028381	Bacteria	6283
416	Ga0268264_10794170	3300028381	Bacteria	945
417	Ga0307515_10000945	3300028794	Bacteria	66458
418	Ga0307408_100160940	3300031548	Bacteria	1783
419	Ga0307408_100347367	3300031548	Bacteria	1258
420	Ga0316579_10002021	3300031691	Bacteria	7595
421	Ga0316578_10029888	3300031728	Bacteria	3095
422	Ga0307405_10664978	3300031731	Bacteria	858
423	Ga0307412_10405676	3300031911	Bacteria	1111
424	Ga0315914_1000010	3300031967	Bacteria	171642
425	Ga0307409_100167378	3300031995	Bacteria	1931
426	Ga0307409_100752514	3300031995	Bacteria	978
427	Ga0307416_100093272	3300032002	Bacteria	2593
428	Ga0307416_100397069	3300032002	Bacteria	1415
429	Ga0307411_10498057	3300032005	Bacteria	1029
430	Ga0307411_10764858	3300032005	Bacteria	847
431	Ga0307411_11853126	3300032005	Bacteria	561
432	Ga0316583_10004918	3300032133	Bacteria	4777
433	Ga0316583_10007067	3300032133	Bacteria	4038
434	Ga0315913_1000005	3300033430	Bacteria	171651
435	Ga0315915_1000012	3300033464	Bacteria	199284
436	Ga0373958_0082813	3300034819	Bacteria	729
437	Ga0373959_0014773	3300034820	Bacteria	1426
438	Ga0373959_0070637	3300034820	Bacteria	789
439	Ga0373938_0057225	3300034957	Bacteria	904
440	Ga0373926_0000860	3300035083	Bacteria	8683
441	Ga0373928_0021740	3300035084	Bacteria	1355
442	Ga0373929_0033902	3300035085	Bacteria	1105
443	Ga0373940_0149405	3300035088	Bacteria	743
444	Ga0373944_0003250	3300035089	Bacteria	4180
445	Ga0373949_0008285	3300035090	Bacteria	2276
446	Ga0373951_0075804	3300035091	Bacteria	863
447	Ga0373923_0173607	3300035111	Bacteria	988
448	Ga0373932_0021715	3300035112	Bacteria	1697
449	Ga0373936_0015541	3300035113	Bacteria	2917
450	Ga0373939_0175761	3300035114	Bacteria	795
451	Ga0373945_0100842	3300035116	Bacteria	1129
452	Ga0373953_0066757	3300035117	Bacteria	1479
453	Ga0373956_0031880	3300035119	Bacteria	2311
454	Ga0373956_0138156	3300035119	Bacteria	1143
455	Ga0373943_0014896	3300035170	Bacteria	3528
456	Ga0373946_0027606	3300035171	Bacteria	2246
457	Ga0373961_0043149	3300035241	Bacteria	1310
458	Ga0373924_0090529	3300035410	Bacteria	1308
459	Ga0373924_0140078	3300035410	Bacteria	1055
460	Ga0373931_0021431	3300035691	Bacteria	3242
461	Ga0373931_0159308	3300035691	Bacteria	1322
462	Ga0373931_0173253	3300035691	Bacteria	1273
463	Ga0373931_0783976	3300035691	Bacteria	634
464	Ga0373935_0003949	3300035692	Bacteria	8659
465	Ga0373927_0009382	3300035695	Bacteria	6564
466	Ga0373927_0095449	3300035695	Bacteria	1933
467	Ga0373947_0009088	3300035725	Bacteria	5710
468	Ga0373937_0012385	3300036401	Bacteria	7500
469	Ga0373937_0193022	3300036401	Bacteria	1914
470	Ga0316582_0044224	3300036647	Bacteria	2798
471	Ga0395900_0398199	3300037418	Bacteria	1342
472	Ga0436365_1397623	3300039437	Bacteria	7292
473	Ga0436360_0549273	3300039438	Bacteria	1716
474	Ga0436362_0387917	3300039453	Bacteria	567
475	Ga0439453_0012544	3300041408	Bacteria	1428
476	Ga0439461_0008132	3300041410	Bacteria	1874
477	Ga0451845_0782002	3300041501	Bacteria	802
478	Ga0439441_000556	3300042001	Bacteria	4136
479	Ga0439432_056806	3300042006	Bacteria	1212
480	Ga0439449_0051120	3300042007	Bacteria	1529
481	Ga0439462_0003827	3300042015	Bacteria	3632
482	Ga0439462_0223826	3300042015	Bacteria	538
483	Ga0439446_0012744	3300042156	Bacteria	2299
484	Ga0439435_0002663	3300042436	Bacteria	3589
485	Ga0439460_0005924	3300042461	Bacteria	3013
486	Ga0450893_0017625	3300042532	Bacteria	1214
487	Ga0451577_0029192	3300042876	Bacteria	4984
488	Ga0451577_1427551	3300042876	Bacteria	613
489	Ga0466966_0042939	3300044684	Bacteria	2900
490	Ga0466966_0195470	3300044684	Bacteria	1225
491	Ga0466964_0347144	3300044706	Bacteria	761
492	Ga0466959_0172851	3300045049	Bacteria	1515
493	Ga0451576_0005592	3300045051	Bacteria	15703
494	Ga0451576_0023317	3300045051	Bacteria	6701
495	Ga0451576_0044258	3300045051	Bacteria	4693
496	Ga0451576_0444608	3300045051	Bacteria	1361
497	Ga0451576_0961944	3300045051	Bacteria	895
498	Ga0466958_0417679	3300045836	Bacteria	867
499	Ga0466967_0043252	3300045976	Bacteria	3899
500	Ga0495592_0056995	3300046454	Bacteria	2885
501	Ga0495603_0014327	3300046455	Bacteria	4794
502	Ga0495590_0198529	3300046457	Bacteria	737
503	Ga0495651_0087495	3300046462	Bacteria	2343
504	Ga0495580_0010043	3300046472	Bacteria	7399
505	Ga0495582_0070394	3300046473	Bacteria	1935
506	Ga0495639_0011028	3300046475	Bacteria	3894
507	Ga0495607_0000252	3300046501	Bacteria	57555
508	Ga0495610_0002342	3300046512	Bacteria	16022
509	Ga0495628_0050060	3300046516	Bacteria	3306
510	Ga0495630_0070696	3300046517	Bacteria	2626
511	Ga0495644_0123118	3300046523	Bacteria	987
512	Ga0495666_0024995	3300046526	Bacteria	2951
513	Ga0495586_0018472	3300046535	Bacteria	3712
514	Ga0495587_0019410	3300046536	Bacteria	4207
515	Ga0495621_0328780	3300046539	Bacteria	638
516	Ga0495645_0021953	3300046543	Bacteria	4616
517	Ga0495645_0645820	3300046543	Bacteria	647
518	Ga0495667_0095135	3300046559	Bacteria	1929
519	Ga0495667_0148633	3300046559	Bacteria	1509
520	Ga0495656_0027754	3300046615	Bacteria	2264
521	Ga0495668_0505675	3300046616	Bacteria	666
522	Ga0495634_0004662	3300046642	Bacteria	10673
523	Ga0495588_0026638	3300046674	Bacteria	2888
524	Ga0495599_0025674	3300046678	Bacteria	3689
525	Ga0495623_0026028	3300046679	Bacteria	3768
526	Ga0495647_0009745	3300046681	Bacteria	3260
527	Ga0495658_0011063	3300046683	Bacteria	4528
528	Ga0495600_0047585	3300046809	Bacteria	2798
529	Ga0495581_0202956	3300047315	Bacteria	1160
530	Ga0495636_0034583	3300047318	Bacteria	2080
531	Ga0495674_0316150	3300047319	Bacteria	1273
532	Ga0495676_0052952	3300047321	Bacteria	3237
533	Ga0495680_0535178	3300047322	Bacteria	791
534	Ga0495675_0481843	3300047444	Bacteria	714
535	Ga0495602_0276733	3300048088	Bacteria	1238
536	Ga0495602_0375412	3300048088	Bacteria	1020
537	Ga0496106_0000050	3300048909	Bacteria	96126
538	Ga0501031_0493777	3300049568	Bacteria	790
539	Ga0501031_0509811	3300049568	Bacteria	776
540	Ga0501033_0143727	3300049570	Bacteria	1724
541	Ga0501033_0195046	3300049570	Bacteria	1448
542	Ga0501036_0001519	3300049572	Bacteria	17901
543	Ga0501036_0081257	3300049572	Bacteria	2739
544	Ga0501036_0646894	3300049572	Bacteria	875
545	Ga0501036_0718779	3300049572	Bacteria	825
546	Ga0501037_0093288	3300049573	Bacteria	2177
547	Ga0501037_0277826	3300049573	Bacteria	1167
548	Ga0501038_0001082	3300049574	Bacteria	24639
549	Ga0501039_0000168	3300049575	Bacteria	45750
550	Ga0501039_0096719	3300049575	Bacteria	2302
551	Ga0501040_0001149	3300049576	Bacteria	16836
552	Ga0501040_0015585	3300049576	Bacteria	5024
553	Ga0501040_0196526	3300049576	Bacteria	1432
554	Ga0501040_0205722	3300049576	Bacteria	1398
555	Ga0501041_0000623	3300049577	Bacteria	18476
556	Ga0501041_0136412	3300049577	Bacteria	1529
557	Ga0501042_0010653	3300049578	Bacteria	6177
558	Ga0501042_0046342	3300049578	Bacteria	3099
559	Ga0501042_0080229	3300049578	Bacteria	2338
560	Ga0501042_0409191	3300049578	Bacteria	983
561	Ga0501043_0137507	3300049579	Bacteria	1914
562	Ga0501046_0000480	3300049580	Bacteria	39915
563	Ga0501046_0241570	3300049580	Bacteria	1332
564	Ga0501048_0000896	3300049582	Bacteria	21988
565	Ga0501048_0618750	3300049582	Bacteria	777
566	Ga0501067_0029549	3300049583	Bacteria	3038
567	Ga0501068_0024852	3300049584	Bacteria	3520
568	Ga0501071_0134164	3300049587	Bacteria	1841
569	Ga0501071_0944765	3300049587	Bacteria	665
570	Ga0501072_0060341	3300049588	Bacteria	2991
571	Ga0501072_0119918	3300049588	Bacteria	2096
572	Ga0501074_0130568	3300049590	Bacteria	1797
573	Ga0501074_0834396	3300049590	Bacteria	649
574	Ga0501075_0000046	3300049591	Bacteria	50813
575	Ga0501075_0066463	3300049591	Bacteria	2721
576	Ga0501076_0000566	3300049592	Bacteria	23610
577	Ga0501077_0004244	3300049593	Bacteria	8660
578	Ga0501077_0104385	3300049593	Bacteria	1796
579	Ga0501079_0000808	3300049741	Bacteria	21315
580	Ga0501081_0001689	3300049743	Bacteria	13675
581	Ga0501035_0004374	3300049822	Bacteria	13419
582	Ga0501045_0000436	3300049824	Bacteria	25558
583	Ga0501045_0019929	3300049824	Bacteria	4787
584	nmdc:mga00v17_256636_c1	3300050491	Bacteria	1134
585	nmdc:mga05p37_1059_c1	3300050507	Bacteria	31441
586	nmdc:mga05p37_2687_c1	3300050507	Bacteria	20683
587	nmdc:mga05p37_454651_c1	3300050507	Bacteria	1481
588	nmdc:mga09592_417012_c1	3300050508	Bacteria	1160
589	nmdc:mga09592_438_c1	3300050508	Bacteria	30676
590	nmdc:mga09592_61_c1	3300050508	Bacteria	60866
591	nmdc:mga09592_622892_c1	3300050508	Bacteria	923
592	nmdc:mga0qj67_112210_c1	3300050509	Bacteria	2201
593	nmdc:mga0qj67_574707_c1	3300050509	Bacteria	903
594	nmdc:mga0qj67_795943_c1	3300050509	Bacteria	749
595	nmdc:mga06r32_11848_c1	3300050510	Bacteria	7853
596	nmdc:mga06r32_332627_c1	3300050510	Bacteria	1504
597	nmdc:mga06r32_914978_c1	3300050510	Bacteria	833
598	nmdc:mga08y16_334659_c1	3300050511	Bacteria	1557
599	nmdc:mga08y16_46313_c1	3300050511	Bacteria	4553
600	nmdc:mga08y16_48826_c1	3300050511	Bacteria	4429
601	nmdc:mga08y16_707660_c1	3300050511	Bacteria	1006
602	nmdc:mga08y16_7845_c1	3300050511	Bacteria	11181
603	nmdc:mga0n895_10713_c1	3300050512	Bacteria	8124
604	nmdc:mga0n895_11009_c1	3300050512	Bacteria	8039
605	nmdc:mga0n895_186096_c1	3300050512	Bacteria	2108
606	nmdc:mga0n895_218696_c1	3300050512	Bacteria	1934
607	nmdc:mga0n895_3867_c1	3300050512	Bacteria	12157
608	nmdc:mga0n895_968802_c1	3300050512	Bacteria	833
609	nmdc:mga0rr50_123773_c1	3300050513	Bacteria	2062
610	nmdc:mga0rr50_16364_c1	3300050513	Bacteria	4924
611	nmdc:mga0rr50_319066_c1	3300050513	Bacteria	1302
612	nmdc:mga0rr50_386804_c1	3300050513	Bacteria	1180
613	nmdc:mga0rr50_569018_c1	3300050513	Bacteria	965
614	nmdc:mga0rr50_90379_c1	3300050513	Bacteria	2383
615	nmdc:mga08x19_127739_c1	3300050514	Bacteria	1708
616	nmdc:mga08x19_200146_c1	3300050514	Bacteria	1369
617	nmdc:mga08x19_375_c1	3300050514	Bacteria	31351
618	nmdc:mga08x19_4952_c1	3300050514	Bacteria	7865
619	nmdc:mga08x19_591298_c1	3300050514	Bacteria	786
620	nmdc:mga08x19_62866_c1	3300050514	Bacteria	2408
621	nmdc:mga0a205_1027619_c1	3300050515	Bacteria	671
622	nmdc:mga0a205_1599_c1	3300050515	Bacteria	19462
623	nmdc:mga0a205_211694_c1	3300050515	Bacteria	1826
624	nmdc:mga0a205_57835_c1	3300050515	Bacteria	3744
625	nmdc:mga0a205_651264_c1	3300050515	Bacteria	905
626	nmdc:mga0a205_742087_c1	3300050515	Bacteria	831
627	nmdc:mga0a205_745504_c1	3300050515	Bacteria	828
628	nmdc:mga0a205_76699_c1	3300050515	Bacteria	3230
629	Ga0495601_0010036	3300053077	Bacteria	5619
630	Ga0495595_0015779	3300053084	Bacteria	3225
631	Ga0495595_0182921	3300053084	Bacteria	1040
632	Ga0495619_0082090	3300053085	Bacteria	2172
633	Ga0500641_0016899	3300053096	Bacteria	2721
634	Ga0500658_0005736	3300053134	Bacteria	4624
635	Ga0500568_0001502	3300053139	Bacteria	14909
636	Ga0501084_0034303	3300054114	Bacteria	4243
637	Ga0501084_0934115	3300054114	Bacteria	729
638	Ga0590071_042212	3300059421	Bacteria	1098
639	Ga0590075_026696	3300059424	Bacteria	1454
640	Ga0501082_0002802	3300060353	Bacteria	15217
641	Ga0466962_0117165	3300061719	Bacteria	1284
642	Ga0530510_0025258	3300061734	Bacteria	4246
643	Ga0530510_0303098	3300061734	Bacteria	1196
644	Ga0530510_0741910	3300061734	Bacteria	749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042006	Ga0439432_056806	Ga0439432_056806_729_1181	146
2	iso_pu_bacteria	2857576091	2857580398	160
3	3300013104	Ga0157370_10001416	Ga0157370_1000141622	161
4	3300005458	Ga0070681_10211062	Ga0070681_102110622	162
5	3300013104	Ga0157370_10147777	Ga0157370_101477772	162
6	3300025949	Ga0207667_10296342	Ga0207667_102963422	162
7	iso_pu_bacteria	2516143018	2516209632	162
8	iso_pu_bacteria	2657244999	2657685865	162
9	iso_pu_bacteria	2690316117	2692315908	162
10	iso_pu_bacteria	2751185821	2753458826	162
11	iso_pu_bacteria	2791355091	2792620097	162
12	iso_pu_bacteria	2791355092	2792626484	162
13	iso_pu_bacteria	2802429268	2804752312	162
14	iso_pu_bacteria	2838074704	2838078940	162
15	iso_pu_bacteria	2847417321	2847419027	162
16	iso_pu_bacteria	2848992105	2848994059	162
17	iso_pu_bacteria	2855872281	2855876702	162
18	iso_pu_bacteria	2896384573	2896390806	162
19	iso_pu_bacteria	2913295892	2913300911	162
20	iso_pu_bacteria	2920760137	2920766149	162
21	iso_pu_bacteria	643692032	643825915	162
22	iso_pu_bacteria	8054558443	8054559902	162
23	3300005331	Ga0070670_100704208	Ga0070670_1007042082	163
24	3300005347	Ga0070668_100009368	Ga0070668_1000093685	163
25	3300005353	Ga0070669_100405369	Ga0070669_1004053692	163
26	3300005356	Ga0070674_100056367	Ga0070674_1000563675	163
27	3300005406	Ga0070703_10362501	Ga0070703_103625011	163
28	3300005543	Ga0070672_100130429	Ga0070672_1001304292	163
29	3300005548	Ga0070665_100563839	Ga0070665_1005638392	163
30	3300006881	Ga0068865_100950084	Ga0068865_1009500841	163
31	3300006946	Ga0079104_1007232	Ga0079104_10072323	163
32	3300006946	Ga0079104_1008431	Ga0079104_10084311	163
33	3300009176	Ga0105242_11123883	Ga0105242_111238832	163
34	3300013308	Ga0157375_10390359	Ga0157375_103903592	163
35	3300014326	Ga0157380_10012418	Ga0157380_100124187	163
36	3300021320	Ga0214544_1000158	Ga0214544_100015897	163
37	3300021321	Ga0214542_1001567	Ga0214542_100156718	163
38	3300021327	Ga0214543_1000011	Ga0214543_100001185	163
39	3300021327	Ga0214543_1000234	Ga0214543_100023433	163
40	3300022739	Ga0228711_1000007	Ga0228711_100000715	163
41	3300022740	Ga0228710_1000007	Ga0228710_10000072	163
42	3300025925	Ga0207650_10690226	Ga0207650_106902262	163
43	3300025937	Ga0207669_10017503	Ga0207669_100175031	163
44	3300025940	Ga0207691_10057987	Ga0207691_100579874	163
45	3300025972	Ga0207668_10015526	Ga0207668_100155266	163
46	3300026118	Ga0207675_100460148	Ga0207675_1004601482	163
47	3300027111	Ga0209281_1000128	Ga0209281_1000128189	163
48	3300027111	Ga0209281_1000483	Ga0209281_100048339	163
49	3300027666	Ga0209282_1000034	Ga0209282_1000034123	163
50	3300028794	Ga0307515_10000945	Ga0307515_1000094537	163
51	3300031548	Ga0307408_100347367	Ga0307408_1003473672	163
52	3300031911	Ga0307412_10405676	Ga0307412_104056763	163
53	3300031967	Ga0315914_1000010	Ga0315914_1000010161	163
54	3300031995	Ga0307409_100752514	Ga0307409_1007525142	163
55	3300032002	Ga0307416_100397069	Ga0307416_1003970692	163
56	3300033430	Ga0315913_1000005	Ga0315913_1000005161	163
57	3300033464	Ga0315915_1000012	Ga0315915_10000122	163
58	3300039438	Ga0436360_0549273	Ga0436360_0549273_243_767	163
59	3300041408	Ga0439453_0012544	Ga0439453_0012544_573_1064	163
60	3300042001	Ga0439441_000556	Ga0439441_000556_1569_2060	163
61	3300042007	Ga0439449_0051120	Ga0439449_0051120_653_1168	163
62	3300042015	Ga0439462_0003827	Ga0439462_0003827_1294_1809	163
63	3300042461	Ga0439460_0005924	Ga0439460_0005924_182_673	163
64	3300042532	Ga0450893_0017625	Ga0450893_0017625_191_682	163
65	3300050509	nmdc:mga0qj67_112210_c1	nmdc:mga0qj67_112210_c1_397_888	163
66	3300050511	nmdc:mga08y16_707660_c1	nmdc:mga08y16_707660_c1_263_799	163
67	3300054114	Ga0501084_0934115	Ga0501084_0934115_22_513	163
68	iso_pu_bacteria	2508501122	2509107478	163
69	iso_pu_bacteria	2509276019	2509375813	163
70	iso_pu_bacteria	2510065057	2510303345	163
71	iso_pu_bacteria	2511231052	2511501838	163
72	iso_pu_bacteria	2512047086	2512533276	163
73	iso_pu_bacteria	2513237086	2513584697	163
74	iso_pu_bacteria	2513237089	2513603939	163
75	iso_pu_bacteria	2513237091	2513615407	163
76	iso_pu_bacteria	2513237140	2513881195	163
77	iso_pu_bacteria	2513237143	2513905664	163
78	iso_pu_bacteria	2513237156	2513984377	163
79	iso_pu_bacteria	2513237160	2514006164	163
80	iso_pu_bacteria	2515154107	2515608701	163
81	iso_pu_bacteria	2516653046	2516893133	163
82	iso_pu_bacteria	2517487022	2517569889	163
83	iso_pu_bacteria	2524023207	2524448896	163
84	iso_pu_bacteria	2551306084	2551677973	163
85	iso_pu_bacteria	2551306085	2551686754	163
86	iso_pu_bacteria	2551306086	2551690979	163
87	iso_pu_bacteria	2551306087	2551698954	163
88	iso_pu_bacteria	2551306089	2551713829	163
89	iso_pu_bacteria	2551306090	2551717857	163
90	iso_pu_bacteria	2551306090	2551719337	163
91	iso_pu_bacteria	2551306091	2551727830	163
92	iso_pu_bacteria	2551306092	2551736530	163
93	iso_pu_bacteria	2551306093	2551743891	163
94	iso_pu_bacteria	2558860100	2558868082	163
95	iso_pu_bacteria	2791355082	2792581857	163
96	iso_pu_bacteria	2791355094	2792639414	163
97	iso_pu_bacteria	2802428858	2802719163	163
98	iso_pu_bacteria	2802428859	2802727394	163
99	iso_pu_bacteria	2802428860	2802732176	163
100	iso_pu_bacteria	2802428861	2802739106	163
101	iso_pu_bacteria	2802428862	2802745006	163
102	iso_pu_bacteria	2802428863	2802752281	163
103	iso_pu_bacteria	2850079185	2850082075	163
104	iso_pu_bacteria	2855825444	2855825934	163
105	iso_pu_bacteria	2855839649	2855841284	163
106	iso_pu_bacteria	2858800743	2858802262	163
107	iso_pu_bacteria	2915980308	2915985531	163
108	iso_pu_bacteria	2915986958	2915990346	163
109	iso_pu_bacteria	2915993759	2915994855	163
110	iso_pu_bacteria	2916000859	2916002763	163
111	iso_pu_bacteria	2916007675	2916014479	163
112	iso_pu_bacteria	2916014648	2916017363	163
113	iso_pu_bacteria	2916021584	2916024018	163
114	iso_pu_bacteria	2916028427	2916033220	163
115	iso_pu_bacteria	2916035215	2916036720	163
116	iso_pu_bacteria	2916041962	2916044288	163
117	iso_pu_bacteria	2916048683	2916052226	163
118	iso_pu_bacteria	2916055098	2916055545	163
119	iso_pu_bacteria	2916061851	2916065285	163
120	iso_pu_bacteria	2916068649	2916072084	163
121	iso_pu_bacteria	2916076590	2916080920	163
122	iso_pu_bacteria	2921201388	2921204855	163
123	iso_pu_bacteria	2921208531	2921212602	163
124	iso_pu_bacteria	2921237296	2921242346	163
125	iso_pu_bacteria	2921244191	2921246571	163
126	iso_pu_bacteria	2921250672	2921255175	163
127	iso_pu_bacteria	2921257292	2921259603	163
128	iso_pu_bacteria	2921263974	2921266966	163
129	iso_pu_bacteria	2921282425	2921287354	163
130	iso_pu_bacteria	2921289301	2921294138	163
131	iso_pu_bacteria	2921296804	2921302602	163
132	iso_pu_bacteria	2924144063	2924145997	163
133	iso_pu_bacteria	2924150972	2924154545	163
134	iso_pu_bacteria	2924158325	2924163062	163
135	iso_pu_bacteria	2924165586	2924170308	163
136	iso_pu_bacteria	2924172951	2924176344	163
137	iso_pu_bacteria	2924179722	2924181399	163
138	iso_pu_bacteria	2924186466	2924189846	163
139	iso_pu_bacteria	2924193448	2924196544	163
140	iso_pu_bacteria	2924200457	2924205828	163
141	iso_pu_bacteria	2924207177	2924211221	163
142	iso_pu_bacteria	2924214083	2924217378	163
143	iso_pu_bacteria	2924221636	2924225027	163
144	iso_pu_bacteria	2924228884	2924231441	163
145	iso_pu_bacteria	2936996657	2936999585	163
146	iso_pu_bacteria	2937002841	2937005985	163
147	iso_pu_bacteria	2937009748	2937013275	163
148	iso_pu_bacteria	2937016420	2937019340	163
149	iso_pu_bacteria	2937023124	2937028915	163
150	iso_pu_bacteria	2937029754	2937033651	163
151	iso_pu_bacteria	2937036028	2937037151	163
152	iso_pu_bacteria	2937042894	2937047512	163
153	iso_pu_bacteria	2937049772	2937052468	163
154	iso_pu_bacteria	2937056579	2937063616	163
155	iso_pu_bacteria	2937063883	2937068092	163
156	iso_pu_bacteria	2937071275	2937072992	163
157	iso_pu_bacteria	2937078374	2937079318	163
158	iso_pu_bacteria	2937084907	2937087871	163
159	iso_pu_bacteria	2937091812	2937094088	163
160	iso_pu_bacteria	2937098957	2937106237	163
161	iso_pu_bacteria	2937106411	2937107998	163
162	iso_pu_bacteria	2937113482	2937115222	163
163	iso_pu_bacteria	2937119839	2937123351	163
164	iso_pu_bacteria	2937126314	2937129112	163
165	iso_pu_bacteria	2957375807	2957381476	163
166	iso_pu_bacteria	2957382221	2957387511	163
167	iso_pu_bacteria	2957388812	2957391795	163
168	iso_pu_bacteria	2957395598	2957396630	163
169	iso_pu_bacteria	2957402308	2957404883	163
170	iso_pu_bacteria	2957408893	2957410920	163
171	iso_pu_bacteria	2957415311	2957420142	163
172	iso_pu_bacteria	2957422303	2957426249	163
173	iso_pu_bacteria	2957430029	2957433926	163
174	iso_pu_bacteria	2957437181	2957441132	163
175	iso_pu_bacteria	2957443900	2957445705	163
176	iso_pu_bacteria	2957450854	2957454639	163
177	iso_pu_bacteria	2957457609	2957464006	163
178	iso_pu_bacteria	2957464669	2957467828	163
179	iso_pu_bacteria	2957471148	2957472447	163
180	iso_pu_bacteria	2957478035	2957480715	163
181	iso_pu_bacteria	2957484790	2957488539	163
182	iso_pu_bacteria	2957491536	2957496654	163
183	iso_pu_bacteria	2957498199	2957502659	163
184	iso_pu_bacteria	2957505466	2957506827	163
185	iso_pu_bacteria	2960584000	2960590096	163
186	iso_pu_bacteria	2960591022	2960597316	163
187	iso_pu_bacteria	2960597568	2960598263	163
188	iso_pu_bacteria	2960603979	2960609660	163
189	iso_pu_bacteria	2960610863	2960615174	163
190	iso_pu_bacteria	2960617483	2960620883	163
191	iso_pu_bacteria	2960624210	2960627587	163
192	iso_pu_bacteria	2960631154	2960635920	163
193	iso_pu_bacteria	2960637947	2960644681	163
194	iso_pu_bacteria	2960645483	2960649029	163
195	iso_pu_bacteria	2960652885	2960659241	163
196	iso_pu_bacteria	2960660292	2960662178	163
197	iso_pu_bacteria	2960667422	2960672717	163
198	iso_pu_bacteria	2960674078	2960676456	163
199	iso_pu_bacteria	2960680706	2960687268	163
200	iso_pu_bacteria	2960687367	2960689918	163
201	iso_pu_bacteria	2960693952	2960698407	163
202	iso_pu_bacteria	2964607997	2964611738	163
203	iso_pu_bacteria	2964615318	2964616928	163
204	iso_pu_bacteria	2964621998	2964624616	163
205	iso_pu_bacteria	2964628898	2964631106	163
206	iso_pu_bacteria	2964636051	2964637556	163
207	iso_pu_bacteria	2964643177	2964646449	163
208	iso_pu_bacteria	2964649959	2964651670	163
209	iso_pu_bacteria	2964656573	2964661622	163
210	iso_pu_bacteria	2964663802	2964669891	163
211	iso_pu_bacteria	2964670856	2964673903	163
212	iso_pu_bacteria	2964678106	2964678476	163
213	iso_pu_bacteria	2964685014	2964686878	163
214	iso_pu_bacteria	2964691889	2964694396	163
215	iso_pu_bacteria	2964698721	2964701579	163
216	iso_pu_bacteria	2964705432	2964710989	163
217	iso_pu_bacteria	2964712639	2964714168	163
218	iso_pu_bacteria	2964719344	2964723453	163
219	iso_pu_bacteria	2967664464	2967665128	163
220	iso_pu_bacteria	2967671571	2967675530	163
221	iso_pu_bacteria	2967678726	2967686167	163
222	iso_pu_bacteria	2967686174	2967690101	163
223	iso_pu_bacteria	2967693043	2967697464	163
224	iso_pu_bacteria	2967699805	2967702835	163
225	iso_pu_bacteria	2967706974	2967709051	163
226	iso_pu_bacteria	2967714385	2967716822	163
227	iso_pu_bacteria	2967721400	2967726371	163
228	iso_pu_bacteria	2967728569	2967732734	163
229	iso_pu_bacteria	2967735183	2967740057	163
230	iso_pu_bacteria	2967742019	2967743298	163
231	iso_pu_bacteria	2967748971	2967753747	163
232	iso_pu_bacteria	2967755722	2967758692	163
233	iso_pu_bacteria	2967762386	2967769276	163
234	iso_pu_bacteria	2967769361	2967770917	163
235	iso_pu_bacteria	2967775926	2967780318	163
236	iso_pu_bacteria	2970019648	2970020397	163
237	iso_pu_bacteria	2970026789	2970030842	163
238	iso_pu_bacteria	2970033650	2970034448	163
239	iso_pu_bacteria	2970040964	2970042539	163
240	iso_pu_bacteria	2970047711	2970048930	163
241	iso_pu_bacteria	2970054988	2970057098	163
242	iso_pu_bacteria	2970061556	2970066184	163
243	iso_pu_bacteria	2970068827	2970070859	163
244	iso_pu_bacteria	2970076120	2970079274	163
245	iso_pu_bacteria	2970082768	2970083688	163
246	iso_pu_bacteria	2970088815	2970090454	163
247	iso_pu_bacteria	2970095765	2970099190	163
248	iso_pu_bacteria	2970102677	2970107442	163
249	iso_pu_bacteria	2970109326	2970111642	163
250	iso_pu_bacteria	2970116247	2970121938	163
251	iso_pu_bacteria	2970122695	2970126719	163
252	iso_pu_bacteria	2970129317	2970133426	163
253	iso_pu_bacteria	2970136068	2970143235	163
254	iso_pu_bacteria	2970143518	2970148090	163
255	iso_pu_bacteria	2970149975	2970156379	163
256	iso_pu_bacteria	2970156795	2970161623	163
257	iso_pu_bacteria	2970164137	2970168176	163
258	iso_pu_bacteria	2970170962	2970174712	163
259	iso_pu_bacteria	2970177841	2970180538	163
260	iso_pu_bacteria	2970184632	2970189331	163
261	iso_pu_bacteria	2970191845	2970195806	163
262	iso_pu_bacteria	2977516862	2977521416	163
263	iso_pu_bacteria	2977523885	2977529295	163
264	iso_pu_bacteria	2977530762	2977534801	163
265	iso_pu_bacteria	2977537788	2977542572	163
266	iso_pu_bacteria	2977544691	2977547763	163
267	iso_pu_bacteria	2977551784	2977556381	163
268	iso_pu_bacteria	2977558990	2977560941	163
269	iso_pu_bacteria	2977565890	2977567910	163
270	iso_pu_bacteria	2977572785	2977575179	163
271	iso_pu_bacteria	2977579622	2977584246	163
272	iso_pu_bacteria	648276728	648737502	163
273	iso_pu_bacteria	8003992118	8003993789	163
274	iso_pu_bacteria	8049293176	8049294869	163
275	3300002244	JGI24742J22300_10070681	JGI24742J22300_100706811	164
276	3300005290	Ga0065712_10122077	Ga0065712_101220772	164
277	3300005295	Ga0065707_10538935	Ga0065707_105389351	164
278	3300005327	Ga0070658_10010004	Ga0070658_100100048	164
279	3300005327	Ga0070658_10075444	Ga0070658_100754443	164
280	3300005327	Ga0070658_11377934	Ga0070658_113779341	164
281	3300005328	Ga0070676_10794085	Ga0070676_107940851	164
282	3300005329	Ga0070683_100135633	Ga0070683_1001356332	164
283	3300005330	Ga0070690_100000148	Ga0070690_1000001484	164
284	3300005330	Ga0070690_100071630	Ga0070690_1000716302	164
285	3300005331	Ga0070670_100480948	Ga0070670_1004809482	164
286	3300005333	Ga0070677_10527158	Ga0070677_105271581	164
287	3300005334	Ga0068869_100000103	Ga0068869_10000010331	164
288	3300005334	Ga0068869_100063869	Ga0068869_1000638696	164
289	3300005336	Ga0070680_100000882	Ga0070680_1000008826	164
290	3300005337	Ga0070682_100008721	Ga0070682_1000087215	164
291	3300005337	Ga0070682_100931071	Ga0070682_1009310712	164
292	3300005338	Ga0068868_100001076	Ga0068868_1000010769	164
293	3300005338	Ga0068868_100270401	Ga0068868_1002704011	164
294	3300005338	Ga0068868_100413471	Ga0068868_1004134712	164
295	3300005339	Ga0070660_100428494	Ga0070660_1004284941	164
296	3300005340	Ga0070689_100002361	Ga0070689_1000023619	164
297	3300005340	Ga0070689_100108737	Ga0070689_1001087374	164
298	3300005340	Ga0070689_100160901	Ga0070689_1001609012	164
299	3300005340	Ga0070689_100170739	Ga0070689_1001707392	164
300	3300005340	Ga0070689_100676291	Ga0070689_1006762912	164
301	3300005341	Ga0070691_10003035	Ga0070691_100030357	164
302	3300005341	Ga0070691_10160365	Ga0070691_101603652	164
303	3300005341	Ga0070691_10442088	Ga0070691_104420881	164
304	3300005343	Ga0070687_100000105	Ga0070687_10000010525	164
305	3300005343	Ga0070687_100024661	Ga0070687_1000246615	164
306	3300005343	Ga0070687_100126534	Ga0070687_1001265342	164
307	3300005345	Ga0070692_10005261	Ga0070692_100052615	164
308	3300005345	Ga0070692_10028792	Ga0070692_100287924	164
309	3300005347	Ga0070668_100016417	Ga0070668_1000164172	164
310	3300005353	Ga0070669_100002037	Ga0070669_1000020372	164
311	3300005354	Ga0070675_100036014	Ga0070675_1000360142	164
312	3300005355	Ga0070671_100264110	Ga0070671_1002641102	164
313	3300005355	Ga0070671_100435214	Ga0070671_1004352143	164
314	3300005356	Ga0070674_100059160	Ga0070674_1000591604	164
315	3300005364	Ga0070673_100273397	Ga0070673_1002733972	164
316	3300005364	Ga0070673_100352279	Ga0070673_1003522792	164
317	3300005364	Ga0070673_100532402	Ga0070673_1005324022	164
318	3300005365	Ga0070688_100052888	Ga0070688_1000528881	164
319	3300005365	Ga0070688_100171705	Ga0070688_1001717052	164
320	3300005366	Ga0070659_100264025	Ga0070659_1002640252	164
321	3300005435	Ga0070714_100198431	Ga0070714_1001984314	164
322	3300005435	Ga0070714_100384122	Ga0070714_1003841222	164
323	3300005435	Ga0070714_100412585	Ga0070714_1004125851	164
324	3300005436	Ga0070713_100403414	Ga0070713_1004034142	164
325	3300005436	Ga0070713_101182719	Ga0070713_1011827191	164
326	3300005437	Ga0070710_10689498	Ga0070710_106894981	164
327	3300005438	Ga0070701_10182682	Ga0070701_101826822	164
328	3300005438	Ga0070701_10204055	Ga0070701_102040552	164
329	3300005438	Ga0070701_10656736	Ga0070701_106567361	164
330	3300005440	Ga0070705_100001061	Ga0070705_1000010615	164
331	3300005440	Ga0070705_100005767	Ga0070705_1000057675	164
332	3300005440	Ga0070705_100075917	Ga0070705_1000759172	164
333	3300005440	Ga0070705_100133086	Ga0070705_1001330863	164
334	3300005440	Ga0070705_100212680	Ga0070705_1002126802	164
335	3300005440	Ga0070705_100368473	Ga0070705_1003684732	164
336	3300005441	Ga0070700_100001887	Ga0070700_1000018879	164
337	3300005441	Ga0070700_100009399	Ga0070700_1000093998	164
338	3300005444	Ga0070694_100000110	Ga0070694_10000011032	164
339	3300005444	Ga0070694_100002797	Ga0070694_1000027973	164
340	3300005444	Ga0070694_100013506	Ga0070694_1000135062	164
341	3300005444	Ga0070694_100365442	Ga0070694_1003654422	164
342	3300005444	Ga0070694_100583412	Ga0070694_1005834122	164
343	3300005445	Ga0070708_100207175	Ga0070708_1002071752	164
344	3300005445	Ga0070708_100614047	Ga0070708_1006140472	164
345	3300005457	Ga0070662_100164412	Ga0070662_1001644122	164
346	3300005457	Ga0070662_101016463	Ga0070662_1010164632	164
347	3300005458	Ga0070681_10118573	Ga0070681_101185733	164
348	3300005458	Ga0070681_10301517	Ga0070681_103015172	164
349	3300005458	Ga0070681_11321818	Ga0070681_113218181	164
350	3300005459	Ga0068867_100000441	Ga0068867_10000044113	164
351	3300005459	Ga0068867_100001737	Ga0068867_10000173713	164
352	3300005459	Ga0068867_100305924	Ga0068867_1003059242	164
353	3300005467	Ga0070706_100830358	Ga0070706_1008303582	164
354	3300005468	Ga0070707_100443939	Ga0070707_1004439392	164
355	3300005471	Ga0070698_100193154	Ga0070698_1001931542	164
356	3300005471	Ga0070698_100701983	Ga0070698_1007019831	164
357	3300005518	Ga0070699_100046681	Ga0070699_1000466815	164
358	3300005518	Ga0070699_100154507	Ga0070699_1001545072	164
359	3300005518	Ga0070699_100379676	Ga0070699_1003796763	164
360	3300005530	Ga0070679_100057268	Ga0070679_1000572686	164
361	3300005535	Ga0070684_100020331	Ga0070684_1000203312	164
362	3300005535	Ga0070684_100478817	Ga0070684_1004788172	164
363	3300005535	Ga0070684_101019853	Ga0070684_1010198532	164
364	3300005536	Ga0070697_100203191	Ga0070697_1002031912	164
365	3300005536	Ga0070697_100223627	Ga0070697_1002236272	164
366	3300005536	Ga0070697_100476188	Ga0070697_1004761882	164
367	3300005536	Ga0070697_100480525	Ga0070697_1004805252	164
368	3300005539	Ga0068853_100064747	Ga0068853_1000647472	164
369	3300005543	Ga0070672_100149330	Ga0070672_1001493302	164
370	3300005544	Ga0070686_100000563	Ga0070686_10000056312	164
371	3300005544	Ga0070686_100054520	Ga0070686_1000545203	164
372	3300005545	Ga0070695_100000512	Ga0070695_10000051225	164
373	3300005545	Ga0070695_100064882	Ga0070695_1000648824	164
374	3300005545	Ga0070695_100189216	Ga0070695_1001892162	164
375	3300005545	Ga0070695_100206318	Ga0070695_1002063182	164
376	3300005545	Ga0070695_100228624	Ga0070695_1002286242	164
377	3300005546	Ga0070696_100009252	Ga0070696_1000092527	164
378	3300005546	Ga0070696_100015140	Ga0070696_1000151405	164
379	3300005546	Ga0070696_100040726	Ga0070696_1000407265	164
380	3300005546	Ga0070696_100076603	Ga0070696_1000766033	164
381	3300005546	Ga0070696_100083654	Ga0070696_1000836544	164
382	3300005546	Ga0070696_100288699	Ga0070696_1002886991	164
383	3300005547	Ga0070693_100000101	Ga0070693_1000001014	164
384	3300005547	Ga0070693_100014688	Ga0070693_1000146883	164
385	3300005549	Ga0070704_100000220	Ga0070704_10000022014	164
386	3300005549	Ga0070704_100001535	Ga0070704_1000015355	164
387	3300005549	Ga0070704_100012096	Ga0070704_1000120962	164
388	3300005549	Ga0070704_100017031	Ga0070704_1000170317	164
389	3300005549	Ga0070704_100104157	Ga0070704_1001041571	164
390	3300005549	Ga0070704_100660563	Ga0070704_1006605632	164
391	3300005563	Ga0068855_100001986	Ga0068855_1000019869	164
392	3300005563	Ga0068855_100010909	Ga0068855_1000109099	164
393	3300005563	Ga0068855_100030675	Ga0068855_1000306752	164
394	3300005563	Ga0068855_100169283	Ga0068855_1001692836	164
395	3300005577	Ga0068857_100495085	Ga0068857_1004950852	164
396	3300005577	Ga0068857_100526291	Ga0068857_1005262912	164
397	3300005577	Ga0068857_101310592	Ga0068857_1013105921	164
398	3300005578	Ga0068854_100005853	Ga0068854_1000058535	164
399	3300005578	Ga0068854_100812516	Ga0068854_1008125162	164
400	3300005614	Ga0068856_100009739	Ga0068856_1000097398	164
401	3300005614	Ga0068856_100037843	Ga0068856_1000378433	164
402	3300005614	Ga0068856_100251353	Ga0068856_1002513532	164
403	3300005615	Ga0070702_100000096	Ga0070702_10000009611	164
404	3300005615	Ga0070702_100375112	Ga0070702_1003751121	164
405	3300005616	Ga0068852_100001888	Ga0068852_1000018883	164
406	3300005616	Ga0068852_100205376	Ga0068852_1002053762	164
407	3300005616	Ga0068852_100250388	Ga0068852_1002503882	164
408	3300005617	Ga0068859_100004200	Ga0068859_10000420011	164
409	3300005617	Ga0068859_100179362	Ga0068859_1001793622	164
410	3300005617	Ga0068859_100599324	Ga0068859_1005993243	164
411	3300005618	Ga0068864_100541723	Ga0068864_1005417232	164
412	3300005718	Ga0068866_10000893	Ga0068866_100008939	164
413	3300005718	Ga0068866_10227104	Ga0068866_102271042	164
414	3300005719	Ga0068861_100000826	Ga0068861_1000008269	164
415	3300005719	Ga0068861_100003187	Ga0068861_1000031877	164
416	3300005834	Ga0068851_10093381	Ga0068851_100933813	164
417	3300005840	Ga0068870_10058985	Ga0068870_100589852	164
418	3300005841	Ga0068863_100904215	Ga0068863_1009042151	164
419	3300005841	Ga0068863_101264015	Ga0068863_1012640152	164
420	3300005842	Ga0068858_100002013	Ga0068858_10000201314	164
421	3300005842	Ga0068858_100007196	Ga0068858_10000719612	164
422	3300005843	Ga0068860_100001309	Ga0068860_10000130926	164
423	3300005844	Ga0068862_100001947	Ga0068862_1000019478	164
424	3300005844	Ga0068862_100006062	Ga0068862_1000060627	164
425	3300005844	Ga0068862_100569450	Ga0068862_1005694502	164
426	3300005985	Ga0081539_10001473	Ga0081539_100014739	164
427	3300006051	Ga0075364_10255516	Ga0075364_102555163	164
428	3300006163	Ga0070715_10019529	Ga0070715_100195295	164
429	3300006163	Ga0070715_10052773	Ga0070715_100527732	164
430	3300006175	Ga0070712_100396333	Ga0070712_1003963331	164
431	3300006175	Ga0070712_100642458	Ga0070712_1006424581	164
432	3300006237	Ga0097621_100000106	Ga0097621_10000010627	164
433	3300006237	Ga0097621_100006960	Ga0097621_1000069606	164
434	3300006237	Ga0097621_100012268	Ga0097621_1000122685	164
435	3300006237	Ga0097621_100050892	Ga0097621_1000508923	164
436	3300006237	Ga0097621_100287557	Ga0097621_1002875571	164
437	3300006358	Ga0068871_100002446	Ga0068871_1000024464	164
438	3300006358	Ga0068871_100008532	Ga0068871_1000085329	164
439	3300006358	Ga0068871_100017675	Ga0068871_1000176754	164
440	3300006358	Ga0068871_100182020	Ga0068871_1001820204	164
441	3300006358	Ga0068871_101188804	Ga0068871_1011888042	164
442	3300006844	Ga0075428_100000134	Ga0075428_10000013439	164
443	3300006844	Ga0075428_100047461	Ga0075428_1000474612	164
444	3300006846	Ga0075430_100060701	Ga0075430_1000607014	164
445	3300006847	Ga0075431_100014959	Ga0075431_1000149593	164
446	3300006847	Ga0075431_100209478	Ga0075431_1002094783	164
447	3300006852	Ga0075433_10001519	Ga0075433_1000151912	164
448	3300006852	Ga0075433_10056858	Ga0075433_100568586	164
449	3300006852	Ga0075433_10140793	Ga0075433_101407932	164
450	3300006852	Ga0075433_10363736	Ga0075433_103637363	164
451	3300006852	Ga0075433_10398836	Ga0075433_103988362	164
452	3300006852	Ga0075433_10594228	Ga0075433_105942281	164
453	3300006852	Ga0075433_10692785	Ga0075433_106927852	164
454	3300006852	Ga0075433_10808494	Ga0075433_108084942	164
455	3300006852	Ga0075433_10911110	Ga0075433_109111102	164
456	3300006871	Ga0075434_100000699	Ga0075434_10000069930	164
457	3300006871	Ga0075434_100000813	Ga0075434_10000081323	164
458	3300006871	Ga0075434_100134764	Ga0075434_1001347644	164
459	3300006871	Ga0075434_100348944	Ga0075434_1003489442	164
460	3300006880	Ga0075429_100000271	Ga0075429_10000027118	164
461	3300006880	Ga0075429_100000975	Ga0075429_10000097521	164
462	3300006881	Ga0068865_100000231	Ga0068865_1000002312	164
463	3300006881	Ga0068865_100057228	Ga0068865_1000572284	164
464	3300006881	Ga0068865_100717876	Ga0068865_1007178762	164
465	3300006881	Ga0068865_100775400	Ga0068865_1007754002	164
466	3300006914	Ga0075436_100002436	Ga0075436_1000024368	164
467	3300006914	Ga0075436_100004776	Ga0075436_1000047768	164
468	3300006914	Ga0075436_100006862	Ga0075436_1000068625	164
469	3300006914	Ga0075436_100012375	Ga0075436_1000123751	164
470	3300006914	Ga0075436_100016124	Ga0075436_1000161243	164
471	3300006914	Ga0075436_100076041	Ga0075436_1000760413	164
472	3300006914	Ga0075436_100291279	Ga0075436_1002912792	164
473	3300006931	Ga0097620_100004200	Ga0097620_10000420011	164
474	3300006931	Ga0097620_100179358	Ga0097620_1001793582	164
475	3300006931	Ga0097620_100599261	Ga0097620_1005992613	164
476	3300007076	Ga0075435_100002136	Ga0075435_10000213613	164
477	3300007076	Ga0075435_100035972	Ga0075435_1000359724	164
478	3300007076	Ga0075435_100083482	Ga0075435_1000834822	164
479	3300007076	Ga0075435_100134671	Ga0075435_1001346712	164
480	3300007076	Ga0075435_100672997	Ga0075435_1006729972	164
481	3300007265	Ga0099794_10201826	Ga0099794_102018262	164
482	3300009093	Ga0105240_10002895	Ga0105240_100028951	164
483	3300009093	Ga0105240_10061715	Ga0105240_100617154	164
484	3300009093	Ga0105240_10071509	Ga0105240_100715092	164
485	3300009093	Ga0105240_10161885	Ga0105240_101618854	164
486	3300009094	Ga0111539_10008776	Ga0111539_1000877616	164
487	3300009094	Ga0111539_10305362	Ga0111539_103053622	164
488	3300009098	Ga0105245_10000347	Ga0105245_100003479	164
489	3300009098	Ga0105245_10042334	Ga0105245_100423344	164
490	3300009098	Ga0105245_10489525	Ga0105245_104895253	164
491	3300009147	Ga0114129_10005561	Ga0114129_100055616	164
492	3300009147	Ga0114129_10474621	Ga0114129_104746212	164
493	3300009148	Ga0105243_10000535	Ga0105243_1000053515	164
494	3300009148	Ga0105243_10004257	Ga0105243_100042578	164
495	3300009148	Ga0105243_11054664	Ga0105243_110546641	164
496	3300009174	Ga0105241_10010941	Ga0105241_100109413	164
497	3300009174	Ga0105241_10265525	Ga0105241_102655252	164
498	3300009174	Ga0105241_11244082	Ga0105241_112440822	164
499	3300009176	Ga0105242_10000905	Ga0105242_1000090517	164
500	3300009176	Ga0105242_10001512	Ga0105242_100015122	164
501	3300009176	Ga0105242_10002624	Ga0105242_1000262420	164
502	3300009176	Ga0105242_10013578	Ga0105242_100135784	164
503	3300009176	Ga0105242_10017281	Ga0105242_100172815	164
504	3300009176	Ga0105242_10136475	Ga0105242_101364754	164
505	3300009176	Ga0105242_10777000	Ga0105242_107770001	164
506	3300009177	Ga0105248_10020172	Ga0105248_100201729	164
507	3300009177	Ga0105248_10159204	Ga0105248_101592045	164
508	3300009177	Ga0105248_10633277	Ga0105248_106332772	164
509	3300009177	Ga0105248_10975333	Ga0105248_109753332	164
510	3300009551	Ga0105238_10020415	Ga0105238_1002041510	164
511	3300009551	Ga0105238_10140266	Ga0105238_101402662	164
512	3300009553	Ga0105249_10005947	Ga0105249_100059478	164
513	3300009553	Ga0105249_10032433	Ga0105249_100324334	164
514	3300009553	Ga0105249_10124436	Ga0105249_101244361	164
515	3300009553	Ga0105249_12034013	Ga0105249_120340131	164
516	3300010375	Ga0105239_10110995	Ga0105239_101109954	164
517	3300011119	Ga0105246_10394906	Ga0105246_103949063	164
518	3300013104	Ga0157370_10207967	Ga0157370_102079672	164
519	3300013105	Ga0157369_10047888	Ga0157369_100478882	164
520	3300013105	Ga0157369_10223677	Ga0157369_102236774	164
521	3300013296	Ga0157374_10087241	Ga0157374_100872413	164
522	3300013296	Ga0157374_11017934	Ga0157374_110179342	164
523	3300013297	Ga0157378_10000447	Ga0157378_100004479	164
524	3300013297	Ga0157378_10072444	Ga0157378_100724446	164
525	3300013297	Ga0157378_10884520	Ga0157378_108845201	164
526	3300013306	Ga0163162_10085969	Ga0163162_100859693	164
527	3300013306	Ga0163162_10169220	Ga0163162_101692202	164
528	3300013306	Ga0163162_10658305	Ga0163162_106583052	164
529	3300013306	Ga0163162_10936126	Ga0163162_109361262	164
530	3300013307	Ga0157372_10011227	Ga0157372_100112279	164
531	3300013307	Ga0157372_10016533	Ga0157372_100165332	164
532	3300013308	Ga0157375_10474713	Ga0157375_104747133	164
533	3300014325	Ga0163163_11692111	Ga0163163_116921112	164
534	3300014326	Ga0157380_10157007	Ga0157380_101570072	164
535	3300014326	Ga0157380_10215074	Ga0157380_102150742	164
536	3300014326	Ga0157380_10936208	Ga0157380_109362081	164
537	3300014745	Ga0157377_10126523	Ga0157377_101265233	164
538	3300014968	Ga0157379_10035647	Ga0157379_100356472	164
539	3300014968	Ga0157379_10380073	Ga0157379_103800732	164
540	3300014969	Ga0157376_10002088	Ga0157376_100020889	164
541	3300017792	Ga0163161_11204082	Ga0163161_112040822	164
542	3300021384	Ga0213876_10203956	Ga0213876_102039562	164
543	3300025885	Ga0207653_10010388	Ga0207653_100103883	164
544	3300025898	Ga0207692_10033185	Ga0207692_100331852	164
545	3300025899	Ga0207642_10018538	Ga0207642_100185385	164
546	3300025899	Ga0207642_10555749	Ga0207642_105557491	164
547	3300025901	Ga0207688_10009633	Ga0207688_100096337	164
548	3300025905	Ga0207685_10016491	Ga0207685_100164912	164
549	3300025905	Ga0207685_10168466	Ga0207685_101684662	164
550	3300025906	Ga0207699_10458149	Ga0207699_104581492	164
551	3300025907	Ga0207645_10653619	Ga0207645_106536192	164
552	3300025908	Ga0207643_10034065	Ga0207643_100340652	164
553	3300025909	Ga0207705_10055223	Ga0207705_100552233	164
554	3300025909	Ga0207705_10067749	Ga0207705_100677492	164
555	3300025910	Ga0207684_10733100	Ga0207684_107331002	164
556	3300025911	Ga0207654_10425853	Ga0207654_104258532	164
557	3300025913	Ga0207695_10003454	Ga0207695_100034541	164
558	3300025913	Ga0207695_10148941	Ga0207695_101489413	164
559	3300025917	Ga0207660_10065878	Ga0207660_100658782	164
560	3300025917	Ga0207660_11153753	Ga0207660_111537532	164
561	3300025918	Ga0207662_10000109	Ga0207662_100001092	164
562	3300025918	Ga0207662_10051386	Ga0207662_100513862	164
563	3300025921	Ga0207652_10030375	Ga0207652_100303755	164
564	3300025922	Ga0207646_10301703	Ga0207646_103017032	164
565	3300025922	Ga0207646_10368302	Ga0207646_103683022	164
566	3300025923	Ga0207681_10005710	Ga0207681_1000571010	164
567	3300025924	Ga0207694_10146947	Ga0207694_101469473	164
568	3300025926	Ga0207659_10027967	Ga0207659_100279673	164
569	3300025926	Ga0207659_10290999	Ga0207659_102909992	164
570	3300025927	Ga0207687_10010136	Ga0207687_100101363	164
571	3300025927	Ga0207687_10073432	Ga0207687_100734324	164
572	3300025927	Ga0207687_10172205	Ga0207687_101722054	164
573	3300025927	Ga0207687_10449317	Ga0207687_104493172	164
574	3300025929	Ga0207664_10592560	Ga0207664_105925602	164
575	3300025932	Ga0207690_10082586	Ga0207690_100825863	164
576	3300025933	Ga0207706_10088982	Ga0207706_100889825	164
577	3300025933	Ga0207706_10131628	Ga0207706_101316282	164
578	3300025934	Ga0207686_10001982	Ga0207686_100019829	164
579	3300025934	Ga0207686_10018157	Ga0207686_100181576	164
580	3300025934	Ga0207686_10086270	Ga0207686_100862702	164
581	3300025934	Ga0207686_10100601	Ga0207686_101006013	164
582	3300025934	Ga0207686_10190999	Ga0207686_101909994	164
583	3300025934	Ga0207686_10628660	Ga0207686_106286602	164
584	3300025935	Ga0207709_10002130	Ga0207709_100021302	164
585	3300025935	Ga0207709_10003201	Ga0207709_100032016	164
586	3300025935	Ga0207709_10313750	Ga0207709_103137502	164
587	3300025936	Ga0207670_10009930	Ga0207670_100099305	164
588	3300025936	Ga0207670_10121748	Ga0207670_101217482	164
589	3300025936	Ga0207670_10222450	Ga0207670_102224502	164
590	3300025936	Ga0207670_10426811	Ga0207670_104268112	164
591	3300025936	Ga0207670_10452459	Ga0207670_104524592	164
592	3300025936	Ga0207670_10573986	Ga0207670_105739862	164
593	3300025937	Ga0207669_10036799	Ga0207669_100367993	164
594	3300025938	Ga0207704_10008864	Ga0207704_100088642	164
595	3300025938	Ga0207704_10023598	Ga0207704_100235983	164
596	3300025938	Ga0207704_10821733	Ga0207704_108217332	164
597	3300025938	Ga0207704_10872868	Ga0207704_108728682	164
598	3300025939	Ga0207665_10882135	Ga0207665_108821352	164
599	3300025940	Ga0207691_10336608	Ga0207691_103366083	164
600	3300025941	Ga0207711_10067898	Ga0207711_100678982	164
601	3300025941	Ga0207711_10693143	Ga0207711_106931431	164
602	3300025942	Ga0207689_10000532	Ga0207689_1000053225	164
603	3300025942	Ga0207689_10044044	Ga0207689_100440442	164
604	3300025944	Ga0207661_10093302	Ga0207661_100933023	164
605	3300025949	Ga0207667_10026319	Ga0207667_100263195	164
606	3300025949	Ga0207667_10091486	Ga0207667_100914864	164
607	3300025949	Ga0207667_10370534	Ga0207667_103705342	164
608	3300025949	Ga0207667_10709918	Ga0207667_107099182	164
609	3300025961	Ga0207712_10003243	Ga0207712_1000324313	164
610	3300025961	Ga0207712_10065714	Ga0207712_100657142	164
611	3300025961	Ga0207712_10188043	Ga0207712_101880432	164
612	3300025961	Ga0207712_11481257	Ga0207712_114812571	164
613	3300025972	Ga0207668_10152942	Ga0207668_101529423	164
614	3300025981	Ga0207640_10136945	Ga0207640_101369453	164
615	3300026023	Ga0207677_10007130	Ga0207677_100071305	164
616	3300026023	Ga0207677_10191492	Ga0207677_101914923	164
617	3300026023	Ga0207677_10736880	Ga0207677_107368802	164
618	3300026035	Ga0207703_10026056	Ga0207703_100260562	164
619	3300026035	Ga0207703_10861590	Ga0207703_108615902	164
620	3300026035	Ga0207703_11321356	Ga0207703_113213562	164
621	3300026041	Ga0207639_10115403	Ga0207639_101154033	164
622	3300026041	Ga0207639_10183033	Ga0207639_101830334	164
623	3300026041	Ga0207639_10794125	Ga0207639_107941252	164
624	3300026075	Ga0207708_10000712	Ga0207708_1000071212	164
625	3300026075	Ga0207708_10003441	Ga0207708_100034412	164
626	3300026075	Ga0207708_10312524	Ga0207708_103125242	164
627	3300026075	Ga0207708_10421411	Ga0207708_104214112	164
628	3300026075	Ga0207708_10966896	Ga0207708_109668962	164
629	3300026078	Ga0207702_10009029	Ga0207702_100090299	164
630	3300026078	Ga0207702_10040144	Ga0207702_100401446	164
631	3300026078	Ga0207702_10146020	Ga0207702_101460202	164
632	3300026088	Ga0207641_11149338	Ga0207641_111493382	164
633	3300026089	Ga0207648_10000505	Ga0207648_1000050511	164
634	3300026089	Ga0207648_10188736	Ga0207648_101887362	164
635	3300026089	Ga0207648_10283810	Ga0207648_102838102	164
636	3300026095	Ga0207676_10707698	Ga0207676_107076982	164
637	3300026116	Ga0207674_10482920	Ga0207674_104829202	164
638	3300026116	Ga0207674_10527796	Ga0207674_105277962	164
639	3300026118	Ga0207675_100000625	Ga0207675_10000062526	164
640	3300026118	Ga0207675_100000760	Ga0207675_10000076016	164
641	3300026121	Ga0207683_10122736	Ga0207683_101227362	164
642	3300026142	Ga0207698_10061806	Ga0207698_100618062	164
643	3300026142	Ga0207698_10105045	Ga0207698_101050452	164
644	3300027360	Ga0209969_1015731	Ga0209969_10157312	164
645	3300027364	Ga0209967_1001411	Ga0209967_10014112	164
646	3300027378	Ga0209981_1002546	Ga0209981_10025463	164
647	3300027378	Ga0209981_1017810	Ga0209981_10178102	164
648	3300027462	Ga0210000_1007602	Ga0210000_10076021	164
649	3300027526	Ga0209968_1005587	Ga0209968_10055872	164
650	3300027543	Ga0209999_1007649	Ga0209999_10076492	164
651	3300027682	Ga0209971_1038064	Ga0209971_10380642	164
652	3300027717	Ga0209998_10079843	Ga0209998_100798432	164
653	3300027907	Ga0207428_10004302	Ga0207428_100043026	164
654	3300027907	Ga0207428_10170429	Ga0207428_101704293	164
655	3300027907	Ga0207428_10221607	Ga0207428_102216072	164
656	3300028380	Ga0268265_10004002	Ga0268265_100040022	164
657	3300028380	Ga0268265_10034846	Ga0268265_100348464	164
658	3300028381	Ga0268264_10015338	Ga0268264_100153386	164
659	3300028381	Ga0268264_10794170	Ga0268264_107941702	164
660	3300031548	Ga0307408_100160940	Ga0307408_1001609402	164
661	3300031691	Ga0316579_10002021	Ga0316579_100020218	164
662	3300031728	Ga0316578_10029888	Ga0316578_100298882	164
663	3300031731	Ga0307405_10664978	Ga0307405_106649782	164
664	3300031995	Ga0307409_100167378	Ga0307409_1001673782	164
665	3300032002	Ga0307416_100093272	Ga0307416_1000932722	164
666	3300032005	Ga0307411_10498057	Ga0307411_104980572	164
667	3300032005	Ga0307411_10764858	Ga0307411_107648581	164
668	3300032005	Ga0307411_11853126	Ga0307411_118531261	164
669	3300032133	Ga0316583_10004918	Ga0316583_100049188	164
670	3300032133	Ga0316583_10007067	Ga0316583_100070674	164
671	3300034819	Ga0373958_0082813	Ga0373958_0082813_191_703	164
672	3300034820	Ga0373959_0014773	Ga0373959_0014773_188_685	164
673	3300034820	Ga0373959_0070637	Ga0373959_0070637_202_696	164
674	3300034957	Ga0373938_0057225	Ga0373938_0057225_253_747	164
675	3300035083	Ga0373926_0000860	Ga0373926_0000860_7475_7972	164
676	3300035084	Ga0373928_0021740	Ga0373928_0021740_180_677	164
677	3300035085	Ga0373929_0033902	Ga0373929_0033902_212_709	164
678	3300035088	Ga0373940_0149405	Ga0373940_0149405_143_640	164
679	3300035089	Ga0373944_0003250	Ga0373944_0003250_1125_1622	164
680	3300035090	Ga0373949_0008285	Ga0373949_0008285_1100_1597	164
681	3300035091	Ga0373951_0075804	Ga0373951_0075804_145_642	164
682	3300035111	Ga0373923_0173607	Ga0373923_0173607_284_781	164
683	3300035112	Ga0373932_0021715	Ga0373932_0021715_864_1361	164
684	3300035113	Ga0373936_0015541	Ga0373936_0015541_612_1109	164
685	3300035114	Ga0373939_0175761	Ga0373939_0175761_62_559	164
686	3300035116	Ga0373945_0100842	Ga0373945_0100842_197_694	164
687	3300035117	Ga0373953_0066757	Ga0373953_0066757_455_985	164
688	3300035119	Ga0373956_0031880	Ga0373956_0031880_1004_1504	164
689	3300035119	Ga0373956_0138156	Ga0373956_0138156_34_546	164
690	3300035170	Ga0373943_0014896	Ga0373943_0014896_2825_3322	164
691	3300035171	Ga0373946_0027606	Ga0373946_0027606_1408_1905	164
692	3300035241	Ga0373961_0043149	Ga0373961_0043149_449_946	164
693	3300035410	Ga0373924_0090529	Ga0373924_0090529_793_1287	164
694	3300035410	Ga0373924_0140078	Ga0373924_0140078_14_511	164
695	3300035691	Ga0373931_0021431	Ga0373931_0021431_1173_1670	164
696	3300035691	Ga0373931_0159308	Ga0373931_0159308_511_1005	164
697	3300035691	Ga0373931_0173253	Ga0373931_0173253_495_1007	164
698	3300035691	Ga0373931_0783976	Ga0373931_0783976_91_585	164
699	3300035692	Ga0373935_0003949	Ga0373935_0003949_5234_5731	164
700	3300035695	Ga0373927_0009382	Ga0373927_0009382_729_1226	164
701	3300035695	Ga0373927_0095449	Ga0373927_0095449_1203_1724	164
702	3300035725	Ga0373947_0009088	Ga0373947_0009088_2267_2764	164
703	3300036401	Ga0373937_0012385	Ga0373937_0012385_1070_1570	164
704	3300036401	Ga0373937_0193022	Ga0373937_0193022_91_585	164
705	3300036647	Ga0316582_0044224	Ga0316582_0044224_1044_1538	164
706	3300037418	Ga0395900_0398199	Ga0395900_0398199_212_748	164
707	3300039437	Ga0436365_1397623	Ga0436365_1397623_1367_1879	164
708	3300039453	Ga0436362_0387917	Ga0436362_0387917_57_551	164
709	3300041410	Ga0439461_0008132	Ga0439461_0008132_497_991	164
710	3300041501	Ga0451845_0782002	Ga0451845_0782002_222_740	164
711	3300042015	Ga0439462_0223826	Ga0439462_0223826_21_515	164
712	3300042156	Ga0439446_0012744	Ga0439446_0012744_1511_2005	164
713	3300042436	Ga0439435_0002663	Ga0439435_0002663_611_1105	164
714	3300042876	Ga0451577_0029192	Ga0451577_0029192_1613_2110	164
715	3300042876	Ga0451577_1427551	Ga0451577_1427551_38_532	164
716	3300044684	Ga0466966_0042939	Ga0466966_0042939_1038_1550	164
717	3300044684	Ga0466966_0195470	Ga0466966_0195470_35_547	164
718	3300044706	Ga0466964_0347144	Ga0466964_0347144_40_534	164
719	3300045049	Ga0466959_0172851	Ga0466959_0172851_807_1319	164
720	3300045051	Ga0451576_0005592	Ga0451576_0005592_2205_2702	164
721	3300045051	Ga0451576_0023317	Ga0451576_0023317_4860_5357	164
722	3300045051	Ga0451576_0044258	Ga0451576_0044258_1657_2154	164
723	3300045051	Ga0451576_0444608	Ga0451576_0444608_518_1012	164
724	3300045051	Ga0451576_0961944	Ga0451576_0961944_177_671	164
725	3300045836	Ga0466958_0417679	Ga0466958_0417679_125_619	164
726	3300045976	Ga0466967_0043252	Ga0466967_0043252_2835_3329	164
727	3300046454	Ga0495592_0056995	Ga0495592_0056995_1783_2295	164
728	3300046455	Ga0495603_0014327	Ga0495603_0014327_2308_2805	164
729	3300046457	Ga0495590_0198529	Ga0495590_0198529_176_706	164
730	3300046462	Ga0495651_0087495	Ga0495651_0087495_1386_1880	164
731	3300046472	Ga0495580_0010043	Ga0495580_0010043_108_605	164
732	3300046473	Ga0495582_0070394	Ga0495582_0070394_855_1352	164
733	3300046475	Ga0495639_0011028	Ga0495639_0011028_2124_2621	164
734	3300046501	Ga0495607_0000252	Ga0495607_0000252_4118_4723	164
735	3300046512	Ga0495610_0002342	Ga0495610_0002342_2166_2705	164
736	3300046516	Ga0495628_0050060	Ga0495628_0050060_1132_1644	164
737	3300046517	Ga0495630_0070696	Ga0495630_0070696_1898_2395	164
738	3300046523	Ga0495644_0123118	Ga0495644_0123118_133_630	164
739	3300046526	Ga0495666_0024995	Ga0495666_0024995_947_1444	164
740	3300046535	Ga0495586_0018472	Ga0495586_0018472_2350_2847	164
741	3300046536	Ga0495587_0019410	Ga0495587_0019410_733_1245	164
742	3300046539	Ga0495621_0328780	Ga0495621_0328780_59_571	164
743	3300046543	Ga0495645_0021953	Ga0495645_0021953_1086_1598	164
744	3300046543	Ga0495645_0645820	Ga0495645_0645820_25_519	164
745	3300046559	Ga0495667_0095135	Ga0495667_0095135_292_822	164
746	3300046559	Ga0495667_0148633	Ga0495667_0148633_514_1014	164
747	3300046615	Ga0495656_0027754	Ga0495656_0027754_1159_1656	164
748	3300046616	Ga0495668_0505675	Ga0495668_0505675_59_610	164
749	3300046642	Ga0495634_0004662	Ga0495634_0004662_4670_5164	164
750	3300046674	Ga0495588_0026638	Ga0495588_0026638_209_706	164
751	3300046678	Ga0495599_0025674	Ga0495599_0025674_251_763	164
752	3300046679	Ga0495623_0026028	Ga0495623_0026028_2219_2731	164
753	3300046681	Ga0495647_0009745	Ga0495647_0009745_1405_1902	164
754	3300046683	Ga0495658_0011063	Ga0495658_0011063_2152_2649	164
755	3300046809	Ga0495600_0047585	Ga0495600_0047585_293_823	164
756	3300047315	Ga0495581_0202956	Ga0495581_0202956_623_1117	164
757	3300047318	Ga0495636_0034583	Ga0495636_0034583_666_1160	164
758	3300047319	Ga0495674_0316150	Ga0495674_0316150_583_1113	164
759	3300047321	Ga0495676_0052952	Ga0495676_0052952_912_1409	164
760	3300047322	Ga0495680_0535178	Ga0495680_0535178_239_751	164
761	3300047444	Ga0495675_0481843	Ga0495675_0481843_142_636	164
762	3300048088	Ga0495602_0276733	Ga0495602_0276733_506_1018	164
763	3300048088	Ga0495602_0375412	Ga0495602_0375412_212_712	164
764	3300048909	Ga0496106_0000050	Ga0496106_0000050_51439_51990	164
765	3300049568	Ga0501031_0493777	Ga0501031_0493777_50_544	164
766	3300049568	Ga0501031_0509811	Ga0501031_0509811_230_724	164
767	3300049570	Ga0501033_0143727	Ga0501033_0143727_831_1325	164
768	3300049570	Ga0501033_0195046	Ga0501033_0195046_535_1029	164
769	3300049572	Ga0501036_0001519	Ga0501036_0001519_6669_7163	164
770	3300049572	Ga0501036_0081257	Ga0501036_0081257_1793_2287	164
771	3300049572	Ga0501036_0646894	Ga0501036_0646894_164_658	164
772	3300049572	Ga0501036_0718779	Ga0501036_0718779_287_787	164
773	3300049573	Ga0501037_0093288	Ga0501037_0093288_261_755	164
774	3300049573	Ga0501037_0277826	Ga0501037_0277826_610_1104	164
775	3300049574	Ga0501038_0001082	Ga0501038_0001082_10821_11315	164
776	3300049575	Ga0501039_0000168	Ga0501039_0000168_12619_13113	164
777	3300049575	Ga0501039_0096719	Ga0501039_0096719_925_1419	164
778	3300049576	Ga0501040_0001149	Ga0501040_0001149_3589_4083	164
779	3300049576	Ga0501040_0015585	Ga0501040_0015585_1059_1553	164
780	3300049576	Ga0501040_0196526	Ga0501040_0196526_802_1299	164
781	3300049576	Ga0501040_0205722	Ga0501040_0205722_57_557	164
782	3300049577	Ga0501041_0000623	Ga0501041_0000623_14274_14768	164
783	3300049577	Ga0501041_0136412	Ga0501041_0136412_1024_1518	164
784	3300049578	Ga0501042_0010653	Ga0501042_0010653_4613_5107	164
785	3300049578	Ga0501042_0046342	Ga0501042_0046342_1469_1963	164
786	3300049578	Ga0501042_0080229	Ga0501042_0080229_224_718	164
787	3300049578	Ga0501042_0409191	Ga0501042_0409191_372_869	164
788	3300049579	Ga0501043_0137507	Ga0501043_0137507_784_1278	164
789	3300049580	Ga0501046_0000480	Ga0501046_0000480_8448_8942	164
790	3300049580	Ga0501046_0241570	Ga0501046_0241570_665_1159	164
791	3300049582	Ga0501048_0000896	Ga0501048_0000896_16579_17073	164
792	3300049582	Ga0501048_0618750	Ga0501048_0618750_114_608	164
793	3300049583	Ga0501067_0029549	Ga0501067_0029549_1306_1800	164
794	3300049584	Ga0501068_0024852	Ga0501068_0024852_1249_1743	164
795	3300049587	Ga0501071_0134164	Ga0501071_0134164_274_768	164
796	3300049587	Ga0501071_0944765	Ga0501071_0944765_101_601	164
797	3300049588	Ga0501072_0060341	Ga0501072_0060341_832_1326	164
798	3300049588	Ga0501072_0119918	Ga0501072_0119918_653_1150	164
799	3300049590	Ga0501074_0130568	Ga0501074_0130568_186_680	164
800	3300049590	Ga0501074_0834396	Ga0501074_0834396_37_534	164
801	3300049591	Ga0501075_0000046	Ga0501075_0000046_14179_14673	164
802	3300049591	Ga0501075_0066463	Ga0501075_0066463_359_859	164
803	3300049592	Ga0501076_0000566	Ga0501076_0000566_6680_7174	164
804	3300049593	Ga0501077_0004244	Ga0501077_0004244_3282_3776	164
805	3300049593	Ga0501077_0104385	Ga0501077_0104385_130_624	164
806	3300049741	Ga0501079_0000808	Ga0501079_0000808_12890_13384	164
807	3300049743	Ga0501081_0001689	Ga0501081_0001689_4306_4800	164
808	3300049822	Ga0501035_0004374	Ga0501035_0004374_5580_6074	164
809	3300049824	Ga0501045_0000436	Ga0501045_0000436_3903_4397	164
810	3300049824	Ga0501045_0019929	Ga0501045_0019929_639_1133	164
811	3300050491	nmdc:mga00v17_256636_c1	nmdc:mga00v17_256636_c1_26_538	164
812	3300050507	nmdc:mga05p37_1059_c1	nmdc:mga05p37_1059_c1_20991_21485	164
813	3300050507	nmdc:mga05p37_2687_c1	nmdc:mga05p37_2687_c1_18308_18805	164
814	3300050507	nmdc:mga05p37_454651_c1	nmdc:mga05p37_454651_c1_508_1005	164
815	3300050508	nmdc:mga09592_417012_c1	nmdc:mga09592_417012_c1_394_888	164
816	3300050508	nmdc:mga09592_438_c1	nmdc:mga09592_438_c1_13203_13700	164
817	3300050508	nmdc:mga09592_61_c1	nmdc:mga09592_61_c1_11444_11938	164
818	3300050508	nmdc:mga09592_622892_c1	nmdc:mga09592_622892_c1_153_650	164
819	3300050509	nmdc:mga0qj67_574707_c1	nmdc:mga0qj67_574707_c1_176_673	164
820	3300050509	nmdc:mga0qj67_795943_c1	nmdc:mga0qj67_795943_c1_73_567	164
821	3300050510	nmdc:mga06r32_11848_c1	nmdc:mga06r32_11848_c1_1323_1817	164
822	3300050510	nmdc:mga06r32_332627_c1	nmdc:mga06r32_332627_c1_235_729	164
823	3300050510	nmdc:mga06r32_914978_c1	nmdc:mga06r32_914978_c1_21_518	164
824	3300050511	nmdc:mga08y16_334659_c1	nmdc:mga08y16_334659_c1_248_745	164
825	3300050511	nmdc:mga08y16_46313_c1	nmdc:mga08y16_46313_c1_730_1224	164
826	3300050511	nmdc:mga08y16_48826_c1	nmdc:mga08y16_48826_c1_3486_3980	164
827	3300050511	nmdc:mga08y16_7845_c1	nmdc:mga08y16_7845_c1_998_1495	164
828	3300050512	nmdc:mga0n895_10713_c1	nmdc:mga0n895_10713_c1_6919_7413	164
829	3300050512	nmdc:mga0n895_11009_c1	nmdc:mga0n895_11009_c1_6598_7092	164
830	3300050512	nmdc:mga0n895_186096_c1	nmdc:mga0n895_186096_c1_709_1206	164
831	3300050512	nmdc:mga0n895_218696_c1	nmdc:mga0n895_218696_c1_384_896	164
832	3300050512	nmdc:mga0n895_3867_c1	nmdc:mga0n895_3867_c1_2023_2517	164
833	3300050512	nmdc:mga0n895_968802_c1	nmdc:mga0n895_968802_c1_37_531	164
834	3300050513	nmdc:mga0rr50_123773_c1	nmdc:mga0rr50_123773_c1_1218_1730	164
835	3300050513	nmdc:mga0rr50_16364_c1	nmdc:mga0rr50_16364_c1_3752_4246	164
836	3300050513	nmdc:mga0rr50_319066_c1	nmdc:mga0rr50_319066_c1_712_1206	164
837	3300050513	nmdc:mga0rr50_386804_c1	nmdc:mga0rr50_386804_c1_579_1073	164
838	3300050513	nmdc:mga0rr50_569018_c1	nmdc:mga0rr50_569018_c1_224_754	164
839	3300050513	nmdc:mga0rr50_90379_c1	nmdc:mga0rr50_90379_c1_1822_2316	164
840	3300050514	nmdc:mga08x19_127739_c1	nmdc:mga08x19_127739_c1_609_1103	164
841	3300050514	nmdc:mga08x19_200146_c1	nmdc:mga08x19_200146_c1_766_1260	164
842	3300050514	nmdc:mga08x19_375_c1	nmdc:mga08x19_375_c1_2911_3423	164
843	3300050514	nmdc:mga08x19_4952_c1	nmdc:mga08x19_4952_c1_5236_5730	164
844	3300050514	nmdc:mga08x19_591298_c1	nmdc:mga08x19_591298_c1_81_575	164
845	3300050514	nmdc:mga08x19_62866_c1	nmdc:mga08x19_62866_c1_1145_1639	164
846	3300050515	nmdc:mga0a205_1027619_c1	nmdc:mga0a205_1027619_c1_28_522	164
847	3300050515	nmdc:mga0a205_1599_c1	nmdc:mga0a205_1599_c1_4662_5159	164
848	3300050515	nmdc:mga0a205_211694_c1	nmdc:mga0a205_211694_c1_651_1145	164
849	3300050515	nmdc:mga0a205_57835_c1	nmdc:mga0a205_57835_c1_180_710	164
850	3300050515	nmdc:mga0a205_651264_c1	nmdc:mga0a205_651264_c1_167_664	164
851	3300050515	nmdc:mga0a205_742087_c1	nmdc:mga0a205_742087_c1_169_663	164
852	3300050515	nmdc:mga0a205_745504_c1	nmdc:mga0a205_745504_c1_202_699	164
853	3300050515	nmdc:mga0a205_76699_c1	nmdc:mga0a205_76699_c1_2308_2802	164
854	3300053077	Ga0495601_0010036	Ga0495601_0010036_1967_2497	164
855	3300053084	Ga0495595_0015779	Ga0495595_0015779_2141_2653	164
856	3300053084	Ga0495595_0182921	Ga0495595_0182921_290_784	164
857	3300053085	Ga0495619_0082090	Ga0495619_0082090_1496_2008	164
858	3300053096	Ga0500641_0016899	Ga0500641_0016899_1014_1532	164
859	3300053134	Ga0500658_0005736	Ga0500658_0005736_3627_4178	164
860	3300053139	Ga0500568_0001502	Ga0500568_0001502_7826_8377	164
861	3300054114	Ga0501084_0034303	Ga0501084_0034303_805_1299	164
862	3300059421	Ga0590071_042212	Ga0590071_042212_323_817	164
863	3300059424	Ga0590075_026696	Ga0590075_026696_662_1156	164
864	3300060353	Ga0501082_0002802	Ga0501082_0002802_11012_11506	164
865	3300061719	Ga0466962_0117165	Ga0466962_0117165_771_1265	164
866	3300061734	Ga0530510_0025258	Ga0530510_0025258_3711_4205	164
867	3300061734	Ga0530510_0303098	Ga0530510_0303098_515_1009	164
868	3300061734	Ga0530510_0741910	Ga0530510_0741910_185_679	164
869	iso_pu_bacteria	2585427594	2585846773	164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

34

166

0.98 PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

16

69

0.93 PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

33

171

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6b9d-assembly1.cif.gz_A	human atl1 mutant - r77a bound to gdp	0.8713	2	28
5hci-assembly4.cif.gz_F-5	gpn-loop gtpase npa3 in complex with gdp	0.853	1	36
5hci-assembly2.cif.gz_B-3	gpn-loop gtpase npa3 in complex with gdp	0.8515	1	36
7oyd-assembly1.cif.gz_v	cryo-em structure of a rabbit 80s ribosome with zebrafish dap1b	0.7968	2	24
1ii0-assembly2.cif.gz_B	crystal structure of the escherichia coli arsenite-translocating atpase	0.79	2	36

ID	Description	Score	Start	End	Superfamily
af_A0A1D8PEF9_556_791_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8742	1	34	3.40.50.300
af_Q5BK22_89_283_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8474	1	24	3.40.50.300
af_P47122_2_271_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8381	1	36	3.40.50.300
af_Q07657_23_341_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8296	1	23	3.40.50.300
af_A0A1D6I1M0_330_626_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8221	4	36	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A426FSQ4-F1-model_v4	Molybdopterin-guanine dinucleotide biosynthesis protein B	0.8025	2	163	GO:0005525 GO:0006777
AF-A0A1F4F8S5-F1-model_v4	Molybdopterin-guanine dinucleotide biosynthesis protein B	0.7999	1	164	GO:0005525 GO:0006777
AF-A0A238KQS4-F1-model_v4	Molybdopterin molybdenumtransferase (EC 2.10.1.1)	0.7964	1	164	GO:0005525 GO:0005829 GO:0006777 GO:0046872 GO:0061599
AF-A0A1F3ZVX0-F1-model_v4	Molybdopterin-guanine dinucleotide biosynthesis protein B	0.7951	1	164	GO:0005525 GO:0006777
AF-A0A0E9MI98-F1-model_v4	Molybdopterin-guanine dinucleotide biosynthesis protein MobB	0.7951	1	164	GO:0005525 GO:0006777

Feature Viewer

pLDDT	pTM	Quality
88.53	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F484110

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

34

166

0.98

PF03308

MeaB

Methylmalonyl Co-A mutase-associated GTPase MeaB

16

69

0.93

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

33

171

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map