F484038

General Info

Members Datasets Scaffolds Average Seq Length
866 537 627 112

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0003305|Ga0500559_0003305_5705_6079
Length 124
Sequence VTAPSNSLDNPMSEQITYADFERVDIRVGTVIEASPFPEARKPAIKLVIDFGPEIGIKKSSAQITVHYTPETMVGRQVLGVVNFPPRQIGPFRSEVLTLGFEDENGAIVLATPGLGVPNGKKLI

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516143018 Ensifer sp. BR816 Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
31 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
32 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
33 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
34 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
35 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
36 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
37 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
38 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
39 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
40 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
41 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
42 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
43 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
44 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
45 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
46 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
47 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
48 2643221568 Rhizobium sp. Root564 Isolate Unclassified
49 2643221582 Rhizobium sp. Root651 Isolate Unclassified
50 2643221607 Rhizobium sp. Root73 Isolate Unclassified
51 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
52 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
53 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
54 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
55 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
56 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
57 2643221688 Rhizobium sp. Root482 Isolate Unclassified
58 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
59 2643221693 Rhizobium sp. Root491 Isolate Unclassified
60 2643221718 Rhizobium sp. Root268 Isolate Unclassified
61 2643221719 Rhizobium sp. Root274 Isolate Unclassified
62 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
63 2718217882 Rhizobium sp. N741 Isolate Nodule
64 2718217927 Rhizobium sp. N324 Isolate Nodule
65 2718218009 Rhizobium sp. N561 Isolate Nodule
66 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
67 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
68 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
69 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
70 2718218363 Rhizobium sp. N113 Isolate Nodule
71 2718218365 Rhizobium sp. N731 Isolate Nodule
72 2718218366 Rhizobium sp. N621 Isolate Nodule
73 2718218423 Rhizobium sp. N941 Isolate Nodule
74 2721755514 Rhizobium sp. N6212 Isolate Nodule
75 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
76 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
77 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
78 2721755809 Rhizobium sp. N541 Isolate Nodule
79 2721755810 Rhizobium sp. N871 Isolate Nodule
80 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
81 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
82 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
83 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
84 2728369365 Rhizobium sp. N1341 Isolate Nodule
85 2728369397 Rhizobium sp. N1314 Isolate Nodule
86 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
87 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
88 2791355261 Rhizobium sp. J15 Isolate Nodule
89 2791355263 Rhizobium chutanense C5 Isolate Nodule
90 2791355266 Rhizobium sp. L43 Isolate Nodule
91 2791355267 Rhizobium sp. L18 Isolate Nodule
92 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
93 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
94 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
95 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
96 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
97 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
98 2802429633 Rhizobium anhuiense J3 Isolate Nodule
99 2802429634 Rhizobium anhuiense S10 Isolate Nodule
100 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
101 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
102 2802429637 Rhizobium anhuiense C15 Isolate Nodule
103 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
104 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
105 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
106 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
107 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
108 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
109 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
110 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
111 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
112 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
113 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
114 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
115 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
116 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
117 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
118 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
119 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
120 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
121 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
122 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
123 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
124 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
125 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
126 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
127 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
128 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
129 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
130 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
131 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
132 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
133 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
134 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
135 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
136 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
137 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
138 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
139 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
140 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
141 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
142 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
143 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
144 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
145 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
146 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
147 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
148 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
149 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
150 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
151 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
152 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
153 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
154 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
155 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
156 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
157 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
158 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
159 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
160 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
161 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
162 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
163 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
164 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
165 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
166 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
167 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
168 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
169 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
170 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
171 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
172 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
173 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
174 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
175 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
176 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
177 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
178 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
179 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
180 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
181 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
182 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
183 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
184 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
185 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
186 2933599457 Rhizobium phaseoli M3 Isolate Nodule
187 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
188 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
189 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
190 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
191 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
192 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
193 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
194 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
195 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
196 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
197 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
198 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
199 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
200 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
201 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
202 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
203 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
204 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
205 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
206 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
207 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
208 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
209 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
210 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
211 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
212 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
213 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
214 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
215 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
216 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
217 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
218 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
219 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
220 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
221 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
222 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
223 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
224 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
225 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
226 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
227 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
228 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
229 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
230 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
231 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
232 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
233 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
234 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
235 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
236 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
237 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
238 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
239 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
240 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
241 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
242 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
243 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
244 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
245 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
246 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
247 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
248 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
249 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
250 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
251 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
252 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
253 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
254 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
255 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
256 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
257 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
258 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
259 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
260 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
261 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
262 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
263 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
264 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
265 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
266 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
267 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
268 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
269 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
270 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
271 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
272 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
273 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
274 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
275 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
276 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
277 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
278 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
279 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
280 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
281 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
282 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
283 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
284 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
285 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
286 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
287 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
288 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
289 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
290 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
291 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
292 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
293 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
294 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
296 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
328 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
330 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
333 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
334 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
335 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
336 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
339 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
342 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
348 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
349 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
350 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
351 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
352 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
353 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
354 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
355 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
356 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
357 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
358 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
359 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
362 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
363 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
364 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
365 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
366 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
367 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
368 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
369 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
370 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
371 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
372 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
373 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
374 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
375 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
376 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
377 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
378 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
379 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
380 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
381 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
382 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
383 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
384 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
385 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
386 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
387 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
391 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
392 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
393 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
394 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
395 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
396 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
397 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
398 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
399 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
400 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
404 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
405 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
406 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
413 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
414 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
423 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
424 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
430 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
433 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
434 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
435 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
436 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
437 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
438 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
439 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
440 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
441 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
442 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
443 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
444 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
445 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
446 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
458 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
459 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
464 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
465 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
466 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
467 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
469 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
470 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
471 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
472 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
473 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
478 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
479 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
483 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
484 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
485 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
486 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
487 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
488 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
489 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
490 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
491 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
492 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
493 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
494 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
500 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
501 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
502 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
503 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
504 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
507 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
508 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
509 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
510 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
511 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
512 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
513 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
514 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
515 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
516 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
517 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
518 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
519 8005275841 Rhizobium sp. N4311 Isolate Nodule
520 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
521 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
522 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
523 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
524 8005382845 Rhizobium sp. R634 Isolate Nodule
525 8005395548 Rhizobium sp. R339 Isolate Nodule
526 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
527 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
528 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
529 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
530 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
531 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
532 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
533 8018176218 Rhizobium sp. N122 Isolate Nodule
534 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
535 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
536 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
537 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.48
Metatranscriptomes 0.92
Isolates 27.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 23.67
Nodule 21.48
Rhizoplane 1.85
Rhizosphere 36.14
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000503 3300002773 Bacteria 21792
2 JGI25152J39213_1003041 3300002773 Bacteria 5914
3 JGI25152J39213_1003940 3300002773 Bacteria 4858
4 JGI25152J39213_1010384 3300002773 Bacteria 2134
5 JGI25150J39212_1002477 3300002774 Bacteria 4572
6 JGI25150J39212_1012380 3300002774 Bacteria 1512
7 JGI25151J46595_10000921 3300003187 Bacteria 22894
8 JGI25151J46595_10003025 3300003187 Bacteria 9543
9 JGI25151J46595_10014979 3300003187 Bacteria 3440
10 JGI25151J46595_10018162 3300003187 Bacteria 3031
11 JGI25151J46595_10128306 3300003187 Bacteria 636
12 JGI25153J46596_10012173 3300003215 Bacteria 3737
13 JGI25153J46596_10025139 3300003215 Bacteria 2134
14 JGI25153J46596_10034645 3300003215 Bacteria 1647
15 JGI25153J46596_10046034 3300003215 Bacteria 1296
16 JGI25153J46596_10103044 3300003215 Bacteria 668
17 rootL2_10119340 3300003322 Bacteria 2766
18 JGI25160J50197_1005492 3300003354 Bacteria 5269
19 JGI25160J50197_1019250 3300003354 Bacteria 2098
20 JGI25161J50226_1005388 3300003374 Bacteria 2490
21 Ga0055526_1002871 3300003771 Bacteria 11351
22 Ga0055526_1012661 3300003771 Bacteria 3654
23 Ga0055526_1013626 3300003771 Bacteria 3421
24 Ga0055526_1029939 3300003771 Bacteria 1600
25 Ga0055524_1000844 3300003775 Bacteria 20102
26 Ga0055524_1008042 3300003775 Bacteria 4415
27 Ga0055524_1008939 3300003775 Bacteria 4120
28 Ga0055528_1000256 3300003790 Bacteria 45159
29 Ga0055528_1001239 3300003790 Bacteria 16230
30 Ga0055528_1008996 3300003790 Bacteria 4216
31 Ga0055528_1010599 3300003790 Bacteria 3737
32 Ga0055528_1021643 3300003790 Bacteria 2032
33 Ga0055540_1001577 3300003792 Bacteria 13292
34 Ga0055540_1025338 3300003792 Bacteria 1454
35 Ga0058692_1007229 3300003856 Bacteria 2967
36 Ga0055543_1000421 3300004625 Bacteria 26753
37 Ga0065165_1006367 3300005262 Bacteria 6222
38 Ga0065165_1011367 3300005262 Bacteria 3724
39 Ga0070658_10109971 3300005327 Bacteria 2282
40 Ga0070683_101009006 3300005329 Bacteria 799
41 Ga0068869_100354934 3300005334 Bacteria 1196
42 Ga0070666_10217216 3300005335 Bacteria 1348
43 Ga0070682_101298880 3300005337 Bacteria 618
44 Ga0070660_100061264 3300005339 Bacteria 2921
45 Ga0070689_100053926 3300005340 Bacteria 3113
46 Ga0070661_100225424 3300005344 Bacteria 1439
47 Ga0070668_100261195 3300005347 Bacteria 1440
48 Ga0070669_101973247 3300005353 Bacteria 510
49 Ga0070671_100021775 3300005355 Bacteria 5235
50 Ga0070659_100859826 3300005366 Bacteria 791
51 Ga0070667_100771409 3300005367 Bacteria 892
52 Ga0070714_100869243 3300005435 Unclassified 875
53 Ga0070705_101365697 3300005440 Unclassified 589
54 Ga0070663_100136914 3300005455 Bacteria 1865
55 Ga0070663_101050941 3300005455 Bacteria 710
56 Ga0070706_100080087 3300005467 Bacteria 3024
57 Ga0070707_101140017 3300005468 Bacteria 746
58 Ga0070707_101404113 3300005468 Unclassified 665
59 Ga0070698_100952267 3300005471 Bacteria 805
60 Ga0070699_101604060 3300005518 Unclassified 596
61 Ga0070697_100134131 3300005536 Bacteria 2078
62 Ga0068853_100259566 3300005539 Bacteria 1597
63 Ga0068853_100990127 3300005539 Bacteria 809
64 Ga0068853_101284961 3300005539 Bacteria 707
65 Ga0070665_100004062 3300005548 Bacteria 15397
66 Ga0070665_100097622 3300005548 Bacteria 2942
67 Ga0068855_100110483 3300005563 Bacteria 3156
68 Ga0068855_100236679 3300005563 Bacteria 2042
69 Ga0068854_100216462 3300005578 Bacteria 1513
70 Ga0068854_100229593 3300005578 Bacteria 1472
71 Ga0068856_100617419 3300005614 Bacteria 1105
72 Ga0068852_100018188 3300005616 Bacteria 5533
73 Ga0068858_100872775 3300005842 Bacteria 879
74 Ga0068862_100362181 3300005844 Bacteria 1348
75 Ga0070717_10277053 3300006028 Unclassified 1487
76 Ga0075365_10000714 3300006038 Bacteria 13415
77 Ga0075365_10004522 3300006038 Bacteria 7383
78 Ga0075365_10050292 3300006038 Bacteria 2749
79 Ga0075365_10113984 3300006038 Bacteria 1860
80 Ga0075368_10007363 3300006042 Bacteria 3881
81 Ga0075363_100014060 3300006048 Bacteria 3899
82 Ga0075363_100119350 3300006048 Bacteria 1471
83 Ga0075363_100549980 3300006048 Bacteria 689
84 Ga0075364_10008358 3300006051 Bacteria 6183
85 Ga0075364_10558614 3300006051 Bacteria 782
86 Ga0075364_10680588 3300006051 Bacteria 702
87 Ga0075362_10000632 3300006177 Bacteria 10310
88 Ga0075362_10002069 3300006177 Bacteria 6623
89 Ga0075362_10009212 3300006177 Bacteria 3807
90 Ga0075362_10033338 3300006177 Bacteria 2240
91 Ga0075367_10000307 3300006178 Bacteria 17312
92 Ga0075367_10044071 3300006178 Bacteria 2614
93 Ga0075367_10114038 3300006178 Bacteria 1661
94 Ga0075367_10601770 3300006178 Bacteria 699
95 Ga0075369_10002993 3300006186 Bacteria 6107
96 Ga0075369_10035047 3300006186 Bacteria 2132
97 Ga0075369_10051396 3300006186 Bacteria 1784
98 Ga0075369_10168987 3300006186 Bacteria 1004
99 Ga0075366_10013072 3300006195 Bacteria 4721
100 Ga0075366_10250412 3300006195 Bacteria 1080
101 Ga0075366_10305345 3300006195 Bacteria 974
102 Ga0075370_10027670 3300006353 Bacteria 3147
103 Ga0075370_10426027 3300006353 Bacteria 797
104 Ga0068871_100725828 3300006358 Bacteria 912
105 Ga0079104_1118385 3300006946 Bacteria 520
106 Ga0099826_10001757 3300006948 Bacteria 13397
107 Ga0099826_10069788 3300006948 Bacteria 2237
108 Ga0099826_10194668 3300006948 Bacteria 1115
109 Ga0105244_10198889 3300009036 Bacteria 945
110 Ga0111539_13406600 3300009094 Bacteria 511
111 Ga0105245_10229134 3300009098 Bacteria 1796
112 Ga0105243_12958453 3300009148 Bacteria 515
113 Ga0105237_11059153 3300009545 Bacteria 818
114 Ga0123340_1050215 3300009763 Bacteria 1540
115 Ga0123341_1000028 3300009765 Bacteria 69145
116 Ga0123341_1063520 3300009765 Bacteria 1755
117 Ga0123342_1008287 3300009766 Bacteria 13193
118 Ga0105246_10111874 3300011119 Bacteria 2007
119 Ga0105246_10300945 3300011119 Bacteria 1295
120 Ga0105246_11511535 3300011119 Bacteria 631
121 Ga0157373_10045009 3300013100 Bacteria 3151
122 Ga0157373_10124005 3300013100 Bacteria 1816
123 Ga0157371_10000017 3300013102 Bacteria 320830
124 Ga0157371_10002714 3300013102 Bacteria 16710
125 Ga0157371_10075087 3300013102 Bacteria 2394
126 Ga0157371_11396873 3300013102 Bacteria 544
127 Ga0157370_10000453 3300013104 Bacteria 51332
128 Ga0157370_10406736 3300013104 Bacteria 1252
129 Ga0157370_10573212 3300013104 Bacteria 1034
130 Ga0157370_12146823 3300013104 Bacteria 500
131 Ga0157369_10189148 3300013105 Bacteria 2163
132 Ga0157369_10253086 3300013105 Bacteria 1838
133 Ga0163162_10226247 3300013306 Bacteria 2000
134 Ga0163162_10328065 3300013306 Bacteria 1663
135 Ga0157372_10068195 3300013307 Bacteria 3999
136 Ga0163163_11756247 3300014325 Bacteria 681
137 Ga0163161_10845628 3300017792 Bacteria 772
138 Ga0228711_1000026 3300022739 Bacteria 101497
139 Ga0228710_1000005 3300022740 Bacteria 233531
140 Ga0207425_1000760 3300025245 Bacteria 16704
141 Ga0207425_1011139 3300025245 Bacteria 2157
142 Ga0209129_1000252 3300025258 Bacteria 55710
143 Ga0209129_1001086 3300025258 Bacteria 15927
144 Ga0209129_1001281 3300025258 Bacteria 14357
145 Ga0209129_1004066 3300025258 Bacteria 5962
146 Ga0209129_1009364 3300025258 Bacteria 2592
147 Ga0209129_1019376 3300025258 Bacteria 1287
148 Ga0209673_1000010 3300025273 Bacteria 596656
149 Ga0209673_1000025 3300025273 Bacteria 404572
150 Ga0209673_1001302 3300025273 Bacteria 25365
151 Ga0209673_1003553 3300025273 Bacteria 9091
152 Ga0209673_1040066 3300025273 Bacteria 1344
153 Ga0209130_1012776 3300025284 Bacteria 2178
154 Ga0209130_1029390 3300025284 Bacteria 1145
155 Ga0209675_1022169 3300025291 Bacteria 1676
156 Ga0209676_1045532 3300025292 Bacteria 1193
157 Ga0209676_1103503 3300025292 Bacteria 601
158 Ga0209025_1000091 3300025294 Bacteria 250401
159 Ga0209025_1000213 3300025294 Bacteria 139002
160 Ga0209025_1002872 3300025294 Bacteria 17275
161 Ga0209025_1003464 3300025294 Bacteria 14898
162 Ga0209025_1004176 3300025294 Bacteria 12766
163 Ga0209025_1005254 3300025294 Bacteria 10663
164 Ga0209025_1009226 3300025294 Bacteria 6917
165 Ga0209025_1018302 3300025294 Bacteria 3983
166 Ga0209025_1049099 3300025294 Bacteria 1703
167 Ga0209564_1000644 3300025295 Bacteria 52727
168 Ga0209564_1002026 3300025295 Bacteria 17574
169 Ga0209564_1004176 3300025295 Bacteria 9021
170 Ga0209564_1012298 3300025295 Bacteria 3744
171 Ga0209564_1027450 3300025295 Bacteria 1848
172 Ga0209564_1084831 3300025295 Bacteria 604
173 Ga0209758_1001343 3300025297 Bacteria 29681
174 Ga0209758_1001396 3300025297 Bacteria 28704
175 Ga0209758_1003105 3300025297 Bacteria 15708
176 Ga0209758_1003829 3300025297 Bacteria 13210
177 Ga0209758_1004170 3300025297 Bacteria 12290
178 Ga0209758_1005268 3300025297 Bacteria 10116
179 Ga0209758_1055031 3300025297 Bacteria 1355
180 Ga0209758_1128885 3300025297 Bacteria 672
181 Ga0209050_1003085 3300025298 Bacteria 12800
182 Ga0209050_1036847 3300025298 Bacteria 1421
183 Ga0209256_1000924 3300025299 Bacteria 35882
184 Ga0209256_1001336 3300025299 Bacteria 26297
185 Ga0209256_1001864 3300025299 Bacteria 19479
186 Ga0209256_1007383 3300025299 Bacteria 5439
187 Ga0209256_1022753 3300025299 Bacteria 1889
188 Ga0209256_1049663 3300025299 Bacteria 1021
189 Ga0207426_1000218 3300025302 Bacteria 135865
190 Ga0207426_1001028 3300025302 Bacteria 26709
191 Ga0207426_1160285 3300025302 Bacteria 516
192 Ga0209051_1000393 3300025303 Bacteria 60776
193 Ga0209051_1003537 3300025303 Bacteria 10186
194 Ga0209051_1011607 3300025303 Bacteria 4335
195 Ga0209257_1001180 3300025304 Bacteria 33048
196 Ga0209257_1070103 3300025304 Bacteria 926
197 Ga0207680_10182492 3300025903 Bacteria 1420
198 Ga0207680_10341475 3300025903 Bacteria 1050
199 Ga0207705_10020189 3300025909 Bacteria 4766
200 Ga0207684_10549811 3300025910 Unclassified 988
201 Ga0207654_11355311 3300025911 Bacteria 519
202 Ga0207657_10021924 3300025919 Bacteria 5998
203 Ga0207649_10782985 3300025920 Bacteria 744
204 Ga0207646_10840097 3300025922 Unclassified 817
205 Ga0207681_10625151 3300025923 Bacteria 891
206 Ga0207664_10208041 3300025929 Bacteria 1692
207 Ga0207644_10045415 3300025931 Bacteria 3125
208 Ga0207644_11209942 3300025931 Bacteria 635
209 Ga0207690_10920700 3300025932 Bacteria 725
210 Ga0207709_10959842 3300025935 Bacteria 697
211 Ga0207709_11762194 3300025935 Bacteria 515
212 Ga0207670_10030826 3300025936 Bacteria 3428
213 Ga0207667_10020598 3300025949 Bacteria 7328
214 Ga0207667_10323726 3300025949 Bacteria 1574
215 Ga0207668_10203562 3300025972 Bacteria 1578
216 Ga0207658_10657182 3300025986 Bacteria 945
217 Ga0207639_10236257 3300026041 Bacteria 1587
218 Ga0207639_10326591 3300026041 Bacteria 1364
219 Ga0207639_10917375 3300026041 Bacteria 819
220 Ga0207678_10319497 3300026067 Bacteria 1336
221 Ga0207678_10750832 3300026067 Bacteria 860
222 Ga0207702_10265229 3300026078 Bacteria 1618
223 Ga0207674_10518409 3300026116 Bacteria 1151
224 Ga0207698_10472077 3300026142 Bacteria 1215
225 Ga0209281_1066943 3300027111 Bacteria 534
226 Ga0209371_1000022 3300027312 Bacteria 536342
227 Ga0209371_1005900 3300027312 Bacteria 4707
228 Ga0209282_1000006 3300027666 Bacteria 276998
229 Ga0209282_1001350 3300027666 Bacteria 13384
230 Ga0209282_1018734 3300027666 Bacteria 4390
231 Ga0209813_10001527 3300027866 Bacteria 5192
232 Ga0268266_10020245 3300028379 Bacteria 5673
233 Ga0268266_10023716 3300028379 Bacteria 5222
234 Ga0268266_10333959 3300028379 Bacteria 1421
235 Ga0307515_10001903 3300028794 Bacteria 46429
236 Ga0307515_10016193 3300028794 Bacteria 13668
237 Ga0307515_10020044 3300028794 Bacteria 11970
238 Ga0307515_10249726 3300028794 Bacteria 1529
239 Ga0268256_1000019 3300030500 Bacteria 587949
240 Ga0316181_1032861 3300030744 Bacteria 1908
241 Ga0307513_10312482 3300031456 Bacteria 1333
242 Ga0307513_10671007 3300031456 Bacteria 743
243 Ga0307516_10215144 3300031730 Bacteria 1634
244 Ga0307405_10518490 3300031731 Bacteria 959
245 Ga0307412_10459760 3300031911 Bacteria 1051
246 Ga0315914_1000003 3300031967 Bacteria 314370
247 Ga0307414_10021577 3300032004 Bacteria 4045
248 Ga0307414_11089636 3300032004 Bacteria 737
249 Ga0315913_1000001 3300033430 Bacteria 284459
250 Ga0315915_1096182 3300033464 Bacteria 534
251 Ga0395899_0118824 3300037312 Bacteria 1895
252 Ga0395900_0072015 3300037418 Bacteria 3554
253 Ga0395900_0349143 3300037418 Bacteria 1453
254 Ga0395898_1780028 3300037466 Bacteria 537
255 Ga0395901_0239965 3300038443 Bacteria 1891
256 Ga0439436_0000675 3300041404 Bacteria 9161
257 Ga0439438_012319 3300041405 Bacteria 2625
258 Ga0439439_0006761 3300041406 Bacteria 2660
259 Ga0439447_103933 3300041407 Bacteria 652
260 Ga0439466_0269527 3300041411 Bacteria 516
261 Ga0439465_0001804 3300041413 Bacteria 7010
262 Ga0439465_0003165 3300041413 Bacteria 5369
263 Ga0439465_0053676 3300041413 Bacteria 1324
264 Ga0451787_575990 3300041441 Bacteria 1411
265 Ga0451789_0064520 3300041443 Bacteria 557
266 Ga0451793_1244246 3300041452 Bacteria 911
267 Ga0451799_00208 3300041454 Bacteria 521
268 Ga0451800_1362711 3300041459 Bacteria 581
269 Ga0451833_0423131 3300041491 Bacteria 610
270 Ga0451835_0152695 3300041492 Bacteria 1157
271 Ga0451835_1004602 3300041492 Bacteria 713
272 Ga0451837_0486399 3300041494 Bacteria 2777
273 Ga0451837_0634917 3300041494 Bacteria 1115
274 Ga0451837_1527727 3300041494 Bacteria 539
275 Ga0451839_0375384 3300041496 Bacteria 2181
276 Ga0451840_18389 3300041497 Bacteria 613
277 Ga0451841_0535233 3300041498 Bacteria 1541
278 Ga0451841_1272931 3300041498 Bacteria 509
279 Ga0451845_0159997 3300041501 Bacteria 2365
280 Ga0451845_0422167 3300041501 Bacteria 578
281 Ga0451846_68033 3300041502 Bacteria 2481
282 Ga0451847_0020291 3300041503 Bacteria 5601
283 Ga0451847_0215037 3300041503 Bacteria 800
284 Ga0451848_07203 3300041504 Bacteria 534
285 Ga0451849_0475687 3300041505 Bacteria 1486
286 Ga0451849_0533560 3300041505 Bacteria 1798
287 Ga0451849_1162648 3300041505 Bacteria 879
288 Ga0451850_63335 3300041506 Bacteria 911
289 Ga0451851_0976728 3300041507 Bacteria 1076
290 Ga0451851_1265113 3300041507 Bacteria 692
291 Ga0451843_0551764 3300041509 Bacteria 1062
292 Ga0451854_33659 3300041510 Bacteria 757
293 Ga0451855_0307230 3300041511 Bacteria 1157
294 Ga0451855_1621500 3300041511 Bacteria 802
295 Ga0451853_0781104 3300041512 Bacteria 3909
296 Ga0452268_46403 3300041907 Bacteria 774
297 Ga0452271_28635 3300041916 Bacteria 812
298 Ga0439442_083484 3300042002 Bacteria 685
299 Ga0439445_0034522 3300042004 Bacteria 1326
300 Ga0439432_021451 3300042006 Bacteria 2141
301 Ga0439449_0037328 3300042007 Bacteria 1807
302 Ga0439449_0424970 3300042007 Bacteria 504
303 Ga0439452_067532 3300042010 Bacteria 792
304 Ga0450920_005098 3300042122 Bacteria 2329
305 Ga0450900_088798 3300042136 Bacteria 502
306 Ga0450907_031419 3300042146 Bacteria 903
307 Ga0450910_023981 3300042147 Bacteria 934
308 Ga0495617_057936 3300046452 Bacteria 1284
309 Ga0495627_146771 3300046453 Bacteria 659
310 Ga0495590_0142419 3300046457 Bacteria 866
311 Ga0495638_0000679 3300046460 Bacteria 36986
312 Ga0495638_0082838 3300046460 Bacteria 1945
313 Ga0495638_0158358 3300046460 Bacteria 1308
314 Ga0495638_0226765 3300046460 Bacteria 1041
315 Ga0495650_0127353 3300046471 Bacteria 932
316 Ga0495650_0255155 3300046471 Bacteria 595
317 Ga0495605_0001576 3300046474 Bacteria 14807
318 Ga0495605_0322157 3300046474 Bacteria 651
319 Ga0495584_0536034 3300046491 Bacteria 597
320 Ga0495585_0049497 3300046492 Bacteria 2333
321 Ga0495585_0076788 3300046492 Bacteria 1814
322 Ga0495585_0177337 3300046492 Bacteria 1097
323 Ga0495585_0587867 3300046492 Bacteria 524
324 Ga0495596_0100008 3300046500 Bacteria 1126
325 Ga0495607_0114360 3300046501 Bacteria 1426
326 Ga0495607_0132961 3300046501 Bacteria 1292
327 Ga0495607_0162162 3300046501 Bacteria 1135
328 Ga0495607_0268301 3300046501 Bacteria 815
329 Ga0495583_0001761 3300046506 Bacteria 20650
330 Ga0495583_0315835 3300046506 Bacteria 619
331 Ga0495606_0024437 3300046507 Bacteria 4354
332 Ga0495606_0061703 3300046507 Bacteria 2396
333 Ga0495606_0282287 3300046507 Bacteria 907
334 Ga0495606_0510897 3300046507 Bacteria 605
335 Ga0495610_0001284 3300046512 Bacteria 22438
336 Ga0495610_0009446 3300046512 Bacteria 6166
337 Ga0495610_0092819 3300046512 Bacteria 1365
338 Ga0495610_0096929 3300046512 Bacteria 1327
339 Ga0495616_0064585 3300046513 Bacteria 1786
340 Ga0495616_0095078 3300046513 Bacteria 1405
341 Ga0495620_0014239 3300046515 Bacteria 4049
342 Ga0495620_0037703 3300046515 Bacteria 2150
343 Ga0495620_0144783 3300046515 Bacteria 928
344 Ga0495631_0000730 3300046518 Bacteria 21123
345 Ga0495631_0050036 3300046518 Bacteria 1828
346 Ga0495631_0153839 3300046518 Bacteria 987
347 Ga0495632_0029102 3300046519 Bacteria 2879
348 Ga0495632_0112701 3300046519 Bacteria 1276
349 Ga0495632_0244971 3300046519 Bacteria 805
350 Ga0495643_0013305 3300046522 Bacteria 4929
351 Ga0495643_0015305 3300046522 Bacteria 4536
352 Ga0495643_0062468 3300046522 Bacteria 1972
353 Ga0495643_0343502 3300046522 Bacteria 670
354 Ga0495648_0029819 3300046524 Bacteria 3615
355 Ga0495648_0132738 3300046524 Bacteria 1322
356 Ga0495663_0228146 3300046525 Bacteria 656
357 Ga0495654_0083809 3300046530 Bacteria 1490
358 Ga0495654_0149528 3300046530 Bacteria 1034
359 Ga0495609_0012577 3300046538 Bacteria 4013
360 Ga0495597_0301058 3300046542 Bacteria 622
361 Ga0495597_0331173 3300046542 Bacteria 587
362 Ga0495633_0011174 3300046558 Bacteria 4860
363 Ga0495633_0029770 3300046558 Bacteria 2655
364 Ga0495633_0050506 3300046558 Bacteria 1960
365 Ga0495633_0061741 3300046558 Bacteria 1754
366 Ga0495656_0031815 3300046615 Bacteria 2143
367 Ga0495668_0024494 3300046616 Bacteria 3432
368 Ga0495668_0038413 3300046616 Bacteria 2675
369 Ga0495668_0046237 3300046616 Bacteria 2418
370 Ga0495668_0146343 3300046616 Bacteria 1293
371 Ga0495611_0006826 3300046648 Bacteria 4850
372 Ga0495611_0270597 3300046648 Bacteria 786
373 Ga0495625_0002939 3300046660 Bacteria 17768
374 Ga0495625_0018879 3300046660 Bacteria 5369
375 Ga0495625_0062388 3300046660 Bacteria 2634
376 Ga0495625_0082179 3300046660 Bacteria 2241
377 Ga0495625_0224750 3300046660 Bacteria 1228
378 Ga0495625_0677104 3300046660 Bacteria 611
379 Ga0495661_0101438 3300046665 Bacteria 1619
380 Ga0495661_0213888 3300046665 Bacteria 1002
381 Ga0495588_0003299 3300046674 Bacteria 7009
382 Ga0495588_0084396 3300046674 Bacteria 1660
383 Ga0495588_0195464 3300046674 Bacteria 1068
384 Ga0495670_0098453 3300046691 Bacteria 1504
385 Ga0495670_0328331 3300046691 Bacteria 822
386 Ga0495671_0074586 3300046692 Bacteria 1664
387 Ga0495671_0094033 3300046692 Bacteria 1467
388 Ga0495660_0031201 3300046810 Bacteria 2998
389 Ga0495636_0106724 3300047318 Bacteria 1229
390 Ga0495672_0108312 3300047320 Bacteria 1495
391 Ga0495683_0120289 3300047323 Bacteria 1247
392 Ga0495683_0147713 3300047323 Bacteria 1097
393 Ga0495687_057454 3300047443 Bacteria 1618
394 Ga0495673_0052604 3300047469 Bacteria 1779
395 Ga0495681_0049343 3300047470 Bacteria 1990
396 Ga0495681_0087851 3300047470 Bacteria 1377
397 Ga0495686_0002387 3300047472 Bacteria 17834
398 Ga0495686_0068869 3300047472 Bacteria 2183
399 Ga0495686_0079178 3300047472 Bacteria 2010
400 Ga0495686_0220438 3300047472 Bacteria 1079
401 Ga0495686_0243706 3300047472 Bacteria 1013
402 Ga0495686_0527291 3300047472 Bacteria 619
403 Ga0495615_0021609 3300048090 Bacteria 1454
404 Ga0496100_0762513 3300048903 Bacteria 757
405 Ga0496102_1215588 3300048905 Bacteria 673
406 Ga0496104_0062113 3300048907 Bacteria 3542
407 Ga0496104_0177469 3300048907 Bacteria 2040
408 Ga0496106_0001187 3300048909 Bacteria 19427
409 Ga0496106_0119030 3300048909 Bacteria 2063
410 Ga0496110_0274335 3300048913 Bacteria 1535
411 Ga0496114_0273625 3300048917 Bacteria 1488
412 Ga0496116_0000345 3300048919 Bacteria 73956
413 Ga0496116_0061164 3300048919 Bacteria 2439
414 Ga0496116_0067689 3300048919 Bacteria 2279
415 Ga0496116_0087532 3300048919 Bacteria 1906
416 Ga0496116_0110178 3300048919 Bacteria 1620
417 Ga0496116_0368224 3300048919 Bacteria 650
418 Ga0496117_0000002 3300048920 Bacteria 2483758
419 Ga0496117_0013587 3300048920 Bacteria 7091
420 Ga0496117_0227004 3300048920 Bacteria 1035
421 Ga0496117_0404485 3300048920 Bacteria 688
422 Ga0496117_0513732 3300048920 Bacteria 578
423 Ga0496118_0000504 3300048921 Bacteria 64695
424 Ga0496118_0042282 3300048921 Bacteria 3597
425 Ga0496118_0061186 3300048921 Bacteria 2790
426 Ga0496118_0250488 3300048921 Bacteria 1007
427 Ga0496118_0529844 3300048921 Bacteria 579
428 Ga0496119_0067662 3300048922 Bacteria 2105
429 Ga0496119_0086309 3300048922 Bacteria 1794
430 Ga0496119_0483324 3300048922 Bacteria 579
431 Ga0496120_0000248 3300048923 Bacteria 90783
432 Ga0496120_0118519 3300048923 Bacteria 1372
433 Ga0496121_0001531 3300048924 Bacteria 38692
434 Ga0496121_0097332 3300048924 Bacteria 2280
435 Ga0496121_0119820 3300048924 Bacteria 1989
436 Ga0496121_0133859 3300048924 Bacteria 1850
437 Ga0496121_0154935 3300048924 Bacteria 1682
438 Ga0496121_0165554 3300048924 Bacteria 1612
439 Ga0496121_0181930 3300048924 Bacteria 1516
440 Ga0496121_0214133 3300048924 Bacteria 1362
441 Ga0496121_0580625 3300048924 Bacteria 695
442 Ga0496121_0618072 3300048924 Bacteria 665
443 Ga0496122_0000004 3300048925 Bacteria 645283
444 Ga0496122_0002548 3300048925 Bacteria 25610
445 Ga0496122_0124112 3300048925 Bacteria 1657
446 Ga0496122_0149762 3300048925 Bacteria 1442
447 Ga0496122_0224031 3300048925 Bacteria 1076
448 Ga0496123_0000007 3300048926 Bacteria 645283
449 Ga0496123_0022459 3300048926 Bacteria 4861
450 Ga0496123_0042125 3300048926 Bacteria 3156
451 Ga0496123_0048267 3300048926 Bacteria 2865
452 Ga0496123_0168449 3300048926 Bacteria 1158
453 Ga0496123_0239234 3300048926 Bacteria 903
454 Ga0496123_0492410 3300048926 Bacteria 537
455 Ga0496124_0000252 3300048927 Bacteria 103596
456 Ga0496124_0006419 3300048927 Bacteria 12818
457 Ga0496124_0009611 3300048927 Bacteria 9911
458 Ga0496124_0020556 3300048927 Bacteria 6095
459 Ga0496124_0139071 3300048927 Bacteria 1918
460 Ga0496124_0192380 3300048927 Bacteria 1559
461 Ga0496124_0226507 3300048927 Bacteria 1401
462 Ga0496124_0633542 3300048927 Bacteria 689
463 Ga0496124_0697542 3300048927 Bacteria 644
464 Ga0496125_0010368 3300048928 Bacteria 9427
465 Ga0496125_0048283 3300048928 Bacteria 3551
466 Ga0496125_0149422 3300048928 Bacteria 1607
467 Ga0496125_0217677 3300048928 Bacteria 1233
468 Ga0496125_0288743 3300048928 Bacteria 1011
469 Ga0496125_0547575 3300048928 Bacteria 642
470 Ga0496126_0000166 3300048929 Bacteria 152470
471 Ga0496126_0124418 3300048929 Bacteria 2233
472 Ga0496126_0268473 3300048929 Bacteria 1416
473 Ga0496126_0305663 3300048929 Bacteria 1310
474 Ga0496126_0400314 3300048929 Bacteria 1113
475 Ga0496126_0575890 3300048929 Bacteria 890
476 Ga0496126_1065619 3300048929 Bacteria 602
477 Ga0495678_021415 3300049459 Bacteria 2847
478 Ga0495678_029112 3300049459 Bacteria 2323
479 Ga0495682_0146631 3300049460 Bacteria 842
480 Ga0501031_0283595 3300049568 Bacteria 1074
481 Ga0501032_0015156 3300049569 Bacteria 5444
482 Ga0501032_0186308 3300049569 Bacteria 1357
483 Ga0501032_0940725 3300049569 Bacteria 544
484 Ga0501033_0004731 3300049570 Bacteria 10892
485 Ga0501033_0138850 3300049570 Bacteria 1758
486 Ga0501033_0321333 3300049570 Bacteria 1087
487 Ga0501033_0379655 3300049570 Bacteria 987
488 Ga0501033_0379700 3300049570 Bacteria 987
489 Ga0501033_0777241 3300049570 Bacteria 648
490 Ga0501034_0144436 3300049571 Bacteria 2357
491 Ga0501034_1273548 3300049571 Bacteria 612
492 Ga0501036_0092975 3300049572 Bacteria 2548
493 Ga0501037_0191459 3300049573 Bacteria 1448
494 Ga0501038_0054666 3300049574 Bacteria 3433
495 Ga0501038_0175679 3300049574 Bacteria 1731
496 Ga0501038_0384945 3300049574 Bacteria 1087
497 Ga0501039_0662979 3300049575 Bacteria 817
498 Ga0501043_0016762 3300049579 Bacteria 5742
499 Ga0501043_0076191 3300049579 Bacteria 2635
500 Ga0501046_0337497 3300049580 Bacteria 1096
501 Ga0501047_0002052 3300049581 Bacteria 19253
502 Ga0501047_0074182 3300049581 Bacteria 3275
503 Ga0501047_0246683 3300049581 Bacteria 1635
504 Ga0501047_0522791 3300049581 Bacteria 1012
505 Ga0501047_1149721 3300049581 Bacteria 590
506 Ga0501068_0003686 3300049584 Bacteria 8289
507 Ga0501069_0001931 3300049585 Bacteria 10354
508 Ga0501069_0057965 3300049585 Bacteria 2160
509 Ga0501069_0121746 3300049585 Bacteria 1490
510 Ga0501070_0000694 3300049586 Bacteria 30882
511 Ga0501070_0001919 3300049586 Bacteria 18354
512 Ga0501070_0121349 3300049586 Bacteria 2160
513 Ga0501070_0147878 3300049586 Bacteria 1939
514 Ga0501070_0724810 3300049586 Bacteria 785
515 Ga0501071_0020928 3300049587 Bacteria 4552
516 Ga0501073_0041954 3300049589 Bacteria 3231
517 Ga0501073_0123033 3300049589 Bacteria 1798
518 Ga0501073_0324713 3300049589 Bacteria 1062
519 Ga0501073_0401151 3300049589 Bacteria 947
520 Ga0501074_0016370 3300049590 Bacteria 5385
521 Ga0501074_0043755 3300049590 Bacteria 3241
522 Ga0501080_0034296 3300049742 Bacteria 4737
523 Ga0501080_0076664 3300049742 Bacteria 3109
524 Ga0501080_1000062 3300049742 Bacteria 725
525 Ga0501080_1167591 3300049742 Bacteria 663
526 Ga0501083_0063598 3300049744 Bacteria 2461
527 Ga0501241_053434 3300049758 Bacteria 801
528 Ga0501280_002281 3300049776 Bacteria 3247
529 Ga0501035_0001755 3300049822 Bacteria 21897
530 Ga0501035_0035914 3300049822 Bacteria 4495
531 Ga0501035_0038295 3300049822 Bacteria 4342
532 Ga0501035_0126470 3300049822 Bacteria 2231
533 Ga0501035_0214960 3300049822 Bacteria 1644
534 Ga0501035_1026923 3300049822 Bacteria 647
535 Ga0501044_0012891 3300049823 Bacteria 9049
536 Ga0501044_0017870 3300049823 Bacteria 7608
537 Ga0501044_0027924 3300049823 Bacteria 5956
538 Ga0501044_0072482 3300049823 Bacteria 3501
539 Ga0501044_0123886 3300049823 Bacteria 2583
540 Ga0501044_0139658 3300049823 Bacteria 2412
541 Ga0501044_0150240 3300049823 Bacteria 2312
542 Ga0501044_0151823 3300049823 Bacteria 2298
543 Ga0501044_0210975 3300049823 Bacteria 1896
544 nmdc:mga03683_25604_c1 3300050489 Bacteria 2320
545 nmdc:mga03683_30154_c1 3300050489 Bacteria 2169
546 nmdc:mga03683_3862_c1 3300050489 Bacteria 4895
547 nmdc:mga03683_5544_c1 3300050489 Bacteria 4269
548 nmdc:mga03n38_191900_c1 3300050490 Bacteria 1053
549 nmdc:mga03n38_8396_c1 3300050490 Bacteria 3706
550 nmdc:mga00v17_241_c1 3300050491 Bacteria 32423
551 nmdc:mga00v17_375033_c1 3300050491 Bacteria 925
552 nmdc:mga00v17_465_c1 3300050491 Bacteria 22680
553 nmdc:mga0yw44_1001192_c1 3300050492 Bacteria 566
554 nmdc:mga0yw44_133_c1 3300050492 Bacteria 25520
555 nmdc:mga0yw44_168685_c1 3300050492 Bacteria 1436
556 nmdc:mga0yw44_2265_c1 3300050492 Bacteria 8111
557 nmdc:mga0yw44_268461_c1 3300050492 Bacteria 1139
558 nmdc:mga0k408_349403_c1 3300050493 Bacteria 882
559 nmdc:mga0k408_60205_c1 3300050493 Bacteria 2206
560 nmdc:mga0k408_8182_c1 3300050493 Bacteria 5605
561 nmdc:mga06z11_130543_c1 3300050494 Bacteria 1411
562 nmdc:mga06z11_153672_c1 3300050494 Bacteria 1310
563 nmdc:mga06z11_23526_c1 3300050494 Bacteria 2896
564 nmdc:mga06z11_247108_c1 3300050494 Bacteria 1050
565 nmdc:mga06z11_627147_c1 3300050494 Bacteria 654
566 nmdc:mga04h51_457552_c1 3300050495 Bacteria 541
567 nmdc:mga07m45_10696_c1 3300050496 Bacteria 4801
568 nmdc:mga07m45_184079_c1 3300050496 Bacteria 1215
569 nmdc:mga0sz30_1524_c1 3300050516 Bacteria 8253
570 nmdc:mga0sz30_17253_c1 3300050516 Bacteria 2877
571 nmdc:mga0sz30_39384_c2 3300050516 Bacteria 557
572 nmdc:mga0sz30_7333_c2 3300050516 Bacteria 1226
573 Ga0500610_0019202 3300053079 Bacteria 3319
574 Ga0500578_0051542 3300053086 Bacteria 2636
575 Ga0500578_0341496 3300053086 Bacteria 877
576 Ga0500643_030625 3300053087 Bacteria 1646
577 Ga0500643_086984 3300053087 Bacteria 854
578 Ga0500644_0469872 3300053088 Bacteria 552
579 Ga0500646_0179060 3300053090 Bacteria 717
580 Ga0500650_0312813 3300053098 Bacteria 693
581 Ga0500556_0433054 3300053104 Bacteria 502
582 Ga0500557_025373 3300053105 Bacteria 1742
583 Ga0500560_000794 3300053107 Bacteria 4835
584 Ga0500560_036860 3300053107 Bacteria 1512
585 Ga0500562_164008 3300053108 Bacteria 604
586 Ga0500569_002351 3300053109 Bacteria 3713
587 Ga0500572_064552 3300053111 Bacteria 1119
588 Ga0500594_0016843 3300053118 Bacteria 1781
589 Ga0500608_212641 3300053122 Bacteria 788
590 Ga0500618_019348 3300053125 Bacteria 1676
591 Ga0500618_021454 3300053125 Bacteria 1575
592 Ga0500642_0261929 3300053130 Bacteria 791
593 Ga0500652_071429 3300053131 Bacteria 1439
594 Ga0500658_0001084 3300053134 Bacteria 11129
595 Ga0500658_0002286 3300053134 Bacteria 7417
596 Ga0500658_0138432 3300053134 Bacteria 1090
597 Ga0500658_0214603 3300053134 Bacteria 881
598 Ga0500559_0003305 3300053136 Bacteria 7999
599 Ga0500561_0000087 3300053137 Bacteria 18523
600 Ga0500568_0000963 3300053139 Bacteria 19793
601 Ga0500568_0001620 3300053139 Bacteria 14187
602 Ga0500573_0070568 3300053140 Bacteria 1993
603 Ga0500577_0103999 3300053142 Bacteria 1164
604 Ga0500588_0015357 3300053146 Bacteria 1959
605 Ga0500604_0017152 3300053151 Bacteria 2000
606 Ga0500604_0017696 3300053151 Bacteria 1977
607 Ga0500616_0000577 3300053153 Bacteria 44621
608 Ga0500616_0000682 3300053153 Bacteria 39794
609 Ga0500616_0013833 3300053153 Bacteria 4659
610 Ga0500616_0015042 3300053153 Bacteria 4434
611 Ga0500616_0021117 3300053153 Bacteria 3654
612 Ga0500620_080485 3300053155 Bacteria 1128
613 Ga0500622_0000429 3300053156 Bacteria 39925
614 Ga0500622_0002353 3300053156 Bacteria 13743
615 Ga0500624_000644 3300053157 Bacteria 9245
616 Ga0500624_016153 3300053157 Bacteria 1149
617 Ga0500624_094647 3300053157 Bacteria 608
618 Ga0500627_0083499 3300053158 Bacteria 1425
619 Ga0500627_0462174 3300053158 Bacteria 533
620 Ga0500633_0009256 3300053160 Bacteria 2581
621 Ga0500634_0002413 3300053161 Bacteria 7859
622 Ga0500634_0003778 3300053161 Bacteria 6842
623 Ga0500636_0072384 3300053177 Bacteria 1997
624 Ga0500645_113579 3300053730 Bacteria 759
625 Ga0500609_026158 3300053731 Bacteria 800
626 Ga0500599_056775 3300053736 Bacteria 630
627 Ga0501082_1102236 3300060353 Bacteria 694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100097622 Ga0070665_1000976224 88
2 3300005844 Ga0068862_100362181 Ga0068862_1003621812 88
3 3300049584 Ga0501068_0003686 Ga0501068_0003686_5748_6134 90
4 3300049586 Ga0501070_0147878 Ga0501070_0147878_513_899 90
5 3300049823 Ga0501044_0151823 Ga0501044_0151823_38_424 90
6 3300041411 Ga0439466_0269527 Ga0439466_0269527_109_441 109
7 iso_pu_bacteria 2509276021 2509391871 109
8 iso_pu_bacteria 2509276033 2509447273 109
9 iso_pu_bacteria 2510461076 2510895539 109
10 iso_pu_bacteria 2510917026 2511170700 109
11 iso_pu_bacteria 2510917030 2511199182 109
12 iso_pu_bacteria 2512875026 2512970464 109
13 iso_pu_bacteria 2513237084 2513567817 109
14 iso_pu_bacteria 2513237085 2513577108 109
15 iso_pu_bacteria 2513237089 2513601529 109
16 iso_pu_bacteria 2513237093 2513633223 109
17 iso_pu_bacteria 2513237103 2513707771 109
18 iso_pu_bacteria 2513237144 2513908664 109
19 iso_pu_bacteria 2513237146 2513925250 109
20 iso_pu_bacteria 2513237156 2513986565 109
21 iso_pu_bacteria 2513237159 2513997742 109
22 iso_pu_bacteria 2513237160 2514003026 109
23 iso_pu_bacteria 2513237162 2514018148 109
24 iso_pu_bacteria 2515154113 2515636840 109
25 iso_pu_bacteria 2515154114 2515645822 109
26 iso_pu_bacteria 2515154116 2515655189 109
27 iso_pu_bacteria 2515154134 2515739641 109
28 iso_pu_bacteria 2516143018 2516206244 109
29 iso_pu_bacteria 2516653077 2517036875 109
30 iso_pu_bacteria 2516653085 2517077238 109
31 iso_pu_bacteria 2517093000 2517095995 109
32 iso_pu_bacteria 2517287029 2517407611 109
33 iso_pu_bacteria 2517487022 2517570498 109
34 iso_pu_bacteria 2529292951 2530646640 109
35 iso_pu_bacteria 2537561587 2537876105 109
36 iso_pu_bacteria 2554235003 2554248327 109
37 iso_pu_bacteria 2558860242 2559295443 109
38 iso_pu_bacteria 2582581283 2585167384 109
39 iso_pu_bacteria 2582581298 2585223012 109
40 iso_pu_bacteria 2582581299 2585228447 109
41 iso_pu_bacteria 2582581306 2585265606 109
42 iso_pu_bacteria 2582581865 2585388811 109
43 iso_pu_bacteria 2582581866 2585395486 109
44 iso_pu_bacteria 2585427526 2585524665 109
45 iso_pu_bacteria 2585427528 2585538353 109
46 iso_pu_bacteria 2585427529 2585545595 109
47 iso_pu_bacteria 2585427593 2585836306 109
48 iso_pu_bacteria 2585427634 2586001123 109
49 iso_pu_bacteria 2599185170 2599417159 109
50 iso_pu_bacteria 2599185210 2599601758 109
51 iso_pu_bacteria 2600255279 2601609982 109
52 iso_pu_bacteria 2600255308 2601746757 109
53 iso_pu_bacteria 2643221568 2643856650 109
54 iso_pu_bacteria 2643221582 2643920243 109
55 iso_pu_bacteria 2643221607 2644050293 109
56 iso_pu_bacteria 2643221634 2644193675 109
57 iso_pu_bacteria 2643221636 2644204645 109
58 iso_pu_bacteria 2643221637 2644208848 109
59 iso_pu_bacteria 2643221643 2644242493 109
60 iso_pu_bacteria 2643221686 2644483213 109
61 iso_pu_bacteria 2643221688 2644494359 109
62 iso_pu_bacteria 2643221689 2644499771 109
63 iso_pu_bacteria 2643221693 2644521862 109
64 iso_pu_bacteria 2643221718 2644652378 109
65 iso_pu_bacteria 2690316117 2692315362 109
66 iso_pu_bacteria 2718217882 2719181954 109
67 iso_pu_bacteria 2718217927 2719386565 109
68 iso_pu_bacteria 2718218009 2719732671 109
69 iso_pu_bacteria 2718218232 2720614201 109
70 iso_pu_bacteria 2718218233 2720620969 109
71 iso_pu_bacteria 2718218235 2720632293 109
72 iso_pu_bacteria 2718218269 2720776021 109
73 iso_pu_bacteria 2718218363 2721148045 109
74 iso_pu_bacteria 2718218365 2721159496 109
75 iso_pu_bacteria 2718218366 2721164881 109
76 iso_pu_bacteria 2718218423 2721400269 109
77 iso_pu_bacteria 2721755514 2722841051 109
78 iso_pu_bacteria 2721755556 2723027620 109
79 iso_pu_bacteria 2721755684 2723561248 109
80 iso_pu_bacteria 2721755685 2723567871 109
81 iso_pu_bacteria 2721755809 2724039082 109
82 iso_pu_bacteria 2721755810 2724045427 109
83 iso_pu_bacteria 2721755819 2724090628 109
84 iso_pu_bacteria 2721755822 2724105136 109
85 iso_pu_bacteria 2721755823 2724110964 109
86 iso_pu_bacteria 2728369352 2730108556 109
87 iso_pu_bacteria 2728369365 2730165189 109
88 iso_pu_bacteria 2728369397 2730299128 109
89 iso_pu_bacteria 2738541333 2739032994 109
90 iso_pu_bacteria 2791355259 2793315933 109
91 iso_pu_bacteria 2791355261 2793328419 109
92 iso_pu_bacteria 2791355263 2793339428 109
93 iso_pu_bacteria 2791355266 2793361983 109
94 iso_pu_bacteria 2791355267 2793367737 109
95 iso_pu_bacteria 2802428858 2802716821 109
96 iso_pu_bacteria 2802428859 2802725633 109
97 iso_pu_bacteria 2802428860 2802730277 109
98 iso_pu_bacteria 2802428861 2802737752 109
99 iso_pu_bacteria 2802428862 2802742858 109
100 iso_pu_bacteria 2802428863 2802750282 109
101 iso_pu_bacteria 2802429633 2806045133 109
102 iso_pu_bacteria 2802429634 2806050073 109
103 iso_pu_bacteria 2802429635 2806056911 109
104 iso_pu_bacteria 2802429636 2806064291 109
105 iso_pu_bacteria 2802429637 2806071559 109
106 iso_pu_bacteria 2808606387 2808987822 109
107 iso_pu_bacteria 2818991439 2819559157 109
108 iso_pu_bacteria 2818991461 2819685078 109
109 iso_pu_bacteria 2838016132 2838021609 109
110 iso_pu_bacteria 2838022645 2838023697 109
111 iso_pu_bacteria 2838035591 2838038636 109
112 iso_pu_bacteria 2838068647 2838069995 109
113 iso_pu_bacteria 2838661181 2838661443 109
114 iso_pu_bacteria 2838675328 2838675672 109
115 iso_pu_bacteria 2838680041 2838683298 109
116 iso_pu_bacteria 2838686498 2838686889 109
117 iso_pu_bacteria 2838694306 2838697758 109
118 iso_pu_bacteria 2838707686 2838710874 109
119 iso_pu_bacteria 2838714209 2838714554 109
120 iso_pu_bacteria 2838719591 2838721645 109
121 iso_pu_bacteria 2838724970 2838725314 109
122 iso_pu_bacteria 2838729681 2838730153 109
123 iso_pu_bacteria 2838742623 2838742832 109
124 iso_pu_bacteria 2841846520 2841848627 109
125 iso_pu_bacteria 2841851746 2841852335 109
126 iso_pu_bacteria 2841859092 2841862226 109
127 iso_pu_bacteria 2842077413 2842079047 109
128 iso_pu_bacteria 2842118031 2842118443 109
129 iso_pu_bacteria 2842124991 2842125342 109
130 iso_pu_bacteria 2842130223 2842130567 109
131 iso_pu_bacteria 2842152218 2842154263 109
132 iso_pu_bacteria 2842156927 2842158207 109
133 iso_pu_bacteria 2842163707 2842168634 109
134 iso_pu_bacteria 2842170452 2842170798 109
135 iso_pu_bacteria 2842175837 2842177883 109
136 iso_pu_bacteria 2842180545 2842181827 109
137 iso_pu_bacteria 2842187318 2842187663 109
138 iso_pu_bacteria 2842198810 2842199211 109
139 iso_pu_bacteria 2842211629 2842211974 109
140 iso_pu_bacteria 2842217011 2842218101 109
141 iso_pu_bacteria 2842224351 2842226407 109
142 iso_pu_bacteria 2842229732 2842230122 109
143 iso_pu_bacteria 2842237096 2842240354 109
144 iso_pu_bacteria 2842243621 2842244011 109
145 iso_pu_bacteria 2842257432 2842257904 109
146 iso_pu_bacteria 2842264693 2842269440 109
147 iso_pu_bacteria 2842271015 2842271573 109
148 iso_pu_bacteria 2842285085 2842285450 109
149 iso_pu_bacteria 2842291075 2842292709 109
150 iso_pu_bacteria 2842304105 2842305204 109
151 iso_pu_bacteria 2842341865 2842347363 109
152 iso_pu_bacteria 2842363717 2842370171 109
153 iso_pu_bacteria 2842370503 2842373929 109
154 iso_pu_bacteria 2842377471 2842379107 109
155 iso_pu_bacteria 2842384541 2842384953 109
156 iso_pu_bacteria 2842402390 2842402810 109
157 iso_pu_bacteria 2842409023 2842409819 109
158 iso_pu_bacteria 2842415677 2842416468 109
159 iso_pu_bacteria 2842422224 2842423609 109
160 iso_pu_bacteria 2842428310 2842430558 109
161 iso_pu_bacteria 2842434925 2842436630 109
162 iso_pu_bacteria 2842441272 2842443528 109
163 iso_pu_bacteria 2842462802 2842466812 109
164 iso_pu_bacteria 2842469257 2842471500 109
165 iso_pu_bacteria 2842515876 2842519010 109
166 iso_pu_bacteria 2842521101 2842522010 109
167 iso_pu_bacteria 2844454524 2844458186 109
168 iso_pu_bacteria 2847417321 2847419577 109
169 iso_pu_bacteria 2848992105 2848994579 109
170 iso_pu_bacteria 2854896431 2854901262 109
171 iso_pu_bacteria 2854916844 2854918643 109
172 iso_pu_bacteria 2855872281 2855872323 109
173 iso_pu_bacteria 2899792073 2899795953 109
174 iso_pu_bacteria 2899845264 2899847813 109
175 iso_pu_bacteria 2915980308 2915982933 109
176 iso_pu_bacteria 2916061851 2916066393 109
177 iso_pu_bacteria 2919114240 2919114590 109
178 iso_pu_bacteria 2919166419 2919169428 109
179 iso_pu_bacteria 2919171160 2919172881 109
180 iso_pu_bacteria 2921250672 2921253782 109
181 iso_pu_bacteria 2926754445 2926755607 109
182 iso_pu_bacteria 2926760298 2926762731 109
183 iso_pu_bacteria 2933006813 2933008908 109
184 iso_pu_bacteria 2933011516 2933014817 109
185 iso_pu_bacteria 2933016740 2933023233 109
186 iso_pu_bacteria 2933570622 2933571011 109
187 iso_pu_bacteria 2933594066 2933596494 109
188 iso_pu_bacteria 2933599457 2933600801 109
189 iso_pu_bacteria 2935894831 2935896856 109
190 iso_pu_bacteria 2935901341 2935901796 109
191 iso_pu_bacteria 2936367885 2936371880 109
192 iso_pu_bacteria 2937029754 2937030984 109
193 iso_pu_bacteria 2937036028 2937038383 109
194 iso_pu_bacteria 2937078374 2937080590 109
195 iso_pu_bacteria 2937084907 2937090763 109
196 iso_pu_bacteria 2957375807 2957380796 109
197 iso_pu_bacteria 2957437181 2957440617 109
198 iso_pu_bacteria 2960591022 2960594121 109
199 iso_pu_bacteria 2960631154 2960635120 109
200 iso_pu_bacteria 2960680706 2960680912 109
201 iso_pu_bacteria 2960693952 2960698351 109
202 iso_pu_bacteria 2967686174 2967691158 109
203 iso_pu_bacteria 2967728569 2967729392 109
204 iso_pu_bacteria 2970026789 2970028118 109
205 iso_pu_bacteria 2970143518 2970145785 109
206 iso_pu_bacteria 2977530762 2977535660 109
207 iso_pu_bacteria 2977544691 2977549361 109
208 iso_pu_bacteria 2979089926 2979094778 109
209 iso_pu_bacteria 2979095461 2979100656 109
210 iso_pu_bacteria 2979100975 2979104011 109
211 iso_pu_bacteria 2984509177 2984511420 109
212 iso_pu_bacteria 2984518228 2984522219 109
213 iso_pu_bacteria 2984537506 2984541520 109
214 iso_pu_bacteria 2984587000 2984590118 109
215 iso_pu_bacteria 2984601300 2984603795 109
216 iso_pu_bacteria 3005409236 3005414414 109
217 iso_pu_bacteria 3005445848 3005448608 109
218 iso_pu_bacteria 639633055 639649334 109
219 iso_pu_bacteria 650716007 650740653 109
220 iso_pu_bacteria 8003570095 8003571724 109
221 iso_pu_bacteria 8003999396 8004002033 109
222 iso_pu_bacteria 8005275841 8005281370 109
223 iso_pu_bacteria 8005282627 8005284660 109
224 iso_pu_bacteria 8005301065 8005303286 109
225 iso_pu_bacteria 8005307578 8005309551 109
226 iso_pu_bacteria 8005376324 8005381088 109
227 iso_pu_bacteria 8005382845 8005388965 109
228 iso_pu_bacteria 8005395548 8005395948 109
229 iso_pu_bacteria 8005430974 8005437439 109
230 iso_pu_bacteria 8005497431 8005501052 109
231 iso_pu_bacteria 8005570704 8005573304 109
232 iso_pu_bacteria 8005619151 8005622419 109
233 iso_pu_bacteria 8005626139 8005629920 109
234 iso_pu_bacteria 8005668836 8005672469 109
235 iso_pu_bacteria 8005688590 8005691942 109
236 iso_pu_bacteria 8018176218 8018176895 109
237 iso_pu_bacteria 8023680758 8023683009 109
238 iso_pu_bacteria 8056375014 8056378298 109
239 iso_pu_bacteria 8056875544 8056875705 109
240 iso_pu_bacteria 8057874678 8057878476 109
241 3300002773 JGI25152J39213_1003041 JGI25152J39213_10030413 110
242 3300002774 JGI25150J39212_1002477 JGI25150J39212_10024775 110
243 3300003215 JGI25153J46596_10034645 JGI25153J46596_100346452 110
244 3300005334 Ga0068869_100354934 Ga0068869_1003549342 110
245 3300005340 Ga0070689_100053926 Ga0070689_1000539263 110
246 3300006177 Ga0075362_10000632 Ga0075362_1000063212 110
247 3300006177 Ga0075362_10009212 Ga0075362_100092123 110
248 3300006358 Ga0068871_100725828 Ga0068871_1007258282 110
249 3300013105 Ga0157369_10253086 Ga0157369_102530862 110
250 3300025245 Ga0207425_1000760 Ga0207425_100076015 110
251 3300025258 Ga0209129_1009364 Ga0209129_10093643 110
252 3300025294 Ga0209025_1049099 Ga0209025_10490992 110
253 3300025297 Ga0209758_1004170 Ga0209758_100417017 110
254 3300025936 Ga0207670_10030826 Ga0207670_100308264 110
255 3300028379 Ga0268266_10020245 Ga0268266_100202456 110
256 3300049823 Ga0501044_0123886 Ga0501044_0123886_1222_1560 110
257 3300050489 nmdc:mga03683_25604_c1 nmdc:mga03683_25604_c1_218_556 110
258 3300050489 nmdc:mga03683_5544_c1 nmdc:mga03683_5544_c1_2524_2862 110
259 iso_pu_bacteria 2837678835 2837681661 110
260 3300003322 rootL2_10119340 rootL2_101193401 112
261 3300005327 Ga0070658_10109971 Ga0070658_101099713 112
262 3300005329 Ga0070683_101009006 Ga0070683_1010090062 112
263 3300005339 Ga0070660_100061264 Ga0070660_1000612644 112
264 3300005366 Ga0070659_100859826 Ga0070659_1008598262 112
265 3300005435 Ga0070714_100869243 Ga0070714_1008692432 112
266 3300005440 Ga0070705_101365697 Ga0070705_1013656971 112
267 3300005455 Ga0070663_100136914 Ga0070663_1001369142 112
268 3300005467 Ga0070706_100080087 Ga0070706_1000800874 112
269 3300005468 Ga0070707_101404113 Ga0070707_1014041131 112
270 3300005518 Ga0070699_101604060 Ga0070699_1016040601 112
271 3300005536 Ga0070697_100134131 Ga0070697_1001341313 112
272 3300005539 Ga0068853_101284961 Ga0068853_1012849612 112
273 3300005563 Ga0068855_100110483 Ga0068855_1001104835 112
274 3300005614 Ga0068856_100617419 Ga0068856_1006174192 112
275 3300006028 Ga0070717_10277053 Ga0070717_102770533 112
276 3300009094 Ga0111539_13406600 Ga0111539_134066001 112
277 3300013104 Ga0157370_12146823 Ga0157370_121468232 112
278 3300025909 Ga0207705_10020189 Ga0207705_100201898 112
279 3300025910 Ga0207684_10549811 Ga0207684_105498112 112
280 3300025919 Ga0207657_10021924 Ga0207657_100219247 112
281 3300025922 Ga0207646_10840097 Ga0207646_108400971 112
282 3300025929 Ga0207664_10208041 Ga0207664_102080412 112
283 3300025932 Ga0207690_10920700 Ga0207690_109207002 112
284 3300025949 Ga0207667_10020598 Ga0207667_100205988 112
285 3300026041 Ga0207639_10917375 Ga0207639_109173751 112
286 3300026067 Ga0207678_10319497 Ga0207678_103194972 112
287 3300048920 Ga0496117_0513732 Ga0496117_0513732_84_422 112
288 3300048921 Ga0496118_0529844 Ga0496118_0529844_13_351 112
289 3300049569 Ga0501032_0940725 Ga0501032_0940725_53_391 112
290 3300049570 Ga0501033_0004731 Ga0501033_0004731_5772_6128 112
291 3300049570 Ga0501033_0777241 Ga0501033_0777241_282_638 112
292 3300049571 Ga0501034_0144436 Ga0501034_0144436_370_708 112
293 3300049571 Ga0501034_1273548 Ga0501034_1273548_251_589 112
294 3300049574 Ga0501038_0175679 Ga0501038_0175679_376_732 112
295 3300049579 Ga0501043_0076191 Ga0501043_0076191_2000_2356 112
296 3300049581 Ga0501047_0074182 Ga0501047_0074182_1613_1969 112
297 3300049581 Ga0501047_0246683 Ga0501047_0246683_99_455 112
298 3300049581 Ga0501047_1149721 Ga0501047_1149721_158_514 112
299 3300049585 Ga0501069_0057965 Ga0501069_0057965_1354_1710 112
300 3300049585 Ga0501069_0121746 Ga0501069_0121746_128_484 112
301 3300049586 Ga0501070_0000694 Ga0501070_0000694_15662_16018 112
302 3300049589 Ga0501073_0123033 Ga0501073_0123033_1080_1436 112
303 3300049590 Ga0501074_0016370 Ga0501074_0016370_1954_2310 112
304 3300049742 Ga0501080_1000062 Ga0501080_1000062_311_667 112
305 3300049822 Ga0501035_0038295 Ga0501035_0038295_1257_1613 112
306 3300049822 Ga0501035_0126470 Ga0501035_0126470_1524_1880 112
307 3300049822 Ga0501035_0214960 Ga0501035_0214960_294_635 112
308 3300049823 Ga0501044_0012891 Ga0501044_0012891_5194_5550 112
309 3300049823 Ga0501044_0210975 Ga0501044_0210975_1346_1702 112
310 3300050495 nmdc:mga04h51_457552_c1 nmdc:mga04h51_457552_c1_121_462 112
311 3300053153 Ga0500616_0013833 Ga0500616_0013833_3772_4110 112
312 3300002773 JGI25152J39213_1000503 JGI25152J39213_100050313 113
313 3300002773 JGI25152J39213_1003940 JGI25152J39213_10039406 113
314 3300002773 JGI25152J39213_1010384 JGI25152J39213_10103843 113
315 3300002774 JGI25150J39212_1012380 JGI25150J39212_10123803 113
316 3300003187 JGI25151J46595_10000921 JGI25151J46595_1000092117 113
317 3300003187 JGI25151J46595_10003025 JGI25151J46595_1000302512 113
318 3300003187 JGI25151J46595_10014979 JGI25151J46595_100149792 113
319 3300003187 JGI25151J46595_10018162 JGI25151J46595_100181623 113
320 3300003187 JGI25151J46595_10128306 JGI25151J46595_101283061 113
321 3300003215 JGI25153J46596_10012173 JGI25153J46596_100121732 113
322 3300003215 JGI25153J46596_10025139 JGI25153J46596_100251393 113
323 3300003215 JGI25153J46596_10046034 JGI25153J46596_100460342 113
324 3300003215 JGI25153J46596_10103044 JGI25153J46596_101030442 113
325 3300003354 JGI25160J50197_1005492 JGI25160J50197_10054927 113
326 3300003354 JGI25160J50197_1019250 JGI25160J50197_10192503 113
327 3300003374 JGI25161J50226_1005388 JGI25161J50226_10053882 113
328 3300003771 Ga0055526_1002871 Ga0055526_10028714 113
329 3300003771 Ga0055526_1012661 Ga0055526_10126614 113
330 3300003771 Ga0055526_1013626 Ga0055526_10136263 113
331 3300003771 Ga0055526_1029939 Ga0055526_10299392 113
332 3300003775 Ga0055524_1000844 Ga0055524_100084422 113
333 3300003775 Ga0055524_1008042 Ga0055524_10080422 113
334 3300003775 Ga0055524_1008939 Ga0055524_10089393 113
335 3300003790 Ga0055528_1000256 Ga0055528_100025641 113
336 3300003790 Ga0055528_1001239 Ga0055528_100123918 113
337 3300003790 Ga0055528_1008996 Ga0055528_10089964 113
338 3300003790 Ga0055528_1010599 Ga0055528_10105992 113
339 3300003790 Ga0055528_1021643 Ga0055528_10216433 113
340 3300003792 Ga0055540_1001577 Ga0055540_10015778 113
341 3300003792 Ga0055540_1025338 Ga0055540_10253382 113
342 3300003856 Ga0058692_1007229 Ga0058692_10072292 113
343 3300004625 Ga0055543_1000421 Ga0055543_100042111 113
344 3300005262 Ga0065165_1006367 Ga0065165_10063676 113
345 3300005262 Ga0065165_1011367 Ga0065165_10113674 113
346 3300005335 Ga0070666_10217216 Ga0070666_102172162 113
347 3300005337 Ga0070682_101298880 Ga0070682_1012988801 113
348 3300005344 Ga0070661_100225424 Ga0070661_1002254242 113
349 3300005347 Ga0070668_100261195 Ga0070668_1002611952 113
350 3300005353 Ga0070669_101973247 Ga0070669_1019732471 113
351 3300005355 Ga0070671_100021775 Ga0070671_1000217757 113
352 3300005367 Ga0070667_100771409 Ga0070667_1007714092 113
353 3300005455 Ga0070663_101050941 Ga0070663_1010509411 113
354 3300005468 Ga0070707_101140017 Ga0070707_1011400171 113
355 3300005471 Ga0070698_100952267 Ga0070698_1009522671 113
356 3300005539 Ga0068853_100259566 Ga0068853_1002595662 113
357 3300005539 Ga0068853_100990127 Ga0068853_1009901272 113
358 3300005548 Ga0070665_100004062 Ga0070665_10000406210 113
359 3300005563 Ga0068855_100236679 Ga0068855_1002366792 113
360 3300005578 Ga0068854_100216462 Ga0068854_1002164622 113
361 3300005578 Ga0068854_100229593 Ga0068854_1002295932 113
362 3300005616 Ga0068852_100018188 Ga0068852_1000181887 113
363 3300005842 Ga0068858_100872775 Ga0068858_1008727752 113
364 3300006038 Ga0075365_10000714 Ga0075365_1000071413 113
365 3300006038 Ga0075365_10004522 Ga0075365_100045225 113
366 3300006038 Ga0075365_10050292 Ga0075365_100502924 113
367 3300006038 Ga0075365_10113984 Ga0075365_101139842 113
368 3300006042 Ga0075368_10007363 Ga0075368_100073635 113
369 3300006048 Ga0075363_100014060 Ga0075363_1000140607 113
370 3300006048 Ga0075363_100119350 Ga0075363_1001193502 113
371 3300006048 Ga0075363_100549980 Ga0075363_1005499802 113
372 3300006051 Ga0075364_10008358 Ga0075364_100083582 113
373 3300006051 Ga0075364_10558614 Ga0075364_105586142 113
374 3300006051 Ga0075364_10680588 Ga0075364_106805881 113
375 3300006177 Ga0075362_10002069 Ga0075362_100020692 113
376 3300006177 Ga0075362_10033338 Ga0075362_100333383 113
377 3300006178 Ga0075367_10000307 Ga0075367_100003073 113
378 3300006178 Ga0075367_10044071 Ga0075367_100440712 113
379 3300006178 Ga0075367_10114038 Ga0075367_101140382 113
380 3300006178 Ga0075367_10601770 Ga0075367_106017702 113
381 3300006186 Ga0075369_10002993 Ga0075369_100029934 113
382 3300006186 Ga0075369_10035047 Ga0075369_100350472 113
383 3300006186 Ga0075369_10051396 Ga0075369_100513962 113
384 3300006186 Ga0075369_10168987 Ga0075369_101689872 113
385 3300006195 Ga0075366_10013072 Ga0075366_100130722 113
386 3300006195 Ga0075366_10250412 Ga0075366_102504122 113
387 3300006195 Ga0075366_10305345 Ga0075366_103053452 113
388 3300006353 Ga0075370_10027670 Ga0075370_100276702 113
389 3300006353 Ga0075370_10426027 Ga0075370_104260272 113
390 3300006946 Ga0079104_1118385 Ga0079104_11183851 113
391 3300006948 Ga0099826_10001757 Ga0099826_1000175710 113
392 3300006948 Ga0099826_10069788 Ga0099826_100697883 113
393 3300006948 Ga0099826_10194668 Ga0099826_101946682 113
394 3300009036 Ga0105244_10198889 Ga0105244_101988892 113
395 3300009098 Ga0105245_10229134 Ga0105245_102291343 113
396 3300009148 Ga0105243_12958453 Ga0105243_129584531 113
397 3300009545 Ga0105237_11059153 Ga0105237_110591532 113
398 3300009763 Ga0123340_1050215 Ga0123340_10502152 113
399 3300009765 Ga0123341_1000028 Ga0123341_10000286 113
400 3300009765 Ga0123341_1063520 Ga0123341_10635202 113
401 3300009766 Ga0123342_1008287 Ga0123342_10082872 113
402 3300011119 Ga0105246_10111874 Ga0105246_101118742 113
403 3300011119 Ga0105246_10300945 Ga0105246_103009452 113
404 3300011119 Ga0105246_11511535 Ga0105246_115115352 113
405 3300013100 Ga0157373_10045009 Ga0157373_100450092 113
406 3300013100 Ga0157373_10124005 Ga0157373_101240052 113
407 3300013102 Ga0157371_10000017 Ga0157371_10000017160 113
408 3300013102 Ga0157371_10002714 Ga0157371_1000271420 113
409 3300013102 Ga0157371_10075087 Ga0157371_100750873 113
410 3300013102 Ga0157371_11396873 Ga0157371_113968732 113
411 3300013104 Ga0157370_10000453 Ga0157370_1000045321 113
412 3300013104 Ga0157370_10406736 Ga0157370_104067363 113
413 3300013104 Ga0157370_10573212 Ga0157370_105732122 113
414 3300013105 Ga0157369_10189148 Ga0157369_101891482 113
415 3300013306 Ga0163162_10226247 Ga0163162_102262474 113
416 3300013306 Ga0163162_10328065 Ga0163162_103280653 113
417 3300013307 Ga0157372_10068195 Ga0157372_100681953 113
418 3300014325 Ga0163163_11756247 Ga0163163_117562472 113
419 3300017792 Ga0163161_10845628 Ga0163161_108456282 113
420 3300022739 Ga0228711_1000026 Ga0228711_100002677 113
421 3300022740 Ga0228710_1000005 Ga0228710_100000551 113
422 3300025245 Ga0207425_1011139 Ga0207425_10111393 113
423 3300025258 Ga0209129_1000252 Ga0209129_100025229 113
424 3300025258 Ga0209129_1001086 Ga0209129_10010865 113
425 3300025258 Ga0209129_1001281 Ga0209129_100128113 113
426 3300025258 Ga0209129_1004066 Ga0209129_10040667 113
427 3300025258 Ga0209129_1019376 Ga0209129_10193762 113
428 3300025273 Ga0209673_1000010 Ga0209673_1000010400 113
429 3300025273 Ga0209673_1000025 Ga0209673_1000025277 113
430 3300025273 Ga0209673_1001302 Ga0209673_100130220 113
431 3300025273 Ga0209673_1003553 Ga0209673_10035533 113
432 3300025273 Ga0209673_1040066 Ga0209673_10400662 113
433 3300025284 Ga0209130_1012776 Ga0209130_10127763 113
434 3300025284 Ga0209130_1029390 Ga0209130_10293902 113
435 3300025291 Ga0209675_1022169 Ga0209675_10221692 113
436 3300025292 Ga0209676_1045532 Ga0209676_10455322 113
437 3300025292 Ga0209676_1103503 Ga0209676_11035032 113
438 3300025294 Ga0209025_1000091 Ga0209025_100009158 113
439 3300025294 Ga0209025_1000213 Ga0209025_100021396 113
440 3300025294 Ga0209025_1002872 Ga0209025_100287221 113
441 3300025294 Ga0209025_1003464 Ga0209025_10034644 113
442 3300025294 Ga0209025_1004176 Ga0209025_10041762 113
443 3300025294 Ga0209025_1005254 Ga0209025_100525413 113
444 3300025294 Ga0209025_1009226 Ga0209025_10092267 113
445 3300025294 Ga0209025_1018302 Ga0209025_10183025 113
446 3300025295 Ga0209564_1000644 Ga0209564_100064430 113
447 3300025295 Ga0209564_1002026 Ga0209564_100202614 113
448 3300025295 Ga0209564_1004176 Ga0209564_10041768 113
449 3300025295 Ga0209564_1012298 Ga0209564_10122982 113
450 3300025295 Ga0209564_1027450 Ga0209564_10274501 113
451 3300025295 Ga0209564_1084831 Ga0209564_10848312 113
452 3300025297 Ga0209758_1001343 Ga0209758_100134332 113
453 3300025297 Ga0209758_1001396 Ga0209758_100139631 113
454 3300025297 Ga0209758_1003105 Ga0209758_100310517 113
455 3300025297 Ga0209758_1003829 Ga0209758_100382919 113
456 3300025297 Ga0209758_1005268 Ga0209758_100526813 113
457 3300025297 Ga0209758_1055031 Ga0209758_10550312 113
458 3300025297 Ga0209758_1128885 Ga0209758_11288851 113
459 3300025298 Ga0209050_1003085 Ga0209050_10030859 113
460 3300025298 Ga0209050_1036847 Ga0209050_10368471 113
461 3300025299 Ga0209256_1000924 Ga0209256_100092440 113
462 3300025299 Ga0209256_1001336 Ga0209256_100133611 113
463 3300025299 Ga0209256_1001864 Ga0209256_10018647 113
464 3300025299 Ga0209256_1007383 Ga0209256_10073836 113
465 3300025299 Ga0209256_1022753 Ga0209256_10227532 113
466 3300025299 Ga0209256_1049663 Ga0209256_10496632 113
467 3300025302 Ga0207426_1000218 Ga0207426_100021854 113
468 3300025302 Ga0207426_1001028 Ga0207426_100102813 113
469 3300025302 Ga0207426_1160285 Ga0207426_11602851 113
470 3300025303 Ga0209051_1000393 Ga0209051_100039312 113
471 3300025303 Ga0209051_1003537 Ga0209051_10035373 113
472 3300025303 Ga0209051_1011607 Ga0209051_10116074 113
473 3300025304 Ga0209257_1001180 Ga0209257_100118037 113
474 3300025304 Ga0209257_1070103 Ga0209257_10701031 113
475 3300025903 Ga0207680_10182492 Ga0207680_101824923 113
476 3300025903 Ga0207680_10341475 Ga0207680_103414752 113
477 3300025911 Ga0207654_11355311 Ga0207654_113553111 113
478 3300025920 Ga0207649_10782985 Ga0207649_107829852 113
479 3300025923 Ga0207681_10625151 Ga0207681_106251512 113
480 3300025931 Ga0207644_10045415 Ga0207644_100454152 113
481 3300025931 Ga0207644_11209942 Ga0207644_112099422 113
482 3300025935 Ga0207709_10959842 Ga0207709_109598421 113
483 3300025935 Ga0207709_11762194 Ga0207709_117621941 113
484 3300025949 Ga0207667_10323726 Ga0207667_103237263 113
485 3300025972 Ga0207668_10203562 Ga0207668_102035622 113
486 3300025986 Ga0207658_10657182 Ga0207658_106571822 113
487 3300026041 Ga0207639_10236257 Ga0207639_102362572 113
488 3300026041 Ga0207639_10326591 Ga0207639_103265912 113
489 3300026067 Ga0207678_10750832 Ga0207678_107508322 113
490 3300026078 Ga0207702_10265229 Ga0207702_102652292 113
491 3300026116 Ga0207674_10518409 Ga0207674_105184092 113
492 3300026142 Ga0207698_10472077 Ga0207698_104720772 113
493 3300027111 Ga0209281_1066943 Ga0209281_10669431 113
494 3300027312 Ga0209371_1000022 Ga0209371_1000022182 113
495 3300027312 Ga0209371_1005900 Ga0209371_10059002 113
496 3300027666 Ga0209282_1000006 Ga0209282_100000622 113
497 3300027666 Ga0209282_1001350 Ga0209282_100135015 113
498 3300027666 Ga0209282_1018734 Ga0209282_10187346 113
499 3300027866 Ga0209813_10001527 Ga0209813_100015273 113
500 3300028379 Ga0268266_10023716 Ga0268266_100237167 113
501 3300028379 Ga0268266_10333959 Ga0268266_103339592 113
502 3300028794 Ga0307515_10001903 Ga0307515_1000190315 113
503 3300028794 Ga0307515_10016193 Ga0307515_1001619310 113
504 3300028794 Ga0307515_10020044 Ga0307515_1002004410 113
505 3300028794 Ga0307515_10249726 Ga0307515_102497262 113
506 3300030500 Ga0268256_1000019 Ga0268256_1000019338 113
507 3300030744 Ga0316181_1032861 Ga0316181_10328612 113
508 3300031456 Ga0307513_10312482 Ga0307513_103124822 113
509 3300031456 Ga0307513_10671007 Ga0307513_106710072 113
510 3300031730 Ga0307516_10215144 Ga0307516_102151444 113
511 3300031731 Ga0307405_10518490 Ga0307405_105184902 113
512 3300031911 Ga0307412_10459760 Ga0307412_104597602 113
513 3300031967 Ga0315914_1000003 Ga0315914_100000377 113
514 3300032004 Ga0307414_10021577 Ga0307414_100215775 113
515 3300032004 Ga0307414_11089636 Ga0307414_110896362 113
516 3300033430 Ga0315913_1000001 Ga0315913_100000129 113
517 3300033464 Ga0315915_1096182 Ga0315915_10961821 113
518 3300037312 Ga0395899_0118824 Ga0395899_0118824_1536_1877 113
519 3300037418 Ga0395900_0072015 Ga0395900_0072015_1745_2086 113
520 3300037418 Ga0395900_0349143 Ga0395900_0349143_1079_1438 113
521 3300037466 Ga0395898_1780028 Ga0395898_1780028_22_363 113
522 3300038443 Ga0395901_0239965 Ga0395901_0239965_160_501 113
523 3300041404 Ga0439436_0000675 Ga0439436_0000675_5687_6028 113
524 3300041405 Ga0439438_012319 Ga0439438_012319_1878_2219 113
525 3300041406 Ga0439439_0006761 Ga0439439_0006761_2079_2420 113
526 3300041407 Ga0439447_103933 Ga0439447_103933_150_491 113
527 3300041413 Ga0439465_0001804 Ga0439465_0001804_3385_3726 113
528 3300041413 Ga0439465_0003165 Ga0439465_0003165_133_474 113
529 3300041413 Ga0439465_0053676 Ga0439465_0053676_14_355 113
530 3300041441 Ga0451787_575990 Ga0451787_575990_44_385 113
531 3300041443 Ga0451789_0064520 Ga0451789_0064520_73_414 113
532 3300041452 Ga0451793_1244246 Ga0451793_1244246_176_517 113
533 3300041454 Ga0451799_00208 Ga0451799_00208_105_446 113
534 3300041459 Ga0451800_1362711 Ga0451800_1362711_226_567 113
535 3300041491 Ga0451833_0423131 Ga0451833_0423131_214_555 113
536 3300041492 Ga0451835_0152695 Ga0451835_0152695_239_580 113
537 3300041492 Ga0451835_1004602 Ga0451835_1004602_317_658 113
538 3300041494 Ga0451837_0486399 Ga0451837_0486399_2198_2539 113
539 3300041494 Ga0451837_0634917 Ga0451837_0634917_741_1082 113
540 3300041494 Ga0451837_1527727 Ga0451837_1527727_186_527 113
541 3300041496 Ga0451839_0375384 Ga0451839_0375384_650_991 113
542 3300041497 Ga0451840_18389 Ga0451840_18389_124_465 113
543 3300041498 Ga0451841_0535233 Ga0451841_0535233_818_1159 113
544 3300041498 Ga0451841_1272931 Ga0451841_1272931_65_406 113
545 3300041501 Ga0451845_0159997 Ga0451845_0159997_834_1175 113
546 3300041501 Ga0451845_0422167 Ga0451845_0422167_44_385 113
547 3300041502 Ga0451846_68033 Ga0451846_68033_2033_2374 113
548 3300041503 Ga0451847_0020291 Ga0451847_0020291_206_547 113
549 3300041503 Ga0451847_0215037 Ga0451847_0215037_296_637 113
550 3300041504 Ga0451848_07203 Ga0451848_07203_105_446 113
551 3300041505 Ga0451849_0475687 Ga0451849_0475687_205_546 113
552 3300041505 Ga0451849_0533560 Ga0451849_0533560_1342_1683 113
553 3300041505 Ga0451849_1162648 Ga0451849_1162648_235_576 113
554 3300041506 Ga0451850_63335 Ga0451850_63335_412_753 113
555 3300041507 Ga0451851_0976728 Ga0451851_0976728_239_580 113
556 3300041507 Ga0451851_1265113 Ga0451851_1265113_65_406 113
557 3300041509 Ga0451843_0551764 Ga0451843_0551764_699_1040 113
558 3300041510 Ga0451854_33659 Ga0451854_33659_124_465 113
559 3300041511 Ga0451855_0307230 Ga0451855_0307230_532_873 113
560 3300041511 Ga0451855_1621500 Ga0451855_1621500_239_580 113
561 3300041512 Ga0451853_0781104 Ga0451853_0781104_1740_2081 113
562 3300041907 Ga0452268_46403 Ga0452268_46403_362_703 113
563 3300041916 Ga0452271_28635 Ga0452271_28635_196_537 113
564 3300042002 Ga0439442_083484 Ga0439442_083484_95_436 113
565 3300042004 Ga0439445_0034522 Ga0439445_0034522_254_595 113
566 3300042006 Ga0439432_021451 Ga0439432_021451_277_618 113
567 3300042007 Ga0439449_0037328 Ga0439449_0037328_521_862 113
568 3300042007 Ga0439449_0424970 Ga0439449_0424970_49_390 113
569 3300042010 Ga0439452_067532 Ga0439452_067532_287_628 113
570 3300042122 Ga0450920_005098 Ga0450920_005098_1242_1583 113
571 3300042136 Ga0450900_088798 Ga0450900_088798_20_361 113
572 3300042146 Ga0450907_031419 Ga0450907_031419_180_521 113
573 3300042147 Ga0450910_023981 Ga0450910_023981_263_604 113
574 3300046452 Ga0495617_057936 Ga0495617_057936_437_778 113
575 3300046453 Ga0495627_146771 Ga0495627_146771_207_548 113
576 3300046457 Ga0495590_0142419 Ga0495590_0142419_226_567 113
577 3300046460 Ga0495638_0000679 Ga0495638_0000679_20902_21243 113
578 3300046460 Ga0495638_0082838 Ga0495638_0082838_108_449 113
579 3300046460 Ga0495638_0158358 Ga0495638_0158358_944_1285 113
580 3300046460 Ga0495638_0226765 Ga0495638_0226765_612_953 113
581 3300046471 Ga0495650_0127353 Ga0495650_0127353_490_831 113
582 3300046471 Ga0495650_0255155 Ga0495650_0255155_197_538 113
583 3300046474 Ga0495605_0001576 Ga0495605_0001576_1149_1490 113
584 3300046474 Ga0495605_0322157 Ga0495605_0322157_18_359 113
585 3300046491 Ga0495584_0536034 Ga0495584_0536034_51_392 113
586 3300046492 Ga0495585_0049497 Ga0495585_0049497_1257_1598 113
587 3300046492 Ga0495585_0076788 Ga0495585_0076788_39_380 113
588 3300046492 Ga0495585_0177337 Ga0495585_0177337_199_540 113
589 3300046492 Ga0495585_0587867 Ga0495585_0587867_45_386 113
590 3300046500 Ga0495596_0100008 Ga0495596_0100008_159_500 113
591 3300046501 Ga0495607_0114360 Ga0495607_0114360_878_1219 113
592 3300046501 Ga0495607_0132961 Ga0495607_0132961_919_1260 113
593 3300046501 Ga0495607_0162162 Ga0495607_0162162_339_680 113
594 3300046501 Ga0495607_0268301 Ga0495607_0268301_261_602 113
595 3300046506 Ga0495583_0001761 Ga0495583_0001761_7494_7835 113
596 3300046506 Ga0495583_0315835 Ga0495583_0315835_222_563 113
597 3300046507 Ga0495606_0024437 Ga0495606_0024437_1462_1803 113
598 3300046507 Ga0495606_0061703 Ga0495606_0061703_927_1268 113
599 3300046507 Ga0495606_0282287 Ga0495606_0282287_286_627 113
600 3300046507 Ga0495606_0510897 Ga0495606_0510897_174_515 113
601 3300046512 Ga0495610_0001284 Ga0495610_0001284_19606_19947 113
602 3300046512 Ga0495610_0009446 Ga0495610_0009446_3318_3659 113
603 3300046512 Ga0495610_0092819 Ga0495610_0092819_1003_1344 113
604 3300046512 Ga0495610_0096929 Ga0495610_0096929_44_385 113
605 3300046513 Ga0495616_0064585 Ga0495616_0064585_301_642 113
606 3300046513 Ga0495616_0095078 Ga0495616_0095078_334_675 113
607 3300046515 Ga0495620_0014239 Ga0495620_0014239_3602_3943 113
608 3300046515 Ga0495620_0037703 Ga0495620_0037703_686_1027 113
609 3300046515 Ga0495620_0144783 Ga0495620_0144783_380_721 113
610 3300046518 Ga0495631_0000730 Ga0495631_0000730_15516_15857 113
611 3300046518 Ga0495631_0050036 Ga0495631_0050036_1457_1798 113
612 3300046518 Ga0495631_0153839 Ga0495631_0153839_399_740 113
613 3300046519 Ga0495632_0029102 Ga0495632_0029102_971_1312 113
614 3300046519 Ga0495632_0112701 Ga0495632_0112701_716_1057 113
615 3300046519 Ga0495632_0244971 Ga0495632_0244971_59_400 113
616 3300046522 Ga0495643_0013305 Ga0495643_0013305_778_1119 113
617 3300046522 Ga0495643_0015305 Ga0495643_0015305_2552_2893 113
618 3300046522 Ga0495643_0062468 Ga0495643_0062468_113_454 113
619 3300046522 Ga0495643_0343502 Ga0495643_0343502_223_564 113
620 3300046524 Ga0495648_0029819 Ga0495648_0029819_1546_1887 113
621 3300046524 Ga0495648_0132738 Ga0495648_0132738_862_1203 113
622 3300046525 Ga0495663_0228146 Ga0495663_0228146_97_438 113
623 3300046530 Ga0495654_0083809 Ga0495654_0083809_1060_1401 113
624 3300046530 Ga0495654_0149528 Ga0495654_0149528_459_800 113
625 3300046538 Ga0495609_0012577 Ga0495609_0012577_2065_2406 113
626 3300046542 Ga0495597_0301058 Ga0495597_0301058_222_563 113
627 3300046542 Ga0495597_0331173 Ga0495597_0331173_24_365 113
628 3300046558 Ga0495633_0011174 Ga0495633_0011174_2385_2726 113
629 3300046558 Ga0495633_0029770 Ga0495633_0029770_372_713 113
630 3300046558 Ga0495633_0050506 Ga0495633_0050506_461_802 113
631 3300046558 Ga0495633_0061741 Ga0495633_0061741_144_485 113
632 3300046615 Ga0495656_0031815 Ga0495656_0031815_1288_1629 113
633 3300046616 Ga0495668_0024494 Ga0495668_0024494_1026_1367 113
634 3300046616 Ga0495668_0038413 Ga0495668_0038413_1410_1751 113
635 3300046616 Ga0495668_0046237 Ga0495668_0046237_60_401 113
636 3300046616 Ga0495668_0146343 Ga0495668_0146343_596_937 113
637 3300046648 Ga0495611_0006826 Ga0495611_0006826_1584_1925 113
638 3300046648 Ga0495611_0270597 Ga0495611_0270597_349_690 113
639 3300046660 Ga0495625_0002939 Ga0495625_0002939_15823_16164 113
640 3300046660 Ga0495625_0018879 Ga0495625_0018879_3296_3637 113
641 3300046660 Ga0495625_0062388 Ga0495625_0062388_2012_2353 113
642 3300046660 Ga0495625_0082179 Ga0495625_0082179_873_1214 113
643 3300046660 Ga0495625_0224750 Ga0495625_0224750_851_1192 113
644 3300046660 Ga0495625_0677104 Ga0495625_0677104_71_412 113
645 3300046665 Ga0495661_0101438 Ga0495661_0101438_97_438 113
646 3300046665 Ga0495661_0213888 Ga0495661_0213888_278_619 113
647 3300046674 Ga0495588_0003299 Ga0495588_0003299_1097_1438 113
648 3300046674 Ga0495588_0084396 Ga0495588_0084396_1272_1613 113
649 3300046674 Ga0495588_0195464 Ga0495588_0195464_88_429 113
650 3300046691 Ga0495670_0098453 Ga0495670_0098453_137_478 113
651 3300046691 Ga0495670_0328331 Ga0495670_0328331_219_560 113
652 3300046692 Ga0495671_0074586 Ga0495671_0074586_530_871 113
653 3300046692 Ga0495671_0094033 Ga0495671_0094033_854_1195 113
654 3300046810 Ga0495660_0031201 Ga0495660_0031201_1053_1394 113
655 3300047318 Ga0495636_0106724 Ga0495636_0106724_171_512 113
656 3300047320 Ga0495672_0108312 Ga0495672_0108312_851_1192 113
657 3300047323 Ga0495683_0120289 Ga0495683_0120289_853_1194 113
658 3300047323 Ga0495683_0147713 Ga0495683_0147713_172_513 113
659 3300047443 Ga0495687_057454 Ga0495687_057454_660_1001 113
660 3300047469 Ga0495673_0052604 Ga0495673_0052604_129_470 113
661 3300047470 Ga0495681_0049343 Ga0495681_0049343_1226_1567 113
662 3300047470 Ga0495681_0087851 Ga0495681_0087851_870_1211 113
663 3300047472 Ga0495686_0002387 Ga0495686_0002387_7973_8314 113
664 3300047472 Ga0495686_0068869 Ga0495686_0068869_633_974 113
665 3300047472 Ga0495686_0079178 Ga0495686_0079178_1252_1593 113
666 3300047472 Ga0495686_0220438 Ga0495686_0220438_347_688 113
667 3300047472 Ga0495686_0243706 Ga0495686_0243706_73_414 113
668 3300047472 Ga0495686_0527291 Ga0495686_0527291_256_597 113
669 3300048090 Ga0495615_0021609 Ga0495615_0021609_782_1123 113
670 3300048903 Ga0496100_0762513 Ga0496100_0762513_251_592 113
671 3300048905 Ga0496102_1215588 Ga0496102_1215588_93_434 113
672 3300048907 Ga0496104_0062113 Ga0496104_0062113_1965_2306 113
673 3300048907 Ga0496104_0177469 Ga0496104_0177469_222_563 113
674 3300048909 Ga0496106_0001187 Ga0496106_0001187_5982_6323 113
675 3300048909 Ga0496106_0119030 Ga0496106_0119030_1530_1871 113
676 3300048913 Ga0496110_0274335 Ga0496110_0274335_977_1318 113
677 3300048917 Ga0496114_0273625 Ga0496114_0273625_737_1078 113
678 3300048919 Ga0496116_0000345 Ga0496116_0000345_36721_37062 113
679 3300048919 Ga0496116_0061164 Ga0496116_0061164_926_1267 113
680 3300048919 Ga0496116_0067689 Ga0496116_0067689_1703_2044 113
681 3300048919 Ga0496116_0087532 Ga0496116_0087532_1149_1490 113
682 3300048919 Ga0496116_0110178 Ga0496116_0110178_283_624 113
683 3300048919 Ga0496116_0368224 Ga0496116_0368224_121_462 113
684 3300048920 Ga0496117_0000002 Ga0496117_0000002_363632_363973 113
685 3300048920 Ga0496117_0013587 Ga0496117_0013587_1485_1826 113
686 3300048920 Ga0496117_0227004 Ga0496117_0227004_53_394 113
687 3300048920 Ga0496117_0404485 Ga0496117_0404485_157_498 113
688 3300048921 Ga0496118_0000504 Ga0496118_0000504_55695_56036 113
689 3300048921 Ga0496118_0042282 Ga0496118_0042282_2287_2628 113
690 3300048921 Ga0496118_0061186 Ga0496118_0061186_673_1014 113
691 3300048921 Ga0496118_0250488 Ga0496118_0250488_183_524 113
692 3300048922 Ga0496119_0067662 Ga0496119_0067662_683_1024 113
693 3300048922 Ga0496119_0086309 Ga0496119_0086309_1136_1477 113
694 3300048922 Ga0496119_0483324 Ga0496119_0483324_55_396 113
695 3300048923 Ga0496120_0000248 Ga0496120_0000248_59681_60022 113
696 3300048923 Ga0496120_0118519 Ga0496120_0118519_890_1231 113
697 3300048924 Ga0496121_0001531 Ga0496121_0001531_18344_18685 113
698 3300048924 Ga0496121_0097332 Ga0496121_0097332_1763_2104 113
699 3300048924 Ga0496121_0119820 Ga0496121_0119820_222_563 113
700 3300048924 Ga0496121_0133859 Ga0496121_0133859_857_1198 113
701 3300048924 Ga0496121_0154935 Ga0496121_0154935_986_1327 113
702 3300048924 Ga0496121_0165554 Ga0496121_0165554_144_485 113
703 3300048924 Ga0496121_0181930 Ga0496121_0181930_171_512 113
704 3300048924 Ga0496121_0214133 Ga0496121_0214133_651_992 113
705 3300048924 Ga0496121_0580625 Ga0496121_0580625_182_523 113
706 3300048924 Ga0496121_0618072 Ga0496121_0618072_148_489 113
707 3300048925 Ga0496122_0000004 Ga0496122_0000004_281703_282044 113
708 3300048925 Ga0496122_0002548 Ga0496122_0002548_11726_12067 113
709 3300048925 Ga0496122_0124112 Ga0496122_0124112_269_610 113
710 3300048925 Ga0496122_0149762 Ga0496122_0149762_596_937 113
711 3300048925 Ga0496122_0224031 Ga0496122_0224031_464_805 113
712 3300048926 Ga0496123_0000007 Ga0496123_0000007_281703_282044 113
713 3300048926 Ga0496123_0022459 Ga0496123_0022459_3866_4207 113
714 3300048926 Ga0496123_0042125 Ga0496123_0042125_2496_2837 113
715 3300048926 Ga0496123_0048267 Ga0496123_0048267_467_808 113
716 3300048926 Ga0496123_0168449 Ga0496123_0168449_413_754 113
717 3300048926 Ga0496123_0239234 Ga0496123_0239234_332_676 113
718 3300048926 Ga0496123_0492410 Ga0496123_0492410_157_498 113
719 3300048927 Ga0496124_0000252 Ga0496124_0000252_22989_23330 113
720 3300048927 Ga0496124_0006419 Ga0496124_0006419_2900_3241 113
721 3300048927 Ga0496124_0009611 Ga0496124_0009611_2418_2759 113
722 3300048927 Ga0496124_0020556 Ga0496124_0020556_2889_3230 113
723 3300048927 Ga0496124_0139071 Ga0496124_0139071_102_443 113
724 3300048927 Ga0496124_0192380 Ga0496124_0192380_1028_1369 113
725 3300048927 Ga0496124_0226507 Ga0496124_0226507_1018_1359 113
726 3300048927 Ga0496124_0633542 Ga0496124_0633542_316_657 113
727 3300048927 Ga0496124_0697542 Ga0496124_0697542_181_522 113
728 3300048928 Ga0496125_0010368 Ga0496125_0010368_3830_4171 113
729 3300048928 Ga0496125_0048283 Ga0496125_0048283_2444_2785 113
730 3300048928 Ga0496125_0149422 Ga0496125_0149422_1006_1347 113
731 3300048928 Ga0496125_0217677 Ga0496125_0217677_839_1180 113
732 3300048928 Ga0496125_0288743 Ga0496125_0288743_265_606 113
733 3300048928 Ga0496125_0547575 Ga0496125_0547575_288_629 113
734 3300048929 Ga0496126_0000166 Ga0496126_0000166_90850_91191 113
735 3300048929 Ga0496126_0124418 Ga0496126_0124418_285_626 113
736 3300048929 Ga0496126_0268473 Ga0496126_0268473_597_938 113
737 3300048929 Ga0496126_0305663 Ga0496126_0305663_379_720 113
738 3300048929 Ga0496126_0400314 Ga0496126_0400314_417_758 113
739 3300048929 Ga0496126_0575890 Ga0496126_0575890_38_379 113
740 3300048929 Ga0496126_1065619 Ga0496126_1065619_212_553 113
741 3300049459 Ga0495678_021415 Ga0495678_021415_716_1057 113
742 3300049459 Ga0495678_029112 Ga0495678_029112_1454_1795 113
743 3300049460 Ga0495682_0146631 Ga0495682_0146631_455_796 113
744 3300049568 Ga0501031_0283595 Ga0501031_0283595_299_658 113
745 3300049569 Ga0501032_0015156 Ga0501032_0015156_1615_1974 113
746 3300049569 Ga0501032_0186308 Ga0501032_0186308_27_368 113
747 3300049570 Ga0501033_0138850 Ga0501033_0138850_351_692 113
748 3300049570 Ga0501033_0321333 Ga0501033_0321333_205_546 113
749 3300049570 Ga0501033_0379655 Ga0501033_0379655_568_909 113
750 3300049570 Ga0501033_0379700 Ga0501033_0379700_93_452 113
751 3300049572 Ga0501036_0092975 Ga0501036_0092975_754_1095 113
752 3300049573 Ga0501037_0191459 Ga0501037_0191459_192_551 113
753 3300049574 Ga0501038_0054666 Ga0501038_0054666_1040_1381 113
754 3300049574 Ga0501038_0384945 Ga0501038_0384945_545_904 113
755 3300049575 Ga0501039_0662979 Ga0501039_0662979_446_787 113
756 3300049579 Ga0501043_0016762 Ga0501043_0016762_4126_4467 113
757 3300049580 Ga0501046_0337497 Ga0501046_0337497_235_576 113
758 3300049581 Ga0501047_0002052 Ga0501047_0002052_5901_6260 113
759 3300049581 Ga0501047_0522791 Ga0501047_0522791_634_975 113
760 3300049585 Ga0501069_0001931 Ga0501069_0001931_544_903 113
761 3300049586 Ga0501070_0001919 Ga0501070_0001919_542_901 113
762 3300049586 Ga0501070_0121349 Ga0501070_0121349_216_557 113
763 3300049586 Ga0501070_0724810 Ga0501070_0724810_332_685 113
764 3300049587 Ga0501071_0020928 Ga0501071_0020928_1824_2183 113
765 3300049589 Ga0501073_0041954 Ga0501073_0041954_344_685 113
766 3300049589 Ga0501073_0324713 Ga0501073_0324713_224_583 113
767 3300049589 Ga0501073_0401151 Ga0501073_0401151_422_763 113
768 3300049590 Ga0501074_0043755 Ga0501074_0043755_2743_3102 113
769 3300049742 Ga0501080_0034296 Ga0501080_0034296_3446_3787 113
770 3300049742 Ga0501080_0076664 Ga0501080_0076664_1077_1418 113
771 3300049742 Ga0501080_1167591 Ga0501080_1167591_155_496 113
772 3300049744 Ga0501083_0063598 Ga0501083_0063598_187_528 113
773 3300049758 Ga0501241_053434 Ga0501241_053434_352_693 113
774 3300049776 Ga0501280_002281 Ga0501280_002281_329_673 113
775 3300049822 Ga0501035_0001755 Ga0501035_0001755_5332_5691 113
776 3300049822 Ga0501035_0035914 Ga0501035_0035914_2778_3119 113
777 3300049822 Ga0501035_1026923 Ga0501035_1026923_218_559 113
778 3300049823 Ga0501044_0017870 Ga0501044_0017870_2582_2941 113
779 3300049823 Ga0501044_0027924 Ga0501044_0027924_424_783 113
780 3300049823 Ga0501044_0072482 Ga0501044_0072482_2349_2690 113
781 3300049823 Ga0501044_0139658 Ga0501044_0139658_1711_2052 113
782 3300049823 Ga0501044_0150240 Ga0501044_0150240_1542_1901 113
783 3300050489 nmdc:mga03683_30154_c1 nmdc:mga03683_30154_c1_408_749 113
784 3300050489 nmdc:mga03683_3862_c1 nmdc:mga03683_3862_c1_3572_3913 113
785 3300050490 nmdc:mga03n38_191900_c1 nmdc:mga03n38_191900_c1_165_506 113
786 3300050490 nmdc:mga03n38_8396_c1 nmdc:mga03n38_8396_c1_3085_3426 113
787 3300050491 nmdc:mga00v17_241_c1 nmdc:mga00v17_241_c1_19014_19355 113
788 3300050491 nmdc:mga00v17_375033_c1 nmdc:mga00v17_375033_c1_288_629 113
789 3300050491 nmdc:mga00v17_465_c1 nmdc:mga00v17_465_c1_13279_13620 113
790 3300050492 nmdc:mga0yw44_1001192_c1 nmdc:mga0yw44_1001192_c1_118_459 113
791 3300050492 nmdc:mga0yw44_133_c1 nmdc:mga0yw44_133_c1_13090_13431 113
792 3300050492 nmdc:mga0yw44_168685_c1 nmdc:mga0yw44_168685_c1_858_1199 113
793 3300050492 nmdc:mga0yw44_2265_c1 nmdc:mga0yw44_2265_c1_1256_1597 113
794 3300050492 nmdc:mga0yw44_268461_c1 nmdc:mga0yw44_268461_c1_462_803 113
795 3300050493 nmdc:mga0k408_349403_c1 nmdc:mga0k408_349403_c1_205_546 113
796 3300050493 nmdc:mga0k408_60205_c1 nmdc:mga0k408_60205_c1_1801_2142 113
797 3300050493 nmdc:mga0k408_8182_c1 nmdc:mga0k408_8182_c1_294_635 113
798 3300050494 nmdc:mga06z11_130543_c1 nmdc:mga06z11_130543_c1_109_450 113
799 3300050494 nmdc:mga06z11_153672_c1 nmdc:mga06z11_153672_c1_341_682 113
800 3300050494 nmdc:mga06z11_23526_c1 nmdc:mga06z11_23526_c1_2047_2388 113
801 3300050494 nmdc:mga06z11_247108_c1 nmdc:mga06z11_247108_c1_94_435 113
802 3300050494 nmdc:mga06z11_627147_c1 nmdc:mga06z11_627147_c1_118_459 113
803 3300050496 nmdc:mga07m45_10696_c1 nmdc:mga07m45_10696_c1_704_1045 113
804 3300050496 nmdc:mga07m45_184079_c1 nmdc:mga07m45_184079_c1_616_957 113
805 3300050516 nmdc:mga0sz30_1524_c1 nmdc:mga0sz30_1524_c1_4603_4944 113
806 3300050516 nmdc:mga0sz30_17253_c1 nmdc:mga0sz30_17253_c1_1351_1692 113
807 3300050516 nmdc:mga0sz30_39384_c2 nmdc:mga0sz30_39384_c2_124_465 113
808 3300050516 nmdc:mga0sz30_7333_c2 nmdc:mga0sz30_7333_c2_264_605 113
809 3300053079 Ga0500610_0019202 Ga0500610_0019202_1566_1907 113
810 3300053086 Ga0500578_0051542 Ga0500578_0051542_282_623 113
811 3300053086 Ga0500578_0341496 Ga0500578_0341496_255_596 113
812 3300053087 Ga0500643_030625 Ga0500643_030625_1212_1553 113
813 3300053087 Ga0500643_086984 Ga0500643_086984_392_733 113
814 3300053088 Ga0500644_0469872 Ga0500644_0469872_201_542 113
815 3300053090 Ga0500646_0179060 Ga0500646_0179060_270_611 113
816 3300053098 Ga0500650_0312813 Ga0500650_0312813_99_440 113
817 3300053104 Ga0500556_0433054 Ga0500556_0433054_48_392 113
818 3300053105 Ga0500557_025373 Ga0500557_025373_201_542 113
819 3300053107 Ga0500560_000794 Ga0500560_000794_3371_3712 113
820 3300053107 Ga0500560_036860 Ga0500560_036860_941_1282 113
821 3300053108 Ga0500562_164008 Ga0500562_164008_180_521 113
822 3300053109 Ga0500569_002351 Ga0500569_002351_68_409 113
823 3300053111 Ga0500572_064552 Ga0500572_064552_470_811 113
824 3300053118 Ga0500594_0016843 Ga0500594_0016843_1240_1581 113
825 3300053122 Ga0500608_212641 Ga0500608_212641_181_522 113
826 3300053125 Ga0500618_019348 Ga0500618_019348_949_1290 113
827 3300053125 Ga0500618_021454 Ga0500618_021454_356_697 113
828 3300053130 Ga0500642_0261929 Ga0500642_0261929_248_589 113
829 3300053131 Ga0500652_071429 Ga0500652_071429_560_901 113
830 3300053134 Ga0500658_0001084 Ga0500658_0001084_7228_7569 113
831 3300053134 Ga0500658_0002286 Ga0500658_0002286_2401_2742 113
832 3300053134 Ga0500658_0138432 Ga0500658_0138432_629_970 113
833 3300053134 Ga0500658_0214603 Ga0500658_0214603_300_641 113
834 3300053136 Ga0500559_0003305 Ga0500559_0003305_5705_6079 113
835 3300053137 Ga0500561_0000087 Ga0500561_0000087_9507_9848 113
836 3300053139 Ga0500568_0000963 Ga0500568_0000963_11694_12035 113
837 3300053139 Ga0500568_0001620 Ga0500568_0001620_5966_6307 113
838 3300053140 Ga0500573_0070568 Ga0500573_0070568_323_664 113
839 3300053142 Ga0500577_0103999 Ga0500577_0103999_755_1096 113
840 3300053146 Ga0500588_0015357 Ga0500588_0015357_202_543 113
841 3300053151 Ga0500604_0017152 Ga0500604_0017152_1406_1747 113
842 3300053151 Ga0500604_0017696 Ga0500604_0017696_567_908 113
843 3300053153 Ga0500616_0000577 Ga0500616_0000577_28438_28779 113
844 3300053153 Ga0500616_0000682 Ga0500616_0000682_30651_30992 113
845 3300053153 Ga0500616_0015042 Ga0500616_0015042_3124_3468 113
846 3300053153 Ga0500616_0021117 Ga0500616_0021117_2011_2352 113
847 3300053155 Ga0500620_080485 Ga0500620_080485_43_384 113
848 3300053156 Ga0500622_0000429 Ga0500622_0000429_26294_26635 113
849 3300053156 Ga0500622_0002353 Ga0500622_0002353_2974_3315 113
850 3300053157 Ga0500624_000644 Ga0500624_000644_8403_8744 113
851 3300053157 Ga0500624_016153 Ga0500624_016153_710_1051 113
852 3300053157 Ga0500624_094647 Ga0500624_094647_211_561 113
853 3300053158 Ga0500627_0083499 Ga0500627_0083499_370_711 113
854 3300053158 Ga0500627_0462174 Ga0500627_0462174_87_428 113
855 3300053160 Ga0500633_0009256 Ga0500633_0009256_527_868 113
856 3300053161 Ga0500634_0002413 Ga0500634_0002413_210_560 113
857 3300053161 Ga0500634_0003778 Ga0500634_0003778_3281_3622 113
858 3300053177 Ga0500636_0072384 Ga0500636_0072384_1576_1917 113
859 3300053730 Ga0500645_113579 Ga0500645_113579_258_599 113
860 3300053731 Ga0500609_026158 Ga0500609_026158_48_389 113
861 3300053736 Ga0500599_056775 Ga0500599_056775_37_378 113
862 3300060353 Ga0501082_1102236 Ga0501082_1102236_40_381 113
863 iso_pu_bacteria 2510461069 2510839555 113
864 iso_pu_bacteria 2643221653 2644298787 113
865 iso_pu_bacteria 2643221719 2644657016 113
866 iso_pu_bacteria 2989776772 2989779344 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

26

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.8754 5 111
5zdi-assembly1.cif.gz_B crystal structure of csaa chaperone protein from picrophilus torridus 0.865 5 111
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.8593 5 111
1ntg-assembly4.cif.gz_D crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase 0.8574 12 99
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.852 5 111
ID Description Score Start End Superfamily
af_A0A1D8PS57_12_182_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9102 13 93 2.40.50.140
af_Q9M1X8_80_273_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.886 13 99 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8749 5 111 2.40.50.140
af_Q54X95_575_736_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8613 13 99 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8514 5 111 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6L8IAA1-F1-model_v4 tRNA-binding protein 0.9803 5 86 GO:0000049
AF-A0A382CJ13-F1-model_v4 tRNA-binding domain-containing protein 0.9724 4 99 GO:0000049
AF-A0A0G0W0R9-F1-model_v4 Methionyl-tRNA synthetase 0.9712 5 99 GO:0000049
GO:0004812
GO:0016616
GO:0051287
AF-A0A554L8Y5-F1-model_v4 tRNA-binding protein 0.9663 16 84 GO:0000049
AF-A0A2D7FMK5-F1-model_v4 tRNA-binding protein 0.9597 4 96

Feature Viewer

pLDDT pTM Quality
91.1 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map