F484033

General Info

Members Datasets Scaffolds Average Seq Length
866 547 731 168

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0400493|Ga0501032_0400493_115_648
Length 177
Sequence MTIPASVHASAVKVGSRAVLIRGPSGSGKSRLAFDLILCGRSGQLPPAVLVGDDRVRLDTGAGQFAGQLLVRPVAELAGLIEIRGLGIRRTDFVAEAGVGLVVDLAAADAERLPPRQALQISIFGVEIPRIPVAADFSPLPLVVAALTTADGLPSLNPAQDCFKGIGNHITGTLAPE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
13 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
16 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
17 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
18 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
19 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
20 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
21 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
22 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
23 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
24 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
25 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
26 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
27 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
28 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
29 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
30 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
31 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
32 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
33 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
34 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
35 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
36 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
37 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
38 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
39 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
40 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
41 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
42 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
43 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
44 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
45 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
46 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
47 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
48 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
49 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
50 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
51 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
52 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
53 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
54 2922368715
55 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
56 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
57 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
58 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
59 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
60 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
61 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
62 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
63 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
64 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
65 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
66 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
67 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
68 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
69 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
70 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
71 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
72 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
73 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
74 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
75 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
76 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
77 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
78 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
79 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
80 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
81 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
82 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
83 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
84 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
85 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
86 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
87 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
88 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
89 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
90 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
91 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
92 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
93 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
94 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
95 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
96 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
97 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
98 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
99 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
100 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
101 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
102 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
103 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
104 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
105 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
106 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
107 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
108 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
109 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
110 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
111 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
112 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
113 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
114 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
115 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
116 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
117 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
118 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
122 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
123 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
124 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
125 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
126 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
127 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
128 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
129 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
130 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
131 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
136 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
137 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
138 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
139 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
140 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
141 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
147 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
148 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
149 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
150 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
151 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
152 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
155 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
156 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
157 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
158 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
159 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
160 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
161 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
162 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
163 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
164 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
165 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
166 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
167 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
168 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
169 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
170 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
171 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
172 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
173 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
174 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
175 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
176 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
177 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
178 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
179 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
180 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
182 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
183 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
184 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
186 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
187 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
188 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
189 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
190 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
192 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
197 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
198 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
210 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
211 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
212 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
213 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
214 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
215 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
216 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
217 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
218 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
219 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
220 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
227 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
229 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
282 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
283 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
284 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
285 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
289 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
290 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
291 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
292 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
293 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
294 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
295 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
298 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
301 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
302 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
303 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
304 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
305 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
306 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
308 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
309 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
310 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
311 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
312 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
313 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
314 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
315 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
319 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
322 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
323 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
324 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
325 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
328 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
329 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
330 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
331 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
332 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
333 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
334 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
335 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
338 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
339 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
340 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
349 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
361 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
364 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
365 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
366 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
367 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
368 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
369 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
370 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
375 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
376 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
380 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
381 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
390 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
391 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
401 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
402 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
403 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
404 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
405 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
406 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
407 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
408 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
409 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
410 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
411 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
412 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
413 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
414 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
415 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
416 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
419 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
420 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
421 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
424 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
425 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
426 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
427 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
428 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
429 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
437 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
438 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
439 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
446 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
447 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
448 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
466 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
467 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
468 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
469 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
470 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
476 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
477 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
480 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
481 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
488 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
489 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
490 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
491 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
492 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
493 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
494 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
495 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
496 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
497 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
498 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
499 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
500 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
503 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
504 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
505 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
506 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
507 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
508 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
509 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
512 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
513 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
514 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
515 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
516 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
517 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
518 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
519 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
520 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
521 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
522 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
523 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
524 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
525 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
526 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
527 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
531 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
532 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
533 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
534 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
535 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
536 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
537 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
538 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
539 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
540 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
541 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
542 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
543 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
544 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
545 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
546 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
547 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 0.23
Isolates 15.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 13.63
Rhizoplane 5.2
Rhizosphere 59.82
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10033514 3300003215 Bacteria 1694
2 JGI25153J46596_10037071 3300003215 Bacteria 1555
3 JGI25160J50197_1013318 3300003354 Bacteria 2809
4 Ga0055539_1009637 3300003752 Bacteria 1197
5 Ga0055531_10015632 3300003794 Bacteria 3329
6 Ga0065165_1012522 3300005262 Bacteria 3448
7 Ga0065165_1077129 3300005262 Bacteria 872
8 Ga0070658_10262669 3300005327 Bacteria 1466
9 Ga0070683_100067645 3300005329 Bacteria 3327
10 Ga0070683_100070645 3300005329 Bacteria 3257
11 Ga0070670_101051257 3300005331 Bacteria 741
12 Ga0070666_10407866 3300005335 Bacteria 977
13 Ga0070680_100038360 3300005336 Bacteria 3875
14 Ga0070682_100030995 3300005337 Bacteria 3231
15 Ga0068868_100824741 3300005338 Bacteria 838
16 Ga0070660_100016551 3300005339 Bacteria 5353
17 Ga0070689_100762774 3300005340 Bacteria 848
18 Ga0070691_10047567 3300005341 Bacteria 2040
19 Ga0070661_100666481 3300005344 Bacteria 845
20 Ga0070661_100922997 3300005344 Bacteria 721
21 Ga0070692_10635626 3300005345 Bacteria 711
22 Ga0070668_100291738 3300005347 Bacteria 1365
23 Ga0070668_100368644 3300005347 Bacteria 1219
24 Ga0070668_100742232 3300005347 Bacteria 868
25 Ga0070668_101065366 3300005347 Bacteria 728
26 Ga0070669_100096348 3300005353 Bacteria 2226
27 Ga0070671_100953668 3300005355 Bacteria 750
28 Ga0070659_100246541 3300005366 Bacteria 1480
29 Ga0070667_100472482 3300005367 Bacteria 1147
30 Ga0070709_10165845 3300005434 Bacteria 1539
31 Ga0070709_10182234 3300005434 Bacteria 1475
32 Ga0070714_100050500 3300005435 Bacteria 3543
33 Ga0070714_100111422 3300005435 Bacteria 2423
34 Ga0070713_100014007 3300005436 Bacteria 5937
35 Ga0070713_100450610 3300005436 Bacteria 1208
36 Ga0070710_10293085 3300005437 Bacteria 1059
37 Ga0070711_100024318 3300005439 Bacteria 3950
38 Ga0070663_100108980 3300005455 Bacteria 2078
39 Ga0070663_100348478 3300005455 Bacteria 1198
40 Ga0070678_100060242 3300005456 Bacteria 2793
41 Ga0070678_100275500 3300005456 Bacteria 1421
42 Ga0070678_100847761 3300005456 Bacteria 832
43 Ga0070662_100301729 3300005457 Bacteria 1301
44 Ga0070681_10080143 3300005458 Bacteria 3221
45 Ga0070681_10140566 3300005458 Bacteria 2344
46 Ga0070681_10262104 3300005458 Bacteria 1640
47 Ga0070681_10572299 3300005458 Bacteria 1043
48 Ga0070685_10183029 3300005466 Bacteria 1350
49 Ga0070707_100216548 3300005468 Bacteria 1866
50 Ga0070679_100304289 3300005530 Bacteria 1545
51 Ga0070679_100557305 3300005530 Bacteria 1090
52 Ga0070684_100005197 3300005535 Bacteria 9952
53 Ga0070684_100073578 3300005535 Bacteria 3011
54 Ga0070697_100508499 3300005536 Bacteria 1054
55 Ga0068853_100156985 3300005539 Bacteria 2050
56 Ga0068853_100329145 3300005539 Bacteria 1417
57 Ga0068853_100457636 3300005539 Bacteria 1201
58 Ga0070693_100722044 3300005547 Bacteria 731
59 Ga0070665_100120177 3300005548 Bacteria 2629
60 Ga0070665_100454604 3300005548 Bacteria 1290
61 Ga0070665_100945123 3300005548 Bacteria 874
62 Ga0068855_100324958 3300005563 Bacteria 1699
63 Ga0068855_100350463 3300005563 Bacteria 1626
64 Ga0070664_100149720 3300005564 Bacteria 2060
65 Ga0070664_100300874 3300005564 Bacteria 1449
66 Ga0070664_101111841 3300005564 Bacteria 744
67 Ga0068857_100639548 3300005577 Bacteria 1007
68 Ga0068857_100930309 3300005577 Bacteria 835
69 Ga0068854_100108189 3300005578 Bacteria 2093
70 Ga0068854_100225483 3300005578 Bacteria 1485
71 Ga0068856_100333155 3300005614 Bacteria 1535
72 Ga0068852_100133685 3300005616 Bacteria 2287
73 Ga0068852_100195359 3300005616 Bacteria 1912
74 Ga0068852_100432784 3300005616 Bacteria 1299
75 Ga0068852_101619923 3300005616 Bacteria 670
76 Ga0068859_100606613 3300005617 Bacteria 1187
77 Ga0068864_100282186 3300005618 Bacteria 1550
78 Ga0068851_10099579 3300005834 Bacteria 1540
79 Ga0068863_100346762 3300005841 Bacteria 1445
80 Ga0068863_100358896 3300005841 Bacteria 1420
81 Ga0068863_100536403 3300005841 Bacteria 1154
82 Ga0068863_101075487 3300005841 Bacteria 808
83 Ga0068858_100186244 3300005842 Bacteria 1961
84 Ga0068858_100406503 3300005842 Bacteria 1308
85 Ga0068858_100515121 3300005842 Bacteria 1156
86 Ga0068860_100533251 3300005843 Bacteria 1174
87 Ga0068860_101077660 3300005843 Bacteria 822
88 Ga0068862_100378117 3300005844 Bacteria 1320
89 Ga0081540_1047384 3300005983 Bacteria 2162
90 Ga0081540_1070925 3300005983 Bacteria 1612
91 Ga0081539_10088217 3300005985 Bacteria 1610
92 Ga0070717_10002055 3300006028 Bacteria 14098
93 Ga0070717_10025850 3300006028 Bacteria 4678
94 Ga0075365_10206647 3300006038 Bacteria 1376
95 Ga0075365_10232508 3300006038 Bacteria 1294
96 Ga0075365_10234257 3300006038 Bacteria 1289
97 Ga0075365_10364252 3300006038 Bacteria 1019
98 Ga0075365_10622319 3300006038 Bacteria 763
99 Ga0075368_10009616 3300006042 Bacteria 3480
100 Ga0075363_100247745 3300006048 Bacteria 1025
101 Ga0075363_100264538 3300006048 Bacteria 993
102 Ga0075363_100379374 3300006048 Bacteria 829
103 Ga0075364_10152558 3300006051 Bacteria 1557
104 Ga0075364_10262342 3300006051 Bacteria 1174
105 Ga0075364_10277744 3300006051 Bacteria 1140
106 Ga0070716_100256662 3300006173 Bacteria 1194
107 Ga0070716_100719448 3300006173 Bacteria 765
108 Ga0070712_100036410 3300006175 Bacteria 3349
109 Ga0075362_10059419 3300006177 Bacteria 1726
110 Ga0075367_10218165 3300006178 Bacteria 1193
111 Ga0075367_10324487 3300006178 Bacteria 970
112 Ga0075367_10364528 3300006178 Bacteria 912
113 Ga0075367_10596566 3300006178 Bacteria 702
114 Ga0075369_10181476 3300006186 Bacteria 968
115 Ga0075369_10211103 3300006186 Bacteria 897
116 Ga0075369_10286017 3300006186 Bacteria 768
117 Ga0075366_10018305 3300006195 Bacteria 4042
118 Ga0075366_10143689 3300006195 Bacteria 1443
119 Ga0075366_10479434 3300006195 Bacteria 768
120 Ga0097621_100672367 3300006237 Bacteria 951
121 Ga0075370_10234397 3300006353 Bacteria 1086
122 Ga0075370_10248780 3300006353 Bacteria 1053
123 Ga0068871_100454545 3300006358 Bacteria 1148
124 Ga0075428_100338329 3300006844 Bacteria 1616
125 Ga0097620_100606605 3300006931 Bacteria 1187
126 Ga0099823_1085769 3300006944 Bacteria 1141
127 Ga0075435_100142716 3300007076 Bacteria 2010
128 Ga0105240_10001522 3300009093 Bacteria 39421
129 Ga0105240_10039101 3300009093 Bacteria 6078
130 Ga0105240_10118623 3300009093 Bacteria 3188
131 Ga0105240_10377122 3300009093 Bacteria 1602
132 Ga0105245_10185096 3300009098 Bacteria 1992
133 Ga0105245_10968557 3300009098 Bacteria 894
134 Ga0105247_10181651 3300009101 Bacteria 1404
135 Ga0105247_10190188 3300009101 Bacteria 1374
136 Ga0105247_10209937 3300009101 Bacteria 1313
137 Ga0114129_10186448 3300009147 Bacteria 2819
138 Ga0105243_10907816 3300009148 Bacteria 877
139 Ga0105241_10213333 3300009174 Bacteria 1618
140 Ga0105242_10201271 3300009176 Bacteria 1769
141 Ga0105248_10127908 3300009177 Bacteria 2866
142 Ga0105248_10451617 3300009177 Bacteria 1448
143 Ga0105248_10937152 3300009177 Bacteria 978
144 Ga0105237_10043065 3300009545 Bacteria 4550
145 Ga0105237_10081784 3300009545 Bacteria 3221
146 Ga0105237_10173918 3300009545 Bacteria 2153
147 Ga0105237_10207163 3300009545 Bacteria 1961
148 Ga0105237_10543982 3300009545 Bacteria 1168
149 Ga0105237_10786368 3300009545 Bacteria 958
150 Ga0105237_10836987 3300009545 Bacteria 927
151 Ga0105238_10545277 3300009551 Bacteria 1164
152 Ga0105238_11112038 3300009551 Bacteria 813
153 Ga0105238_11404517 3300009551 Bacteria 725
154 Ga0105249_10546486 3300009553 Bacteria 1208
155 Ga0099796_10022000 3300010159 Bacteria 1972
156 Ga0105239_10175070 3300010375 Bacteria 2400
157 Ga0105239_10664518 3300010375 Bacteria 1190
158 Ga0105239_11087032 3300010375 Bacteria 920
159 Ga0105239_11165830 3300010375 Bacteria 888
160 Ga0105239_11373142 3300010375 Bacteria 815
161 Ga0105239_11609889 3300010375 Bacteria 751
162 Ga0105239_11614904 3300010375 Bacteria 750
163 Ga0105246_10048250 3300011119 Bacteria 2910
164 Ga0105246_10859604 3300011119 Bacteria 810
165 Ga0157314_1003836 3300012500 Bacteria 1082
166 Ga0157371_10136557 3300013102 Bacteria 1746
167 Ga0157370_10077383 3300013104 Bacteria 3134
168 Ga0157370_10519605 3300013104 Bacteria 1093
169 Ga0157370_10655669 3300013104 Bacteria 959
170 Ga0157369_10010577 3300013105 Bacteria 10503
171 Ga0157369_10111832 3300013105 Bacteria 2903
172 Ga0157369_10194618 3300013105 Bacteria 2130
173 Ga0157374_10229486 3300013296 Bacteria 1823
174 Ga0157374_11277486 3300013296 Bacteria 756
175 Ga0157378_11164949 3300013297 Bacteria 809
176 Ga0157378_11362339 3300013297 Bacteria 752
177 Ga0163162_10473514 3300013306 Bacteria 1384
178 Ga0163162_11186576 3300013306 Bacteria 866
179 Ga0163162_11315793 3300013306 Bacteria 821
180 Ga0163162_11664201 3300013306 Bacteria 728
181 Ga0157372_10231909 3300013307 Bacteria 2140
182 Ga0157372_10507255 3300013307 Bacteria 1406
183 Ga0157372_11521526 3300013307 Bacteria 771
184 Ga0157372_12070924 3300013307 Bacteria 654
185 Ga0157375_10457366 3300013308 Bacteria 1442
186 Ga0157375_10535403 3300013308 Bacteria 1334
187 Ga0163163_10096851 3300014325 Bacteria 2971
188 Ga0163163_10167718 3300014325 Bacteria 2242
189 Ga0157380_10759698 3300014326 Bacteria 982
190 Ga0157380_11412267 3300014326 Bacteria 747
191 Ga0157379_10065931 3300014968 Bacteria 3237
192 Ga0157376_10160668 3300014969 Bacteria 2036
193 Ga0157376_10601087 3300014969 Bacteria 1095
194 Ga0157376_10632910 3300014969 Bacteria 1068
195 Ga0163161_10277455 3300017792 Bacteria 1314
196 Ga0163161_10517824 3300017792 Bacteria 974
197 Ga0163161_10790537 3300017792 Bacteria 797
198 Ga0214544_1000007 3300021320 Bacteria 379989
199 Ga0214542_1000216 3300021321 Bacteria 92614
200 Ga0214542_1042175 3300021321 Bacteria 1106
201 Ga0214545_1000118 3300021324 Bacteria 92737
202 Ga0214545_1043334 3300021324 Bacteria 1106
203 Ga0214543_1000009 3300021327 Bacteria 384302
204 Ga0213872_10166416 3300021361 Bacteria 957
205 Ga0213874_10030678 3300021377 Bacteria 1551
206 Ga0213876_10022972 3300021384 Bacteria 3295
207 Ga0224712_10136980 3300022467 Bacteria 1074
208 Ga0209563_103176 3300025230 Bacteria 3463
209 Ga0209677_100296 3300025253 Bacteria 32613
210 Ga0209677_106519 3300025253 Bacteria 2741
211 Ga0209148_1001484 3300025254 Bacteria 11741
212 Ga0209233_1006650 3300025261 Bacteria 3707
213 Ga0209564_1021748 3300025295 Bacteria 2294
214 Ga0209758_1000030 3300025297 Bacteria 509217
215 Ga0209758_1000429 3300025297 Bacteria 71157
216 Ga0209758_1006708 3300025297 Bacteria 8117
217 Ga0209758_1033130 3300025297 Bacteria 2082
218 Ga0209758_1034727 3300025297 Bacteria 2000
219 Ga0209256_1002159 3300025299 Bacteria 16970
220 Ga0207426_1001158 3300025302 Bacteria 23695
221 Ga0207426_1008203 3300025302 Bacteria 4252
222 Ga0207426_1078254 3300025302 Bacteria 903
223 Ga0209257_1005466 3300025304 Bacteria 8912
224 Ga0209257_1026629 3300025304 Bacteria 1943
225 Ga0207710_10108429 3300025900 Bacteria 1317
226 Ga0207710_10244828 3300025900 Bacteria 895
227 Ga0207688_10049994 3300025901 Bacteria 2339
228 Ga0207680_10476417 3300025903 Bacteria 887
229 Ga0207647_10017521 3300025904 Bacteria 4868
230 Ga0207647_10191221 3300025904 Bacteria 1186
231 Ga0207699_10241754 3300025906 Bacteria 1240
232 Ga0207645_10385829 3300025907 Bacteria 941
233 Ga0207705_10048892 3300025909 Bacteria 3043
234 Ga0207705_10168126 3300025909 Bacteria 1650
235 Ga0207684_10073655 3300025910 Bacteria 2901
236 Ga0207654_10253672 3300025911 Bacteria 1180
237 Ga0207707_10016071 3300025912 Bacteria 6527
238 Ga0207707_10082019 3300025912 Bacteria 2815
239 Ga0207707_10185538 3300025912 Bacteria 1815
240 Ga0207707_10269126 3300025912 Bacteria 1477
241 Ga0207695_10000006 3300025913 Bacteria 1135309
242 Ga0207671_10498170 3300025914 Bacteria 971
243 Ga0207671_10498693 3300025914 Bacteria 971
244 Ga0207671_10558395 3300025914 Bacteria 913
245 Ga0207671_10585255 3300025914 Bacteria 890
246 Ga0207671_10692660 3300025914 Bacteria 811
247 Ga0207693_10037984 3300025915 Bacteria 3793
248 Ga0207663_10018567 3300025916 Bacteria 3900
249 Ga0207657_10003442 3300025919 Bacteria 16882
250 Ga0207657_10208275 3300025919 Bacteria 1570
251 Ga0207652_10015649 3300025921 Bacteria 6174
252 Ga0207652_10270126 3300025921 Bacteria 1534
253 Ga0207681_10475865 3300025923 Bacteria 1019
254 Ga0207694_10243918 3300025924 Bacteria 1469
255 Ga0207694_10362224 3300025924 Bacteria 1202
256 Ga0207694_11148492 3300025924 Bacteria 657
257 Ga0207650_10694664 3300025925 Bacteria 859
258 Ga0207700_10004386 3300025928 Bacteria 8309
259 Ga0207700_10036905 3300025928 Bacteria 3534
260 Ga0207700_10359390 3300025928 Bacteria 1269
261 Ga0207664_10112953 3300025929 Bacteria 2262
262 Ga0207664_10175510 3300025929 Bacteria 1837
263 Ga0207644_10122338 3300025931 Bacteria 1982
264 Ga0207690_10029081 3300025932 Bacteria 3510
265 Ga0207690_10673141 3300025932 Bacteria 849
266 Ga0207690_10702476 3300025932 Bacteria 831
267 Ga0207706_10163428 3300025933 Bacteria 1957
268 Ga0207669_10865854 3300025937 Bacteria 753
269 Ga0207665_10220392 3300025939 Bacteria 1390
270 Ga0207665_10429433 3300025939 Bacteria 1011
271 Ga0207665_10611723 3300025939 Bacteria 851
272 Ga0207691_10580733 3300025940 Bacteria 949
273 Ga0207711_10323460 3300025941 Bacteria 1425
274 Ga0207689_10939625 3300025942 Bacteria 730
275 Ga0207661_10000379 3300025944 Bacteria 28634
276 Ga0207661_10042228 3300025944 Bacteria 3594
277 Ga0207679_10144070 3300025945 Bacteria 1930
278 Ga0207679_10520126 3300025945 Bacteria 1064
279 Ga0207679_10886879 3300025945 Bacteria 815
280 Ga0207679_11449195 3300025945 Bacteria 630
281 Ga0207667_10226493 3300025949 Bacteria 1915
282 Ga0207651_10749486 3300025960 Bacteria 863
283 Ga0207712_11183865 3300025961 Bacteria 681
284 Ga0207668_10055426 3300025972 Bacteria 2755
285 Ga0207668_10292695 3300025972 Bacteria 1340
286 Ga0207668_10909319 3300025972 Bacteria 783
287 Ga0207640_11174499 3300025981 Bacteria 681
288 Ga0207658_10909768 3300025986 Bacteria 801
289 Ga0207677_10038493 3300026023 Bacteria 3136
290 Ga0207677_10767693 3300026023 Bacteria 860
291 Ga0207703_10181174 3300026035 Bacteria 1859
292 Ga0207639_10086651 3300026041 Bacteria 2494
293 Ga0207639_10184081 3300026041 Bacteria 1779
294 Ga0207639_10313636 3300026041 Bacteria 1390
295 Ga0207639_11012424 3300026041 Bacteria 778
296 Ga0207639_11217732 3300026041 Bacteria 707
297 Ga0207678_10077612 3300026067 Bacteria 2845
298 Ga0207678_10174915 3300026067 Bacteria 1833
299 Ga0207678_10975831 3300026067 Bacteria 750
300 Ga0207702_10229166 3300026078 Bacteria 1735
301 Ga0207702_10285899 3300026078 Bacteria 1561
302 Ga0207702_10337813 3300026078 Bacteria 1438
303 Ga0207702_10480126 3300026078 Bacteria 1209
304 Ga0207641_10513023 3300026088 Bacteria 1165
305 Ga0207648_10593045 3300026089 Bacteria 1021
306 Ga0207648_10821384 3300026089 Bacteria 866
307 Ga0207676_10405994 3300026095 Bacteria 1274
308 Ga0207676_11325365 3300026095 Bacteria 715
309 Ga0207674_10663277 3300026116 Bacteria 1007
310 Ga0207674_11046140 3300026116 Bacteria 785
311 Ga0207675_100157667 3300026118 Bacteria 2163
312 Ga0207675_100953586 3300026118 Bacteria 875
313 Ga0207683_10089043 3300026121 Bacteria 2747
314 Ga0207683_10147116 3300026121 Bacteria 2125
315 Ga0207683_10488983 3300026121 Bacteria 1136
316 Ga0207683_11075637 3300026121 Bacteria 746
317 Ga0207698_10143546 3300026142 Bacteria 2061
318 Ga0207698_10158800 3300026142 Bacteria 1974
319 Ga0209389_1000015 3300027296 Bacteria 188311
320 Ga0209389_1000035 3300027296 Bacteria 127089
321 Ga0209589_1000039 3300027357 Bacteria 127084
322 Ga0209489_100072 3300027361 Bacteria 138111
323 Ga0209489_100084 3300027361 Bacteria 127094
324 Ga0209700_100034 3300027363 Bacteria 197276
325 Ga0209813_10020652 3300027866 Bacteria 1845
326 Ga0268266_10033807 3300028379 Bacteria 4345
327 Ga0268266_10039481 3300028379 Bacteria 4021
328 Ga0268266_10392170 3300028379 Bacteria 1311
329 Ga0268266_11075393 3300028379 Bacteria 778
330 Ga0268264_10776862 3300028381 Bacteria 956
331 Ga0268264_10908123 3300028381 Bacteria 884
332 Ga0307517_10000066 3300028786 Bacteria 141370
333 Ga0265340_10078084 3300031247 Bacteria 1561
334 Ga0265339_10002540 3300031249 Bacteria 13011
335 Ga0307508_10023991 3300031616 Bacteria 5535
336 Ga0307516_10334304 3300031730 Bacteria 1183
337 Ga0307405_10580691 3300031731 Bacteria 912
338 Ga0307405_10781400 3300031731 Bacteria 798
339 Ga0307407_10330785 3300031903 Bacteria 1072
340 Ga0307412_10218952 3300031911 Bacteria 1458
341 Ga0307416_100321671 3300032002 Bacteria 1549
342 Ga0307416_101615683 3300032002 Bacteria 753
343 Ga0307411_11077849 3300032005 Bacteria 723
344 Ga0307415_100265892 3300032126 Bacteria 1402
345 Ga0307510_10009663 3300033180 Bacteria 11491
346 Ga0316215_1007381 3300033544 Bacteria 1071
347 Ga0316213_1003479 3300033546 Bacteria 1043
348 Ga0373958_0126472 3300034819 Bacteria 622
349 Ga0373928_0032860 3300035084 Bacteria 1158
350 Ga0373934_0060865 3300035086 Bacteria 1504
351 Ga0373944_0094694 3300035089 Bacteria 1002
352 Ga0373944_0235089 3300035089 Bacteria 673
353 Ga0373923_0004740 3300035111 Bacteria 4544
354 Ga0373939_0080834 3300035114 Bacteria 1079
355 Ga0373945_0198753 3300035116 Bacteria 831
356 Ga0373954_0179668 3300035118 Bacteria 1037
357 Ga0373956_0086675 3300035119 Bacteria 1441
358 Ga0373957_0199298 3300035120 Bacteria 834
359 Ga0373943_0008271 3300035170 Bacteria 4668
360 Ga0373943_0142886 3300035170 Bacteria 1291
361 Ga0373946_0022042 3300035171 Bacteria 2476
362 Ga0373955_0012972 3300035172 Bacteria 4018
363 Ga0373935_0008474 3300035692 Bacteria 6153
364 Ga0373935_0498589 3300035692 Bacteria 884
365 Ga0373927_0026977 3300035695 Bacteria 3753
366 Ga0373927_0057019 3300035695 Bacteria 2526
367 Ga0373927_0361617 3300035695 Bacteria 957
368 Ga0373933_0115072 3300035724 Bacteria 1680
369 Ga0373947_0005615 3300035725 Bacteria 7313
370 Ga0373947_0052888 3300035725 Bacteria 2447
371 Ga0373947_0451247 3300035725 Bacteria 871
372 Ga0372808_009171 3300036459 Bacteria 1380
373 Ga0373925_0686444 3300037068 Bacteria 844
374 Ga0373925_0934269 3300037068 Bacteria 715
375 Ga0395899_0047216 3300037312 Bacteria 3206
376 Ga0395900_0041199 3300037418 Bacteria 4762
377 Ga0395900_0133440 3300037418 Bacteria 2544
378 Ga0395898_0020298 3300037466 Bacteria 6749
379 Ga0395898_0074171 3300037466 Bacteria 3287
380 Ga0395898_0195700 3300037466 Bacteria 1931
381 Ga0395905_0004327 3300037471 Bacteria 14794
382 Ga0395905_0764011 3300037471 Bacteria 869
383 Ga0395905_0801988 3300037471 Bacteria 844
384 Ga0436364_0136702 3300037853 Bacteria 1269
385 Ga0436364_1443852 3300037853 Bacteria 758
386 Ga0395901_0129731 3300038443 Bacteria 2649
387 Ga0395901_0181707 3300038443 Bacteria 2206
388 Ga0395901_1091263 3300038443 Bacteria 769
389 Ga0436365_0661667 3300039437 Bacteria 1876
390 Ga0436365_1810308 3300039437 Bacteria 3241
391 Ga0436365_1812884 3300039437 Bacteria 1134
392 Ga0436361_0536082 3300039447 Bacteria 3581
393 Ga0436363_1392658 3300039450 Bacteria 7115
394 Ga0451791_0030660 3300041451 Bacteria 2006
395 Ga0451791_1119922 3300041451 Bacteria 719
396 Ga0451791_1553070 3300041451 Bacteria 900
397 Ga0451795_0110462 3300041456 Bacteria 934
398 Ga0451795_0382645 3300041456 Bacteria 650
399 Ga0451802_0059232 3300041460 Bacteria 1596
400 Ga0451839_1326352 3300041496 Bacteria 1033
401 Ga0451841_0245673 3300041498 Bacteria 1742
402 Ga0451843_1639070 3300041509 Bacteria 677
403 Ga0451853_2076652 3300041512 Bacteria 2420
404 Ga0466972_0133985 3300044658 Bacteria 1166
405 Ga0466966_0002003 3300044684 Bacteria 13212
406 Ga0466961_0000018 3300044693 Bacteria 109837
407 Ga0466964_0039193 3300044706 Bacteria 1908
408 Ga0466964_0078685 3300044706 Bacteria 1410
409 Ga0466968_0009927 3300044735 Bacteria 3676
410 Ga0466970_0053360 3300044765 Bacteria 2159
411 Ga0466970_0138054 3300044765 Bacteria 1342
412 Ga0466957_0163488 3300044842 Bacteria 1447
413 Ga0466957_0230093 3300044842 Bacteria 1227
414 Ga0466960_0133576 3300044901 Bacteria 1312
415 Ga0466959_0002636 3300045049 Bacteria 11514
416 Ga0466959_0034315 3300045049 Bacteria 3752
417 Ga0466959_0040827 3300045049 Bacteria 3427
418 Ga0466967_0050248 3300045976 Bacteria 3650
419 Ga0466967_0337734 3300045976 Bacteria 1456
420 Ga0495592_0077819 3300046454 Bacteria 2403
421 Ga0495603_0099252 3300046455 Bacteria 1700
422 Ga0495603_0136144 3300046455 Bacteria 1429
423 Ga0495603_0164673 3300046455 Bacteria 1285
424 Ga0495590_0137261 3300046457 Bacteria 882
425 Ga0495629_0005545 3300046459 Bacteria 9419
426 Ga0495629_0169381 3300046459 Bacteria 1516
427 Ga0495629_0224091 3300046459 Bacteria 1297
428 Ga0495638_0008455 3300046460 Bacteria 7296
429 Ga0495651_0025977 3300046462 Bacteria 4559
430 Ga0495651_0070775 3300046462 Bacteria 2653
431 Ga0495653_0038982 3300046463 Bacteria 3725
432 Ga0495653_0108209 3300046463 Bacteria 2002
433 Ga0495653_0553673 3300046463 Bacteria 711
434 Ga0495580_0014347 3300046472 Bacteria 6010
435 Ga0495582_0038446 3300046473 Bacteria 2633
436 Ga0495605_0080857 3300046474 Bacteria 1520
437 Ga0495605_0109262 3300046474 Bacteria 1263
438 Ga0495639_0003783 3300046475 Bacteria 6502
439 Ga0495639_0039176 3300046475 Bacteria 2130
440 Ga0495639_0424034 3300046475 Bacteria 674
441 Ga0495662_0078274 3300046476 Bacteria 1606
442 Ga0495662_0093420 3300046476 Bacteria 1468
443 Ga0495664_0226851 3300046477 Bacteria 1130
444 Ga0495664_0297060 3300046477 Bacteria 975
445 Ga0495664_0422029 3300046477 Bacteria 800
446 Ga0495584_0264556 3300046491 Bacteria 874
447 Ga0495584_0375279 3300046491 Bacteria 722
448 Ga0495585_0211912 3300046492 Bacteria 981
449 Ga0495585_0236509 3300046492 Bacteria 916
450 Ga0495606_0050032 3300046507 Bacteria 2736
451 Ga0495606_0221853 3300046507 Bacteria 1064
452 Ga0495606_0315685 3300046507 Bacteria 841
453 Ga0495608_0016024 3300046511 Bacteria 5189
454 Ga0495608_0211113 3300046511 Bacteria 1220
455 Ga0495610_0053526 3300046512 Bacteria 1954
456 Ga0495610_0072907 3300046512 Bacteria 1597
457 Ga0495618_0035125 3300046514 Bacteria 3146
458 Ga0495618_0049203 3300046514 Bacteria 2662
459 Ga0495620_0158049 3300046515 Bacteria 881
460 Ga0495628_0074122 3300046516 Bacteria 2652
461 Ga0495628_0276804 3300046516 Bacteria 1247
462 Ga0495628_0876483 3300046516 Bacteria 624
463 Ga0495630_0020544 3300046517 Bacteria 4869
464 Ga0495631_0064808 3300046518 Bacteria 1581
465 Ga0495632_0247967 3300046519 Bacteria 799
466 Ga0495632_0325487 3300046519 Bacteria 678
467 Ga0495643_0036835 3300046522 Bacteria 2685
468 Ga0495644_0189540 3300046523 Bacteria 791
469 Ga0495648_0056155 3300046524 Bacteria 2370
470 Ga0495648_0193408 3300046524 Bacteria 1024
471 Ga0495648_0268938 3300046524 Bacteria 814
472 Ga0495652_0047256 3300046529 Bacteria 3691
473 Ga0495652_0692549 3300046529 Bacteria 686
474 Ga0495654_0182459 3300046530 Bacteria 908
475 Ga0495640_0016318 3300046533 Bacteria 5559
476 Ga0495640_0045368 3300046533 Bacteria 3050
477 Ga0495640_0338854 3300046533 Bacteria 929
478 Ga0495640_0773403 3300046533 Bacteria 573
479 Ga0495586_0082041 3300046535 Bacteria 1773
480 Ga0495587_0020507 3300046536 Bacteria 4080
481 Ga0495587_0381424 3300046536 Bacteria 784
482 Ga0495598_0046390 3300046537 Bacteria 1291
483 Ga0495609_0154446 3300046538 Bacteria 975
484 Ga0495597_0055721 3300046542 Bacteria 1733
485 Ga0495597_0196583 3300046542 Bacteria 809
486 Ga0495645_0044979 3300046543 Bacteria 3220
487 Ga0495645_0107774 3300046543 Bacteria 1974
488 Ga0495622_0016420 3300046557 Bacteria 3447
489 Ga0495633_0211282 3300046558 Bacteria 889
490 Ga0495667_0035941 3300046559 Bacteria 3309
491 Ga0495667_0052128 3300046559 Bacteria 2697
492 Ga0495667_0168329 3300046559 Bacteria 1408
493 Ga0495668_0421866 3300046616 Bacteria 733
494 Ga0495634_0046734 3300046642 Bacteria 2920
495 Ga0495634_0194143 3300046642 Bacteria 1264
496 Ga0495611_0374785 3300046648 Bacteria 652
497 Ga0495625_0013351 3300046660 Bacteria 6602
498 Ga0495625_0119428 3300046660 Bacteria 1795
499 Ga0495635_0040207 3300046663 Bacteria 3231
500 Ga0495635_0118868 3300046663 Bacteria 1803
501 Ga0495659_0025848 3300046664 Bacteria 2012
502 Ga0495661_0058502 3300046665 Bacteria 2297
503 Ga0495588_0020269 3300046674 Bacteria 3265
504 Ga0495588_0188651 3300046674 Bacteria 1089
505 Ga0495588_0332121 3300046674 Bacteria 799
506 Ga0495588_0381867 3300046674 Bacteria 740
507 Ga0495657_0003331 3300046675 Bacteria 13160
508 Ga0495599_0022898 3300046678 Bacteria 3902
509 Ga0495599_0486596 3300046678 Bacteria 727
510 Ga0495623_0024029 3300046679 Bacteria 3931
511 Ga0495623_0124733 3300046679 Bacteria 1547
512 Ga0495646_0100261 3300046680 Bacteria 1661
513 Ga0495647_0005990 3300046681 Bacteria 4006
514 Ga0495647_0041458 3300046681 Bacteria 1753
515 Ga0495658_0008260 3300046683 Bacteria 5156
516 Ga0495613_0022819 3300046689 Bacteria 4663
517 Ga0495613_0046915 3300046689 Bacteria 3193
518 Ga0495624_0127579 3300046690 Bacteria 1560
519 Ga0495624_0232827 3300046690 Bacteria 1115
520 Ga0495670_0447845 3300046691 Bacteria 699
521 Ga0495671_0207267 3300046692 Bacteria 950
522 Ga0495671_0226628 3300046692 Bacteria 904
523 Ga0495671_0278232 3300046692 Bacteria 806
524 Ga0495649_0048054 3300046694 Bacteria 2319
525 Ga0495649_0097376 3300046694 Bacteria 1565
526 Ga0495649_0238660 3300046694 Bacteria 936
527 Ga0495649_0428427 3300046694 Bacteria 662
528 Ga0495589_0069690 3300046794 Bacteria 1720
529 Ga0495589_0110926 3300046794 Bacteria 1324
530 Ga0495589_0333053 3300046794 Bacteria 700
531 Ga0495600_0156994 3300046809 Bacteria 1471
532 Ga0495600_0231258 3300046809 Bacteria 1180
533 Ga0495660_0055114 3300046810 Bacteria 2153
534 Ga0495581_0064567 3300047315 Bacteria 2115
535 Ga0495581_0327593 3300047315 Bacteria 894
536 Ga0495604_0007178 3300047317 Bacteria 8823
537 Ga0495604_0011216 3300047317 Bacteria 7113
538 Ga0495604_0220001 3300047317 Bacteria 1307
539 Ga0495636_0054292 3300047318 Bacteria 1683
540 Ga0495674_0013462 3300047319 Bacteria 7692
541 Ga0495674_0072115 3300047319 Bacteria 2979
542 Ga0495674_0733476 3300047319 Bacteria 773
543 Ga0495672_0043340 3300047320 Bacteria 2706
544 Ga0495676_0020621 3300047321 Bacteria 5777
545 Ga0495676_0113996 3300047321 Bacteria 1978
546 Ga0495676_0321838 3300047321 Bacteria 1039
547 Ga0495680_0002619 3300047322 Bacteria 18287
548 Ga0495683_0334152 3300047323 Bacteria 643
549 Ga0495683_0348650 3300047323 Bacteria 625
550 Ga0495687_081653 3300047443 Bacteria 1264
551 Ga0495675_0007823 3300047444 Bacteria 6599
552 Ga0495679_038314 3300047446 Bacteria 1502
553 Ga0495685_180499 3300047447 Bacteria 680
554 Ga0495673_0064702 3300047469 Bacteria 1554
555 Ga0495673_0099566 3300047469 Bacteria 1177
556 Ga0495681_0197805 3300047470 Bacteria 817
557 Ga0495684_0120392 3300047471 Bacteria 1977
558 Ga0495684_0427188 3300047471 Bacteria 925
559 Ga0495686_0315776 3300047472 Bacteria 858
560 Ga0495593_0003341 3300047673 Bacteria 9611
561 Ga0495593_0030634 3300047673 Bacteria 2943
562 Ga0495593_0157334 3300047673 Bacteria 1148
563 Ga0495602_0048059 3300048088 Bacteria 3839
564 Ga0495602_0246879 3300048088 Bacteria 1332
565 Ga0495615_0083588 3300048090 Bacteria 879
566 Ga0495626_0056962 3300048091 Bacteria 1788
567 Ga0495626_0196950 3300048091 Bacteria 828
568 Ga0496100_0277751 3300048903 Bacteria 1248
569 Ga0496101_0168879 3300048904 Bacteria 1680
570 Ga0496101_0434334 3300048904 Bacteria 1035
571 Ga0496102_0029630 3300048905 Bacteria 4898
572 Ga0496102_0135069 3300048905 Bacteria 2311
573 Ga0496102_0636288 3300048905 Bacteria 990
574 Ga0496102_0976846 3300048905 Bacteria 768
575 Ga0496103_0016458 3300048906 Bacteria 4413
576 Ga0496104_0002055 3300048907 Bacteria 17481
577 Ga0496104_0047669 3300048907 Bacteria 4038
578 Ga0496104_0093803 3300048907 Bacteria 2871
579 Ga0496104_0208826 3300048907 Bacteria 1864
580 Ga0496105_0000745 3300048908 Bacteria 22090
581 Ga0496105_0027123 3300048908 Bacteria 4676
582 Ga0496105_0095923 3300048908 Bacteria 2449
583 Ga0496105_0525320 3300048908 Bacteria 926
584 Ga0496106_0128417 3300048909 Bacteria 1986
585 Ga0496107_0042886 3300048910 Bacteria 3250
586 Ga0496107_0095035 3300048910 Bacteria 2180
587 Ga0496108_0127781 3300048911 Bacteria 2183
588 Ga0496108_0163040 3300048911 Bacteria 1927
589 Ga0496108_1150531 3300048911 Bacteria 658
590 Ga0496109_0042780 3300048912 Bacteria 4105
591 Ga0496109_0171892 3300048912 Bacteria 2033
592 Ga0496109_0202106 3300048912 Bacteria 1868
593 Ga0496110_0058446 3300048913 Bacteria 3396
594 Ga0496110_0116321 3300048913 Bacteria 2407
595 Ga0496110_0459296 3300048913 Bacteria 1160
596 Ga0496111_0085755 3300048914 Bacteria 2303
597 Ga0496111_0096784 3300048914 Bacteria 2166
598 Ga0496112_0087025 3300048915 Bacteria 3091
599 Ga0496112_0107518 3300048915 Bacteria 2759
600 Ga0496112_0210571 3300048915 Bacteria 1901
601 Ga0496112_0390376 3300048915 Bacteria 1332
602 Ga0496113_0281726 3300048916 Bacteria 1329
603 Ga0496114_0035582 3300048917 Bacteria 4112
604 Ga0496115_0021454 3300048918 Bacteria 4991
605 Ga0496115_0037752 3300048918 Bacteria 3829
606 Ga0496115_0043348 3300048918 Bacteria 3588
607 Ga0496116_0037200 3300048919 Bacteria 3397
608 Ga0496117_0084392 3300048920 Bacteria 2072
609 Ga0496117_0177875 3300048920 Bacteria 1227
610 Ga0496117_0178316 3300048920 Bacteria 1224
611 Ga0496117_0263319 3300048920 Bacteria 933
612 Ga0496118_0024046 3300048921 Bacteria 5271
613 Ga0496118_0176871 3300048921 Bacteria 1295
614 Ga0496119_0009075 3300048922 Bacteria 8617
615 Ga0496119_0025547 3300048922 Bacteria 4121
616 Ga0496119_0389365 3300048922 Bacteria 667
617 Ga0496120_0032183 3300048923 Bacteria 3165
618 Ga0496121_0021718 3300048924 Bacteria 6272
619 Ga0496121_0026391 3300048924 Bacteria 5476
620 Ga0496121_0201185 3300048924 Bacteria 1419
621 Ga0496121_0212495 3300048924 Bacteria 1369
622 Ga0496121_0235287 3300048924 Bacteria 1280
623 Ga0496121_0343443 3300048924 Bacteria 997
624 Ga0496122_0056773 3300048925 Bacteria 2915
625 Ga0496124_0501360 3300048927 Bacteria 814
626 Ga0496125_0036077 3300048928 Bacteria 4324
627 Ga0496125_0130278 3300048928 Bacteria 1772
628 Ga0496125_0192633 3300048928 Bacteria 1344
629 Ga0496125_0237682 3300048928 Bacteria 1159
630 Ga0496126_0021458 3300048929 Bacteria 6306
631 Ga0496126_0073568 3300048929 Bacteria 3037
632 Ga0496126_0180249 3300048929 Bacteria 1795
633 Ga0496126_0236647 3300048929 Bacteria 1527
634 Ga0496126_0255698 3300048929 Bacteria 1458
635 Ga0496126_0291159 3300048929 Bacteria 1350
636 Ga0496126_0307291 3300048929 Bacteria 1306
637 Ga0495682_0059826 3300049460 Bacteria 1376
638 Ga0501031_0067076 3300049568 Bacteria 2338
639 Ga0501032_0127464 3300049569 Bacteria 1680
640 Ga0501032_0400493 3300049569 Bacteria 882
641 Ga0501033_0042269 3300049570 Bacteria 3398
642 Ga0501034_0130715 3300049571 Bacteria 2494
643 Ga0501036_0078810 3300049572 Bacteria 2786
644 Ga0501036_0342315 3300049572 Bacteria 1249
645 Ga0501038_0169176 3300049574 Bacteria 1770
646 Ga0501039_0042185 3300049575 Bacteria 3525
647 Ga0501046_0085782 3300049580 Bacteria 2427
648 Ga0501046_0159344 3300049580 Bacteria 1698
649 Ga0501047_0128083 3300049581 Bacteria 2418
650 Ga0501048_0075701 3300049582 Bacteria 2375
651 Ga0501067_0606110 3300049583 Bacteria 614
652 Ga0501070_0052265 3300049586 Bacteria 3391
653 Ga0501070_0075254 3300049586 Bacteria 2795
654 Ga0501071_0132872 3300049587 Bacteria 1850
655 Ga0501074_0032975 3300049590 Bacteria 3753
656 Ga0501074_0092394 3300049590 Bacteria 2167
657 Ga0501079_0286475 3300049741 Bacteria 1288
658 Ga0501080_0004892 3300049742 Bacteria 11942
659 Ga0501080_0167470 3300049742 Bacteria 2027
660 Ga0501044_0086872 3300049823 Bacteria 3159
661 Ga0501044_1382913 3300049823 Bacteria 569
662 nmdc:mga00v17_162327_c1 3300050491 Bacteria 1439
663 nmdc:mga00v17_70575_c1 3300050491 Bacteria 2164
664 nmdc:mga0yw44_190730_c1 3300050492 Bacteria 1352
665 nmdc:mga0k408_209435_c1 3300050493 Bacteria 1164
666 nmdc:mga0k408_869509_c1 3300050493 Bacteria 524
667 nmdc:mga07m45_368410_c1 3300050496 Bacteria 835
668 nmdc:mga05p37_213133_c1 3300050507 Bacteria 2334
669 nmdc:mga0qj67_309975_c1 3300050509 Bacteria 1278
670 nmdc:mga08y16_1404567_c1 3300050511 Bacteria 661
671 nmdc:mga0rr50_128322_c1 3300050513 Bacteria 2027
672 nmdc:mga08x19_156422_c1 3300050514 Bacteria 1546
673 nmdc:mga0sz30_142571_c1 3300050516 Bacteria 1058
674 nmdc:mga0sz30_156936_c1 3300050516 Bacteria 1008
675 nmdc:mga0sz30_86682_c2 3300050516 Bacteria 785
676 nmdc:mga0sz30_93636_c1 3300050516 Bacteria 1309
677 Ga0495601_0218484 3300053077 Bacteria 1245
678 Ga0495601_0261416 3300053077 Bacteria 1130
679 Ga0495612_0065275 3300053078 Bacteria 1512
680 Ga0500635_0055646 3300053080 Bacteria 1367
681 Ga0495595_0048111 3300053084 Bacteria 1969
682 Ga0495619_0296705 3300053085 Bacteria 1120
683 Ga0500578_0073568 3300053086 Bacteria 2177
684 Ga0500578_0151304 3300053086 Bacteria 1445
685 Ga0500578_0298316 3300053086 Bacteria 956
686 Ga0500643_000231 3300053087 Bacteria 51641
687 Ga0500644_0216071 3300053088 Bacteria 798
688 Ga0500647_0022727 3300053091 Bacteria 2937
689 Ga0500583_0038068 3300053092 Bacteria 2163
690 Ga0500651_0025302 3300053093 Bacteria 3724
691 Ga0500566_0000931 3300053094 Bacteria 16746
692 Ga0500641_0164704 3300053096 Bacteria 955
693 Ga0500650_0291985 3300053098 Bacteria 723
694 Ga0500555_002267 3300053103 Bacteria 5601
695 Ga0500555_097694 3300053103 Bacteria 749
696 Ga0500556_0264943 3300053104 Bacteria 675
697 Ga0500557_000179 3300053105 Bacteria 12626
698 Ga0500562_011871 3300053108 Bacteria 2213
699 Ga0500569_010567 3300053109 Bacteria 2180
700 Ga0500572_000668 3300053111 Bacteria 11350
701 Ga0500572_007171 3300053111 Bacteria 2575
702 Ga0500608_122841 3300053122 Bacteria 1175
703 Ga0500642_0000087 3300053130 Bacteria 48287
704 Ga0500652_335308 3300053131 Bacteria 576
705 Ga0500658_0073809 3300053134 Bacteria 1445
706 Ga0500559_0017216 3300053136 Bacteria 3051
707 Ga0500568_0045168 3300053139 Bacteria 1754
708 Ga0500577_0213391 3300053142 Bacteria 834
709 Ga0500604_0137025 3300053151 Bacteria 825
710 Ga0500616_0097472 3300053153 Bacteria 1443
711 Ga0500622_0004589 3300053156 Bacteria 8601
712 Ga0500627_0008055 3300053158 Bacteria 3718
713 Ga0500634_0065140 3300053161 Bacteria 1924
714 Ga0500638_095670 3300053162 Bacteria 1392
715 Ga0500639_002805 3300053163 Bacteria 8756
716 Ga0500636_0033935 3300053177 Bacteria 3019
717 Ga0500636_0523645 3300053177 Bacteria 519
718 Ga0500570_144234 3300053724 Bacteria 866
719 Ga0500611_052493 3300053727 Bacteria 939
720 Ga0500645_007988 3300053730 Bacteria 3645
721 Ga0500645_155811 3300053730 Bacteria 627
722 Ga0500609_033795 3300053731 Bacteria 704
723 Ga0500596_001693 3300053735 Bacteria 4468
724 Ga0500596_013426 3300053735 Bacteria 1237
725 Ga0500596_020443 3300053735 Bacteria 996
726 Ga0500599_001236 3300053736 Bacteria 2916
727 Ga0501084_0199140 3300054114 Bacteria 1690
728 Ga0501084_0499665 3300054114 Bacteria 1028
729 Ga0500661_016839 3300055283 Bacteria 1306
730 Ga0466962_0077533 3300061719 Bacteria 1589
731 Ga0530510_0480126 3300061734 Bacteria 941

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_869509_c1 nmdc:mga0k408_869509_c1_40_507 130
2 iso_pu_bacteria 2922386360 2922389183 133
3 3300037418 Ga0395900_0133440 Ga0395900_0133440_1072_1593 136
4 3300037466 Ga0395898_0074171 Ga0395898_0074171_1683_2204 136
5 3300038443 Ga0395901_0181707 Ga0395901_0181707_721_1242 136
6 3300048091 Ga0495626_0056962 Ga0495626_0056962_55_579 136
7 3300006051 Ga0075364_10262342 Ga0075364_102623422 137
8 3300035086 Ga0373934_0060865 Ga0373934_0060865_833_1321 137
9 3300035089 Ga0373944_0094694 Ga0373944_0094694_60_548 137
10 3300035111 Ga0373923_0004740 Ga0373923_0004740_1446_1934 137
11 3300035116 Ga0373945_0198753 Ga0373945_0198753_286_774 137
12 3300035118 Ga0373954_0179668 Ga0373954_0179668_145_633 137
13 3300035119 Ga0373956_0086675 Ga0373956_0086675_710_1198 137
14 3300035120 Ga0373957_0199298 Ga0373957_0199298_71_559 137
15 3300035170 Ga0373943_0008271 Ga0373943_0008271_1210_1698 137
16 3300035171 Ga0373946_0022042 Ga0373946_0022042_405_893 137
17 3300035172 Ga0373955_0012972 Ga0373955_0012972_1119_1607 137
18 3300035692 Ga0373935_0008474 Ga0373935_0008474_2351_2839 137
19 3300035724 Ga0373933_0115072 Ga0373933_0115072_1078_1566 137
20 3300035725 Ga0373947_0005615 Ga0373947_0005615_2646_3134 137
21 3300037853 Ga0436364_1443852 Ga0436364_1443852_11_532 137
22 3300039437 Ga0436365_1812884 Ga0436365_1812884_601_1122 137
23 3300041496 Ga0451839_1326352 Ga0451839_1326352_164_688 137
24 3300046459 Ga0495629_0169381 Ga0495629_0169381_558_1046 137
25 3300046463 Ga0495653_0553673 Ga0495653_0553673_96_584 137
26 3300046472 Ga0495580_0014347 Ga0495580_0014347_2188_2676 137
27 3300046473 Ga0495582_0038446 Ga0495582_0038446_215_703 137
28 3300046475 Ga0495639_0003783 Ga0495639_0003783_4024_4512 137
29 3300046477 Ga0495664_0226851 Ga0495664_0226851_472_960 137
30 3300046514 Ga0495618_0049203 Ga0495618_0049203_1563_2051 137
31 3300046516 Ga0495628_0276804 Ga0495628_0276804_612_1100 137
32 3300046517 Ga0495630_0020544 Ga0495630_0020544_4007_4495 137
33 3300046533 Ga0495640_0338854 Ga0495640_0338854_405_893 137
34 3300046535 Ga0495586_0082041 Ga0495586_0082041_377_865 137
35 3300046543 Ga0495645_0107774 Ga0495645_0107774_477_965 137
36 3300046559 Ga0495667_0052128 Ga0495667_0052128_111_599 137
37 3300046642 Ga0495634_0194143 Ga0495634_0194143_367_855 137
38 3300046678 Ga0495599_0486596 Ga0495599_0486596_13_501 137
39 3300046681 Ga0495647_0005990 Ga0495647_0005990_1391_1879 137
40 3300046683 Ga0495658_0008260 Ga0495658_0008260_2152_2640 137
41 3300046689 Ga0495613_0046915 Ga0495613_0046915_815_1303 137
42 3300046690 Ga0495624_0232827 Ga0495624_0232827_261_749 137
43 3300047315 Ga0495581_0327593 Ga0495581_0327593_284_772 137
44 3300047317 Ga0495604_0220001 Ga0495604_0220001_214_702 137
45 3300047319 Ga0495674_0013462 Ga0495674_0013462_5865_6353 137
46 3300047321 Ga0495676_0321838 Ga0495676_0321838_415_903 137
47 3300047471 Ga0495684_0120392 Ga0495684_0120392_360_848 137
48 3300047673 Ga0495593_0030634 Ga0495593_0030634_1381_1869 137
49 3300049571 Ga0501034_0130715 Ga0501034_0130715_29_517 137
50 3300049823 Ga0501044_1382913 Ga0501044_1382913_28_516 137
51 3300050513 nmdc:mga0rr50_128322_c1 nmdc:mga0rr50_128322_c1_159_647 137
52 3300050514 nmdc:mga08x19_156422_c1 nmdc:mga08x19_156422_c1_985_1473 137
53 3300050516 nmdc:mga0sz30_86682_c2 nmdc:mga0sz30_86682_c2_78_602 137
54 3300053077 Ga0495601_0261416 Ga0495601_0261416_115_603 137
55 3300053078 Ga0495612_0065275 Ga0495612_0065275_565_1053 137
56 3300013306 Ga0163162_11315793 Ga0163162_113157932 138
57 3300014969 Ga0157376_10160668 Ga0157376_101606682 138
58 3300017792 Ga0163161_10790537 Ga0163161_107905372 138
59 3300048925 Ga0496122_0056773 Ga0496122_0056773_1490_2011 138
60 3300048929 Ga0496126_0021458 Ga0496126_0021458_3287_3808 138
61 iso_pu_bacteria 2889033259 2889036116 138
62 3300005340 Ga0070689_100762774 Ga0070689_1007627742 139
63 3300005458 Ga0070681_10080143 Ga0070681_100801433 139
64 3300005530 Ga0070679_100557305 Ga0070679_1005573052 139
65 3300025912 Ga0207707_10185538 Ga0207707_101855382 139
66 3300035695 Ga0373927_0057019 Ga0373927_0057019_1449_1970 139
67 3300035725 Ga0373947_0451247 Ga0373947_0451247_237_758 139
68 3300046459 Ga0495629_0224091 Ga0495629_0224091_43_561 139
69 3300053080 Ga0500635_0055646 Ga0500635_0055646_332_853 139
70 3300053153 Ga0500616_0097472 Ga0500616_0097472_524_1048 139
71 3300006178 Ga0075367_10324487 Ga0075367_103244872 140
72 3300006186 Ga0075369_10181476 Ga0075369_101814762 140
73 3300006195 Ga0075366_10143689 Ga0075366_101436892 140
74 3300050493 nmdc:mga0k408_209435_c1 nmdc:mga0k408_209435_c1_433_957 140
75 3300050516 nmdc:mga0sz30_142571_c1 nmdc:mga0sz30_142571_c1_333_857 140
76 3300005435 Ga0070714_100111422 Ga0070714_1001114222 141
77 3300005436 Ga0070713_100014007 Ga0070713_1000140072 141
78 3300005616 Ga0068852_101619923 Ga0068852_1016199232 141
79 3300006028 Ga0070717_10002055 Ga0070717_100020556 141
80 3300021361 Ga0213872_10166416 Ga0213872_101664162 141
81 3300025928 Ga0207700_10004386 Ga0207700_100043866 141
82 3300025929 Ga0207664_10175510 Ga0207664_101755102 141
83 3300025939 Ga0207665_10429433 Ga0207665_104294332 141
84 3300037466 Ga0395898_0020298 Ga0395898_0020298_4997_5533 141
85 3300038443 Ga0395901_0129731 Ga0395901_0129731_1053_1589 141
86 3300039447 Ga0436361_0536082 Ga0436361_0536082_2902_3429 141
87 3300045976 Ga0466967_0337734 Ga0466967_0337734_374_895 141
88 3300048903 Ga0496100_0277751 Ga0496100_0277751_580_1107 141
89 3300005548 Ga0070665_100120177 Ga0070665_1001201771 142
90 3300028379 Ga0268266_10039481 Ga0268266_100394814 142
91 3300041498 Ga0451841_0245673 Ga0451841_0245673_121_645 142
92 3300041512 Ga0451853_2076652 Ga0451853_2076652_1028_1552 142
93 3300046679 Ga0495623_0024029 Ga0495623_0024029_2846_3370 142
94 3300047447 Ga0495685_180499 Ga0495685_180499_16_519 142
95 3300048929 Ga0496126_0291159 Ga0496126_0291159_17_541 142
96 3300003215 JGI25153J46596_10037071 JGI25153J46596_100370711 144
97 3300003794 Ga0055531_10015632 Ga0055531_100156323 144
98 3300005262 Ga0065165_1012522 Ga0065165_10125222 144
99 3300025295 Ga0209564_1021748 Ga0209564_10217482 144
100 3300025297 Ga0209758_1000030 Ga0209758_1000030309 144
101 3300025299 Ga0209256_1002159 Ga0209256_10021594 144
102 3300025302 Ga0207426_1078254 Ga0207426_10782542 144
103 3300025304 Ga0209257_1005466 Ga0209257_10054665 144
104 3300027296 Ga0209389_1000035 Ga0209389_1000035120 144
105 3300027357 Ga0209589_1000039 Ga0209589_1000039120 144
106 3300027361 Ga0209489_100084 Ga0209489_100084120 144
107 3300053086 Ga0500578_0151304 Ga0500578_0151304_765_1289 144
108 iso_pu_bacteria 8056673599 8056678435 144
109 3300005347 Ga0070668_100291738 Ga0070668_1002917382 145
110 3300005353 Ga0070669_100096348 Ga0070669_1000963482 145
111 3300005455 Ga0070663_100108980 Ga0070663_1001089802 145
112 3300005456 Ga0070678_100275500 Ga0070678_1002755002 145
113 3300005539 Ga0068853_100329145 Ga0068853_1003291451 145
114 3300005614 Ga0068856_100333155 Ga0068856_1003331552 145
115 3300005841 Ga0068863_100346762 Ga0068863_1003467623 145
116 3300005842 Ga0068858_100186244 Ga0068858_1001862442 145
117 3300005843 Ga0068860_100533251 Ga0068860_1005332512 145
118 3300006038 Ga0075365_10206647 Ga0075365_102066471 145
119 3300006042 Ga0075368_10009616 Ga0075368_100096163 145
120 3300006051 Ga0075364_10277744 Ga0075364_102777442 145
121 3300006177 Ga0075362_10059419 Ga0075362_100594193 145
122 3300006178 Ga0075367_10218165 Ga0075367_102181651 145
123 3300006195 Ga0075366_10018305 Ga0075366_100183054 145
124 3300006353 Ga0075370_10248780 Ga0075370_102487801 145
125 3300006944 Ga0099823_1085769 Ga0099823_10857692 145
126 3300009101 Ga0105247_10190188 Ga0105247_101901882 145
127 3300009148 Ga0105243_10907816 Ga0105243_109078162 145
128 3300009177 Ga0105248_10451617 Ga0105248_104516171 145
129 3300009545 Ga0105237_10043065 Ga0105237_100430655 145
130 3300010375 Ga0105239_10664518 Ga0105239_106645182 145
131 3300011119 Ga0105246_10048250 Ga0105246_100482503 145
132 3300012500 Ga0157314_1003836 Ga0157314_10038362 145
133 3300013296 Ga0157374_10229486 Ga0157374_102294862 145
134 3300013297 Ga0157378_11164949 Ga0157378_111649492 145
135 3300013308 Ga0157375_10457366 Ga0157375_104573662 145
136 3300014325 Ga0163163_10096851 Ga0163163_100968511 145
137 3300014326 Ga0157380_11412267 Ga0157380_114122672 145
138 3300014968 Ga0157379_10065931 Ga0157379_100659312 145
139 3300014969 Ga0157376_10601087 Ga0157376_106010871 145
140 3300025901 Ga0207688_10049994 Ga0207688_100499944 145
141 3300025904 Ga0207647_10017521 Ga0207647_100175215 145
142 3300025911 Ga0207654_10253672 Ga0207654_102536722 145
143 3300025923 Ga0207681_10475865 Ga0207681_104758652 145
144 3300025931 Ga0207644_10122338 Ga0207644_101223382 145
145 3300025941 Ga0207711_10323460 Ga0207711_103234602 145
146 3300025945 Ga0207679_11449195 Ga0207679_114491951 145
147 3300025960 Ga0207651_10749486 Ga0207651_107494861 145
148 3300025972 Ga0207668_10292695 Ga0207668_102926952 145
149 3300026067 Ga0207678_10174915 Ga0207678_101749151 145
150 3300026078 Ga0207702_10337813 Ga0207702_103378132 145
151 3300026121 Ga0207683_10147116 Ga0207683_101471164 145
152 3300027296 Ga0209389_1000015 Ga0209389_1000015119 145
153 3300027361 Ga0209489_100072 Ga0209489_10007280 145
154 3300027363 Ga0209700_100034 Ga0209700_10003464 145
155 3300027866 Ga0209813_10020652 Ga0209813_100206523 145
156 3300028381 Ga0268264_10776862 Ga0268264_107768622 145
157 3300035089 Ga0373944_0235089 Ga0373944_0235089_123_662 145
158 3300037471 Ga0395905_0004327 Ga0395905_0004327_2912_3436 145
159 3300041451 Ga0451791_0030660 Ga0451791_0030660_674_1198 145
160 3300046462 Ga0495651_0025977 Ga0495651_0025977_3351_3875 145
161 3300046463 Ga0495653_0038982 Ga0495653_0038982_478_1002 145
162 3300046476 Ga0495662_0093420 Ga0495662_0093420_865_1389 145
163 3300046511 Ga0495608_0016024 Ga0495608_0016024_687_1211 145
164 3300046512 Ga0495610_0053526 Ga0495610_0053526_725_1249 145
165 3300046516 Ga0495628_0074122 Ga0495628_0074122_1983_2507 145
166 3300046522 Ga0495643_0036835 Ga0495643_0036835_869_1393 145
167 3300046529 Ga0495652_0047256 Ga0495652_0047256_854_1378 145
168 3300046533 Ga0495640_0045368 Ga0495640_0045368_2387_2911 145
169 3300046536 Ga0495587_0020507 Ga0495587_0020507_3525_4049 145
170 3300046543 Ga0495645_0044979 Ga0495645_0044979_2000_2524 145
171 3300046559 Ga0495667_0035941 Ga0495667_0035941_2101_2625 145
172 3300046642 Ga0495634_0046734 Ga0495634_0046734_801_1325 145
173 3300046663 Ga0495635_0118868 Ga0495635_0118868_1138_1662 145
174 3300046678 Ga0495599_0022898 Ga0495599_0022898_269_793 145
175 3300046694 Ga0495649_0097376 Ga0495649_0097376_628_1152 145
176 3300046809 Ga0495600_0231258 Ga0495600_0231258_146_670 145
177 3300047317 Ga0495604_0011216 Ga0495604_0011216_4024_4548 145
178 3300047319 Ga0495674_0072115 Ga0495674_0072115_680_1204 145
179 3300047322 Ga0495680_0002619 Ga0495680_0002619_7545_8069 145
180 3300047444 Ga0495675_0007823 Ga0495675_0007823_1898_2422 145
181 3300048088 Ga0495602_0048059 Ga0495602_0048059_3170_3694 145
182 3300048091 Ga0495626_0196950 Ga0495626_0196950_56_580 145
183 3300048905 Ga0496102_0029630 Ga0496102_0029630_2748_3272 145
184 3300048906 Ga0496103_0016458 Ga0496103_0016458_224_748 145
185 3300048907 Ga0496104_0047669 Ga0496104_0047669_1023_1547 145
186 3300048908 Ga0496105_0095923 Ga0496105_0095923_1054_1578 145
187 3300048912 Ga0496109_0202106 Ga0496109_0202106_249_773 145
188 3300048915 Ga0496112_0107518 Ga0496112_0107518_194_718 145
189 3300048919 Ga0496116_0037200 Ga0496116_0037200_2846_3370 145
190 3300048922 Ga0496119_0025547 Ga0496119_0025547_2526_3050 145
191 3300048923 Ga0496120_0032183 Ga0496120_0032183_2618_3142 145
192 3300048928 Ga0496125_0237682 Ga0496125_0237682_476_1000 145
193 3300050491 nmdc:mga00v17_70575_c1 nmdc:mga00v17_70575_c1_1048_1572 145
194 3300050496 nmdc:mga07m45_368410_c1 nmdc:mga07m45_368410_c1_152_676 145
195 3300050516 nmdc:mga0sz30_156936_c1 nmdc:mga0sz30_156936_c1_71_595 145
196 3300053084 Ga0495595_0048111 Ga0495595_0048111_493_1017 145
197 3300061719 Ga0466962_0077533 Ga0466962_0077533_86_625 145
198 iso_pu_bacteria 2508501009 2508539895 145
199 iso_pu_bacteria 2508501042 2508694970 145
200 iso_pu_bacteria 2513237092 2513625618 145
201 iso_pu_bacteria 2513237095 2513652996 145
202 iso_pu_bacteria 2513237102 2513701748 145
203 iso_pu_bacteria 2513237139 2513874029 145
204 iso_pu_bacteria 2515154112 2515627774 145
205 iso_pu_bacteria 2528768022 2528850591 145
206 iso_pu_bacteria 2617270741 2617377148 145
207 iso_pu_bacteria 2802429603 2805920387 145
208 iso_pu_bacteria 2816332527 2818243503 145
209 iso_pu_bacteria 2824617872 2824622837 145
210 iso_pu_bacteria 2824626560 2824631926 145
211 iso_pu_bacteria 2824635225 2824639127 145
212 iso_pu_bacteria 2824644064 2824650741 145
213 iso_pu_bacteria 2824661429 2824664310 145
214 iso_pu_bacteria 2824671348 2824676900 145
215 iso_pu_bacteria 2824687955 2824693277 145
216 iso_pu_bacteria 2824696289 2824701521 145
217 iso_pu_bacteria 2824714736 2824719443 145
218 iso_pu_bacteria 2824723954 2824732612 145
219 iso_pu_bacteria 2824732956 2824734125 145
220 iso_pu_bacteria 2824746037 2824749187 145
221 iso_pu_bacteria 2824773399 2824780108 145
222 iso_pu_bacteria 2847939898 2847943065 145
223 iso_pu_bacteria 2874590934 2874593713 145
224 iso_pu_bacteria 2874645413 2874647976 145
225 iso_pu_bacteria 2876771140 2876772804 145
226 iso_pu_bacteria 2876818435 2876826467 145
227 iso_pu_bacteria 2879074833 2879077500 145
228 iso_pu_bacteria 2879083081 2879089968 145
229 iso_pu_bacteria 2879099564 2879105506 145
230 iso_pu_bacteria 2879127579 2879134396 145
231 iso_pu_bacteria 2879142872 2879147355 145
232 iso_pu_bacteria 2881665667 2881666090 145
233 iso_pu_bacteria 2885366525 2885369066 145
234 iso_pu_bacteria 2888378607 2888378859 145
235 iso_pu_bacteria 2906643746 2906645611 145
236 iso_pu_bacteria 2908775508 2908783062 145
237 iso_pu_bacteria 2922368715 2922377718 145
238 iso_pu_bacteria 2929615660 2929623313 145
239 iso_pu_bacteria 2929624759 2929632596 145
240 iso_pu_bacteria 2932784394 2932789207 145
241 iso_pu_bacteria 2932809354 2932818133 145
242 iso_pu_bacteria 2932818245 2932820283 145
243 iso_pu_bacteria 2932828146 2932834457 145
244 iso_pu_bacteria 2933577622 2933585216 145
245 iso_pu_bacteria 2935608549 2935615117 145
246 iso_pu_bacteria 2935616580 2935620140 145
247 iso_pu_bacteria 2935638405 2935640458 145
248 iso_pu_bacteria 2935648319 2935651526 145
249 iso_pu_bacteria 2935656913 2935659706 145
250 iso_pu_bacteria 2935665750 2935668652 145
251 iso_pu_bacteria 2935675223 2935681954 145
252 iso_pu_bacteria 2935684952 2935686960 145
253 iso_pu_bacteria 2935694250 2935697070 145
254 iso_pu_bacteria 2935703347 2935709838 145
255 iso_pu_bacteria 2935713505 2935716648 145
256 iso_pu_bacteria 2935722832 2935723227 145
257 iso_pu_bacteria 2935732158 2935734784 145
258 iso_pu_bacteria 2935741537 2935744425 145
259 iso_pu_bacteria 2935750917 2935752926 145
260 iso_pu_bacteria 2935760218 2935766824 145
261 iso_pu_bacteria 2935777560 2935779697 145
262 iso_pu_bacteria 2935785616 2935789685 145
263 iso_pu_bacteria 2935793552 2935797947 145
264 iso_pu_bacteria 2935801545 2935804572 145
265 iso_pu_bacteria 2935810662 2935818212 145
266 iso_pu_bacteria 2935819856 2935825845 145
267 iso_pu_bacteria 2935827899 2935831964 145
268 iso_pu_bacteria 2935837841 2935841204 145
269 iso_pu_bacteria 2935847175 2935851464 145
270 iso_pu_bacteria 2935855204 2935859026 145
271 iso_pu_bacteria 2935864058 2935864207 145
272 iso_pu_bacteria 2935873716 2935875441 145
273 iso_pu_bacteria 2935908558 2935910510 145
274 iso_pu_bacteria 2935916978 2935918086 145
275 iso_pu_bacteria 2935926038 2935927579 145
276 iso_pu_bacteria 2935934488 2935936549 145
277 iso_pu_bacteria 2935942939 2935943898 145
278 iso_pu_bacteria 2935951376 2935952335 145
279 iso_pu_bacteria 2935959822 2935964003 145
280 iso_pu_bacteria 2935967501 2935969175 145
281 iso_pu_bacteria 2935975950 2935978439 145
282 iso_pu_bacteria 2935984226 2935984628 145
283 iso_pu_bacteria 2935992306 2935995580 145
284 iso_pu_bacteria 2936002035 2936008000 145
285 iso_pu_bacteria 2936011229 2936014122 145
286 iso_pu_bacteria 2936019824 2936022969 145
287 iso_pu_bacteria 2936028420 2936031105 145
288 iso_pu_bacteria 2936037263 2936044822 145
289 iso_pu_bacteria 2936046547 2936049227 145
290 iso_pu_bacteria 2936055302 2936055673 145
291 iso_pu_bacteria 2940556831 2940558839 145
292 iso_pu_bacteria 2941538514 2941543430 145
293 iso_pu_bacteria 3005506211 3005506429 145
294 iso_pu_bacteria 3005587118 3005588923 145
295 iso_pu_bacteria 8016511872 8016517585 145
296 iso_pu_bacteria 8016548790 8016549740 145
297 iso_pu_bacteria 8016557553 8016558158 145
298 iso_pu_bacteria 8016575299 8016581597 145
299 iso_pu_bacteria 8016595262 8016596163 145
300 iso_pu_bacteria 8016603502 8016607063 145
301 iso_pu_bacteria 8016630954 8016636468 145
302 iso_pu_bacteria 8017057580 8017059036 145
303 iso_pu_bacteria 8019538911 8019541049 145
304 iso_pu_bacteria 8019576017 8019576603 145
305 iso_pu_bacteria 8019586578 8019594478 145
306 iso_pu_bacteria 8019597564 8019607084 145
307 iso_pu_bacteria 8019608314 8019611424 145
308 iso_pu_bacteria 8019619141 8019622204 145
309 iso_pu_bacteria 8019629233 8019631112 145
310 iso_pu_bacteria 8019638758 8019639512 145
311 iso_pu_bacteria 8019668869 8019677333 145
312 iso_pu_bacteria 8019687851 8019696865 145
313 iso_pu_bacteria 8055742211 8055743255 145
314 3300010375 Ga0105239_11609889 Ga0105239_116098891 146
315 3300044901 Ga0466960_0133576 Ga0466960_0133576_432_971 146
316 iso_pu_bacteria 2508501128 2509149921 146
317 3300005456 Ga0070678_100060242 Ga0070678_1000602423 147
318 3300005548 Ga0070665_100945123 Ga0070665_1009451232 147
319 3300005616 Ga0068852_100432784 Ga0068852_1004327842 147
320 3300005842 Ga0068858_100406503 Ga0068858_1004065032 147
321 3300006038 Ga0075365_10234257 Ga0075365_102342572 147
322 3300010375 Ga0105239_11614904 Ga0105239_116149042 147
323 3300026089 Ga0207648_10821384 Ga0207648_108213841 147
324 3300026116 Ga0207674_11046140 Ga0207674_110461401 147
325 3300026121 Ga0207683_10089043 Ga0207683_100890433 147
326 3300026121 Ga0207683_11075637 Ga0207683_110756372 147
327 3300028379 Ga0268266_11075393 Ga0268266_110753931 147
328 3300028381 Ga0268264_10908123 Ga0268264_109081231 147
329 3300028786 Ga0307517_10000066 Ga0307517_1000006622 147
330 3300031730 Ga0307516_10334304 Ga0307516_103343041 147
331 3300031731 Ga0307405_10580691 Ga0307405_105806911 147
332 3300035114 Ga0373939_0080834 Ga0373939_0080834_358_876 147
333 3300041451 Ga0451791_1553070 Ga0451791_1553070_193_711 147
334 3300047320 Ga0495672_0043340 Ga0495672_0043340_1060_1578 147
335 3300047472 Ga0495686_0315776 Ga0495686_0315776_145_663 147
336 3300048905 Ga0496102_0135069 Ga0496102_0135069_409_927 147
337 3300048907 Ga0496104_0093803 Ga0496104_0093803_1944_2462 147
338 3300048924 Ga0496121_0343443 Ga0496121_0343443_339_857 147
339 iso_pu_bacteria 2513237141 2513889659 147
340 3300005327 Ga0070658_10262669 Ga0070658_102626692 148
341 3300005329 Ga0070683_100070645 Ga0070683_1000706455 148
342 3300005331 Ga0070670_101051257 Ga0070670_1010512572 148
343 3300005337 Ga0070682_100030995 Ga0070682_1000309956 148
344 3300005338 Ga0068868_100824741 Ga0068868_1008247411 148
345 3300005341 Ga0070691_10047567 Ga0070691_100475672 148
346 3300005344 Ga0070661_100666481 Ga0070661_1006664812 148
347 3300005344 Ga0070661_100922997 Ga0070661_1009229971 148
348 3300005347 Ga0070668_100368644 Ga0070668_1003686442 148
349 3300005347 Ga0070668_101065366 Ga0070668_1010653661 148
350 3300005355 Ga0070671_100953668 Ga0070671_1009536682 148
351 3300005366 Ga0070659_100246541 Ga0070659_1002465413 148
352 3300005367 Ga0070667_100472482 Ga0070667_1004724821 148
353 3300005434 Ga0070709_10165845 Ga0070709_101658451 148
354 3300005434 Ga0070709_10182234 Ga0070709_101822342 148
355 3300005435 Ga0070714_100050500 Ga0070714_1000505003 148
356 3300005436 Ga0070713_100450610 Ga0070713_1004506102 148
357 3300005437 Ga0070710_10293085 Ga0070710_102930852 148
358 3300005439 Ga0070711_100024318 Ga0070711_1000243182 148
359 3300005455 Ga0070663_100348478 Ga0070663_1003484782 148
360 3300005456 Ga0070678_100847761 Ga0070678_1008477611 148
361 3300005458 Ga0070681_10140566 Ga0070681_101405662 148
362 3300005458 Ga0070681_10262104 Ga0070681_102621042 148
363 3300005458 Ga0070681_10572299 Ga0070681_105722992 148
364 3300005466 Ga0070685_10183029 Ga0070685_101830292 148
365 3300005530 Ga0070679_100304289 Ga0070679_1003042893 148
366 3300005535 Ga0070684_100073578 Ga0070684_1000735782 148
367 3300005539 Ga0068853_100156985 Ga0068853_1001569852 148
368 3300005539 Ga0068853_100457636 Ga0068853_1004576362 148
369 3300005547 Ga0070693_100722044 Ga0070693_1007220442 148
370 3300005548 Ga0070665_100454604 Ga0070665_1004546042 148
371 3300005563 Ga0068855_100324958 Ga0068855_1003249582 148
372 3300005563 Ga0068855_100350463 Ga0068855_1003504632 148
373 3300005564 Ga0070664_100149720 Ga0070664_1001497202 148
374 3300005564 Ga0070664_101111841 Ga0070664_1011118412 148
375 3300005577 Ga0068857_100639548 Ga0068857_1006395481 148
376 3300005578 Ga0068854_100225483 Ga0068854_1002254833 148
377 3300005616 Ga0068852_100195359 Ga0068852_1001953593 148
378 3300005617 Ga0068859_100606613 Ga0068859_1006066132 148
379 3300005841 Ga0068863_100536403 Ga0068863_1005364031 148
380 3300005841 Ga0068863_101075487 Ga0068863_1010754871 148
381 3300005842 Ga0068858_100515121 Ga0068858_1005151211 148
382 3300005844 Ga0068862_100378117 Ga0068862_1003781172 148
383 3300005985 Ga0081539_10088217 Ga0081539_100882172 148
384 3300006038 Ga0075365_10232508 Ga0075365_102325082 148
385 3300006048 Ga0075363_100247745 Ga0075363_1002477451 148
386 3300006048 Ga0075363_100264538 Ga0075363_1002645381 148
387 3300006173 Ga0070716_100256662 Ga0070716_1002566622 148
388 3300006175 Ga0070712_100036410 Ga0070712_1000364104 148
389 3300006186 Ga0075369_10286017 Ga0075369_102860172 148
390 3300006195 Ga0075366_10479434 Ga0075366_104794342 148
391 3300006844 Ga0075428_100338329 Ga0075428_1003383291 148
392 3300006931 Ga0097620_100606605 Ga0097620_1006066051 148
393 3300009093 Ga0105240_10039101 Ga0105240_100391012 148
394 3300009093 Ga0105240_10118623 Ga0105240_101186233 148
395 3300009093 Ga0105240_10377122 Ga0105240_103771222 148
396 3300009101 Ga0105247_10209937 Ga0105247_102099371 148
397 3300009147 Ga0114129_10186448 Ga0114129_101864484 148
398 3300009174 Ga0105241_10213333 Ga0105241_102133332 148
399 3300009545 Ga0105237_10173918 Ga0105237_101739182 148
400 3300009545 Ga0105237_10836987 Ga0105237_108369871 148
401 3300009551 Ga0105238_10545277 Ga0105238_105452772 148
402 3300009551 Ga0105238_11404517 Ga0105238_114045172 148
403 3300010159 Ga0099796_10022000 Ga0099796_100220003 148
404 3300010375 Ga0105239_11087032 Ga0105239_110870322 148
405 3300010375 Ga0105239_11373142 Ga0105239_113731422 148
406 3300013104 Ga0157370_10655669 Ga0157370_106556692 148
407 3300013105 Ga0157369_10010577 Ga0157369_1001057710 148
408 3300013105 Ga0157369_10111832 Ga0157369_101118323 148
409 3300013105 Ga0157369_10194618 Ga0157369_101946182 148
410 3300013297 Ga0157378_11362339 Ga0157378_113623391 148
411 3300013306 Ga0163162_11186576 Ga0163162_111865762 148
412 3300013307 Ga0157372_10507255 Ga0157372_105072552 148
413 3300013307 Ga0157372_11521526 Ga0157372_115215262 148
414 3300014326 Ga0157380_10759698 Ga0157380_107596982 148
415 3300014969 Ga0157376_10632910 Ga0157376_106329101 148
416 3300017792 Ga0163161_10517824 Ga0163161_105178242 148
417 3300021384 Ga0213876_10022972 Ga0213876_100229723 148
418 3300022467 Ga0224712_10136980 Ga0224712_101369801 148
419 3300025900 Ga0207710_10108429 Ga0207710_101084292 148
420 3300025906 Ga0207699_10241754 Ga0207699_102417541 148
421 3300025907 Ga0207645_10385829 Ga0207645_103858292 148
422 3300025912 Ga0207707_10016071 Ga0207707_100160718 148
423 3300025912 Ga0207707_10082019 Ga0207707_100820193 148
424 3300025912 Ga0207707_10269126 Ga0207707_102691262 148
425 3300025914 Ga0207671_10498170 Ga0207671_104981701 148
426 3300025914 Ga0207671_10558395 Ga0207671_105583951 148
427 3300025915 Ga0207693_10037984 Ga0207693_100379842 148
428 3300025916 Ga0207663_10018567 Ga0207663_100185672 148
429 3300025921 Ga0207652_10015649 Ga0207652_100156497 148
430 3300025921 Ga0207652_10270126 Ga0207652_102701262 148
431 3300025924 Ga0207694_10362224 Ga0207694_103622242 148
432 3300025925 Ga0207650_10694664 Ga0207650_106946642 148
433 3300025928 Ga0207700_10036905 Ga0207700_100369054 148
434 3300025928 Ga0207700_10359390 Ga0207700_103593902 148
435 3300025929 Ga0207664_10112953 Ga0207664_101129532 148
436 3300025932 Ga0207690_10673141 Ga0207690_106731412 148
437 3300025937 Ga0207669_10865854 Ga0207669_108658542 148
438 3300025939 Ga0207665_10220392 Ga0207665_102203922 148
439 3300025940 Ga0207691_10580733 Ga0207691_105807331 148
440 3300025942 Ga0207689_10939625 Ga0207689_109396251 148
441 3300025944 Ga0207661_10042228 Ga0207661_100422286 148
442 3300025945 Ga0207679_10144070 Ga0207679_101440702 148
443 3300025945 Ga0207679_10886879 Ga0207679_108868791 148
444 3300025961 Ga0207712_11183865 Ga0207712_111838652 148
445 3300025972 Ga0207668_10909319 Ga0207668_109093191 148
446 3300025986 Ga0207658_10909768 Ga0207658_109097682 148
447 3300026023 Ga0207677_10038493 Ga0207677_100384931 148
448 3300026023 Ga0207677_10767693 Ga0207677_107676931 148
449 3300026041 Ga0207639_10184081 Ga0207639_101840812 148
450 3300026041 Ga0207639_10313636 Ga0207639_103136363 148
451 3300026041 Ga0207639_11217732 Ga0207639_112177322 148
452 3300026067 Ga0207678_10975831 Ga0207678_109758311 148
453 3300026089 Ga0207648_10593045 Ga0207648_105930451 148
454 3300026116 Ga0207674_10663277 Ga0207674_106632772 148
455 3300026118 Ga0207675_100953586 Ga0207675_1009535861 148
456 3300026121 Ga0207683_10488983 Ga0207683_104889832 148
457 3300026142 Ga0207698_10143546 Ga0207698_101435462 148
458 3300026142 Ga0207698_10158800 Ga0207698_101588004 148
459 3300028379 Ga0268266_10033807 Ga0268266_100338071 148
460 3300031731 Ga0307405_10781400 Ga0307405_107814002 148
461 3300031903 Ga0307407_10330785 Ga0307407_103307852 148
462 3300031911 Ga0307412_10218952 Ga0307412_102189521 148
463 3300032002 Ga0307416_100321671 Ga0307416_1003216712 148
464 3300032002 Ga0307416_101615683 Ga0307416_1016156832 148
465 3300032005 Ga0307411_11077849 Ga0307411_110778492 148
466 3300032126 Ga0307415_100265892 Ga0307415_1002658921 148
467 3300035695 Ga0373927_0026977 Ga0373927_0026977_1135_1656 148
468 3300035725 Ga0373947_0052888 Ga0373947_0052888_1014_1535 148
469 3300037068 Ga0373925_0934269 Ga0373925_0934269_131_655 148
470 3300037312 Ga0395899_0047216 Ga0395899_0047216_140_661 148
471 3300037418 Ga0395900_0041199 Ga0395900_0041199_3204_3725 148
472 3300037466 Ga0395898_0195700 Ga0395898_0195700_406_927 148
473 3300037471 Ga0395905_0764011 Ga0395905_0764011_75_599 148
474 3300037853 Ga0436364_0136702 Ga0436364_0136702_334_855 148
475 3300038443 Ga0395901_1091263 Ga0395901_1091263_224_745 148
476 3300039437 Ga0436365_1810308 Ga0436365_1810308_147_668 148
477 3300041451 Ga0451791_1119922 Ga0451791_1119922_14_538 148
478 3300041456 Ga0451795_0382645 Ga0451795_0382645_97_621 148
479 3300041509 Ga0451843_1639070 Ga0451843_1639070_44_493 148
480 3300046455 Ga0495603_0099252 Ga0495603_0099252_258_779 148
481 3300046455 Ga0495603_0136144 Ga0495603_0136144_154_678 148
482 3300046455 Ga0495603_0164673 Ga0495603_0164673_56_580 148
483 3300046474 Ga0495605_0109262 Ga0495605_0109262_114_638 148
484 3300046475 Ga0495639_0039176 Ga0495639_0039176_139_663 148
485 3300046477 Ga0495664_0422029 Ga0495664_0422029_207_728 148
486 3300046491 Ga0495584_0375279 Ga0495584_0375279_100_624 148
487 3300046492 Ga0495585_0211912 Ga0495585_0211912_301_825 148
488 3300046492 Ga0495585_0236509 Ga0495585_0236509_98_622 148
489 3300046507 Ga0495606_0221853 Ga0495606_0221853_280_804 148
490 3300046515 Ga0495620_0158049 Ga0495620_0158049_61_585 148
491 3300046516 Ga0495628_0876483 Ga0495628_0876483_57_578 148
492 3300046518 Ga0495631_0064808 Ga0495631_0064808_896_1420 148
493 3300046519 Ga0495632_0325487 Ga0495632_0325487_90_614 148
494 3300046523 Ga0495644_0189540 Ga0495644_0189540_109_633 148
495 3300046524 Ga0495648_0268938 Ga0495648_0268938_56_580 148
496 3300046530 Ga0495654_0182459 Ga0495654_0182459_261_785 148
497 3300046533 Ga0495640_0773403 Ga0495640_0773403_12_533 148
498 3300046537 Ga0495598_0046390 Ga0495598_0046390_606_1130 148
499 3300046542 Ga0495597_0196583 Ga0495597_0196583_246_770 148
500 3300046558 Ga0495633_0211282 Ga0495633_0211282_52_576 148
501 3300046616 Ga0495668_0421866 Ga0495668_0421866_122_646 148
502 3300046664 Ga0495659_0025848 Ga0495659_0025848_900_1424 148
503 3300046674 Ga0495588_0332121 Ga0495588_0332121_114_638 148
504 3300046681 Ga0495647_0041458 Ga0495647_0041458_810_1334 148
505 3300046691 Ga0495670_0447845 Ga0495670_0447845_162_686 148
506 3300046692 Ga0495671_0207267 Ga0495671_0207267_122_646 148
507 3300046694 Ga0495649_0428427 Ga0495649_0428427_69_593 148
508 3300046794 Ga0495589_0333053 Ga0495589_0333053_55_579 148
509 3300047318 Ga0495636_0054292 Ga0495636_0054292_996_1520 148
510 3300047321 Ga0495676_0113996 Ga0495676_0113996_410_934 148
511 3300047323 Ga0495683_0334152 Ga0495683_0334152_64_588 148
512 3300047446 Ga0495679_038314 Ga0495679_038314_433_957 148
513 3300047470 Ga0495681_0197805 Ga0495681_0197805_121_645 148
514 3300048090 Ga0495615_0083588 Ga0495615_0083588_59_583 148
515 3300048905 Ga0496102_0636288 Ga0496102_0636288_390_911 148
516 3300048911 Ga0496108_1150531 Ga0496108_1150531_89_613 148
517 3300048912 Ga0496109_0042780 Ga0496109_0042780_1511_2035 148
518 3300048922 Ga0496119_0389365 Ga0496119_0389365_88_612 148
519 3300048924 Ga0496121_0235287 Ga0496121_0235287_61_585 148
520 3300048928 Ga0496125_0192633 Ga0496125_0192633_62_586 148
521 3300048929 Ga0496126_0236647 Ga0496126_0236647_195_719 148
522 3300049569 Ga0501032_0400493 Ga0501032_0400493_115_648 148
523 3300049572 Ga0501036_0342315 Ga0501036_0342315_321_842 148
524 3300049580 Ga0501046_0159344 Ga0501046_0159344_564_1097 148
525 3300049586 Ga0501070_0075254 Ga0501070_0075254_1650_2183 148
526 3300049590 Ga0501074_0032975 Ga0501074_0032975_2079_2612 148
527 3300049742 Ga0501080_0004892 Ga0501080_0004892_4093_4626 148
528 3300049823 Ga0501044_0086872 Ga0501044_0086872_2262_2795 148
529 3300050507 nmdc:mga05p37_213133_c1 nmdc:mga05p37_213133_c1_1031_1555 148
530 3300050509 nmdc:mga0qj67_309975_c1 nmdc:mga0qj67_309975_c1_598_1122 148
531 3300050511 nmdc:mga08y16_1404567_c1 nmdc:mga08y16_1404567_c1_113_637 148
532 3300053103 Ga0500555_097694 Ga0500555_097694_42_566 148
533 3300053104 Ga0500556_0264943 Ga0500556_0264943_77_601 148
534 3300053730 Ga0500645_007988 Ga0500645_007988_611_1135 148
535 3300053730 Ga0500645_155811 Ga0500645_155811_52_576 148
536 3300054114 Ga0501084_0199140 Ga0501084_0199140_340_861 148
537 3300054114 Ga0501084_0499665 Ga0501084_0499665_19_540 148
538 3300061734 Ga0530510_0480126 Ga0530510_0480126_153_674 148
539 3300005345 Ga0070692_10635626 Ga0070692_106356262 149
540 3300005347 Ga0070668_100742232 Ga0070668_1007422322 149
541 3300005457 Ga0070662_100301729 Ga0070662_1003017292 149
542 3300005564 Ga0070664_100300874 Ga0070664_1003008742 149
543 3300005578 Ga0068854_100108189 Ga0068854_1001081892 149
544 3300005618 Ga0068864_100282186 Ga0068864_1002821862 149
545 3300005834 Ga0068851_10099579 Ga0068851_100995792 149
546 3300005983 Ga0081540_1070925 Ga0081540_10709253 149
547 3300006038 Ga0075365_10364252 Ga0075365_103642521 149
548 3300006178 Ga0075367_10596566 Ga0075367_105965661 149
549 3300006353 Ga0075370_10234397 Ga0075370_102343971 149
550 3300009545 Ga0105237_10786368 Ga0105237_107863681 149
551 3300009551 Ga0105238_11112038 Ga0105238_111120382 149
552 3300011119 Ga0105246_10859604 Ga0105246_108596041 149
553 3300013306 Ga0163162_10473514 Ga0163162_104735141 149
554 3300013307 Ga0157372_10231909 Ga0157372_102319093 149
555 3300013308 Ga0157375_10535403 Ga0157375_105354032 149
556 3300014325 Ga0163163_10167718 Ga0163163_101677182 149
557 3300017792 Ga0163161_10277455 Ga0163161_102774552 149
558 3300021320 Ga0214544_1000007 Ga0214544_100000789 149
559 3300021321 Ga0214542_1000216 Ga0214542_10002162 149
560 3300021321 Ga0214542_1042175 Ga0214542_10421752 149
561 3300021324 Ga0214545_1000118 Ga0214545_100011889 149
562 3300021324 Ga0214545_1043334 Ga0214545_10433341 149
563 3300021327 Ga0214543_1000009 Ga0214543_100000989 149
564 3300025230 Ga0209563_103176 Ga0209563_1031761 149
565 3300025253 Ga0209677_100296 Ga0209677_1002965 149
566 3300025297 Ga0209758_1000429 Ga0209758_100042949 149
567 3300025297 Ga0209758_1033130 Ga0209758_10331302 149
568 3300025909 Ga0207705_10168126 Ga0207705_101681263 149
569 3300025914 Ga0207671_10585255 Ga0207671_105852552 149
570 3300025919 Ga0207657_10208275 Ga0207657_102082751 149
571 3300025924 Ga0207694_11148492 Ga0207694_111484921 149
572 3300025932 Ga0207690_10702476 Ga0207690_107024762 149
573 3300025933 Ga0207706_10163428 Ga0207706_101634283 149
574 3300025945 Ga0207679_10520126 Ga0207679_105201262 149
575 3300025949 Ga0207667_10226493 Ga0207667_102264933 149
576 3300025972 Ga0207668_10055426 Ga0207668_100554262 149
577 3300026035 Ga0207703_10181174 Ga0207703_101811742 149
578 3300026041 Ga0207639_11012424 Ga0207639_110124242 149
579 3300026067 Ga0207678_10077612 Ga0207678_100776121 149
580 3300026078 Ga0207702_10229166 Ga0207702_102291661 149
581 3300026078 Ga0207702_10480126 Ga0207702_104801261 149
582 3300026088 Ga0207641_10513023 Ga0207641_105130232 149
583 3300026095 Ga0207676_10405994 Ga0207676_104059942 149
584 3300026118 Ga0207675_100157667 Ga0207675_1001576673 149
585 3300028379 Ga0268266_10392170 Ga0268266_103921701 149
586 3300031616 Ga0307508_10023991 Ga0307508_100239914 149
587 3300033180 Ga0307510_10009663 Ga0307510_100096636 149
588 3300035170 Ga0373943_0142886 Ga0373943_0142886_721_1170 149
589 3300035695 Ga0373927_0361617 Ga0373927_0361617_209_658 149
590 3300037471 Ga0395905_0801988 Ga0395905_0801988_339_788 149
591 3300044658 Ga0466972_0133985 Ga0466972_0133985_486_935 149
592 3300044735 Ga0466968_0009927 Ga0466968_0009927_1385_1834 149
593 3300046454 Ga0495592_0077819 Ga0495592_0077819_1827_2276 149
594 3300046457 Ga0495590_0137261 Ga0495590_0137261_159_683 149
595 3300046459 Ga0495629_0005545 Ga0495629_0005545_5374_5823 149
596 3300046460 Ga0495638_0008455 Ga0495638_0008455_508_1032 149
597 3300046462 Ga0495651_0070775 Ga0495651_0070775_2007_2456 149
598 3300046463 Ga0495653_0108209 Ga0495653_0108209_12_461 149
599 3300046474 Ga0495605_0080857 Ga0495605_0080857_283_807 149
600 3300046475 Ga0495639_0424034 Ga0495639_0424034_148_597 149
601 3300046476 Ga0495662_0078274 Ga0495662_0078274_592_1041 149
602 3300046491 Ga0495584_0264556 Ga0495584_0264556_15_464 149
603 3300046507 Ga0495606_0050032 Ga0495606_0050032_1131_1655 149
604 3300046507 Ga0495606_0315685 Ga0495606_0315685_141_590 149
605 3300046511 Ga0495608_0211113 Ga0495608_0211113_600_1049 149
606 3300046512 Ga0495610_0072907 Ga0495610_0072907_194_718 149
607 3300046514 Ga0495618_0035125 Ga0495618_0035125_1615_2064 149
608 3300046519 Ga0495632_0247967 Ga0495632_0247967_34_558 149
609 3300046524 Ga0495648_0056155 Ga0495648_0056155_940_1464 149
610 3300046524 Ga0495648_0193408 Ga0495648_0193408_458_907 149
611 3300046529 Ga0495652_0692549 Ga0495652_0692549_96_545 149
612 3300046533 Ga0495640_0016318 Ga0495640_0016318_5029_5478 149
613 3300046536 Ga0495587_0381424 Ga0495587_0381424_70_519 149
614 3300046538 Ga0495609_0154446 Ga0495609_0154446_24_548 149
615 3300046542 Ga0495597_0055721 Ga0495597_0055721_33_482 149
616 3300046557 Ga0495622_0016420 Ga0495622_0016420_502_1026 149
617 3300046559 Ga0495667_0168329 Ga0495667_0168329_202_651 149
618 3300046648 Ga0495611_0374785 Ga0495611_0374785_17_541 149
619 3300046660 Ga0495625_0013351 Ga0495625_0013351_1205_1729 149
620 3300046660 Ga0495625_0119428 Ga0495625_0119428_1014_1463 149
621 3300046663 Ga0495635_0040207 Ga0495635_0040207_70_519 149
622 3300046665 Ga0495661_0058502 Ga0495661_0058502_290_814 149
623 3300046674 Ga0495588_0020269 Ga0495588_0020269_1039_1563 149
624 3300046674 Ga0495588_0188651 Ga0495588_0188651_433_882 149
625 3300046674 Ga0495588_0381867 Ga0495588_0381867_146_670 149
626 3300046675 Ga0495657_0003331 Ga0495657_0003331_8751_9200 149
627 3300046679 Ga0495623_0124733 Ga0495623_0124733_141_590 149
628 3300046680 Ga0495646_0100261 Ga0495646_0100261_289_738 149
629 3300046689 Ga0495613_0022819 Ga0495613_0022819_2152_2601 149
630 3300046690 Ga0495624_0127579 Ga0495624_0127579_198_647 149
631 3300046692 Ga0495671_0226628 Ga0495671_0226628_53_502 149
632 3300046692 Ga0495671_0278232 Ga0495671_0278232_249_773 149
633 3300046694 Ga0495649_0048054 Ga0495649_0048054_811_1260 149
634 3300046694 Ga0495649_0238660 Ga0495649_0238660_289_813 149
635 3300046794 Ga0495589_0069690 Ga0495589_0069690_1053_1577 149
636 3300046794 Ga0495589_0110926 Ga0495589_0110926_214_738 149
637 3300046809 Ga0495600_0156994 Ga0495600_0156994_802_1251 149
638 3300046810 Ga0495660_0055114 Ga0495660_0055114_1319_1843 149
639 3300047315 Ga0495581_0064567 Ga0495581_0064567_517_966 149
640 3300047317 Ga0495604_0007178 Ga0495604_0007178_5584_6033 149
641 3300047319 Ga0495674_0733476 Ga0495674_0733476_73_522 149
642 3300047321 Ga0495676_0020621 Ga0495676_0020621_1792_2241 149
643 3300047323 Ga0495683_0348650 Ga0495683_0348650_112_561 149
644 3300047443 Ga0495687_081653 Ga0495687_081653_708_1232 149
645 3300047469 Ga0495673_0064702 Ga0495673_0064702_781_1305 149
646 3300047469 Ga0495673_0099566 Ga0495673_0099566_436_885 149
647 3300047471 Ga0495684_0427188 Ga0495684_0427188_276_725 149
648 3300047673 Ga0495593_0003341 Ga0495593_0003341_3107_3556 149
649 3300047673 Ga0495593_0157334 Ga0495593_0157334_416_940 149
650 3300048088 Ga0495602_0246879 Ga0495602_0246879_221_670 149
651 3300048904 Ga0496101_0168879 Ga0496101_0168879_878_1402 149
652 3300048904 Ga0496101_0434334 Ga0496101_0434334_334_783 149
653 3300048905 Ga0496102_0976846 Ga0496102_0976846_250_699 149
654 3300048907 Ga0496104_0002055 Ga0496104_0002055_12627_13076 149
655 3300048907 Ga0496104_0208826 Ga0496104_0208826_1147_1671 149
656 3300048908 Ga0496105_0000745 Ga0496105_0000745_20048_20497 149
657 3300048908 Ga0496105_0027123 Ga0496105_0027123_1815_2339 149
658 3300048909 Ga0496106_0128417 Ga0496106_0128417_1152_1676 149
659 3300048910 Ga0496107_0042886 Ga0496107_0042886_2076_2600 149
660 3300048911 Ga0496108_0127781 Ga0496108_0127781_617_1141 149
661 3300048913 Ga0496110_0116321 Ga0496110_0116321_1417_1956 149
662 3300048913 Ga0496110_0459296 Ga0496110_0459296_541_1065 149
663 3300048914 Ga0496111_0085755 Ga0496111_0085755_832_1356 149
664 3300048915 Ga0496112_0210571 Ga0496112_0210571_724_1248 149
665 3300048915 Ga0496112_0390376 Ga0496112_0390376_796_1320 149
666 3300048916 Ga0496113_0281726 Ga0496113_0281726_665_1114 149
667 3300048918 Ga0496115_0037752 Ga0496115_0037752_2816_3340 149
668 3300048918 Ga0496115_0043348 Ga0496115_0043348_475_924 149
669 3300048920 Ga0496117_0177875 Ga0496117_0177875_53_502 149
670 3300048920 Ga0496117_0178316 Ga0496117_0178316_490_1014 149
671 3300048921 Ga0496118_0176871 Ga0496118_0176871_691_1215 149
672 3300048922 Ga0496119_0009075 Ga0496119_0009075_5263_5712 149
673 3300048924 Ga0496121_0026391 Ga0496121_0026391_2486_3010 149
674 3300048924 Ga0496121_0201185 Ga0496121_0201185_270_719 149
675 3300048924 Ga0496121_0212495 Ga0496121_0212495_188_637 149
676 3300048927 Ga0496124_0501360 Ga0496124_0501360_167_616 149
677 3300048928 Ga0496125_0130278 Ga0496125_0130278_1020_1469 149
678 3300048929 Ga0496126_0073568 Ga0496126_0073568_1594_2043 149
679 3300048929 Ga0496126_0180249 Ga0496126_0180249_51_500 149
680 3300048929 Ga0496126_0307291 Ga0496126_0307291_807_1256 149
681 3300049460 Ga0495682_0059826 Ga0495682_0059826_910_1359 149
682 3300053077 Ga0495601_0218484 Ga0495601_0218484_664_1113 149
683 3300053086 Ga0500578_0073568 Ga0500578_0073568_1038_1487 149
684 3300053086 Ga0500578_0298316 Ga0500578_0298316_94_543 149
685 3300053087 Ga0500643_000231 Ga0500643_000231_32060_32584 149
686 3300053088 Ga0500644_0216071 Ga0500644_0216071_257_706 149
687 3300053091 Ga0500647_0022727 Ga0500647_0022727_1400_1924 149
688 3300053092 Ga0500583_0038068 Ga0500583_0038068_706_1230 149
689 3300053093 Ga0500651_0025302 Ga0500651_0025302_1936_2385 149
690 3300053094 Ga0500566_0000931 Ga0500566_0000931_3080_3529 149
691 3300053096 Ga0500641_0164704 Ga0500641_0164704_49_573 149
692 3300053098 Ga0500650_0291985 Ga0500650_0291985_206_655 149
693 3300053103 Ga0500555_002267 Ga0500555_002267_1002_1526 149
694 3300053105 Ga0500557_000179 Ga0500557_000179_3742_4266 149
695 3300053108 Ga0500562_011871 Ga0500562_011871_26_550 149
696 3300053109 Ga0500569_010567 Ga0500569_010567_875_1324 149
697 3300053131 Ga0500652_335308 Ga0500652_335308_32_481 149
698 3300053134 Ga0500658_0073809 Ga0500658_0073809_868_1392 149
699 3300053136 Ga0500559_0017216 Ga0500559_0017216_252_701 149
700 3300053139 Ga0500568_0045168 Ga0500568_0045168_1140_1664 149
701 3300053142 Ga0500577_0213391 Ga0500577_0213391_16_540 149
702 3300053151 Ga0500604_0137025 Ga0500604_0137025_46_570 149
703 3300053156 Ga0500622_0004589 Ga0500622_0004589_106_630 149
704 3300053158 Ga0500627_0008055 Ga0500627_0008055_751_1275 149
705 3300053161 Ga0500634_0065140 Ga0500634_0065140_129_653 149
706 3300053177 Ga0500636_0523645 Ga0500636_0523645_53_502 149
707 3300053724 Ga0500570_144234 Ga0500570_144234_219_743 149
708 3300053727 Ga0500611_052493 Ga0500611_052493_259_783 149
709 3300053731 Ga0500609_033795 Ga0500609_033795_199_648 149
710 3300053735 Ga0500596_013426 Ga0500596_013426_561_1010 149
711 3300053735 Ga0500596_020443 Ga0500596_020443_509_958 149
712 3300053736 Ga0500599_001236 Ga0500599_001236_1571_2095 149
713 iso_pu_bacteria 2507262055 2507504688 149
714 iso_pu_bacteria 2841941048 2841942719 149
715 iso_pu_bacteria 2841949485 2841952929 149
716 iso_pu_bacteria 2841966195 2841971042 149
717 iso_pu_bacteria 2842045827 2842049583 149
718 iso_pu_bacteria 2857509624 2857515773 149
719 iso_pu_bacteria 2904666416 2904669393 149
720 3300005468 Ga0070707_100216548 Ga0070707_1002165482 150
721 3300005536 Ga0070697_100508499 Ga0070697_1005084992 150
722 3300006028 Ga0070717_10025850 Ga0070717_100258504 150
723 3300007076 Ga0075435_100142716 Ga0075435_1001427164 150
724 3300013307 Ga0157372_12070924 Ga0157372_120709241 150
725 3300021377 Ga0213874_10030678 Ga0213874_100306783 150
726 3300025910 Ga0207684_10073655 Ga0207684_100736552 150
727 3300031247 Ga0265340_10078084 Ga0265340_100780842 150
728 3300031249 Ga0265339_10002540 Ga0265339_1000254010 150
729 3300033544 Ga0316215_1007381 Ga0316215_10073812 150
730 3300033546 Ga0316213_1003479 Ga0316213_10034792 150
731 3300036459 Ga0372808_009171 Ga0372808_009171_737_1264 150
732 3300039450 Ga0436363_1392658 Ga0436363_1392658_3951_4469 150
733 3300045049 Ga0466959_0040827 Ga0466959_0040827_778_1305 150
734 iso_pu_bacteria 3005594810 3005595588 150
735 iso_pu_bacteria 3005718088 3005718838 150
736 iso_pu_bacteria 8056967851 8056970696 150
737 3300005329 Ga0070683_100067645 Ga0070683_1000676453 151
738 3300005535 Ga0070684_100005197 Ga0070684_1000051975 151
739 3300005983 Ga0081540_1047384 Ga0081540_10473842 151
740 3300025944 Ga0207661_10000379 Ga0207661_1000037912 151
741 3300044765 Ga0466970_0053360 Ga0466970_0053360_34_567 151
742 3300045049 Ga0466959_0034315 Ga0466959_0034315_2046_2579 151
743 3300048929 Ga0496126_0255698 Ga0496126_0255698_829_1359 151
744 3300049568 Ga0501031_0067076 Ga0501031_0067076_925_1458 151
745 3300049569 Ga0501032_0127464 Ga0501032_0127464_1070_1603 151
746 3300049582 Ga0501048_0075701 Ga0501048_0075701_919_1452 151
747 3300005336 Ga0070680_100038360 Ga0070680_1000383602 152
748 3300005339 Ga0070660_100016551 Ga0070660_1000165512 152
749 3300005616 Ga0068852_100133685 Ga0068852_1001336852 152
750 3300009093 Ga0105240_10001522 Ga0105240_1000152222 152
751 3300009098 Ga0105245_10185096 Ga0105245_101850962 152
752 3300009545 Ga0105237_10081784 Ga0105237_100817843 152
753 3300013102 Ga0157371_10136557 Ga0157371_101365572 152
754 3300013104 Ga0157370_10077383 Ga0157370_100773832 152
755 3300025904 Ga0207647_10191221 Ga0207647_101912212 152
756 3300025909 Ga0207705_10048892 Ga0207705_100488923 152
757 3300025913 Ga0207695_10000006 Ga0207695_1000000686 152
758 3300025919 Ga0207657_10003442 Ga0207657_1000344211 152
759 3300025932 Ga0207690_10029081 Ga0207690_100290813 152
760 3300025981 Ga0207640_11174499 Ga0207640_111744991 152
761 3300026041 Ga0207639_10086651 Ga0207639_100866512 152
762 3300049570 Ga0501033_0042269 Ga0501033_0042269_2234_2770 152
763 3300049572 Ga0501036_0078810 Ga0501036_0078810_1259_1795 152
764 3300049574 Ga0501038_0169176 Ga0501038_0169176_1113_1649 152
765 3300049575 Ga0501039_0042185 Ga0501039_0042185_1149_1685 152
766 3300049580 Ga0501046_0085782 Ga0501046_0085782_1123_1659 152
767 3300049581 Ga0501047_0128083 Ga0501047_0128083_1177_1713 152
768 3300049583 Ga0501067_0606110 Ga0501067_0606110_29_565 152
769 3300049586 Ga0501070_0052265 Ga0501070_0052265_1559_2095 152
770 3300049587 Ga0501071_0132872 Ga0501071_0132872_1210_1746 152
771 3300049590 Ga0501074_0092394 Ga0501074_0092394_913_1449 152
772 3300049741 Ga0501079_0286475 Ga0501079_0286475_204_740 152
773 3300049742 Ga0501080_0167470 Ga0501080_0167470_299_835 152
774 3300013296 Ga0157374_11277486 Ga0157374_112774862 153
775 3300025297 Ga0209758_1034727 Ga0209758_10347271 153
776 3300025924 Ga0207694_10243918 Ga0207694_102439182 153
777 3300044706 Ga0466964_0039193 Ga0466964_0039193_1059_1595 153
778 3300044842 Ga0466957_0230093 Ga0466957_0230093_120_656 153
779 3300053111 Ga0500572_000668 Ga0500572_000668_7124_7666 153
780 3300053163 Ga0500639_002805 Ga0500639_002805_3094_3636 153
781 3300053735 Ga0500596_001693 Ga0500596_001693_2365_2907 153
782 3300003215 JGI25153J46596_10033514 JGI25153J46596_100335142 154
783 3300003354 JGI25160J50197_1013318 JGI25160J50197_10133182 154
784 3300003752 Ga0055539_1009637 Ga0055539_10096372 154
785 3300005262 Ga0065165_1077129 Ga0065165_10771292 154
786 3300005335 Ga0070666_10407866 Ga0070666_104078661 154
787 3300005577 Ga0068857_100930309 Ga0068857_1009303092 154
788 3300005841 Ga0068863_100358896 Ga0068863_1003588962 154
789 3300005843 Ga0068860_101077660 Ga0068860_1010776602 154
790 3300006038 Ga0075365_10622319 Ga0075365_106223192 154
791 3300006048 Ga0075363_100379374 Ga0075363_1003793742 154
792 3300006051 Ga0075364_10152558 Ga0075364_101525581 154
793 3300006173 Ga0070716_100719448 Ga0070716_1007194482 154
794 3300006178 Ga0075367_10364528 Ga0075367_103645282 154
795 3300006186 Ga0075369_10211103 Ga0075369_102111031 154
796 3300006237 Ga0097621_100672367 Ga0097621_1006723672 154
797 3300006358 Ga0068871_100454545 Ga0068871_1004545452 154
798 3300009098 Ga0105245_10968557 Ga0105245_109685571 154
799 3300009101 Ga0105247_10181651 Ga0105247_101816512 154
800 3300009176 Ga0105242_10201271 Ga0105242_102012712 154
801 3300009177 Ga0105248_10127908 Ga0105248_101279083 154
802 3300009177 Ga0105248_10937152 Ga0105248_109371521 154
803 3300009545 Ga0105237_10207163 Ga0105237_102071632 154
804 3300009545 Ga0105237_10543982 Ga0105237_105439822 154
805 3300009553 Ga0105249_10546486 Ga0105249_105464861 154
806 3300010375 Ga0105239_10175070 Ga0105239_101750702 154
807 3300010375 Ga0105239_11165830 Ga0105239_111658301 154
808 3300013104 Ga0157370_10519605 Ga0157370_105196052 154
809 3300013306 Ga0163162_11664201 Ga0163162_116642011 154
810 3300025253 Ga0209677_106519 Ga0209677_1065195 154
811 3300025254 Ga0209148_1001484 Ga0209148_10014849 154
812 3300025261 Ga0209233_1006650 Ga0209233_10066502 154
813 3300025297 Ga0209758_1006708 Ga0209758_10067084 154
814 3300025302 Ga0207426_1001158 Ga0207426_100115816 154
815 3300025302 Ga0207426_1008203 Ga0207426_10082034 154
816 3300025304 Ga0209257_1026629 Ga0209257_10266291 154
817 3300025900 Ga0207710_10244828 Ga0207710_102448282 154
818 3300025903 Ga0207680_10476417 Ga0207680_104764171 154
819 3300025914 Ga0207671_10498693 Ga0207671_104986932 154
820 3300025914 Ga0207671_10692660 Ga0207671_106926601 154
821 3300025939 Ga0207665_10611723 Ga0207665_106117232 154
822 3300026078 Ga0207702_10285899 Ga0207702_102858991 154
823 3300026095 Ga0207676_11325365 Ga0207676_113253652 154
824 3300034819 Ga0373958_0126472 Ga0373958_0126472_15_554 154
825 3300035084 Ga0373928_0032860 Ga0373928_0032860_334_873 154
826 3300035692 Ga0373935_0498589 Ga0373935_0498589_199_738 154
827 3300037068 Ga0373925_0686444 Ga0373925_0686444_75_614 154
828 3300039437 Ga0436365_0661667 Ga0436365_0661667_522_986 154
829 3300041456 Ga0451795_0110462 Ga0451795_0110462_87_626 154
830 3300041460 Ga0451802_0059232 Ga0451802_0059232_930_1469 154
831 3300044684 Ga0466966_0002003 Ga0466966_0002003_12593_13057 154
832 3300044693 Ga0466961_0000018 Ga0466961_0000018_8211_8675 154
833 3300044706 Ga0466964_0078685 Ga0466964_0078685_507_971 154
834 3300044765 Ga0466970_0138054 Ga0466970_0138054_817_1281 154
835 3300044842 Ga0466957_0163488 Ga0466957_0163488_658_1122 154
836 3300045049 Ga0466959_0002636 Ga0466959_0002636_8285_8749 154
837 3300045976 Ga0466967_0050248 Ga0466967_0050248_2676_3140 154
838 3300046477 Ga0495664_0297060 Ga0495664_0297060_231_695 154
839 3300048908 Ga0496105_0525320 Ga0496105_0525320_198_737 154
840 3300048910 Ga0496107_0095035 Ga0496107_0095035_309_848 154
841 3300048911 Ga0496108_0163040 Ga0496108_0163040_470_1009 154
842 3300048912 Ga0496109_0171892 Ga0496109_0171892_1107_1646 154
843 3300048913 Ga0496110_0058446 Ga0496110_0058446_339_878 154
844 3300048914 Ga0496111_0096784 Ga0496111_0096784_457_996 154
845 3300048915 Ga0496112_0087025 Ga0496112_0087025_171_710 154
846 3300048917 Ga0496114_0035582 Ga0496114_0035582_359_898 154
847 3300048918 Ga0496115_0021454 Ga0496115_0021454_2116_2655 154
848 3300048920 Ga0496117_0084392 Ga0496117_0084392_532_1071 154
849 3300048920 Ga0496117_0263319 Ga0496117_0263319_355_819 154
850 3300048921 Ga0496118_0024046 Ga0496118_0024046_53_592 154
851 3300048924 Ga0496121_0021718 Ga0496121_0021718_4355_4894 154
852 3300048928 Ga0496125_0036077 Ga0496125_0036077_2849_3313 154
853 3300050491 nmdc:mga00v17_162327_c1 nmdc:mga00v17_162327_c1_740_1204 154
854 3300050492 nmdc:mga0yw44_190730_c1 nmdc:mga0yw44_190730_c1_664_1128 154
855 3300050516 nmdc:mga0sz30_93636_c1 nmdc:mga0sz30_93636_c1_184_648 154
856 3300053085 Ga0495619_0296705 Ga0495619_0296705_182_721 154
857 3300053111 Ga0500572_007171 Ga0500572_007171_515_994 154
858 3300053122 Ga0500608_122841 Ga0500608_122841_118_597 154
859 3300053130 Ga0500642_0000087 Ga0500642_0000087_21110_21649 154
860 3300053162 Ga0500638_095670 Ga0500638_095670_125_589 154
861 3300053177 Ga0500636_0033935 Ga0500636_0033935_2320_2799 154
862 3300055283 Ga0500661_016839 Ga0500661_016839_324_788 154
863 iso_pu_bacteria 2824600985 2824605825 154
864 iso_pu_bacteria 2824609381 2824611961 154
865 iso_pu_bacteria 2824653114 2824658792 154
866 iso_pu_bacteria 2888419890 2888427286 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07475

Hpr_kinase_C

HPr Serine kinase C-terminal domain

1

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xal-assembly1.cif.gz_A y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9086 27 49
5x8k-assembly1.cif.gz_A v158t mutant of thermus thermophilus hb8 thymidylate kinase 0.9028 27 49
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.8969 27 49
4rfv-assembly1.cif.gz_A structure of the mycobacterium tuberculosis aps kinase cysc cys556ala mutant 0.8873 25 49
5x8v-assembly1.cif.gz_A y92h mutant of thermus thermophilus hb8 thymidylate kinase 0.882 27 49
ID Description Score Start End Superfamily
af_Q4DDG5_124_392_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 25 48 3.40.50.300
af_Q10DY0_3_261_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8333 25 55 3.40.50.300
af_P96394_152_310_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8041 25 47 3.40.50.300
af_Q9GS21_1_131_3.30.390.110 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1; 0.7837 62 73 3.30.390.110
3tqfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7834 11 149 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W6SQG8-F1-model_v4 Serine kinase of HPr protein (Carbohydrate metabolism regulator) 0.9921 13 154 GO:0000155
GO:0005524
GO:0006109
AF-B6JJT4-F1-model_v4 HprK/P domain protein 0.9917 10 152 GO:0000155
GO:0005524
GO:0006109
AF-A0A431MAJ2-F1-model_v4 Serine kinase 0.9886 7 152 GO:0000155
GO:0005524
GO:0006109
AF-A0A7T8BWW8-F1-model_v4 deleted 0.9883 8 154
AF-A3WS26-F1-model_v4 HPr kinase/phosphorylase C-terminal domain-containing protein 0.9875 11 153 GO:0000155
GO:0005524
GO:0006109

Feature Viewer

pLDDT pTM Quality
91.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map