F483973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 864 | 410 | 771 | 424 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_002855|Ga0500618_002855_4475_6013 |
| Length | 501 |
| Sequence | MPPRVFLSKIRQNQNTSFVNRNNVFPPLFDSFDCPHRLIVLKTLIHLHVQLIGRACDLTTQRRPIGESAHQAACNSALPDDLPPNIAEFRIMTFCAIDFGTSNSALALPALPSTNPDGSRLIALEGANRTLPTAVFFNADEHTQAFGRAAIAEYIDGYDGRLMRSLKSILGSPLALGSTEIGDGSALPFLDIIALFLEHLMKSARRAAGGPVDRAVMGRPVFFVDDDPKAARSVGLKEVVFQFEPIAAAFDYESRLDEERIVLVVDIGGGTSDFSLVRVGPQRIARLDRRDDVLGHHGVHVAGTDIDKRVALSSVMRELGYRSIDVEGREVPNRIYFDLATWHLVNTVYGVRRMAEFKLMRHIYADEAYPSRLERVFDHRLGHALIGVAEGAKIAVSAGGETAIDLHLIEDGLATEFDATRLAEASAEETHRIVAAALDTARQAGIAPQDVSALYFTGGSTGLKFLSSAISAAFPAAVAVHGDPLASVAKGLGIYAERVFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 11 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 12 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 13 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 14 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 15 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 16 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 17 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 18 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 19 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 20 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 21 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 22 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 23 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 24 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 25 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 26 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 27 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 28 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 29 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 30 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 31 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 32 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 33 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 34 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 35 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 36 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 37 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 38 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 39 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 40 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 41 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 42 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 43 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 44 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 45 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 46 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 47 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 48 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 49 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 50 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 51 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 52 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 53 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 54 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 55 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 56 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 57 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 58 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 59 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 60 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 61 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 62 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 63 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 64 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 65 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 66 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 67 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 68 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 69 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 70 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 71 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 72 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 73 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 74 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 75 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 76 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 77 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 78 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 79 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 80 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 81 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 82 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 83 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 84 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 85 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 86 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 87 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 91 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 93 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 94 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 95 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 98 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 102 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 120 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 121 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 125 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 129 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 131 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 134 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 135 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 136 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 137 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 138 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 139 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 140 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 141 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 142 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 143 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 148 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 250 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 251 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 263 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 267 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 268 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 274 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 277 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 278 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 279 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 280 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 376 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 377 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 380 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 381 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 382 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 383 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 384 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 389 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 390 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 392 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 396 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 397 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 398 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 399 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 400 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 401 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 402 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 403 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 404 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 405 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 406 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 407 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 408 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 409 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 410 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.24 |
| Metatranscriptomes | 0 |
| Isolates | 10.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.87 |
| Nodule | 2.2 |
| Rhizoplane | 5.44 |
| Rhizosphere | 72.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001229 | 3300001989 | Bacteria | 9626 |
| 2 | JGI24739J22299_10007347 | 3300001989 | Bacteria | 4137 |
| 3 | JGI24737J22298_10006947 | 3300001990 | Bacteria | 3838 |
| 4 | JGI24735J21928_10000114 | 3300002067 | Bacteria | 29422 |
| 5 | JGI24735J21928_10000535 | 3300002067 | Bacteria | 13420 |
| 6 | JGI24738J21930_10002284 | 3300002075 | Bacteria | 5070 |
| 7 | JGI25156J39149_1001087 | 3300002705 | Bacteria | 12480 |
| 8 | JGI25156J39149_1001828 | 3300002705 | Bacteria | 8334 |
| 9 | JGI25156J39149_1003877 | 3300002705 | Bacteria | 4748 |
| 10 | JGI25157J39369_1000341 | 3300002741 | Bacteria | 33014 |
| 11 | JGI25165J46597_1001604 | 3300003214 | Bacteria | 10840 |
| 12 | rootH1_10013471 | 3300003316 | Bacteria | 2011 |
| 13 | rootH1_10013482 | 3300003316 | Bacteria | 2247 |
| 14 | rootH2_10025596 | 3300003320 | Bacteria | 5978 |
| 15 | rootL2_10000022 | 3300003322 | Bacteria | 23388 |
| 16 | rootL2_10032325 | 3300003322 | Bacteria | 2280 |
| 17 | rootL2_10143345 | 3300003322 | Bacteria | 2871 |
| 18 | rootH1_10003329 | 3300003323 | Bacteria | 20992 |
| 19 | rootH1_10035876 | 3300003323 | Bacteria | 3021 |
| 20 | rootH1_10049978 | 3300003323 | Bacteria | 4068 |
| 21 | Ga0055539_1000414 | 3300003752 | Bacteria | 16123 |
| 22 | Ga0055533_1000048 | 3300003756 | Bacteria | 212106 |
| 23 | Ga0055533_1000068 | 3300003756 | Bacteria | 155215 |
| 24 | Ga0055533_1000645 | 3300003756 | Bacteria | 11726 |
| 25 | Ga0055533_1005548 | 3300003756 | Bacteria | 2008 |
| 26 | Ga0055532_1000092 | 3300003758 | Bacteria | 103243 |
| 27 | Ga0055525_1000036 | 3300003759 | Bacteria | 298878 |
| 28 | Ga0055527_1000035 | 3300003760 | Bacteria | 138481 |
| 29 | Ga0055527_1000575 | 3300003760 | Bacteria | 11999 |
| 30 | Ga0055535_1000050 | 3300003761 | Bacteria | 138481 |
| 31 | Ga0055535_1000252 | 3300003761 | Bacteria | 56714 |
| 32 | Ga0055542_1000120 | 3300003762 | Bacteria | 103243 |
| 33 | Ga0055529_1000089 | 3300003763 | Bacteria | 138481 |
| 34 | Ga0055529_1000150 | 3300003763 | Bacteria | 99993 |
| 35 | Ga0055529_1000883 | 3300003763 | Bacteria | 17034 |
| 36 | Ga0055528_1001636 | 3300003790 | Bacteria | 13188 |
| 37 | Ga0055531_10011470 | 3300003794 | Bacteria | 4267 |
| 38 | Ga0058692_1009755 | 3300003856 | Bacteria | 2405 |
| 39 | Ga0065165_1000648 | 3300005262 | Bacteria | 50260 |
| 40 | Ga0070658_10005242 | 3300005327 | Bacteria | 10534 |
| 41 | Ga0070658_10018761 | 3300005327 | Bacteria | 5541 |
| 42 | Ga0070658_10077601 | 3300005327 | Bacteria | 2725 |
| 43 | Ga0070658_10125676 | 3300005327 | Bacteria | 2134 |
| 44 | Ga0070658_10135448 | 3300005327 | Bacteria | 2055 |
| 45 | Ga0070676_10005469 | 3300005328 | Bacteria | 6766 |
| 46 | Ga0070676_10008522 | 3300005328 | Bacteria | 5526 |
| 47 | Ga0070676_10012132 | 3300005328 | Bacteria | 4698 |
| 48 | Ga0070676_10014500 | 3300005328 | Bacteria | 4333 |
| 49 | Ga0070690_100067482 | 3300005330 | Bacteria | 2318 |
| 50 | Ga0070670_100008507 | 3300005331 | Bacteria | 8752 |
| 51 | Ga0070670_100038836 | 3300005331 | Bacteria | 4093 |
| 52 | Ga0070677_10030348 | 3300005333 | Bacteria | 2058 |
| 53 | Ga0068869_100003849 | 3300005334 | Bacteria | 9258 |
| 54 | Ga0068868_100004217 | 3300005338 | Bacteria | 10058 |
| 55 | Ga0068868_100008329 | 3300005338 | Bacteria | 7419 |
| 56 | Ga0068868_100101223 | 3300005338 | Bacteria | 2332 |
| 57 | Ga0070660_100000144 | 3300005339 | Bacteria | 45562 |
| 58 | Ga0070660_100011520 | 3300005339 | Bacteria | 6290 |
| 59 | Ga0070660_100011761 | 3300005339 | Bacteria | 6232 |
| 60 | Ga0070668_100016481 | 3300005347 | Bacteria | 5525 |
| 61 | Ga0070669_100010392 | 3300005353 | Bacteria | 6609 |
| 62 | Ga0070675_100000289 | 3300005354 | Bacteria | 33460 |
| 63 | Ga0070675_100002040 | 3300005354 | Bacteria | 14995 |
| 64 | Ga0070675_100002486 | 3300005354 | Bacteria | 13794 |
| 65 | Ga0070675_100081164 | 3300005354 | Bacteria | 2704 |
| 66 | Ga0070671_100000158 | 3300005355 | Bacteria | 44456 |
| 67 | Ga0070671_100001245 | 3300005355 | Bacteria | 19079 |
| 68 | Ga0070671_100038161 | 3300005355 | Bacteria | 3988 |
| 69 | Ga0070671_100068975 | 3300005355 | Bacteria | 2949 |
| 70 | Ga0070674_100004464 | 3300005356 | Bacteria | 7980 |
| 71 | Ga0070674_100020277 | 3300005356 | Bacteria | 4242 |
| 72 | Ga0070674_100034669 | 3300005356 | Bacteria | 3373 |
| 73 | Ga0070673_100014996 | 3300005364 | Bacteria | 5423 |
| 74 | Ga0070673_100056244 | 3300005364 | Bacteria | 3103 |
| 75 | Ga0070659_100000156 | 3300005366 | Bacteria | 52480 |
| 76 | Ga0070659_100016174 | 3300005366 | Bacteria | 5597 |
| 77 | Ga0070659_100020101 | 3300005366 | Bacteria | 5070 |
| 78 | Ga0070667_100007319 | 3300005367 | Bacteria | 9174 |
| 79 | Ga0070667_100014781 | 3300005367 | Bacteria | 6449 |
| 80 | Ga0070667_100025925 | 3300005367 | Bacteria | 4876 |
| 81 | Ga0070700_100041725 | 3300005441 | Bacteria | 2814 |
| 82 | Ga0070663_100007485 | 3300005455 | Bacteria | 6648 |
| 83 | Ga0070663_100009183 | 3300005455 | Bacteria | 6113 |
| 84 | Ga0070663_100011786 | 3300005455 | Bacteria | 5504 |
| 85 | Ga0070678_100030616 | 3300005456 | Bacteria | 3702 |
| 86 | Ga0070678_100074496 | 3300005456 | Bacteria | 2551 |
| 87 | Ga0070678_100222162 | 3300005456 | Bacteria | 1571 |
| 88 | Ga0070662_100005185 | 3300005457 | Bacteria | 8313 |
| 89 | Ga0070662_100010999 | 3300005457 | Bacteria | 5963 |
| 90 | Ga0070662_100035146 | 3300005457 | Bacteria | 3537 |
| 91 | Ga0068867_100016036 | 3300005459 | Bacteria | 5318 |
| 92 | Ga0068867_100074147 | 3300005459 | Bacteria | 2550 |
| 93 | Ga0070685_10014350 | 3300005466 | Bacteria | 4196 |
| 94 | Ga0070706_100000873 | 3300005467 | Bacteria | 33089 |
| 95 | Ga0070707_100047413 | 3300005468 | Bacteria | 4114 |
| 96 | Ga0070684_100259765 | 3300005535 | Bacteria | 1589 |
| 97 | Ga0068853_100028409 | 3300005539 | Bacteria | 4704 |
| 98 | Ga0068853_100155020 | 3300005539 | Bacteria | 2063 |
| 99 | Ga0070672_100001393 | 3300005543 | Bacteria | 14909 |
| 100 | Ga0070672_100007786 | 3300005543 | Bacteria | 7308 |
| 101 | Ga0070693_100015902 | 3300005547 | Bacteria | 3883 |
| 102 | Ga0070665_100000449 | 3300005548 | Bacteria | 59974 |
| 103 | Ga0068855_100002740 | 3300005563 | Bacteria | 21700 |
| 104 | Ga0068855_100004044 | 3300005563 | Bacteria | 17897 |
| 105 | Ga0068855_100013478 | 3300005563 | Bacteria | 9855 |
| 106 | Ga0068855_100018189 | 3300005563 | Bacteria | 8443 |
| 107 | Ga0068855_100070586 | 3300005563 | Bacteria | 4063 |
| 108 | Ga0070664_100058655 | 3300005564 | Bacteria | 3274 |
| 109 | Ga0070664_100078849 | 3300005564 | Bacteria | 2833 |
| 110 | Ga0068857_100030365 | 3300005577 | Bacteria | 4772 |
| 111 | Ga0068857_100211128 | 3300005577 | Bacteria | 1771 |
| 112 | Ga0068856_100003535 | 3300005614 | Bacteria | 15759 |
| 113 | Ga0068856_100046209 | 3300005614 | Bacteria | 4289 |
| 114 | Ga0068856_100105703 | 3300005614 | Bacteria | 2809 |
| 115 | Ga0068856_100161365 | 3300005614 | Bacteria | 2252 |
| 116 | Ga0068852_100005295 | 3300005616 | Bacteria | 9212 |
| 117 | Ga0068852_100008251 | 3300005616 | Bacteria | 7660 |
| 118 | Ga0068852_100037364 | 3300005616 | Bacteria | 4070 |
| 119 | Ga0068852_100037797 | 3300005616 | Bacteria | 4051 |
| 120 | Ga0068852_100088525 | 3300005616 | Bacteria | 2765 |
| 121 | Ga0068864_100001456 | 3300005618 | Bacteria | 19511 |
| 122 | Ga0068864_100005493 | 3300005618 | Bacteria | 10390 |
| 123 | Ga0068864_100026924 | 3300005618 | Bacteria | 4850 |
| 124 | Ga0068864_100032542 | 3300005618 | Bacteria | 4431 |
| 125 | Ga0068861_100001086 | 3300005719 | Bacteria | 16821 |
| 126 | Ga0068861_100056839 | 3300005719 | Bacteria | 2987 |
| 127 | Ga0068861_100110832 | 3300005719 | Bacteria | 2198 |
| 128 | Ga0068851_10009506 | 3300005834 | Bacteria | 4524 |
| 129 | Ga0068851_10035389 | 3300005834 | Bacteria | 2496 |
| 130 | Ga0068863_100002575 | 3300005841 | Bacteria | 17979 |
| 131 | Ga0068863_100030532 | 3300005841 | Bacteria | 5145 |
| 132 | Ga0068863_100080377 | 3300005841 | Bacteria | 3087 |
| 133 | Ga0068858_100000259 | 3300005842 | Bacteria | 56570 |
| 134 | Ga0068858_100005411 | 3300005842 | Bacteria | 12510 |
| 135 | Ga0068858_100039138 | 3300005842 | Bacteria | 4398 |
| 136 | Ga0068858_100065389 | 3300005842 | Bacteria | 3365 |
| 137 | Ga0068860_100011221 | 3300005843 | Bacteria | 8831 |
| 138 | Ga0068860_100178984 | 3300005843 | Bacteria | 2050 |
| 139 | Ga0068862_100024393 | 3300005844 | Bacteria | 5074 |
| 140 | Ga0075368_10056181 | 3300006042 | Bacteria | 1570 |
| 141 | Ga0075367_10023384 | 3300006178 | Bacteria | 3476 |
| 142 | Ga0075366_10050472 | 3300006195 | Bacteria | 2470 |
| 143 | Ga0097621_100027144 | 3300006237 | Bacteria | 4499 |
| 144 | Ga0097621_100084226 | 3300006237 | Bacteria | 2650 |
| 145 | Ga0097621_100127022 | 3300006237 | Bacteria | 2167 |
| 146 | Ga0075370_10002167 | 3300006353 | Bacteria | 8999 |
| 147 | Ga0068871_100003953 | 3300006358 | Bacteria | 10231 |
| 148 | Ga0068871_100009997 | 3300006358 | Bacteria | 6896 |
| 149 | Ga0068871_100013951 | 3300006358 | Bacteria | 5975 |
| 150 | Ga0068865_100020199 | 3300006881 | Bacteria | 4319 |
| 151 | Ga0099823_1000003 | 3300006944 | Bacteria | 189058 |
| 152 | Ga0105251_10000758 | 3300009011 | Bacteria | 29449 |
| 153 | Ga0105251_10001262 | 3300009011 | Bacteria | 21860 |
| 154 | Ga0105240_10001922 | 3300009093 | Bacteria | 34528 |
| 155 | Ga0105240_10029364 | 3300009093 | Bacteria | 7165 |
| 156 | Ga0105240_10031832 | 3300009093 | Bacteria | 6834 |
| 157 | Ga0105240_10121643 | 3300009093 | Bacteria | 3142 |
| 158 | Ga0105240_10128415 | 3300009093 | Bacteria | 3043 |
| 159 | Ga0105240_10156360 | 3300009093 | Bacteria | 2711 |
| 160 | Ga0105240_10226800 | 3300009093 | Bacteria | 2173 |
| 161 | Ga0105245_10020932 | 3300009098 | Bacteria | 5734 |
| 162 | Ga0105245_10108902 | 3300009098 | Bacteria | 2574 |
| 163 | Ga0105243_10050239 | 3300009148 | Bacteria | 3294 |
| 164 | Ga0105241_10047670 | 3300009174 | Bacteria | 3259 |
| 165 | Ga0105242_10022980 | 3300009176 | Bacteria | 4912 |
| 166 | Ga0105242_10034621 | 3300009176 | Bacteria | 4049 |
| 167 | Ga0105248_10001469 | 3300009177 | Bacteria | 26234 |
| 168 | Ga0105248_10007710 | 3300009177 | Bacteria | 11822 |
| 169 | Ga0105248_10014364 | 3300009177 | Bacteria | 8714 |
| 170 | Ga0105248_10033206 | 3300009177 | Bacteria | 5764 |
| 171 | Ga0105248_10041858 | 3300009177 | Bacteria | 5136 |
| 172 | Ga0105248_10063036 | 3300009177 | Bacteria | 4160 |
| 173 | Ga0105248_10178667 | 3300009177 | Bacteria | 2392 |
| 174 | Ga0105237_10021860 | 3300009545 | Bacteria | 6571 |
| 175 | Ga0105237_10406141 | 3300009545 | Bacteria | 1367 |
| 176 | Ga0105238_10003750 | 3300009551 | Bacteria | 15099 |
| 177 | Ga0105238_10030242 | 3300009551 | Bacteria | 5512 |
| 178 | Ga0105238_10031327 | 3300009551 | Bacteria | 5413 |
| 179 | Ga0105238_10108170 | 3300009551 | Bacteria | 2761 |
| 180 | Ga0105238_10149896 | 3300009551 | Bacteria | 2307 |
| 181 | Ga0105249_10031828 | 3300009553 | Bacteria | 4772 |
| 182 | Ga0105239_10003468 | 3300010375 | Bacteria | 19297 |
| 183 | Ga0105239_10094132 | 3300010375 | Bacteria | 3309 |
| 184 | Ga0157371_10008450 | 3300013102 | Bacteria | 8197 |
| 185 | Ga0157370_10000439 | 3300013104 | Bacteria | 51955 |
| 186 | Ga0157370_10002253 | 3300013104 | Bacteria | 23432 |
| 187 | Ga0157369_10000410 | 3300013105 | Bacteria | 56813 |
| 188 | Ga0157369_10001007 | 3300013105 | Bacteria | 35470 |
| 189 | Ga0157369_10002529 | 3300013105 | Bacteria | 21858 |
| 190 | Ga0157369_10157497 | 3300013105 | Bacteria | 2398 |
| 191 | Ga0157374_10000146 | 3300013296 | Bacteria | 64549 |
| 192 | Ga0157374_10002254 | 3300013296 | Bacteria | 16245 |
| 193 | Ga0157374_10108736 | 3300013296 | Bacteria | 2665 |
| 194 | Ga0157374_10361070 | 3300013296 | Bacteria | 1444 |
| 195 | Ga0157378_10133474 | 3300013297 | Bacteria | 2300 |
| 196 | Ga0163162_10000877 | 3300013306 | Bacteria | 28017 |
| 197 | Ga0163162_10051354 | 3300013306 | Bacteria | 4138 |
| 198 | Ga0157372_10000323 | 3300013307 | Bacteria | 52602 |
| 199 | Ga0157372_10013139 | 3300013307 | Bacteria | 8834 |
| 200 | Ga0157375_10002349 | 3300013308 | Bacteria | 16343 |
| 201 | Ga0157375_10029847 | 3300013308 | Bacteria | 5133 |
| 202 | Ga0157375_10030968 | 3300013308 | Bacteria | 5050 |
| 203 | Ga0163163_10001655 | 3300014325 | Bacteria | 18774 |
| 204 | Ga0157380_10175014 | 3300014326 | Bacteria | 1879 |
| 205 | Ga0157379_10010791 | 3300014968 | Bacteria | 7963 |
| 206 | Ga0157379_10021975 | 3300014968 | Bacteria | 5653 |
| 207 | Ga0157379_10191344 | 3300014968 | Bacteria | 1849 |
| 208 | Ga0157376_10007994 | 3300014969 | Bacteria | 7592 |
| 209 | Ga0157376_10010441 | 3300014969 | Bacteria | 6793 |
| 210 | Ga0182007_10003995 | 3300015262 | Bacteria | 6804 |
| 211 | Ga0182005_1030737 | 3300015265 | Bacteria | 1463 |
| 212 | Ga0183361_10015 | 3300016635 | Bacteria | 166772 |
| 213 | Ga0163161_10006231 | 3300017792 | Bacteria | 8264 |
| 214 | Ga0213872_10000021 | 3300021361 | Bacteria | 158749 |
| 215 | Ga0213872_10000022 | 3300021361 | Bacteria | 158011 |
| 216 | Ga0209566_101192 | 3300025225 | Bacteria | 9260 |
| 217 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 218 | Ga0209674_100153 | 3300025226 | Bacteria | 94333 |
| 219 | Ga0209674_100671 | 3300025226 | Bacteria | 12214 |
| 220 | Ga0209672_100054 | 3300025228 | Bacteria | 222217 |
| 221 | Ga0209672_100072 | 3300025228 | Bacteria | 167942 |
| 222 | Ga0209672_100073 | 3300025228 | Bacteria | 166621 |
| 223 | Ga0209672_100185 | 3300025228 | Bacteria | 50385 |
| 224 | Ga0209147_100085 | 3300025229 | Bacteria | 185813 |
| 225 | Ga0209147_100093 | 3300025229 | Bacteria | 167196 |
| 226 | Ga0209147_100100 | 3300025229 | Bacteria | 162747 |
| 227 | Ga0209147_100278 | 3300025229 | Bacteria | 44611 |
| 228 | Ga0209563_100101 | 3300025230 | Bacteria | 152297 |
| 229 | Ga0207427_100866 | 3300025231 | Bacteria | 13407 |
| 230 | Ga0209258_100080 | 3300025242 | Bacteria | 255287 |
| 231 | Ga0209258_100140 | 3300025242 | Bacteria | 167245 |
| 232 | Ga0209258_100168 | 3300025242 | Bacteria | 145329 |
| 233 | Ga0209258_100331 | 3300025242 | Bacteria | 71624 |
| 234 | Ga0209258_101186 | 3300025242 | Bacteria | 10492 |
| 235 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 236 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 237 | Ga0209677_100091 | 3300025253 | Bacteria | 106743 |
| 238 | Ga0209677_100150 | 3300025253 | Bacteria | 64346 |
| 239 | Ga0209677_100509 | 3300025253 | Bacteria | 21760 |
| 240 | Ga0209148_1000140 | 3300025254 | Bacteria | 166819 |
| 241 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 242 | Ga0209759_1000067 | 3300025256 | Bacteria | 183764 |
| 243 | Ga0209759_1000195 | 3300025256 | Bacteria | 96092 |
| 244 | Ga0209759_1000329 | 3300025256 | Bacteria | 62253 |
| 245 | Ga0209759_1000351 | 3300025256 | Bacteria | 59891 |
| 246 | Ga0209759_1000827 | 3300025256 | Bacteria | 24481 |
| 247 | Ga0209759_1000945 | 3300025256 | Bacteria | 20847 |
| 248 | Ga0209759_1013933 | 3300025256 | Bacteria | 2151 |
| 249 | Ga0209759_1014092 | 3300025256 | Bacteria | 2132 |
| 250 | Ga0209233_1000173 | 3300025261 | Bacteria | 145995 |
| 251 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 252 | Ga0209455_1000125 | 3300025272 | Bacteria | 166819 |
| 253 | Ga0209455_1000279 | 3300025272 | Bacteria | 55567 |
| 254 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 255 | Ga0209673_1022252 | 3300025273 | Bacteria | 2192 |
| 256 | Ga0209564_1010959 | 3300025295 | Bacteria | 4114 |
| 257 | Ga0209050_1003447 | 3300025298 | Bacteria | 11647 |
| 258 | Ga0209256_1001730 | 3300025299 | Bacteria | 20913 |
| 259 | Ga0207426_1000199 | 3300025302 | Bacteria | 145826 |
| 260 | Ga0209051_1004239 | 3300025303 | Bacteria | 8937 |
| 261 | Ga0209257_1013559 | 3300025304 | Bacteria | 3608 |
| 262 | Ga0207656_10005850 | 3300025321 | Bacteria | 4382 |
| 263 | Ga0207656_10007084 | 3300025321 | Bacteria | 4072 |
| 264 | Ga0207656_10018683 | 3300025321 | Bacteria | 2732 |
| 265 | Ga0207713_1000186 | 3300025735 | Bacteria | 87336 |
| 266 | Ga0207713_1026239 | 3300025735 | Bacteria | 2674 |
| 267 | Ga0207682_10004849 | 3300025893 | Bacteria | 5565 |
| 268 | Ga0207688_10008118 | 3300025901 | Bacteria | 5706 |
| 269 | Ga0207688_10008981 | 3300025901 | Bacteria | 5441 |
| 270 | Ga0207680_10028032 | 3300025903 | Bacteria | 3145 |
| 271 | Ga0207647_10000126 | 3300025904 | Bacteria | 59628 |
| 272 | Ga0207647_10002464 | 3300025904 | Bacteria | 14022 |
| 273 | Ga0207647_10003041 | 3300025904 | Bacteria | 12605 |
| 274 | Ga0207647_10021302 | 3300025904 | Bacteria | 4329 |
| 275 | Ga0207647_10030780 | 3300025904 | Bacteria | 3459 |
| 276 | Ga0207645_10010523 | 3300025907 | Bacteria | 6353 |
| 277 | Ga0207645_10017533 | 3300025907 | Bacteria | 4723 |
| 278 | Ga0207645_10130543 | 3300025907 | Bacteria | 1635 |
| 279 | Ga0207705_10000841 | 3300025909 | Bacteria | 25146 |
| 280 | Ga0207705_10061699 | 3300025909 | Bacteria | 2708 |
| 281 | Ga0207705_10162409 | 3300025909 | Bacteria | 1679 |
| 282 | Ga0207684_10006340 | 3300025910 | Bacteria | 10788 |
| 283 | Ga0207695_10000971 | 3300025913 | Bacteria | 51107 |
| 284 | Ga0207695_10004600 | 3300025913 | Bacteria | 18738 |
| 285 | Ga0207695_10005877 | 3300025913 | Bacteria | 16101 |
| 286 | Ga0207695_10224610 | 3300025913 | Bacteria | 1784 |
| 287 | Ga0207671_10009292 | 3300025914 | Bacteria | 8233 |
| 288 | Ga0207657_10000096 | 3300025919 | Bacteria | 85043 |
| 289 | Ga0207657_10011541 | 3300025919 | Bacteria | 8770 |
| 290 | Ga0207657_10017325 | 3300025919 | Bacteria | 6911 |
| 291 | Ga0207657_10025683 | 3300025919 | Bacteria | 5427 |
| 292 | Ga0207657_10058343 | 3300025919 | Bacteria | 3322 |
| 293 | Ga0207681_10001527 | 3300025923 | Bacteria | 14917 |
| 294 | Ga0207681_10047020 | 3300025923 | Bacteria | 2904 |
| 295 | Ga0207694_10046481 | 3300025924 | Bacteria | 3355 |
| 296 | Ga0207650_10015466 | 3300025925 | Bacteria | 5314 |
| 297 | Ga0207659_10003345 | 3300025926 | Bacteria | 9615 |
| 298 | Ga0207659_10008152 | 3300025926 | Bacteria | 6485 |
| 299 | Ga0207687_10011763 | 3300025927 | Bacteria | 5726 |
| 300 | Ga0207644_10000042 | 3300025931 | Bacteria | 112685 |
| 301 | Ga0207644_10002231 | 3300025931 | Bacteria | 12574 |
| 302 | Ga0207644_10030996 | 3300025931 | Bacteria | 3724 |
| 303 | Ga0207690_10000074 | 3300025932 | Bacteria | 87516 |
| 304 | Ga0207690_10004028 | 3300025932 | Bacteria | 8678 |
| 305 | Ga0207690_10019260 | 3300025932 | Bacteria | 4199 |
| 306 | Ga0207690_10156025 | 3300025932 | Bacteria | 1697 |
| 307 | Ga0207706_10005846 | 3300025933 | Bacteria | 11439 |
| 308 | Ga0207686_10029246 | 3300025934 | Bacteria | 3248 |
| 309 | Ga0207709_10027645 | 3300025935 | Bacteria | 3271 |
| 310 | Ga0207709_10080988 | 3300025935 | Bacteria | 2092 |
| 311 | Ga0207669_10096940 | 3300025937 | Bacteria | 1937 |
| 312 | Ga0207669_10117912 | 3300025937 | Bacteria | 1795 |
| 313 | Ga0207691_10018985 | 3300025940 | Bacteria | 6512 |
| 314 | Ga0207691_10088071 | 3300025940 | Bacteria | 2784 |
| 315 | Ga0207691_10128212 | 3300025940 | Bacteria | 2243 |
| 316 | Ga0207711_10004500 | 3300025941 | Bacteria | 11878 |
| 317 | Ga0207711_10011271 | 3300025941 | Bacteria | 7429 |
| 318 | Ga0207711_10019217 | 3300025941 | Bacteria | 5689 |
| 319 | Ga0207711_10039974 | 3300025941 | Bacteria | 3989 |
| 320 | Ga0207711_10094057 | 3300025941 | Bacteria | 2641 |
| 321 | Ga0207711_10134976 | 3300025941 | Bacteria | 2216 |
| 322 | Ga0207689_10002702 | 3300025942 | Bacteria | 16400 |
| 323 | Ga0207689_10016959 | 3300025942 | Bacteria | 6162 |
| 324 | Ga0207661_10214939 | 3300025944 | Bacteria | 1696 |
| 325 | Ga0207679_10061937 | 3300025945 | Bacteria | 2786 |
| 326 | Ga0207679_10082688 | 3300025945 | Bacteria | 2459 |
| 327 | Ga0207679_10114038 | 3300025945 | Bacteria | 2139 |
| 328 | Ga0207679_10127450 | 3300025945 | Bacteria | 2036 |
| 329 | Ga0207667_10011603 | 3300025949 | Bacteria | 10230 |
| 330 | Ga0207667_10014189 | 3300025949 | Bacteria | 9092 |
| 331 | Ga0207667_10018190 | 3300025949 | Bacteria | 7888 |
| 332 | Ga0207667_10047603 | 3300025949 | Bacteria | 4538 |
| 333 | Ga0207667_10074256 | 3300025949 | Bacteria | 3532 |
| 334 | Ga0207667_10091752 | 3300025949 | Bacteria | 3137 |
| 335 | Ga0207651_10002012 | 3300025960 | Bacteria | 9558 |
| 336 | Ga0207651_10010282 | 3300025960 | Bacteria | 5177 |
| 337 | Ga0207712_10016735 | 3300025961 | Bacteria | 4754 |
| 338 | Ga0207668_10086755 | 3300025972 | Bacteria | 2287 |
| 339 | Ga0207658_10016870 | 3300025986 | Bacteria | 5026 |
| 340 | Ga0207658_10042895 | 3300025986 | Bacteria | 3285 |
| 341 | Ga0207658_10043516 | 3300025986 | Bacteria | 3264 |
| 342 | Ga0207677_10000498 | 3300026023 | Bacteria | 25465 |
| 343 | Ga0207677_10004687 | 3300026023 | Bacteria | 7367 |
| 344 | Ga0207703_10001748 | 3300026035 | Bacteria | 19439 |
| 345 | Ga0207703_10026640 | 3300026035 | Bacteria | 4552 |
| 346 | Ga0207703_10189629 | 3300026035 | Bacteria | 1820 |
| 347 | Ga0207639_10006612 | 3300026041 | Bacteria | 7884 |
| 348 | Ga0207678_10000061 | 3300026067 | Bacteria | 85413 |
| 349 | Ga0207678_10077473 | 3300026067 | Bacteria | 2847 |
| 350 | Ga0207708_10061685 | 3300026075 | Bacteria | 2863 |
| 351 | Ga0207708_10081018 | 3300026075 | Bacteria | 2494 |
| 352 | Ga0207702_10001911 | 3300026078 | Bacteria | 20342 |
| 353 | Ga0207641_10002258 | 3300026088 | Bacteria | 17958 |
| 354 | Ga0207641_10009577 | 3300026088 | Bacteria | 7981 |
| 355 | Ga0207641_10031693 | 3300026088 | Bacteria | 4385 |
| 356 | Ga0207641_10081318 | 3300026088 | Bacteria | 2813 |
| 357 | Ga0207648_10011019 | 3300026089 | Bacteria | 8536 |
| 358 | Ga0207648_10072782 | 3300026089 | Bacteria | 2995 |
| 359 | Ga0207648_10189421 | 3300026089 | Bacteria | 1822 |
| 360 | Ga0207648_10209599 | 3300026089 | Bacteria | 1729 |
| 361 | Ga0207648_10234408 | 3300026089 | Bacteria | 1633 |
| 362 | Ga0207676_10000660 | 3300026095 | Bacteria | 27633 |
| 363 | Ga0207676_10010869 | 3300026095 | Bacteria | 6493 |
| 364 | Ga0207676_10036534 | 3300026095 | Bacteria | 3738 |
| 365 | Ga0207676_10145429 | 3300026095 | Bacteria | 2035 |
| 366 | Ga0207674_10024284 | 3300026116 | Bacteria | 6480 |
| 367 | Ga0207674_10049178 | 3300026116 | Bacteria | 4314 |
| 368 | Ga0207675_100003111 | 3300026118 | Bacteria | 16274 |
| 369 | Ga0207675_100003717 | 3300026118 | Bacteria | 14862 |
| 370 | Ga0207675_100082236 | 3300026118 | Bacteria | 3020 |
| 371 | Ga0207683_10003870 | 3300026121 | Bacteria | 12982 |
| 372 | Ga0207683_10029618 | 3300026121 | Bacteria | 4740 |
| 373 | Ga0207683_10072943 | 3300026121 | Bacteria | 3036 |
| 374 | Ga0207698_10014920 | 3300026142 | Bacteria | 5184 |
| 375 | Ga0207698_10021499 | 3300026142 | Bacteria | 4464 |
| 376 | Ga0209371_1000141 | 3300027312 | Bacteria | 118767 |
| 377 | Ga0209371_1001782 | 3300027312 | Bacteria | 13499 |
| 378 | Ga0209970_1000308 | 3300027614 | Bacteria | 8052 |
| 379 | Ga0268266_10000110 | 3300028379 | Bacteria | 171840 |
| 380 | Ga0268265_10015132 | 3300028380 | Bacteria | 5272 |
| 381 | Ga0268264_10035103 | 3300028381 | Bacteria | 4128 |
| 382 | Ga0268264_10038718 | 3300028381 | Bacteria | 3936 |
| 383 | Ga0268264_10278296 | 3300028381 | Bacteria | 1566 |
| 384 | Ga0265336_10000030 | 3300028666 | Bacteria | 169335 |
| 385 | Ga0307517_10068391 | 3300028786 | Bacteria | 3237 |
| 386 | Ga0307515_10006245 | 3300028794 | Bacteria | 23915 |
| 387 | Ga0265338_10000547 | 3300028800 | Bacteria | 65836 |
| 388 | Ga0265324_10001751 | 3300029957 | Bacteria | 11936 |
| 389 | Ga0268256_1000418 | 3300030500 | Bacteria | 38424 |
| 390 | Ga0268256_1006262 | 3300030500 | Bacteria | 4461 |
| 391 | Ga0265316_10064767 | 3300031344 | Bacteria | 2831 |
| 392 | Ga0307408_100000422 | 3300031548 | Bacteria | 38013 |
| 393 | Ga0307408_100182314 | 3300031548 | Bacteria | 1685 |
| 394 | Ga0265313_10028117 | 3300031595 | Bacteria | 2929 |
| 395 | Ga0307516_10004112 | 3300031730 | Bacteria | 18151 |
| 396 | Ga0307516_10036065 | 3300031730 | Bacteria | 4953 |
| 397 | Ga0307405_10005333 | 3300031731 | Bacteria | 6190 |
| 398 | Ga0307405_10017781 | 3300031731 | Bacteria | 3909 |
| 399 | Ga0307412_10000056 | 3300031911 | Bacteria | 145861 |
| 400 | Ga0307409_100021088 | 3300031995 | Bacteria | 4459 |
| 401 | Ga0307416_100006410 | 3300032002 | Bacteria | 7365 |
| 402 | Ga0307416_100008384 | 3300032002 | Bacteria | 6663 |
| 403 | Ga0307416_100165379 | 3300032002 | Bacteria | 2051 |
| 404 | Ga0307414_10092059 | 3300032004 | Bacteria | 2255 |
| 405 | Ga0307411_10062805 | 3300032005 | Bacteria | 2479 |
| 406 | Ga0307411_10133060 | 3300032005 | Bacteria | 1821 |
| 407 | Ga0373931_0008624 | 3300035691 | Bacteria | 4844 |
| 408 | Ga0373931_0012132 | 3300035691 | Bacteria | 4171 |
| 409 | Ga0373937_0314291 | 3300036401 | Bacteria | 1482 |
| 410 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 411 | Ga0395899_0122248 | 3300037312 | Bacteria | 1863 |
| 412 | Ga0395899_0167878 | 3300037312 | Bacteria | 1547 |
| 413 | Ga0395899_0248320 | 3300037312 | Bacteria | 1222 |
| 414 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 415 | Ga0395900_0000673 | 3300037418 | Bacteria | 45477 |
| 416 | Ga0395900_0102356 | 3300037418 | Bacteria | 2942 |
| 417 | Ga0395900_0103296 | 3300037418 | Bacteria | 2927 |
| 418 | Ga0395900_0114951 | 3300037418 | Bacteria | 2762 |
| 419 | Ga0395898_0000559 | 3300037466 | Bacteria | 69751 |
| 420 | Ga0395898_0000679 | 3300037466 | Bacteria | 61481 |
| 421 | Ga0395898_0009374 | 3300037466 | Bacteria | 10283 |
| 422 | Ga0395898_0091789 | 3300037466 | Bacteria | 2921 |
| 423 | Ga0395905_0000166 | 3300037471 | Bacteria | 108507 |
| 424 | Ga0395905_0018424 | 3300037471 | Bacteria | 6626 |
| 425 | Ga0395905_0084927 | 3300037471 | Bacteria | 2966 |
| 426 | Ga0395901_0000053 | 3300038443 | Bacteria | 163807 |
| 427 | Ga0395901_0000771 | 3300038443 | Bacteria | 35916 |
| 428 | Ga0395901_0001663 | 3300038443 | Bacteria | 22943 |
| 429 | Ga0395901_0088474 | 3300038443 | Bacteria | 3239 |
| 430 | Ga0436365_1429793 | 3300039437 | Bacteria | 6961 |
| 431 | Ga0436361_0354255 | 3300039447 | Bacteria | 247479 |
| 432 | Ga0436361_0422241 | 3300039447 | Bacteria | 4417 |
| 433 | Ga0436361_0446381 | 3300039447 | Bacteria | 3192 |
| 434 | Ga0436361_0563595 | 3300039447 | Bacteria | 5414 |
| 435 | Ga0436361_0675000 | 3300039447 | Bacteria | 73288 |
| 436 | Ga0436361_0974052 | 3300039447 | Bacteria | 7812 |
| 437 | Ga0439448_0000429 | 3300042005 | Bacteria | 9645 |
| 438 | Ga0439464_0007495 | 3300042439 | Bacteria | 2854 |
| 439 | Ga0466969_0000023 | 3300044656 | Bacteria | 97322 |
| 440 | Ga0466969_0000833 | 3300044656 | Bacteria | 16765 |
| 441 | Ga0466969_0002590 | 3300044656 | Bacteria | 9660 |
| 442 | Ga0466969_0003181 | 3300044656 | Bacteria | 8752 |
| 443 | Ga0466969_0008844 | 3300044656 | Bacteria | 5341 |
| 444 | Ga0466969_0036269 | 3300044656 | Bacteria | 2491 |
| 445 | Ga0466972_0003681 | 3300044658 | Bacteria | 7625 |
| 446 | Ga0466972_0033238 | 3300044658 | Bacteria | 2530 |
| 447 | Ga0466977_0056070 | 3300044666 | Bacteria | 2583 |
| 448 | Ga0466965_0002202 | 3300044683 | Bacteria | 8202 |
| 449 | Ga0466965_0005911 | 3300044683 | Bacteria | 5526 |
| 450 | Ga0466965_0034444 | 3300044683 | Bacteria | 2477 |
| 451 | Ga0466966_0000058 | 3300044684 | Bacteria | 81196 |
| 452 | Ga0466966_0000731 | 3300044684 | Bacteria | 20893 |
| 453 | Ga0466966_0002025 | 3300044684 | Bacteria | 13155 |
| 454 | Ga0466966_0002795 | 3300044684 | Bacteria | 11476 |
| 455 | Ga0466966_0005527 | 3300044684 | Bacteria | 8303 |
| 456 | Ga0466966_0085575 | 3300044684 | Bacteria | 1960 |
| 457 | Ga0466966_0113788 | 3300044684 | Bacteria | 1666 |
| 458 | Ga0466961_0000204 | 3300044693 | Bacteria | 39748 |
| 459 | Ga0466961_0000224 | 3300044693 | Bacteria | 38254 |
| 460 | Ga0466961_0005061 | 3300044693 | Bacteria | 8292 |
| 461 | Ga0466961_0013426 | 3300044693 | Bacteria | 5245 |
| 462 | Ga0466961_0023727 | 3300044693 | Bacteria | 3947 |
| 463 | Ga0466961_0094159 | 3300044693 | Bacteria | 1890 |
| 464 | Ga0466963_0013557 | 3300044694 | Bacteria | 5005 |
| 465 | Ga0466963_0018734 | 3300044694 | Bacteria | 4333 |
| 466 | Ga0466964_0001232 | 3300044706 | Bacteria | 8681 |
| 467 | Ga0466964_0017955 | 3300044706 | Bacteria | 2711 |
| 468 | Ga0466971_0001186 | 3300044719 | Bacteria | 10818 |
| 469 | Ga0466971_0001200 | 3300044719 | Bacteria | 10766 |
| 470 | Ga0466971_0006019 | 3300044719 | Bacteria | 5279 |
| 471 | Ga0466971_0026068 | 3300044719 | Bacteria | 2611 |
| 472 | Ga0466968_0027880 | 3300044735 | Bacteria | 2326 |
| 473 | Ga0466970_0001740 | 3300044765 | Bacteria | 10497 |
| 474 | Ga0466970_0026559 | 3300044765 | Bacteria | 3034 |
| 475 | Ga0466957_0000379 | 3300044842 | Bacteria | 21768 |
| 476 | Ga0466957_0000621 | 3300044842 | Bacteria | 17927 |
| 477 | Ga0466957_0008986 | 3300044842 | Bacteria | 5695 |
| 478 | Ga0466957_0022364 | 3300044842 | Bacteria | 3731 |
| 479 | Ga0466957_0022783 | 3300044842 | Bacteria | 3698 |
| 480 | Ga0466957_0024748 | 3300044842 | Bacteria | 3555 |
| 481 | Ga0466957_0036373 | 3300044842 | Bacteria | 2960 |
| 482 | Ga0466957_0083559 | 3300044842 | Bacteria | 1992 |
| 483 | Ga0466960_0011631 | 3300044901 | Bacteria | 3690 |
| 484 | Ga0466959_0003971 | 3300045049 | Bacteria | 9831 |
| 485 | Ga0466959_0005343 | 3300045049 | Bacteria | 8786 |
| 486 | Ga0466959_0007366 | 3300045049 | Bacteria | 7716 |
| 487 | Ga0466959_0014968 | 3300045049 | Bacteria | 5652 |
| 488 | Ga0466959_0058527 | 3300045049 | Bacteria | 2806 |
| 489 | Ga0466959_0080235 | 3300045049 | Bacteria | 2352 |
| 490 | Ga0466959_0095375 | 3300045049 | Bacteria | 2133 |
| 491 | Ga0451576_0131415 | 3300045051 | Bacteria | 2610 |
| 492 | Ga0451576_0363745 | 3300045051 | Bacteria | 1515 |
| 493 | Ga0466958_0003077 | 3300045836 | Bacteria | 8556 |
| 494 | Ga0466958_0013227 | 3300045836 | Bacteria | 4694 |
| 495 | Ga0466958_0017979 | 3300045836 | Bacteria | 4097 |
| 496 | Ga0466958_0047061 | 3300045836 | Bacteria | 2603 |
| 497 | Ga0495592_0005182 | 3300046454 | Bacteria | 9610 |
| 498 | Ga0495592_0009220 | 3300046454 | Bacteria | 7424 |
| 499 | Ga0495603_0006083 | 3300046455 | Bacteria | 7214 |
| 500 | Ga0495603_0031509 | 3300046455 | Bacteria | 3192 |
| 501 | Ga0495590_0003243 | 3300046457 | Bacteria | 6651 |
| 502 | Ga0495590_0005892 | 3300046457 | Bacteria | 4811 |
| 503 | Ga0495590_0018895 | 3300046457 | Bacteria | 2461 |
| 504 | Ga0495590_0021494 | 3300046457 | Bacteria | 2286 |
| 505 | Ga0495629_0000052 | 3300046459 | Bacteria | 106578 |
| 506 | Ga0495629_0000162 | 3300046459 | Bacteria | 58860 |
| 507 | Ga0495629_0000625 | 3300046459 | Bacteria | 28762 |
| 508 | Ga0495629_0006110 | 3300046459 | Bacteria | 8951 |
| 509 | Ga0495629_0006585 | 3300046459 | Bacteria | 8603 |
| 510 | Ga0495638_0000875 | 3300046460 | Bacteria | 31213 |
| 511 | Ga0495638_0011363 | 3300046460 | Bacteria | 6136 |
| 512 | Ga0495641_0015103 | 3300046461 | Bacteria | 4145 |
| 513 | Ga0495651_0013319 | 3300046462 | Bacteria | 6361 |
| 514 | Ga0495651_0028962 | 3300046462 | Bacteria | 4319 |
| 515 | Ga0495653_0001943 | 3300046463 | Bacteria | 16253 |
| 516 | Ga0495653_0003345 | 3300046463 | Bacteria | 12886 |
| 517 | Ga0495653_0012493 | 3300046463 | Bacteria | 6934 |
| 518 | Ga0495653_0104553 | 3300046463 | Bacteria | 2046 |
| 519 | Ga0495650_0001711 | 3300046471 | Bacteria | 20137 |
| 520 | Ga0495650_0006659 | 3300046471 | Bacteria | 7161 |
| 521 | Ga0495650_0010974 | 3300046471 | Bacteria | 5010 |
| 522 | Ga0495650_0012488 | 3300046471 | Bacteria | 4566 |
| 523 | Ga0495650_0037866 | 3300046471 | Bacteria | 2094 |
| 524 | Ga0495650_0054965 | 3300046471 | Bacteria | 1622 |
| 525 | Ga0495580_0001573 | 3300046472 | Bacteria | 20072 |
| 526 | Ga0495580_0004723 | 3300046472 | Bacteria | 11417 |
| 527 | Ga0495580_0008529 | 3300046472 | Bacteria | 8139 |
| 528 | Ga0495580_0009825 | 3300046472 | Bacteria | 7503 |
| 529 | Ga0495580_0011040 | 3300046472 | Bacteria | 7001 |
| 530 | Ga0495580_0183263 | 3300046472 | Bacteria | 1445 |
| 531 | Ga0495582_0018014 | 3300046473 | Bacteria | 3862 |
| 532 | Ga0495582_0036915 | 3300046473 | Bacteria | 2688 |
| 533 | Ga0495605_0009236 | 3300046474 | Bacteria | 5540 |
| 534 | Ga0495605_0013347 | 3300046474 | Bacteria | 4530 |
| 535 | Ga0495605_0018915 | 3300046474 | Bacteria | 3687 |
| 536 | Ga0495605_0022628 | 3300046474 | Bacteria | 3316 |
| 537 | Ga0495605_0034044 | 3300046474 | Bacteria | 2582 |
| 538 | Ga0495639_0027429 | 3300046475 | Bacteria | 2521 |
| 539 | Ga0495664_0014580 | 3300046477 | Bacteria | 4458 |
| 540 | Ga0495664_0040265 | 3300046477 | Bacteria | 2762 |
| 541 | Ga0495585_0037697 | 3300046492 | Bacteria | 2722 |
| 542 | Ga0495585_0041066 | 3300046492 | Bacteria | 2595 |
| 543 | Ga0495596_0001981 | 3300046500 | Bacteria | 11294 |
| 544 | Ga0495596_0008448 | 3300046500 | Bacteria | 4581 |
| 545 | Ga0495596_0011681 | 3300046500 | Bacteria | 3777 |
| 546 | Ga0495596_0020553 | 3300046500 | Bacteria | 2702 |
| 547 | Ga0495607_0021514 | 3300046501 | Bacteria | 4057 |
| 548 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 549 | Ga0495583_0004759 | 3300046506 | Bacteria | 9536 |
| 550 | Ga0495583_0006177 | 3300046506 | Bacteria | 7886 |
| 551 | Ga0495606_0001504 | 3300046507 | Bacteria | 30980 |
| 552 | Ga0495606_0009474 | 3300046507 | Bacteria | 8234 |
| 553 | Ga0495606_0012297 | 3300046507 | Bacteria | 6884 |
| 554 | Ga0495606_0020562 | 3300046507 | Bacteria | 4861 |
| 555 | Ga0495606_0049375 | 3300046507 | Bacteria | 2760 |
| 556 | Ga0495606_0100766 | 3300046507 | Bacteria | 1758 |
| 557 | Ga0495608_0002463 | 3300046511 | Bacteria | 13294 |
| 558 | Ga0495608_0002588 | 3300046511 | Bacteria | 12995 |
| 559 | Ga0495616_0015844 | 3300046513 | Bacteria | 4181 |
| 560 | Ga0495620_0033951 | 3300046515 | Bacteria | 2310 |
| 561 | Ga0495628_0005506 | 3300046516 | Bacteria | 11082 |
| 562 | Ga0495628_0043834 | 3300046516 | Bacteria | 3561 |
| 563 | Ga0495630_0008386 | 3300046517 | Bacteria | 7412 |
| 564 | Ga0495630_0092137 | 3300046517 | Bacteria | 2291 |
| 565 | Ga0495630_0122643 | 3300046517 | Bacteria | 1971 |
| 566 | Ga0495648_0029036 | 3300046524 | Bacteria | 3675 |
| 567 | Ga0495666_0001199 | 3300046526 | Bacteria | 12516 |
| 568 | Ga0495666_0006602 | 3300046526 | Bacteria | 5835 |
| 569 | Ga0495666_0020219 | 3300046526 | Bacteria | 3300 |
| 570 | Ga0495666_0100462 | 3300046526 | Bacteria | 1363 |
| 571 | Ga0495642_0050858 | 3300046528 | Bacteria | 1704 |
| 572 | Ga0495652_0051652 | 3300046529 | Bacteria | 3509 |
| 573 | Ga0495652_0126398 | 3300046529 | Bacteria | 2030 |
| 574 | Ga0495654_0011167 | 3300046530 | Bacteria | 4875 |
| 575 | Ga0495665_0017510 | 3300046531 | Bacteria | 3854 |
| 576 | Ga0495665_0022274 | 3300046531 | Bacteria | 3405 |
| 577 | Ga0495665_0023261 | 3300046531 | Bacteria | 3327 |
| 578 | Ga0495640_0005048 | 3300046533 | Bacteria | 10481 |
| 579 | Ga0495640_0006347 | 3300046533 | Bacteria | 9368 |
| 580 | Ga0495586_0031274 | 3300046535 | Bacteria | 2850 |
| 581 | Ga0495586_0083545 | 3300046535 | Bacteria | 1757 |
| 582 | Ga0495598_0005706 | 3300046537 | Bacteria | 2776 |
| 583 | Ga0495597_0015125 | 3300046542 | Bacteria | 3657 |
| 584 | Ga0495645_0001234 | 3300046543 | Bacteria | 17452 |
| 585 | Ga0495645_0089013 | 3300046543 | Bacteria | 2207 |
| 586 | Ga0495667_0115902 | 3300046559 | Bacteria | 1731 |
| 587 | Ga0495634_0016709 | 3300046642 | Bacteria | 5243 |
| 588 | Ga0495634_0021151 | 3300046642 | Bacteria | 4603 |
| 589 | Ga0495625_0050942 | 3300046660 | Bacteria | 2969 |
| 590 | Ga0495635_0000986 | 3300046663 | Bacteria | 18758 |
| 591 | Ga0495635_0004865 | 3300046663 | Bacteria | 9346 |
| 592 | Ga0495635_0096718 | 3300046663 | Bacteria | 2018 |
| 593 | Ga0495661_0009353 | 3300046665 | Bacteria | 6727 |
| 594 | Ga0495661_0063515 | 3300046665 | Bacteria | 2182 |
| 595 | Ga0495599_0025962 | 3300046678 | Bacteria | 3669 |
| 596 | Ga0495623_0002524 | 3300046679 | Bacteria | 12120 |
| 597 | Ga0495623_0005105 | 3300046679 | Bacteria | 8613 |
| 598 | Ga0495623_0012250 | 3300046679 | Bacteria | 5554 |
| 599 | Ga0495646_0003646 | 3300046680 | Bacteria | 9606 |
| 600 | Ga0495646_0004620 | 3300046680 | Bacteria | 8670 |
| 601 | Ga0495646_0037671 | 3300046680 | Bacteria | 2990 |
| 602 | Ga0495646_0079441 | 3300046680 | Bacteria | 1915 |
| 603 | Ga0495669_0009470 | 3300046684 | Bacteria | 4107 |
| 604 | Ga0495669_0076232 | 3300046684 | Bacteria | 1535 |
| 605 | Ga0495613_0001221 | 3300046689 | Bacteria | 19632 |
| 606 | Ga0495613_0029780 | 3300046689 | Bacteria | 4058 |
| 607 | Ga0495613_0066860 | 3300046689 | Bacteria | 2624 |
| 608 | Ga0495624_0003206 | 3300046690 | Bacteria | 12190 |
| 609 | Ga0495624_0007370 | 3300046690 | Bacteria | 7726 |
| 610 | Ga0495624_0008497 | 3300046690 | Bacteria | 7152 |
| 611 | Ga0495624_0041803 | 3300046690 | Bacteria | 2930 |
| 612 | Ga0495624_0063016 | 3300046690 | Bacteria | 2318 |
| 613 | Ga0495670_0014585 | 3300046691 | Bacteria | 3864 |
| 614 | Ga0495671_0021994 | 3300046692 | Bacteria | 3344 |
| 615 | Ga0495649_0000282 | 3300046694 | Bacteria | 44864 |
| 616 | Ga0495649_0001094 | 3300046694 | Bacteria | 21155 |
| 617 | Ga0495649_0006432 | 3300046694 | Bacteria | 7312 |
| 618 | Ga0495649_0027513 | 3300046694 | Bacteria | 3155 |
| 619 | Ga0495649_0053665 | 3300046694 | Bacteria | 2181 |
| 620 | Ga0495649_0071968 | 3300046694 | Bacteria | 1853 |
| 621 | Ga0495589_0003149 | 3300046794 | Bacteria | 9026 |
| 622 | Ga0495589_0017268 | 3300046794 | Bacteria | 3705 |
| 623 | Ga0495589_0027902 | 3300046794 | Bacteria | 2853 |
| 624 | Ga0495581_0009419 | 3300047315 | Bacteria | 5650 |
| 625 | Ga0495581_0014655 | 3300047315 | Bacteria | 4545 |
| 626 | Ga0495604_0002265 | 3300047317 | Bacteria | 15403 |
| 627 | Ga0495604_0008712 | 3300047317 | Bacteria | 8020 |
| 628 | Ga0495604_0105331 | 3300047317 | Bacteria | 2064 |
| 629 | Ga0495674_0004487 | 3300047319 | Bacteria | 13435 |
| 630 | Ga0495674_0006941 | 3300047319 | Bacteria | 10832 |
| 631 | Ga0495674_0014053 | 3300047319 | Bacteria | 7504 |
| 632 | Ga0495674_0027200 | 3300047319 | Bacteria | 5227 |
| 633 | Ga0495674_0032066 | 3300047319 | Bacteria | 4769 |
| 634 | Ga0495674_0035427 | 3300047319 | Bacteria | 4503 |
| 635 | Ga0495674_0038188 | 3300047319 | Bacteria | 4311 |
| 636 | Ga0495674_0049395 | 3300047319 | Bacteria | 3718 |
| 637 | Ga0495674_0049782 | 3300047319 | Bacteria | 3699 |
| 638 | Ga0495672_0002522 | 3300047320 | Bacteria | 16718 |
| 639 | Ga0495672_0037033 | 3300047320 | Bacteria | 2989 |
| 640 | Ga0495676_0113531 | 3300047321 | Bacteria | 1983 |
| 641 | Ga0495676_0189905 | 3300047321 | Bacteria | 1433 |
| 642 | Ga0495680_0026016 | 3300047322 | Bacteria | 4832 |
| 643 | Ga0495680_0036297 | 3300047322 | Bacteria | 3959 |
| 644 | Ga0495680_0063701 | 3300047322 | Bacteria | 2830 |
| 645 | Ga0495680_0064367 | 3300047322 | Bacteria | 2812 |
| 646 | Ga0495680_0075404 | 3300047322 | Bacteria | 2559 |
| 647 | Ga0495683_0001933 | 3300047323 | Bacteria | 12931 |
| 648 | Ga0495683_0002777 | 3300047323 | Bacteria | 10424 |
| 649 | Ga0495683_0006554 | 3300047323 | Bacteria | 6352 |
| 650 | Ga0495683_0014346 | 3300047323 | Bacteria | 4128 |
| 651 | Ga0495683_0022445 | 3300047323 | Bacteria | 3245 |
| 652 | Ga0495687_000419 | 3300047443 | Bacteria | 52487 |
| 653 | Ga0495687_005432 | 3300047443 | Bacteria | 8127 |
| 654 | Ga0495687_029501 | 3300047443 | Bacteria | 2538 |
| 655 | Ga0495687_041634 | 3300047443 | Bacteria | 2013 |
| 656 | Ga0495675_0001691 | 3300047444 | Bacteria | 13223 |
| 657 | Ga0495675_0024973 | 3300047444 | Bacteria | 3811 |
| 658 | Ga0495675_0075232 | 3300047444 | Bacteria | 2128 |
| 659 | Ga0495677_0060041 | 3300047445 | Bacteria | 1409 |
| 660 | Ga0495679_000023 | 3300047446 | Bacteria | 209366 |
| 661 | Ga0495679_001555 | 3300047446 | Bacteria | 12949 |
| 662 | Ga0495679_001975 | 3300047446 | Bacteria | 10918 |
| 663 | Ga0495679_032091 | 3300047446 | Bacteria | 1688 |
| 664 | Ga0495673_0008551 | 3300047469 | Bacteria | 5743 |
| 665 | Ga0495673_0008615 | 3300047469 | Bacteria | 5712 |
| 666 | Ga0495673_0012722 | 3300047469 | Bacteria | 4445 |
| 667 | Ga0495684_0045511 | 3300047471 | Bacteria | 3358 |
| 668 | Ga0495684_0050822 | 3300047471 | Bacteria | 3164 |
| 669 | Ga0495686_0000540 | 3300047472 | Bacteria | 54110 |
| 670 | Ga0495686_0029484 | 3300047472 | Bacteria | 3569 |
| 671 | Ga0495686_0074331 | 3300047472 | Bacteria | 2085 |
| 672 | Ga0495593_0001681 | 3300047673 | Bacteria | 13120 |
| 673 | Ga0495593_0022913 | 3300047673 | Bacteria | 3475 |
| 674 | Ga0495593_0027471 | 3300047673 | Bacteria | 3133 |
| 675 | Ga0495602_0015604 | 3300048088 | Bacteria | 7661 |
| 676 | Ga0495602_0055386 | 3300048088 | Bacteria | 3492 |
| 677 | Ga0495614_0002282 | 3300048089 | Bacteria | 8518 |
| 678 | Ga0495614_0005163 | 3300048089 | Bacteria | 5893 |
| 679 | Ga0495626_0013389 | 3300048091 | Bacteria | 4262 |
| 680 | Ga0495626_0067956 | 3300048091 | Bacteria | 1608 |
| 681 | Ga0496100_0004382 | 3300048903 | Bacteria | 7474 |
| 682 | Ga0496100_0022940 | 3300048903 | Bacteria | 3783 |
| 683 | Ga0496100_0127650 | 3300048903 | Bacteria | 1787 |
| 684 | Ga0496101_0005429 | 3300048904 | Bacteria | 8122 |
| 685 | Ga0496101_0006077 | 3300048904 | Bacteria | 7751 |
| 686 | Ga0496101_0051807 | 3300048904 | Bacteria | 2958 |
| 687 | Ga0496101_0062546 | 3300048904 | Bacteria | 2706 |
| 688 | Ga0496101_0087085 | 3300048904 | Bacteria | 2318 |
| 689 | Ga0496102_0002104 | 3300048905 | Bacteria | 17112 |
| 690 | Ga0496102_0011493 | 3300048905 | Bacteria | 7635 |
| 691 | Ga0496102_0014872 | 3300048905 | Bacteria | 6770 |
| 692 | Ga0496102_0039452 | 3300048905 | Bacteria | 4267 |
| 693 | Ga0496102_0162338 | 3300048905 | Bacteria | 2102 |
| 694 | Ga0496102_0224552 | 3300048905 | Bacteria | 1771 |
| 695 | Ga0496103_0002058 | 3300048906 | Bacteria | 12871 |
| 696 | Ga0496103_0017942 | 3300048906 | Bacteria | 4241 |
| 697 | Ga0496104_0031075 | 3300048907 | Bacteria | 4965 |
| 698 | Ga0496104_0034573 | 3300048907 | Bacteria | 4714 |
| 699 | Ga0496104_0067201 | 3300048907 | Bacteria | 3405 |
| 700 | Ga0496104_0068607 | 3300048907 | Bacteria | 3369 |
| 701 | Ga0496104_0074201 | 3300048907 | Bacteria | 3238 |
| 702 | Ga0496105_0082639 | 3300048908 | Bacteria | 2653 |
| 703 | Ga0496105_0088283 | 3300048908 | Bacteria | 2561 |
| 704 | Ga0496106_0002866 | 3300048909 | Bacteria | 12808 |
| 705 | Ga0496106_0015848 | 3300048909 | Bacteria | 5574 |
| 706 | Ga0496106_0020212 | 3300048909 | Bacteria | 4940 |
| 707 | Ga0496107_0015745 | 3300048910 | Bacteria | 5303 |
| 708 | Ga0496107_0248178 | 3300048910 | Bacteria | 1324 |
| 709 | Ga0496108_0087642 | 3300048911 | Bacteria | 2644 |
| 710 | Ga0496109_0193613 | 3300048912 | Bacteria | 1910 |
| 711 | Ga0496110_0021363 | 3300048913 | Bacteria | 5478 |
| 712 | Ga0496110_0333871 | 3300048913 | Bacteria | 1381 |
| 713 | Ga0496111_0008723 | 3300048914 | Bacteria | 6728 |
| 714 | Ga0496112_0235650 | 3300048915 | Bacteria | 1784 |
| 715 | Ga0496113_0015084 | 3300048916 | Bacteria | 5295 |
| 716 | Ga0496113_0066817 | 3300048916 | Bacteria | 2724 |
| 717 | Ga0496114_0013986 | 3300048917 | Bacteria | 6432 |
| 718 | Ga0496114_0047284 | 3300048917 | Bacteria | 3579 |
| 719 | Ga0496114_0144126 | 3300048917 | Bacteria | 2064 |
| 720 | Ga0496114_0337058 | 3300048917 | Bacteria | 1333 |
| 721 | Ga0496115_0061025 | 3300048918 | Bacteria | 3039 |
| 722 | Ga0496115_0206707 | 3300048918 | Bacteria | 1622 |
| 723 | Ga0496116_0014707 | 3300048919 | Bacteria | 6234 |
| 724 | Ga0496116_0020794 | 3300048919 | Bacteria | 4972 |
| 725 | Ga0496117_0003538 | 3300048920 | Bacteria | 18044 |
| 726 | Ga0496117_0005798 | 3300048920 | Bacteria | 12808 |
| 727 | Ga0496117_0096298 | 3300048920 | Bacteria | 1888 |
| 728 | Ga0496118_0001951 | 3300048921 | Bacteria | 29216 |
| 729 | Ga0496118_0002552 | 3300048921 | Bacteria | 24370 |
| 730 | Ga0496118_0004263 | 3300048921 | Bacteria | 17109 |
| 731 | Ga0496118_0006943 | 3300048921 | Bacteria | 12239 |
| 732 | Ga0496118_0009356 | 3300048921 | Bacteria | 9921 |
| 733 | Ga0496118_0012795 | 3300048921 | Bacteria | 8008 |
| 734 | Ga0496118_0143341 | 3300048921 | Bacteria | 1509 |
| 735 | Ga0496118_0160785 | 3300048921 | Bacteria | 1389 |
| 736 | Ga0496121_0002288 | 3300048924 | Bacteria | 29774 |
| 737 | Ga0496121_0011728 | 3300048924 | Bacteria | 9671 |
| 738 | Ga0496121_0014464 | 3300048924 | Bacteria | 8369 |
| 739 | Ga0496121_0015965 | 3300048924 | Bacteria | 7791 |
| 740 | Ga0496121_0028418 | 3300048924 | Bacteria | 5205 |
| 741 | Ga0496121_0030932 | 3300048924 | Bacteria | 4905 |
| 742 | Ga0496122_0064974 | 3300048925 | Bacteria | 2650 |
| 743 | Ga0496123_0055509 | 3300048926 | Bacteria | 2598 |
| 744 | Ga0496124_0007316 | 3300048927 | Bacteria | 11773 |
| 745 | Ga0496124_0026007 | 3300048927 | Bacteria | 5286 |
| 746 | Ga0496124_0100115 | 3300048927 | Bacteria | 2350 |
| 747 | Ga0496125_0000318 | 3300048928 | Bacteria | 93900 |
| 748 | Ga0496125_0022100 | 3300048928 | Bacteria | 5914 |
| 749 | Ga0496125_0112109 | 3300048928 | Bacteria | 1972 |
| 750 | Ga0496125_0159337 | 3300048928 | Bacteria | 1536 |
| 751 | Ga0496126_0000538 | 3300048929 | Bacteria | 73271 |
| 752 | Ga0496126_0000908 | 3300048929 | Bacteria | 51277 |
| 753 | Ga0496126_0002311 | 3300048929 | Bacteria | 26148 |
| 754 | Ga0496126_0008981 | 3300048929 | Bacteria | 10696 |
| 755 | Ga0496126_0053001 | 3300048929 | Bacteria | 3683 |
| 756 | Ga0495678_008464 | 3300049459 | Bacteria | 5185 |
| 757 | Ga0495682_0058461 | 3300049460 | Bacteria | 1394 |
| 758 | nmdc:mga0k408_109898_c1 | 3300050493 | Bacteria | 1630 |
| 759 | nmdc:mga07m45_21376_c1 | 3300050496 | Bacteria | 3523 |
| 760 | nmdc:mga07m45_2201_c1 | 3300050496 | Bacteria | 9102 |
| 761 | nmdc:mga07m45_25901_c1 | 3300050496 | Bacteria | 3221 |
| 762 | Ga0500635_0000047 | 3300053080 | Bacteria | 84059 |
| 763 | Ga0500647_0049245 | 3300053091 | Bacteria | 2026 |
| 764 | Ga0500618_002855 | 3300053125 | Bacteria | 6196 |
| 765 | Ga0500588_0005414 | 3300053146 | Bacteria | 2837 |
| 766 | Ga0500604_0000228 | 3300053151 | Bacteria | 16039 |
| 767 | Ga0500636_0021540 | 3300053177 | Bacteria | 3815 |
| 768 | Ga0466962_0002532 | 3300061719 | Bacteria | 8682 |
| 769 | Ga0466962_0004545 | 3300061719 | Bacteria | 6655 |
| 770 | Ga0466962_0004735 | 3300061719 | Bacteria | 6540 |
| 771 | Ga0466962_0012138 | 3300061719 | Bacteria | 4141 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047443 | Ga0495687_041634 | Ga0495687_041634_380_1432 | 350 |
| 2 | 3300025907 | Ga0207645_10130543 | Ga0207645_101305431 | 378 |
| 3 | 3300025945 | Ga0207679_10114038 | Ga0207679_101140383 | 378 |
| 4 | 3300026142 | Ga0207698_10021499 | Ga0207698_100214996 | 378 |
| 5 | 3300048908 | Ga0496105_0082639 | Ga0496105_0082639_28_1260 | 379 |
| 6 | 3300037312 | Ga0395899_0248320 | Ga0395899_0248320_25_1203 | 380 |
| 7 | 3300044693 | Ga0466961_0023727 | Ga0466961_0023727_2140_3399 | 380 |
| 8 | 3300044842 | Ga0466957_0008986 | Ga0466957_0008986_433_1692 | 380 |
| 9 | 3300003322 | rootL2_10000022 | rootL2_100000229 | 382 |
| 10 | 3300025893 | Ga0207682_10004849 | Ga0207682_100048492 | 382 |
| 11 | 3300048904 | Ga0496101_0051807 | Ga0496101_0051807_1693_2931 | 386 |
| 12 | 3300003316 | rootH1_10013482 | rootH1_100134823 | 391 |
| 13 | 3300026075 | Ga0207708_10081018 | Ga0207708_100810182 | 392 |
| 14 | 3300037312 | Ga0395899_0167878 | Ga0395899_0167878_19_1227 | 392 |
| 15 | 3300028666 | Ga0265336_10000030 | Ga0265336_1000003083 | 393 |
| 16 | 3300029957 | Ga0265324_10001751 | Ga0265324_100017517 | 393 |
| 17 | 3300037471 | Ga0395905_0018424 | Ga0395905_0018424_111_1403 | 393 |
| 18 | 3300009011 | Ga0105251_10001262 | Ga0105251_100012629 | 394 |
| 19 | 3300025735 | Ga0207713_1026239 | Ga0207713_10262392 | 394 |
| 20 | 3300046457 | Ga0495590_0005892 | Ga0495590_0005892_1575_2858 | 394 |
| 21 | 3300046542 | Ga0495597_0015125 | Ga0495597_0015125_915_2165 | 394 |
| 22 | 3300048921 | Ga0496118_0143341 | Ga0496118_0143341_186_1439 | 394 |
| 23 | 3300048927 | Ga0496124_0007316 | Ga0496124_0007316_564_1847 | 394 |
| 24 | 3300005331 | Ga0070670_100038836 | Ga0070670_1000388364 | 395 |
| 25 | 3300009177 | Ga0105248_10178667 | Ga0105248_101786672 | 395 |
| 26 | 3300037471 | Ga0395905_0084927 | Ga0395905_0084927_1244_2494 | 395 |
| 27 | 3300025945 | Ga0207679_10127450 | Ga0207679_101274501 | 396 |
| 28 | 3300044719 | Ga0466971_0001186 | Ga0466971_0001186_4093_5460 | 396 |
| 29 | 3300044842 | Ga0466957_0024748 | Ga0466957_0024748_1961_3220 | 396 |
| 30 | 3300047320 | Ga0495672_0002522 | Ga0495672_0002522_12057_13307 | 396 |
| 31 | 3300048927 | Ga0496124_0100115 | Ga0496124_0100115_648_1910 | 396 |
| 32 | 3300061719 | Ga0466962_0004735 | Ga0466962_0004735_5201_6460 | 396 |
| 33 | 3300002067 | JGI24735J21928_10000114 | JGI24735J21928_1000011415 | 397 |
| 34 | 3300003322 | rootL2_10143345 | rootL2_101433452 | 397 |
| 35 | 3300005457 | Ga0070662_100005185 | Ga0070662_1000051852 | 397 |
| 36 | 3300025295 | Ga0209564_1010959 | Ga0209564_10109592 | 397 |
| 37 | 3300025932 | Ga0207690_10004028 | Ga0207690_100040287 | 397 |
| 38 | 3300046794 | Ga0495589_0017268 | Ga0495589_0017268_157_1425 | 397 |
| 39 | 3300047323 | Ga0495683_0002777 | Ga0495683_0002777_8905_10155 | 397 |
| 40 | 3300048903 | Ga0496100_0004382 | Ga0496100_0004382_5911_7161 | 397 |
| 41 | 3300048904 | Ga0496101_0062546 | Ga0496101_0062546_310_1560 | 397 |
| 42 | 3300048905 | Ga0496102_0039452 | Ga0496102_0039452_2747_3997 | 397 |
| 43 | 3300048909 | Ga0496106_0002866 | Ga0496106_0002866_10400_11650 | 397 |
| 44 | 3300048910 | Ga0496107_0015745 | Ga0496107_0015745_622_1872 | 397 |
| 45 | 3300048914 | Ga0496111_0008723 | Ga0496111_0008723_4242_5492 | 397 |
| 46 | 3300048916 | Ga0496113_0015084 | Ga0496113_0015084_1613_2863 | 397 |
| 47 | 3300048919 | Ga0496116_0014707 | Ga0496116_0014707_2422_3672 | 397 |
| 48 | 3300048920 | Ga0496117_0003538 | Ga0496117_0003538_3307_4587 | 397 |
| 49 | 3300048921 | Ga0496118_0001951 | Ga0496118_0001951_17542_18822 | 397 |
| 50 | 3300048921 | Ga0496118_0006943 | Ga0496118_0006943_10452_11702 | 397 |
| 51 | 3300048924 | Ga0496121_0014464 | Ga0496121_0014464_2202_3452 | 397 |
| 52 | 3300048928 | Ga0496125_0022100 | Ga0496125_0022100_3367_4617 | 397 |
| 53 | 3300048929 | Ga0496126_0000908 | Ga0496126_0000908_36581_37861 | 397 |
| 54 | 3300005354 | Ga0070675_100081164 | Ga0070675_1000811642 | 398 |
| 55 | 3300005356 | Ga0070674_100034669 | Ga0070674_1000346693 | 398 |
| 56 | 3300005457 | Ga0070662_100035146 | Ga0070662_1000351464 | 398 |
| 57 | 3300005618 | Ga0068864_100032542 | Ga0068864_1000325423 | 398 |
| 58 | 3300005843 | Ga0068860_100011221 | Ga0068860_1000112214 | 398 |
| 59 | 3300013308 | Ga0157375_10029847 | Ga0157375_100298474 | 398 |
| 60 | 3300025901 | Ga0207688_10008981 | Ga0207688_100089814 | 398 |
| 61 | 3300025923 | Ga0207681_10001527 | Ga0207681_1000152715 | 398 |
| 62 | 3300025941 | Ga0207711_10134976 | Ga0207711_101349761 | 398 |
| 63 | 3300026089 | Ga0207648_10011019 | Ga0207648_100110198 | 398 |
| 64 | 3300026089 | Ga0207648_10189421 | Ga0207648_101894212 | 398 |
| 65 | 3300028381 | Ga0268264_10035103 | Ga0268264_100351035 | 398 |
| 66 | 3300048911 | Ga0496108_0087642 | Ga0496108_0087642_838_2220 | 398 |
| 67 | 3300048912 | Ga0496109_0193613 | Ga0496109_0193613_115_1497 | 398 |
| 68 | 3300048918 | Ga0496115_0206707 | Ga0496115_0206707_266_1516 | 398 |
| 69 | 3300038443 | Ga0395901_0000053 | Ga0395901_0000053_51402_52661 | 399 |
| 70 | 3300044656 | Ga0466969_0036269 | Ga0466969_0036269_1203_2462 | 399 |
| 71 | 3300044684 | Ga0466966_0000058 | Ga0466966_0000058_36055_37314 | 399 |
| 72 | 3300044693 | Ga0466961_0000204 | Ga0466961_0000204_18150_19409 | 399 |
| 73 | 3300044694 | Ga0466963_0013557 | Ga0466963_0013557_372_1631 | 399 |
| 74 | 3300044842 | Ga0466957_0036373 | Ga0466957_0036373_291_1550 | 399 |
| 75 | 3300045049 | Ga0466959_0014968 | Ga0466959_0014968_2618_3877 | 399 |
| 76 | 3300045836 | Ga0466958_0003077 | Ga0466958_0003077_1103_2362 | 399 |
| 77 | 3300045836 | Ga0466958_0013227 | Ga0466958_0013227_2690_3949 | 399 |
| 78 | 3300061719 | Ga0466962_0004545 | Ga0466962_0004545_1848_3107 | 399 |
| 79 | 3300006353 | Ga0075370_10002167 | Ga0075370_100021671 | 400 |
| 80 | 3300039437 | Ga0436365_1429793 | Ga0436365_1429793_531_1844 | 400 |
| 81 | 3300048907 | Ga0496104_0067201 | Ga0496104_0067201_1316_2632 | 400 |
| 82 | 3300050496 | nmdc:mga07m45_21376_c1 | nmdc:mga07m45_21376_c1_1503_2789 | 400 |
| 83 | 3300005367 | Ga0070667_100007319 | Ga0070667_10000731910 | 401 |
| 84 | 3300005616 | Ga0068852_100037364 | Ga0068852_1000373644 | 401 |
| 85 | 3300005842 | Ga0068858_100005411 | Ga0068858_1000054117 | 401 |
| 86 | 3300013308 | Ga0157375_10030968 | Ga0157375_100309682 | 401 |
| 87 | 3300014968 | Ga0157379_10191344 | Ga0157379_101913441 | 401 |
| 88 | 3300025986 | Ga0207658_10042895 | Ga0207658_100428954 | 401 |
| 89 | 3300026035 | Ga0207703_10026640 | Ga0207703_100266404 | 401 |
| 90 | 3300028381 | Ga0268264_10038718 | Ga0268264_100387184 | 401 |
| 91 | 3300039447 | Ga0436361_0446381 | Ga0436361_0446381_1153_2463 | 401 |
| 92 | 3300046463 | Ga0495653_0104553 | Ga0495653_0104553_678_1928 | 401 |
| 93 | 3300047322 | Ga0495680_0064367 | Ga0495680_0064367_839_2089 | 401 |
| 94 | 3300021361 | Ga0213872_10000022 | Ga0213872_1000002261 | 402 |
| 95 | 3300039447 | Ga0436361_0675000 | Ga0436361_0675000_16366_17667 | 402 |
| 96 | 3300039447 | Ga0436361_0974052 | Ga0436361_0974052_3830_5176 | 402 |
| 97 | 3300046462 | Ga0495651_0028962 | Ga0495651_0028962_230_1480 | 402 |
| 98 | 3300046678 | Ga0495599_0025962 | Ga0495599_0025962_607_1857 | 402 |
| 99 | 3300046679 | Ga0495623_0012250 | Ga0495623_0012250_3849_5099 | 402 |
| 100 | 3300047317 | Ga0495604_0002265 | Ga0495604_0002265_11206_12456 | 402 |
| 101 | 3300047321 | Ga0495676_0189905 | Ga0495676_0189905_23_1231 | 402 |
| 102 | 3300047444 | Ga0495675_0024973 | Ga0495675_0024973_489_1739 | 402 |
| 103 | 3300053125 | Ga0500618_002855 | Ga0500618_002855_4475_6013 | 402 |
| 104 | 3300009093 | Ga0105240_10156360 | Ga0105240_101563602 | 403 |
| 105 | 3300009545 | Ga0105237_10406141 | Ga0105237_104061411 | 403 |
| 106 | 3300025225 | Ga0209566_101192 | Ga0209566_1011926 | 403 |
| 107 | 3300046507 | Ga0495606_0020562 | Ga0495606_0020562_937_2187 | 403 |
| 108 | 3300046517 | Ga0495630_0092137 | Ga0495630_0092137_227_1477 | 403 |
| 109 | 3300046531 | Ga0495665_0022274 | Ga0495665_0022274_791_2041 | 403 |
| 110 | 3300046543 | Ga0495645_0089013 | Ga0495645_0089013_531_1781 | 403 |
| 111 | 3300046663 | Ga0495635_0096718 | Ga0495635_0096718_292_1575 | 403 |
| 112 | 3300046680 | Ga0495646_0037671 | Ga0495646_0037671_265_1548 | 403 |
| 113 | 3300047322 | Ga0495680_0036297 | Ga0495680_0036297_1500_2750 | 403 |
| 114 | 3300048905 | Ga0496102_0162338 | Ga0496102_0162338_609_1859 | 403 |
| 115 | 3300048907 | Ga0496104_0074201 | Ga0496104_0074201_1479_2729 | 403 |
| 116 | 3300048917 | Ga0496114_0337058 | Ga0496114_0337058_67_1317 | 403 |
| 117 | 3300048928 | Ga0496125_0159337 | Ga0496125_0159337_94_1344 | 403 |
| 118 | 3300002705 | JGI25156J39149_1001828 | JGI25156J39149_10018282 | 404 |
| 119 | 3300002741 | JGI25157J39369_1000341 | JGI25157J39369_100034126 | 404 |
| 120 | 3300003760 | Ga0055527_1000575 | Ga0055527_100057512 | 404 |
| 121 | 3300003763 | Ga0055529_1000883 | Ga0055529_100088317 | 404 |
| 122 | 3300003790 | Ga0055528_1001636 | Ga0055528_10016363 | 404 |
| 123 | 3300003856 | Ga0058692_1009755 | Ga0058692_10097552 | 404 |
| 124 | 3300005535 | Ga0070684_100259765 | Ga0070684_1002597651 | 404 |
| 125 | 3300005539 | Ga0068853_100155020 | Ga0068853_1001550202 | 404 |
| 126 | 3300005577 | Ga0068857_100030365 | Ga0068857_1000303653 | 404 |
| 127 | 3300005577 | Ga0068857_100211128 | Ga0068857_1002111282 | 404 |
| 128 | 3300005614 | Ga0068856_100003535 | Ga0068856_10000353516 | 404 |
| 129 | 3300009093 | Ga0105240_10121643 | Ga0105240_101216432 | 404 |
| 130 | 3300009174 | Ga0105241_10047670 | Ga0105241_100476702 | 404 |
| 131 | 3300009551 | Ga0105238_10031327 | Ga0105238_100313272 | 404 |
| 132 | 3300025228 | Ga0209672_100054 | Ga0209672_10005443 | 404 |
| 133 | 3300025229 | Ga0209147_100085 | Ga0209147_100085147 | 404 |
| 134 | 3300025229 | Ga0209147_100278 | Ga0209147_10027822 | 404 |
| 135 | 3300025242 | Ga0209258_100168 | Ga0209258_100168146 | 404 |
| 136 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012194 | 404 |
| 137 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004424 | 404 |
| 138 | 3300025253 | Ga0209677_100150 | Ga0209677_10015025 | 404 |
| 139 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003302 | 404 |
| 140 | 3300025256 | Ga0209759_1000067 | Ga0209759_1000067113 | 404 |
| 141 | 3300025272 | Ga0209455_1000279 | Ga0209455_100027934 | 404 |
| 142 | 3300025273 | Ga0209673_1000098 | Ga0209673_100009844 | 404 |
| 143 | 3300025919 | Ga0207657_10058343 | Ga0207657_100583433 | 404 |
| 144 | 3300026078 | Ga0207702_10001911 | Ga0207702_100019114 | 404 |
| 145 | 3300026116 | Ga0207674_10024284 | Ga0207674_100242842 | 404 |
| 146 | 3300026116 | Ga0207674_10049178 | Ga0207674_100491782 | 404 |
| 147 | 3300027312 | Ga0209371_1000141 | Ga0209371_100014183 | 404 |
| 148 | 3300030500 | Ga0268256_1000418 | Ga0268256_10004183 | 404 |
| 149 | 3300037471 | Ga0395905_0000166 | Ga0395905_0000166_44603_45871 | 404 |
| 150 | 3300005328 | Ga0070676_10012132 | Ga0070676_100121326 | 405 |
| 151 | 3300005334 | Ga0068869_100003849 | Ga0068869_10000384910 | 405 |
| 152 | 3300005338 | Ga0068868_100008329 | Ga0068868_1000083295 | 405 |
| 153 | 3300005339 | Ga0070660_100011520 | Ga0070660_1000115204 | 405 |
| 154 | 3300005354 | Ga0070675_100002486 | Ga0070675_10000248614 | 405 |
| 155 | 3300005355 | Ga0070671_100068975 | Ga0070671_1000689752 | 405 |
| 156 | 3300005366 | Ga0070659_100020101 | Ga0070659_1000201014 | 405 |
| 157 | 3300005441 | Ga0070700_100041725 | Ga0070700_1000417252 | 405 |
| 158 | 3300005455 | Ga0070663_100009183 | Ga0070663_1000091835 | 405 |
| 159 | 3300005457 | Ga0070662_100010999 | Ga0070662_1000109994 | 405 |
| 160 | 3300005539 | Ga0068853_100028409 | Ga0068853_1000284094 | 405 |
| 161 | 3300005547 | Ga0070693_100015902 | Ga0070693_1000159025 | 405 |
| 162 | 3300005563 | Ga0068855_100013478 | Ga0068855_1000134785 | 405 |
| 163 | 3300005614 | Ga0068856_100046209 | Ga0068856_1000462093 | 405 |
| 164 | 3300005616 | Ga0068852_100037797 | Ga0068852_1000377973 | 405 |
| 165 | 3300005618 | Ga0068864_100005493 | Ga0068864_1000054939 | 405 |
| 166 | 3300005834 | Ga0068851_10009506 | Ga0068851_100095064 | 405 |
| 167 | 3300005842 | Ga0068858_100039138 | Ga0068858_1000391382 | 405 |
| 168 | 3300009093 | Ga0105240_10029364 | Ga0105240_100293646 | 405 |
| 169 | 3300009098 | Ga0105245_10020932 | Ga0105245_100209325 | 405 |
| 170 | 3300013296 | Ga0157374_10002254 | Ga0157374_1000225411 | 405 |
| 171 | 3300014968 | Ga0157379_10010791 | Ga0157379_100107916 | 405 |
| 172 | 3300016635 | Ga0183361_10015 | Ga0183361_10015138 | 405 |
| 173 | 3300017792 | Ga0163161_10006231 | Ga0163161_100062316 | 405 |
| 174 | 3300025321 | Ga0207656_10005850 | Ga0207656_100058502 | 405 |
| 175 | 3300025901 | Ga0207688_10008118 | Ga0207688_100081185 | 405 |
| 176 | 3300025913 | Ga0207695_10000971 | Ga0207695_1000097125 | 405 |
| 177 | 3300025919 | Ga0207657_10017325 | Ga0207657_100173255 | 405 |
| 178 | 3300025923 | Ga0207681_10047020 | Ga0207681_100470202 | 405 |
| 179 | 3300025926 | Ga0207659_10003345 | Ga0207659_100033452 | 405 |
| 180 | 3300025927 | Ga0207687_10011763 | Ga0207687_100117634 | 405 |
| 181 | 3300025933 | Ga0207706_10005846 | Ga0207706_100058465 | 405 |
| 182 | 3300025942 | Ga0207689_10002702 | Ga0207689_100027025 | 405 |
| 183 | 3300025944 | Ga0207661_10214939 | Ga0207661_102149392 | 405 |
| 184 | 3300025945 | Ga0207679_10061937 | Ga0207679_100619372 | 405 |
| 185 | 3300025949 | Ga0207667_10014189 | Ga0207667_100141895 | 405 |
| 186 | 3300026041 | Ga0207639_10006612 | Ga0207639_100066123 | 405 |
| 187 | 3300026075 | Ga0207708_10061685 | Ga0207708_100616852 | 405 |
| 188 | 3300026118 | Ga0207675_100003111 | Ga0207675_10000311116 | 405 |
| 189 | 3300031344 | Ga0265316_10064767 | Ga0265316_100647673 | 405 |
| 190 | 3300031595 | Ga0265313_10028117 | Ga0265313_100281172 | 405 |
| 191 | 3300035691 | Ga0373931_0012132 | Ga0373931_0012132_2151_3467 | 405 |
| 192 | 3300044656 | Ga0466969_0000833 | Ga0466969_0000833_8618_9877 | 405 |
| 193 | 3300044683 | Ga0466965_0002202 | Ga0466965_0002202_2501_3760 | 405 |
| 194 | 3300044693 | Ga0466961_0000224 | Ga0466961_0000224_611_1870 | 405 |
| 195 | 3300044706 | Ga0466964_0017955 | Ga0466964_0017955_104_1363 | 405 |
| 196 | 3300044719 | Ga0466971_0001200 | Ga0466971_0001200_2013_3272 | 405 |
| 197 | 3300044765 | Ga0466970_0026559 | Ga0466970_0026559_264_1523 | 405 |
| 198 | 3300044842 | Ga0466957_0000621 | Ga0466957_0000621_738_1997 | 405 |
| 199 | 3300045049 | Ga0466959_0058527 | Ga0466959_0058527_13_1272 | 405 |
| 200 | 3300048905 | Ga0496102_0011493 | Ga0496102_0011493_3338_4654 | 405 |
| 201 | 3300048913 | Ga0496110_0021363 | Ga0496110_0021363_974_2290 | 405 |
| 202 | 3300048917 | Ga0496114_0144126 | Ga0496114_0144126_92_1408 | 405 |
| 203 | 3300053091 | Ga0500647_0049245 | Ga0500647_0049245_110_1363 | 405 |
| 204 | 3300061719 | Ga0466962_0012138 | Ga0466962_0012138_214_1473 | 405 |
| 205 | 3300005330 | Ga0070690_100067482 | Ga0070690_1000674822 | 406 |
| 206 | 3300005719 | Ga0068861_100001086 | Ga0068861_10000108610 | 406 |
| 207 | 3300006358 | Ga0068871_100003953 | Ga0068871_1000039536 | 406 |
| 208 | 3300009177 | Ga0105248_10007710 | Ga0105248_100077106 | 406 |
| 209 | 3300013102 | Ga0157371_10008450 | Ga0157371_100084504 | 406 |
| 210 | 3300013105 | Ga0157369_10000410 | Ga0157369_1000041026 | 406 |
| 211 | 3300014969 | Ga0157376_10007994 | Ga0157376_100079944 | 406 |
| 212 | 3300021361 | Ga0213872_10000021 | Ga0213872_1000002183 | 406 |
| 213 | 3300026023 | Ga0207677_10004687 | Ga0207677_100046874 | 406 |
| 214 | 3300037312 | Ga0395899_0000080 | Ga0395899_0000080_42070_43329 | 406 |
| 215 | 3300037418 | Ga0395900_0000087 | Ga0395900_0000087_128240_129499 | 406 |
| 216 | 3300037418 | Ga0395900_0102356 | Ga0395900_0102356_377_1636 | 406 |
| 217 | 3300037466 | Ga0395898_0000559 | Ga0395898_0000559_10481_11740 | 406 |
| 218 | 3300037466 | Ga0395898_0000679 | Ga0395898_0000679_42070_43329 | 406 |
| 219 | 3300038443 | Ga0395901_0088474 | Ga0395901_0088474_1401_2660 | 406 |
| 220 | 3300039447 | Ga0436361_0354255 | Ga0436361_0354255_162654_163925 | 406 |
| 221 | 3300046454 | Ga0495592_0005182 | Ga0495592_0005182_3002_4261 | 406 |
| 222 | 3300046459 | Ga0495629_0006585 | Ga0495629_0006585_4394_5653 | 406 |
| 223 | 3300046462 | Ga0495651_0013319 | Ga0495651_0013319_170_1429 | 406 |
| 224 | 3300046472 | Ga0495580_0001573 | Ga0495580_0001573_10777_12036 | 406 |
| 225 | 3300046473 | Ga0495582_0036915 | Ga0495582_0036915_257_1516 | 406 |
| 226 | 3300046477 | Ga0495664_0040265 | Ga0495664_0040265_1256_2515 | 406 |
| 227 | 3300046500 | Ga0495596_0001981 | Ga0495596_0001981_1401_2660 | 406 |
| 228 | 3300046511 | Ga0495608_0002463 | Ga0495608_0002463_545_1804 | 406 |
| 229 | 3300046516 | Ga0495628_0043834 | Ga0495628_0043834_554_1813 | 406 |
| 230 | 3300046524 | Ga0495648_0029036 | Ga0495648_0029036_1891_3150 | 406 |
| 231 | 3300046526 | Ga0495666_0006602 | Ga0495666_0006602_145_1404 | 406 |
| 232 | 3300046529 | Ga0495652_0051652 | Ga0495652_0051652_1706_2965 | 406 |
| 233 | 3300046531 | Ga0495665_0023261 | Ga0495665_0023261_1823_3082 | 406 |
| 234 | 3300046533 | Ga0495640_0005048 | Ga0495640_0005048_9094_10344 | 406 |
| 235 | 3300046535 | Ga0495586_0031274 | Ga0495586_0031274_1402_2661 | 406 |
| 236 | 3300046559 | Ga0495667_0115902 | Ga0495667_0115902_327_1586 | 406 |
| 237 | 3300046642 | Ga0495634_0021151 | Ga0495634_0021151_3274_4533 | 406 |
| 238 | 3300046663 | Ga0495635_0004865 | Ga0495635_0004865_2260_3519 | 406 |
| 239 | 3300046665 | Ga0495661_0009353 | Ga0495661_0009353_1677_2936 | 406 |
| 240 | 3300046679 | Ga0495623_0005105 | Ga0495623_0005105_5863_7122 | 406 |
| 241 | 3300046680 | Ga0495646_0003646 | Ga0495646_0003646_3920_5179 | 406 |
| 242 | 3300046689 | Ga0495613_0001221 | Ga0495613_0001221_13946_15205 | 406 |
| 243 | 3300046690 | Ga0495624_0063016 | Ga0495624_0063016_654_1913 | 406 |
| 244 | 3300046794 | Ga0495589_0003149 | Ga0495589_0003149_3250_4509 | 406 |
| 245 | 3300047317 | Ga0495604_0105331 | Ga0495604_0105331_545_1804 | 406 |
| 246 | 3300047319 | Ga0495674_0027200 | Ga0495674_0027200_177_1436 | 406 |
| 247 | 3300047322 | Ga0495680_0063701 | Ga0495680_0063701_360_1619 | 406 |
| 248 | 3300047323 | Ga0495683_0001933 | Ga0495683_0001933_254_1513 | 406 |
| 249 | 3300047444 | Ga0495675_0001691 | Ga0495675_0001691_8045_9304 | 406 |
| 250 | 3300047446 | Ga0495679_001975 | Ga0495679_001975_9397_10656 | 406 |
| 251 | 3300047469 | Ga0495673_0008615 | Ga0495673_0008615_4191_5450 | 406 |
| 252 | 3300047673 | Ga0495593_0022913 | Ga0495593_0022913_1954_3213 | 406 |
| 253 | 3300048088 | Ga0495602_0055386 | Ga0495602_0055386_249_1508 | 406 |
| 254 | 3300048089 | Ga0495614_0005163 | Ga0495614_0005163_208_1467 | 406 |
| 255 | 3300048909 | Ga0496106_0015848 | Ga0496106_0015848_2981_4297 | 406 |
| 256 | 3300005328 | Ga0070676_10014500 | Ga0070676_100145004 | 407 |
| 257 | 3300005338 | Ga0068868_100004217 | Ga0068868_10000421711 | 407 |
| 258 | 3300005354 | Ga0070675_100000289 | Ga0070675_1000002892 | 407 |
| 259 | 3300005355 | Ga0070671_100001245 | Ga0070671_10000124517 | 407 |
| 260 | 3300005364 | Ga0070673_100014996 | Ga0070673_1000149964 | 407 |
| 261 | 3300005466 | Ga0070685_10014350 | Ga0070685_100143505 | 407 |
| 262 | 3300005841 | Ga0068863_100002575 | Ga0068863_10000257516 | 407 |
| 263 | 3300005842 | Ga0068858_100000259 | Ga0068858_10000025921 | 407 |
| 264 | 3300005843 | Ga0068860_100178984 | Ga0068860_1001789842 | 407 |
| 265 | 3300006237 | Ga0097621_100027144 | Ga0097621_1000271446 | 407 |
| 266 | 3300009177 | Ga0105248_10014364 | Ga0105248_100143645 | 407 |
| 267 | 3300013296 | Ga0157374_10108736 | Ga0157374_101087362 | 407 |
| 268 | 3300013306 | Ga0163162_10051354 | Ga0163162_100513544 | 407 |
| 269 | 3300014325 | Ga0163163_10001655 | Ga0163163_1000165511 | 407 |
| 270 | 3300014326 | Ga0157380_10175014 | Ga0157380_101750142 | 407 |
| 271 | 3300014968 | Ga0157379_10021975 | Ga0157379_100219752 | 407 |
| 272 | 3300025321 | Ga0207656_10018683 | Ga0207656_100186833 | 407 |
| 273 | 3300025907 | Ga0207645_10010523 | Ga0207645_100105236 | 407 |
| 274 | 3300025931 | Ga0207644_10002231 | Ga0207644_1000223110 | 407 |
| 275 | 3300025941 | Ga0207711_10011271 | Ga0207711_100112713 | 407 |
| 276 | 3300025960 | Ga0207651_10002012 | Ga0207651_100020124 | 407 |
| 277 | 3300026023 | Ga0207677_10000498 | Ga0207677_100004989 | 407 |
| 278 | 3300026035 | Ga0207703_10001748 | Ga0207703_1000174814 | 407 |
| 279 | 3300026088 | Ga0207641_10002258 | Ga0207641_1000225815 | 407 |
| 280 | 3300026089 | Ga0207648_10234408 | Ga0207648_102344082 | 407 |
| 281 | 3300026095 | Ga0207676_10000660 | Ga0207676_1000066018 | 407 |
| 282 | 3300026121 | Ga0207683_10003870 | Ga0207683_1000387011 | 407 |
| 283 | iso_pu_bacteria | 2643221585 | 2643934307 | 407 |
| 284 | iso_pu_bacteria | 2643221646 | 2644255906 | 407 |
| 285 | iso_pu_bacteria | 2643221656 | 2644315794 | 407 |
| 286 | 3300003323 | rootH1_10049978 | rootH1_100499785 | 409 |
| 287 | 3300003759 | Ga0055525_1000036 | Ga0055525_1000036193 | 409 |
| 288 | 3300037418 | Ga0395900_0000673 | Ga0395900_0000673_43864_45123 | 409 |
| 289 | 3300046680 | Ga0495646_0079441 | Ga0495646_0079441_487_1746 | 409 |
| 290 | 3300048088 | Ga0495602_0015604 | Ga0495602_0015604_6221_7480 | 409 |
| 291 | 3300005614 | Ga0068856_100161365 | Ga0068856_1001613652 | 410 |
| 292 | 3300044656 | Ga0466969_0003181 | Ga0466969_0003181_1862_3106 | 410 |
| 293 | 3300044684 | Ga0466966_0000731 | Ga0466966_0000731_14573_15817 | 410 |
| 294 | 3300044693 | Ga0466961_0005061 | Ga0466961_0005061_2567_3811 | 410 |
| 295 | 3300044694 | Ga0466963_0018734 | Ga0466963_0018734_864_2108 | 410 |
| 296 | 3300044842 | Ga0466957_0022783 | Ga0466957_0022783_933_2177 | 410 |
| 297 | 3300045049 | Ga0466959_0007366 | Ga0466959_0007366_3692_4936 | 410 |
| 298 | 3300045836 | Ga0466958_0017979 | Ga0466958_0017979_687_1931 | 410 |
| 299 | iso_pu_bacteria | 2643221591 | 2643964301 | 410 |
| 300 | 3300005356 | Ga0070674_100004464 | Ga0070674_1000044645 | 411 |
| 301 | 3300005467 | Ga0070706_100000873 | Ga0070706_1000008735 | 411 |
| 302 | 3300005468 | Ga0070707_100047413 | Ga0070707_1000474133 | 411 |
| 303 | 3300005563 | Ga0068855_100018189 | Ga0068855_1000181896 | 411 |
| 304 | 3300006042 | Ga0075368_10056181 | Ga0075368_100561812 | 411 |
| 305 | 3300006178 | Ga0075367_10023384 | Ga0075367_100233842 | 411 |
| 306 | 3300006195 | Ga0075366_10050472 | Ga0075366_100504722 | 411 |
| 307 | 3300025910 | Ga0207684_10006340 | Ga0207684_1000634010 | 411 |
| 308 | 3300025949 | Ga0207667_10047603 | Ga0207667_100476033 | 411 |
| 309 | 3300050493 | nmdc:mga0k408_109898_c1 | nmdc:mga0k408_109898_c1_199_1506 | 411 |
| 310 | 3300050496 | nmdc:mga07m45_25901_c1 | nmdc:mga07m45_25901_c1_337_1644 | 411 |
| 311 | iso_pu_bacteria | 2721755763 | 2723879739 | 411 |
| 312 | iso_pu_bacteria | 2904434214 | 2904439334 | 411 |
| 313 | 3300005327 | Ga0070658_10135448 | Ga0070658_101354482 | 412 |
| 314 | 3300005328 | Ga0070676_10005469 | Ga0070676_100054692 | 412 |
| 315 | 3300005328 | Ga0070676_10008522 | Ga0070676_100085225 | 412 |
| 316 | 3300005331 | Ga0070670_100008507 | Ga0070670_1000085072 | 412 |
| 317 | 3300005333 | Ga0070677_10030348 | Ga0070677_100303481 | 412 |
| 318 | 3300005338 | Ga0068868_100101223 | Ga0068868_1001012232 | 412 |
| 319 | 3300005339 | Ga0070660_100011761 | Ga0070660_1000117616 | 412 |
| 320 | 3300005353 | Ga0070669_100010392 | Ga0070669_1000103924 | 412 |
| 321 | 3300005354 | Ga0070675_100002040 | Ga0070675_1000020405 | 412 |
| 322 | 3300005355 | Ga0070671_100000158 | Ga0070671_10000015819 | 412 |
| 323 | 3300005355 | Ga0070671_100038161 | Ga0070671_1000381612 | 412 |
| 324 | 3300005367 | Ga0070667_100014781 | Ga0070667_1000147814 | 412 |
| 325 | 3300005456 | Ga0070678_100074496 | Ga0070678_1000744962 | 412 |
| 326 | 3300005456 | Ga0070678_100222162 | Ga0070678_1002221622 | 412 |
| 327 | 3300005459 | Ga0068867_100074147 | Ga0068867_1000741472 | 412 |
| 328 | 3300005543 | Ga0070672_100001393 | Ga0070672_1000013939 | 412 |
| 329 | 3300005543 | Ga0070672_100007786 | Ga0070672_1000077862 | 412 |
| 330 | 3300005564 | Ga0070664_100058655 | Ga0070664_1000586552 | 412 |
| 331 | 3300005564 | Ga0070664_100078849 | Ga0070664_1000788492 | 412 |
| 332 | 3300005616 | Ga0068852_100005295 | Ga0068852_1000052957 | 412 |
| 333 | 3300005616 | Ga0068852_100088525 | Ga0068852_1000885253 | 412 |
| 334 | 3300005618 | Ga0068864_100001456 | Ga0068864_10000145610 | 412 |
| 335 | 3300005618 | Ga0068864_100026924 | Ga0068864_1000269243 | 412 |
| 336 | 3300005719 | Ga0068861_100056839 | Ga0068861_1000568394 | 412 |
| 337 | 3300005834 | Ga0068851_10035389 | Ga0068851_100353891 | 412 |
| 338 | 3300005841 | Ga0068863_100030532 | Ga0068863_1000305326 | 412 |
| 339 | 3300005841 | Ga0068863_100080377 | Ga0068863_1000803772 | 412 |
| 340 | 3300005844 | Ga0068862_100024393 | Ga0068862_1000243936 | 412 |
| 341 | 3300006237 | Ga0097621_100084226 | Ga0097621_1000842262 | 412 |
| 342 | 3300006237 | Ga0097621_100127022 | Ga0097621_1001270222 | 412 |
| 343 | 3300006358 | Ga0068871_100009997 | Ga0068871_1000099976 | 412 |
| 344 | 3300006358 | Ga0068871_100013951 | Ga0068871_1000139516 | 412 |
| 345 | 3300006881 | Ga0068865_100020199 | Ga0068865_1000201993 | 412 |
| 346 | 3300009098 | Ga0105245_10108902 | Ga0105245_101089021 | 412 |
| 347 | 3300009176 | Ga0105242_10034621 | Ga0105242_100346212 | 412 |
| 348 | 3300009177 | Ga0105248_10001469 | Ga0105248_1000146925 | 412 |
| 349 | 3300009177 | Ga0105248_10033206 | Ga0105248_100332066 | 412 |
| 350 | 3300009551 | Ga0105238_10030242 | Ga0105238_100302426 | 412 |
| 351 | 3300009553 | Ga0105249_10031828 | Ga0105249_100318284 | 412 |
| 352 | 3300013105 | Ga0157369_10002529 | Ga0157369_100025298 | 412 |
| 353 | 3300013296 | Ga0157374_10361070 | Ga0157374_103610701 | 412 |
| 354 | 3300013307 | Ga0157372_10013139 | Ga0157372_1001313910 | 412 |
| 355 | 3300013308 | Ga0157375_10002349 | Ga0157375_1000234917 | 412 |
| 356 | 3300014969 | Ga0157376_10010441 | Ga0157376_100104414 | 412 |
| 357 | 3300025321 | Ga0207656_10007084 | Ga0207656_100070842 | 412 |
| 358 | 3300025903 | Ga0207680_10028032 | Ga0207680_100280322 | 412 |
| 359 | 3300025907 | Ga0207645_10017533 | Ga0207645_100175334 | 412 |
| 360 | 3300025919 | Ga0207657_10025683 | Ga0207657_100256834 | 412 |
| 361 | 3300025925 | Ga0207650_10015466 | Ga0207650_100154663 | 412 |
| 362 | 3300025926 | Ga0207659_10008152 | Ga0207659_100081522 | 412 |
| 363 | 3300025931 | Ga0207644_10000042 | Ga0207644_1000004225 | 412 |
| 364 | 3300025931 | Ga0207644_10030996 | Ga0207644_100309964 | 412 |
| 365 | 3300025934 | Ga0207686_10029246 | Ga0207686_100292462 | 412 |
| 366 | 3300025935 | Ga0207709_10027645 | Ga0207709_100276452 | 412 |
| 367 | 3300025937 | Ga0207669_10096940 | Ga0207669_100969402 | 412 |
| 368 | 3300025940 | Ga0207691_10018985 | Ga0207691_100189852 | 412 |
| 369 | 3300025940 | Ga0207691_10128212 | Ga0207691_101282122 | 412 |
| 370 | 3300025941 | Ga0207711_10004500 | Ga0207711_100045009 | 412 |
| 371 | 3300025941 | Ga0207711_10019217 | Ga0207711_100192172 | 412 |
| 372 | 3300025942 | Ga0207689_10016959 | Ga0207689_100169595 | 412 |
| 373 | 3300025945 | Ga0207679_10082688 | Ga0207679_100826882 | 412 |
| 374 | 3300025961 | Ga0207712_10016735 | Ga0207712_100167354 | 412 |
| 375 | 3300025986 | Ga0207658_10043516 | Ga0207658_100435164 | 412 |
| 376 | 3300026035 | Ga0207703_10189629 | Ga0207703_101896292 | 412 |
| 377 | 3300026088 | Ga0207641_10009577 | Ga0207641_100095775 | 412 |
| 378 | 3300026088 | Ga0207641_10031693 | Ga0207641_100316934 | 412 |
| 379 | 3300026088 | Ga0207641_10081318 | Ga0207641_100813183 | 412 |
| 380 | 3300026089 | Ga0207648_10072782 | Ga0207648_100727821 | 412 |
| 381 | 3300026089 | Ga0207648_10209599 | Ga0207648_102095992 | 412 |
| 382 | 3300026095 | Ga0207676_10010869 | Ga0207676_100108694 | 412 |
| 383 | 3300026095 | Ga0207676_10036534 | Ga0207676_100365342 | 412 |
| 384 | 3300026095 | Ga0207676_10145429 | Ga0207676_101454292 | 412 |
| 385 | 3300026118 | Ga0207675_100003717 | Ga0207675_10000371715 | 412 |
| 386 | 3300026121 | Ga0207683_10072943 | Ga0207683_100729432 | 412 |
| 387 | 3300027614 | Ga0209970_1000308 | Ga0209970_10003082 | 412 |
| 388 | 3300028380 | Ga0268265_10015132 | Ga0268265_100151324 | 412 |
| 389 | 3300031731 | Ga0307405_10017781 | Ga0307405_100177813 | 412 |
| 390 | 3300032002 | Ga0307416_100006410 | Ga0307416_1000064106 | 412 |
| 391 | 3300032002 | Ga0307416_100165379 | Ga0307416_1001653791 | 412 |
| 392 | 3300032005 | Ga0307411_10062805 | Ga0307411_100628052 | 412 |
| 393 | 3300036401 | Ga0373937_0314291 | Ga0373937_0314291_82_1380 | 412 |
| 394 | 3300039447 | Ga0436361_0422241 | Ga0436361_0422241_750_2096 | 412 |
| 395 | 3300044656 | Ga0466969_0000023 | Ga0466969_0000023_32369_33664 | 412 |
| 396 | 3300044656 | Ga0466969_0008844 | Ga0466969_0008844_3412_4692 | 412 |
| 397 | 3300044658 | Ga0466972_0033238 | Ga0466972_0033238_1124_2413 | 412 |
| 398 | 3300044683 | Ga0466965_0034444 | Ga0466965_0034444_969_2258 | 412 |
| 399 | 3300044684 | Ga0466966_0002025 | Ga0466966_0002025_2493_3788 | 412 |
| 400 | 3300044684 | Ga0466966_0113788 | Ga0466966_0113788_306_1586 | 412 |
| 401 | 3300044719 | Ga0466971_0026068 | Ga0466971_0026068_590_1870 | 412 |
| 402 | 3300044901 | Ga0466960_0011631 | Ga0466960_0011631_2054_3343 | 412 |
| 403 | 3300045049 | Ga0466959_0080235 | Ga0466959_0080235_457_1752 | 412 |
| 404 | 3300045049 | Ga0466959_0095375 | Ga0466959_0095375_675_1955 | 412 |
| 405 | 3300045051 | Ga0451576_0363745 | Ga0451576_0363745_128_1429 | 412 |
| 406 | 3300046471 | Ga0495650_0006659 | Ga0495650_0006659_4678_5958 | 412 |
| 407 | iso_pu_bacteria | 2508501125 | 2509130752 | 412 |
| 408 | iso_pu_bacteria | 2510065045 | 2510252492 | 412 |
| 409 | iso_pu_bacteria | 2512047030 | 2512348348 | 412 |
| 410 | iso_pu_bacteria | 2513237151 | 2513962692 | 412 |
| 411 | iso_pu_bacteria | 2513237166 | 2514050808 | 412 |
| 412 | iso_pu_bacteria | 2515154122 | 2515684766 | 412 |
| 413 | iso_pu_bacteria | 2519103095 | 2519457645 | 412 |
| 414 | iso_pu_bacteria | 2526164713 | 2527079936 | 412 |
| 415 | iso_pu_bacteria | 2562617112 | 2563061622 | 412 |
| 416 | iso_pu_bacteria | 2582581311 | 2585294035 | 412 |
| 417 | iso_pu_bacteria | 2599185239 | 2599741168 | 412 |
| 418 | iso_pu_bacteria | 2599185240 | 2599747726 | 412 |
| 419 | iso_pu_bacteria | 2599185355 | 2600209731 | 412 |
| 420 | iso_pu_bacteria | 2600255067 | 2600813925 | 412 |
| 421 | iso_pu_bacteria | 2675903129 | 2676745908 | 412 |
| 422 | iso_pu_bacteria | 2711768613 | 2713478511 | 412 |
| 423 | iso_pu_bacteria | 2718217991 | 2719641590 | 412 |
| 424 | iso_pu_bacteria | 2738541296 | 2738824578 | 412 |
| 425 | iso_pu_bacteria | 2738541298 | 2738837045 | 412 |
| 426 | iso_pu_bacteria | 2738541306 | 2738878575 | 412 |
| 427 | iso_pu_bacteria | 2738543002 | 2739190267 | 412 |
| 428 | iso_pu_bacteria | 2738543008 | 2739225168 | 412 |
| 429 | iso_pu_bacteria | 2744054900 | 2746087319 | 412 |
| 430 | iso_pu_bacteria | 2744054901 | 2746093174 | 412 |
| 431 | iso_pu_bacteria | 2751185846 | 2753566076 | 412 |
| 432 | iso_pu_bacteria | 2791355137 | 2792836975 | 412 |
| 433 | iso_pu_bacteria | 2808606384 | 2808972966 | 412 |
| 434 | iso_pu_bacteria | 2808606390 | 2809007869 | 412 |
| 435 | iso_pu_bacteria | 2808606391 | 2809015491 | 412 |
| 436 | iso_pu_bacteria | 2816332253 | 2817259839 | 412 |
| 437 | iso_pu_bacteria | 2816332256 | 2817277501 | 412 |
| 438 | iso_pu_bacteria | 2816332286 | 2817456633 | 412 |
| 439 | iso_pu_bacteria | 2818991450 | 2819624257 | 412 |
| 440 | iso_pu_bacteria | 2818991452 | 2819637023 | 412 |
| 441 | iso_pu_bacteria | 2842324504 | 2842332091 | 412 |
| 442 | iso_pu_bacteria | 2842348783 | 2842356457 | 412 |
| 443 | iso_pu_bacteria | 2842454564 | 2842461189 | 412 |
| 444 | iso_pu_bacteria | 2863421361 | 2863426373 | 412 |
| 445 | iso_pu_bacteria | 2870068957 | 2870069260 | 412 |
| 446 | iso_pu_bacteria | 2885270888 | 2885272460 | 412 |
| 447 | iso_pu_bacteria | 2900634093 | 2900637166 | 412 |
| 448 | iso_pu_bacteria | 2902682994 | 2902686772 | 412 |
| 449 | iso_pu_bacteria | 2904483920 | 2904490212 | 412 |
| 450 | iso_pu_bacteria | 2904564687 | 2904569512 | 412 |
| 451 | iso_pu_bacteria | 2904571731 | 2904576651 | 412 |
| 452 | iso_pu_bacteria | 2904615490 | 2904621475 | 412 |
| 453 | iso_pu_bacteria | 2919527303 | 2919533382 | 412 |
| 454 | iso_pu_bacteria | 2928108538 | 2928114117 | 412 |
| 455 | iso_pu_bacteria | 2928135762 | 2928141135 | 412 |
| 456 | iso_pu_bacteria | 2928170801 | 2928176188 | 412 |
| 457 | iso_pu_bacteria | 2928503688 | 2928509112 | 412 |
| 458 | iso_pu_bacteria | 2928536128 | 2928542133 | 412 |
| 459 | iso_pu_bacteria | 2945934425 | 2945934470 | 412 |
| 460 | iso_pu_bacteria | 2990703756 | 2990704970 | 412 |
| 461 | iso_pu_bacteria | 641736151 | 642426634 | 412 |
| 462 | iso_pu_bacteria | 641736154 | 642418382 | 412 |
| 463 | iso_pu_bacteria | 642555112 | 642594523 | 412 |
| 464 | iso_pu_bacteria | 642555113 | 642621785 | 412 |
| 465 | iso_pu_bacteria | 642555113 | 642623108 | 412 |
| 466 | iso_pu_bacteria | 8018845410 | 8018848778 | 412 |
| 467 | iso_pu_bacteria | 8020807995 | 8020810810 | 412 |
| 468 | iso_pu_bacteria | 8020938398 | 8020938913 | 412 |
| 469 | iso_pu_bacteria | 8020945358 | 8020950449 | 412 |
| 470 | iso_pu_bacteria | 8020953355 | 8020953543 | 412 |
| 471 | iso_pu_bacteria | 8021120328 | 8021127925 | 412 |
| 472 | iso_pu_bacteria | 8039098773 | 8039102041 | 412 |
| 473 | iso_pu_bacteria | 8040167225 | 8040172657 | 412 |
| 474 | iso_pu_bacteria | 8040173305 | 8040176385 | 412 |
| 475 | iso_pu_bacteria | 8055266321 | 8055269520 | 412 |
| 476 | iso_pu_bacteria | 8055301274 | 8055307318 | 412 |
| 477 | 3300003316 | rootH1_10013471 | rootH1_100134712 | 413 |
| 478 | 3300003320 | rootH2_10025596 | rootH2_100255964 | 413 |
| 479 | 3300003322 | rootL2_10032325 | rootL2_100323252 | 413 |
| 480 | 3300003323 | rootH1_10003329 | rootH1_100033298 | 413 |
| 481 | 3300003323 | rootH1_10035876 | rootH1_100358763 | 413 |
| 482 | 3300003752 | Ga0055539_1000414 | Ga0055539_10004149 | 413 |
| 483 | 3300003756 | Ga0055533_1000048 | Ga0055533_100004819 | 413 |
| 484 | 3300003756 | Ga0055533_1000068 | Ga0055533_100006864 | 413 |
| 485 | 3300003761 | Ga0055535_1000252 | Ga0055535_100025237 | 413 |
| 486 | 3300003763 | Ga0055529_1000150 | Ga0055529_100015081 | 413 |
| 487 | 3300003794 | Ga0055531_10011470 | Ga0055531_100114702 | 413 |
| 488 | 3300005327 | Ga0070658_10077601 | Ga0070658_100776012 | 413 |
| 489 | 3300005347 | Ga0070668_100016481 | Ga0070668_1000164813 | 413 |
| 490 | 3300005356 | Ga0070674_100020277 | Ga0070674_1000202775 | 413 |
| 491 | 3300005364 | Ga0070673_100056244 | Ga0070673_1000562442 | 413 |
| 492 | 3300005366 | Ga0070659_100016174 | Ga0070659_1000161743 | 413 |
| 493 | 3300005459 | Ga0068867_100016036 | Ga0068867_1000160365 | 413 |
| 494 | 3300005563 | Ga0068855_100002740 | Ga0068855_1000027404 | 413 |
| 495 | 3300005719 | Ga0068861_100110832 | Ga0068861_1001108322 | 413 |
| 496 | 3300006944 | Ga0099823_1000003 | Ga0099823_100000355 | 413 |
| 497 | 3300009093 | Ga0105240_10226800 | Ga0105240_102268001 | 413 |
| 498 | 3300009148 | Ga0105243_10050239 | Ga0105243_100502391 | 413 |
| 499 | 3300009176 | Ga0105242_10022980 | Ga0105242_100229802 | 413 |
| 500 | 3300009177 | Ga0105248_10063036 | Ga0105248_100630362 | 413 |
| 501 | 3300013297 | Ga0157378_10133474 | Ga0157378_101334741 | 413 |
| 502 | 3300025226 | Ga0209674_100024 | Ga0209674_100024315 | 413 |
| 503 | 3300025230 | Ga0209563_100101 | Ga0209563_10010165 | 413 |
| 504 | 3300025242 | Ga0209258_100080 | Ga0209258_10008019 | 413 |
| 505 | 3300025242 | Ga0209258_101186 | Ga0209258_1011863 | 413 |
| 506 | 3300025253 | Ga0209677_100091 | Ga0209677_10009147 | 413 |
| 507 | 3300025253 | Ga0209677_100509 | Ga0209677_1005095 | 413 |
| 508 | 3300025256 | Ga0209759_1000827 | Ga0209759_10008274 | 413 |
| 509 | 3300025256 | Ga0209759_1000945 | Ga0209759_100094523 | 413 |
| 510 | 3300025272 | Ga0209455_1000030 | Ga0209455_1000030480 | 413 |
| 511 | 3300025273 | Ga0209673_1022252 | Ga0209673_10222522 | 413 |
| 512 | 3300025298 | Ga0209050_1003447 | Ga0209050_10034471 | 413 |
| 513 | 3300025299 | Ga0209256_1001730 | Ga0209256_10017302 | 413 |
| 514 | 3300025303 | Ga0209051_1004239 | Ga0209051_10042392 | 413 |
| 515 | 3300025304 | Ga0209257_1013559 | Ga0209257_10135592 | 413 |
| 516 | 3300025909 | Ga0207705_10061699 | Ga0207705_100616992 | 413 |
| 517 | 3300025913 | Ga0207695_10224610 | Ga0207695_102246101 | 413 |
| 518 | 3300025932 | Ga0207690_10156025 | Ga0207690_101560251 | 413 |
| 519 | 3300025935 | Ga0207709_10080988 | Ga0207709_100809881 | 413 |
| 520 | 3300025937 | Ga0207669_10117912 | Ga0207669_101179121 | 413 |
| 521 | 3300025940 | Ga0207691_10088071 | Ga0207691_100880714 | 413 |
| 522 | 3300025941 | Ga0207711_10039974 | Ga0207711_100399745 | 413 |
| 523 | 3300025949 | Ga0207667_10011603 | Ga0207667_100116034 | 413 |
| 524 | 3300025960 | Ga0207651_10010282 | Ga0207651_100102823 | 413 |
| 525 | 3300025972 | Ga0207668_10086755 | Ga0207668_100867552 | 413 |
| 526 | 3300026118 | Ga0207675_100082236 | Ga0207675_1000822362 | 413 |
| 527 | 3300026142 | Ga0207698_10014920 | Ga0207698_100149203 | 413 |
| 528 | 3300028381 | Ga0268264_10278296 | Ga0268264_102782962 | 413 |
| 529 | 3300028786 | Ga0307517_10068391 | Ga0307517_100683912 | 413 |
| 530 | 3300028794 | Ga0307515_10006245 | Ga0307515_100062452 | 413 |
| 531 | 3300031730 | Ga0307516_10004112 | Ga0307516_1000411219 | 413 |
| 532 | 3300031730 | Ga0307516_10036065 | Ga0307516_100360651 | 413 |
| 533 | 3300032004 | Ga0307414_10092059 | Ga0307414_100920591 | 413 |
| 534 | 3300035691 | Ga0373931_0008624 | Ga0373931_0008624_1940_3265 | 413 |
| 535 | 3300039447 | Ga0436361_0563595 | Ga0436361_0563595_322_1632 | 413 |
| 536 | 3300042439 | Ga0439464_0007495 | Ga0439464_0007495_1380_2699 | 413 |
| 537 | 3300044656 | Ga0466969_0002590 | Ga0466969_0002590_144_1454 | 413 |
| 538 | 3300044658 | Ga0466972_0003681 | Ga0466972_0003681_742_2040 | 413 |
| 539 | 3300044684 | Ga0466966_0002795 | Ga0466966_0002795_1429_2739 | 413 |
| 540 | 3300044706 | Ga0466964_0001232 | Ga0466964_0001232_1022_2332 | 413 |
| 541 | 3300044719 | Ga0466971_0006019 | Ga0466971_0006019_2751_4061 | 413 |
| 542 | 3300044735 | Ga0466968_0027880 | Ga0466968_0027880_852_2162 | 413 |
| 543 | 3300044842 | Ga0466957_0000379 | Ga0466957_0000379_6697_8007 | 413 |
| 544 | 3300044842 | Ga0466957_0022364 | Ga0466957_0022364_2288_3598 | 413 |
| 545 | 3300045049 | Ga0466959_0003971 | Ga0466959_0003971_1341_2651 | 413 |
| 546 | 3300045836 | Ga0466958_0047061 | Ga0466958_0047061_200_1510 | 413 |
| 547 | 3300046475 | Ga0495639_0027429 | Ga0495639_0027429_276_1628 | 413 |
| 548 | 3300046492 | Ga0495585_0041066 | Ga0495585_0041066_1175_2500 | 413 |
| 549 | 3300046506 | Ga0495583_0000022 | Ga0495583_0000022_211192_212517 | 413 |
| 550 | 3300046507 | Ga0495606_0001504 | Ga0495606_0001504_11215_12540 | 413 |
| 551 | 3300046537 | Ga0495598_0005706 | Ga0495598_0005706_815_2146 | 413 |
| 552 | 3300046660 | Ga0495625_0050942 | Ga0495625_0050942_1486_2811 | 413 |
| 553 | 3300046694 | Ga0495649_0000282 | Ga0495649_0000282_32763_34088 | 413 |
| 554 | 3300047472 | Ga0495686_0074331 | Ga0495686_0074331_631_2070 | 413 |
| 555 | 3300048904 | Ga0496101_0087085 | Ga0496101_0087085_268_1596 | 413 |
| 556 | 3300048907 | Ga0496104_0034573 | Ga0496104_0034573_325_1638 | 413 |
| 557 | 3300048913 | Ga0496110_0333871 | Ga0496110_0333871_23_1282 | 413 |
| 558 | 3300048927 | Ga0496124_0026007 | Ga0496124_0026007_1235_2557 | 413 |
| 559 | 3300048928 | Ga0496125_0000318 | Ga0496125_0000318_78475_79734 | 413 |
| 560 | 3300048929 | Ga0496126_0053001 | Ga0496126_0053001_291_1547 | 413 |
| 561 | 3300050496 | nmdc:mga07m45_2201_c1 | nmdc:mga07m45_2201_c1_3567_4895 | 413 |
| 562 | 3300053080 | Ga0500635_0000047 | Ga0500635_0000047_17946_19307 | 413 |
| 563 | 3300053151 | Ga0500604_0000228 | Ga0500604_0000228_10330_11586 | 413 |
| 564 | 3300053177 | Ga0500636_0021540 | Ga0500636_0021540_1441_2763 | 413 |
| 565 | 3300061719 | Ga0466962_0002532 | Ga0466962_0002532_1219_2529 | 413 |
| 566 | iso_pu_bacteria | 2501025502 | 2501084031 | 413 |
| 567 | iso_pu_bacteria | 2510917013 | 2511093414 | 413 |
| 568 | iso_pu_bacteria | 2513237082 | 2513556059 | 413 |
| 569 | iso_pu_bacteria | 2513237083 | 2513564245 | 413 |
| 570 | iso_pu_bacteria | 2515154189 | 2516022358 | 413 |
| 571 | iso_pu_bacteria | 2883087390 | 2883091351 | 413 |
| 572 | iso_pu_bacteria | 8003955200 | 8003956737 | 413 |
| 573 | 3300005327 | Ga0070658_10125676 | Ga0070658_101256762 | 414 |
| 574 | 3300005548 | Ga0070665_100000449 | Ga0070665_10000044928 | 414 |
| 575 | 3300009551 | Ga0105238_10108170 | Ga0105238_101081702 | 414 |
| 576 | 3300028379 | Ga0268266_10000110 | Ga0268266_1000011041 | 414 |
| 577 | 3300031548 | Ga0307408_100182314 | Ga0307408_1001823141 | 414 |
| 578 | 3300048915 | Ga0496112_0235650 | Ga0496112_0235650_442_1695 | 414 |
| 579 | 3300045051 | Ga0451576_0131415 | Ga0451576_0131415_691_2031 | 415 |
| 580 | 3300053146 | Ga0500588_0005414 | Ga0500588_0005414_1388_2644 | 415 |
| 581 | 3300001989 | JGI24739J22299_10001229 | JGI24739J22299_1000122910 | 416 |
| 582 | 3300001989 | JGI24739J22299_10007347 | JGI24739J22299_100073474 | 416 |
| 583 | 3300001990 | JGI24737J22298_10006947 | JGI24737J22298_100069472 | 416 |
| 584 | 3300002067 | JGI24735J21928_10000535 | JGI24735J21928_1000053516 | 416 |
| 585 | 3300002075 | JGI24738J21930_10002284 | JGI24738J21930_100022842 | 416 |
| 586 | 3300002705 | JGI25156J39149_1001087 | JGI25156J39149_100108712 | 416 |
| 587 | 3300002705 | JGI25156J39149_1003877 | JGI25156J39149_10038771 | 416 |
| 588 | 3300003214 | JGI25165J46597_1001604 | JGI25165J46597_10016043 | 416 |
| 589 | 3300003756 | Ga0055533_1000645 | Ga0055533_10006457 | 416 |
| 590 | 3300003756 | Ga0055533_1005548 | Ga0055533_10055482 | 416 |
| 591 | 3300003758 | Ga0055532_1000092 | Ga0055532_100009267 | 416 |
| 592 | 3300003760 | Ga0055527_1000035 | Ga0055527_1000035105 | 416 |
| 593 | 3300003761 | Ga0055535_1000050 | Ga0055535_1000050105 | 416 |
| 594 | 3300003762 | Ga0055542_1000120 | Ga0055542_100012067 | 416 |
| 595 | 3300003763 | Ga0055529_1000089 | Ga0055529_1000089105 | 416 |
| 596 | 3300005262 | Ga0065165_1000648 | Ga0065165_100064841 | 416 |
| 597 | 3300005327 | Ga0070658_10005242 | Ga0070658_100052425 | 416 |
| 598 | 3300005327 | Ga0070658_10018761 | Ga0070658_100187613 | 416 |
| 599 | 3300005339 | Ga0070660_100000144 | Ga0070660_10000014436 | 416 |
| 600 | 3300005366 | Ga0070659_100000156 | Ga0070659_10000015636 | 416 |
| 601 | 3300005367 | Ga0070667_100025925 | Ga0070667_1000259253 | 416 |
| 602 | 3300005455 | Ga0070663_100007485 | Ga0070663_1000074854 | 416 |
| 603 | 3300005455 | Ga0070663_100011786 | Ga0070663_1000117865 | 416 |
| 604 | 3300005456 | Ga0070678_100030616 | Ga0070678_1000306164 | 416 |
| 605 | 3300005563 | Ga0068855_100004044 | Ga0068855_1000040446 | 416 |
| 606 | 3300005563 | Ga0068855_100070586 | Ga0068855_1000705864 | 416 |
| 607 | 3300005614 | Ga0068856_100105703 | Ga0068856_1001057032 | 416 |
| 608 | 3300005616 | Ga0068852_100008251 | Ga0068852_1000082517 | 416 |
| 609 | 3300005842 | Ga0068858_100065389 | Ga0068858_1000653893 | 416 |
| 610 | 3300009011 | Ga0105251_10000758 | Ga0105251_1000075817 | 416 |
| 611 | 3300009093 | Ga0105240_10001922 | Ga0105240_1000192222 | 416 |
| 612 | 3300009093 | Ga0105240_10031832 | Ga0105240_100318326 | 416 |
| 613 | 3300009093 | Ga0105240_10128415 | Ga0105240_101284153 | 416 |
| 614 | 3300009177 | Ga0105248_10041858 | Ga0105248_100418584 | 416 |
| 615 | 3300009545 | Ga0105237_10021860 | Ga0105237_100218605 | 416 |
| 616 | 3300009551 | Ga0105238_10003750 | Ga0105238_1000375012 | 416 |
| 617 | 3300009551 | Ga0105238_10149896 | Ga0105238_101498962 | 416 |
| 618 | 3300010375 | Ga0105239_10003468 | Ga0105239_1000346811 | 416 |
| 619 | 3300010375 | Ga0105239_10094132 | Ga0105239_100941323 | 416 |
| 620 | 3300013104 | Ga0157370_10000439 | Ga0157370_1000043929 | 416 |
| 621 | 3300013104 | Ga0157370_10002253 | Ga0157370_1000225317 | 416 |
| 622 | 3300013105 | Ga0157369_10001007 | Ga0157369_1000100718 | 416 |
| 623 | 3300013105 | Ga0157369_10157497 | Ga0157369_101574972 | 416 |
| 624 | 3300013296 | Ga0157374_10000146 | Ga0157374_1000014620 | 416 |
| 625 | 3300013306 | Ga0163162_10000877 | Ga0163162_1000087712 | 416 |
| 626 | 3300013307 | Ga0157372_10000323 | Ga0157372_100003235 | 416 |
| 627 | 3300015262 | Ga0182007_10003995 | Ga0182007_100039955 | 416 |
| 628 | 3300015265 | Ga0182005_1030737 | Ga0182005_10307372 | 416 |
| 629 | 3300025226 | Ga0209674_100153 | Ga0209674_1001532 | 416 |
| 630 | 3300025226 | Ga0209674_100671 | Ga0209674_1006712 | 416 |
| 631 | 3300025228 | Ga0209672_100072 | Ga0209672_100072124 | 416 |
| 632 | 3300025228 | Ga0209672_100073 | Ga0209672_10007342 | 416 |
| 633 | 3300025228 | Ga0209672_100185 | Ga0209672_10018531 | 416 |
| 634 | 3300025229 | Ga0209147_100093 | Ga0209147_10009342 | 416 |
| 635 | 3300025229 | Ga0209147_100100 | Ga0209147_100100116 | 416 |
| 636 | 3300025231 | Ga0207427_100866 | Ga0207427_1008664 | 416 |
| 637 | 3300025242 | Ga0209258_100140 | Ga0209258_10014042 | 416 |
| 638 | 3300025242 | Ga0209258_100331 | Ga0209258_10033125 | 416 |
| 639 | 3300025254 | Ga0209148_1000140 | Ga0209148_100014043 | 416 |
| 640 | 3300025256 | Ga0209759_1000195 | Ga0209759_100019518 | 416 |
| 641 | 3300025256 | Ga0209759_1000329 | Ga0209759_100032966 | 416 |
| 642 | 3300025256 | Ga0209759_1000351 | Ga0209759_100035146 | 416 |
| 643 | 3300025256 | Ga0209759_1013933 | Ga0209759_10139332 | 416 |
| 644 | 3300025256 | Ga0209759_1014092 | Ga0209759_10140922 | 416 |
| 645 | 3300025261 | Ga0209233_1000173 | Ga0209233_100017342 | 416 |
| 646 | 3300025272 | Ga0209455_1000125 | Ga0209455_100012543 | 416 |
| 647 | 3300025302 | Ga0207426_1000199 | Ga0207426_1000199112 | 416 |
| 648 | 3300025735 | Ga0207713_1000186 | Ga0207713_100018652 | 416 |
| 649 | 3300025904 | Ga0207647_10000126 | Ga0207647_1000012661 | 416 |
| 650 | 3300025904 | Ga0207647_10002464 | Ga0207647_100024643 | 416 |
| 651 | 3300025904 | Ga0207647_10003041 | Ga0207647_100030412 | 416 |
| 652 | 3300025904 | Ga0207647_10021302 | Ga0207647_100213022 | 416 |
| 653 | 3300025904 | Ga0207647_10030780 | Ga0207647_100307802 | 416 |
| 654 | 3300025909 | Ga0207705_10000841 | Ga0207705_1000084116 | 416 |
| 655 | 3300025909 | Ga0207705_10162409 | Ga0207705_101624091 | 416 |
| 656 | 3300025913 | Ga0207695_10004600 | Ga0207695_100046003 | 416 |
| 657 | 3300025913 | Ga0207695_10005877 | Ga0207695_100058776 | 416 |
| 658 | 3300025914 | Ga0207671_10009292 | Ga0207671_100092923 | 416 |
| 659 | 3300025919 | Ga0207657_10000096 | Ga0207657_1000009636 | 416 |
| 660 | 3300025919 | Ga0207657_10011541 | Ga0207657_100115413 | 416 |
| 661 | 3300025924 | Ga0207694_10046481 | Ga0207694_100464813 | 416 |
| 662 | 3300025932 | Ga0207690_10000074 | Ga0207690_1000007443 | 416 |
| 663 | 3300025932 | Ga0207690_10019260 | Ga0207690_100192603 | 416 |
| 664 | 3300025941 | Ga0207711_10094057 | Ga0207711_100940572 | 416 |
| 665 | 3300025949 | Ga0207667_10018190 | Ga0207667_100181905 | 416 |
| 666 | 3300025949 | Ga0207667_10074256 | Ga0207667_100742562 | 416 |
| 667 | 3300025949 | Ga0207667_10091752 | Ga0207667_100917523 | 416 |
| 668 | 3300025986 | Ga0207658_10016870 | Ga0207658_100168703 | 416 |
| 669 | 3300026067 | Ga0207678_10000061 | Ga0207678_1000006144 | 416 |
| 670 | 3300026067 | Ga0207678_10077473 | Ga0207678_100774734 | 416 |
| 671 | 3300026121 | Ga0207683_10029618 | Ga0207683_100296183 | 416 |
| 672 | 3300027312 | Ga0209371_1001782 | Ga0209371_100178210 | 416 |
| 673 | 3300028800 | Ga0265338_10000547 | Ga0265338_1000054737 | 416 |
| 674 | 3300030500 | Ga0268256_1006262 | Ga0268256_10062623 | 416 |
| 675 | 3300031548 | Ga0307408_100000422 | Ga0307408_10000042228 | 416 |
| 676 | 3300031731 | Ga0307405_10005333 | Ga0307405_100053333 | 416 |
| 677 | 3300031911 | Ga0307412_10000056 | Ga0307412_10000056118 | 416 |
| 678 | 3300031995 | Ga0307409_100021088 | Ga0307409_1000210883 | 416 |
| 679 | 3300032002 | Ga0307416_100008384 | Ga0307416_1000083843 | 416 |
| 680 | 3300032005 | Ga0307411_10133060 | Ga0307411_101330602 | 416 |
| 681 | 3300037312 | Ga0395899_0122248 | Ga0395899_0122248_64_1323 | 416 |
| 682 | 3300037418 | Ga0395900_0103296 | Ga0395900_0103296_597_1856 | 416 |
| 683 | 3300037418 | Ga0395900_0114951 | Ga0395900_0114951_154_1419 | 416 |
| 684 | 3300037466 | Ga0395898_0009374 | Ga0395898_0009374_423_1688 | 416 |
| 685 | 3300037466 | Ga0395898_0091789 | Ga0395898_0091789_1596_2855 | 416 |
| 686 | 3300038443 | Ga0395901_0000771 | Ga0395901_0000771_34329_35588 | 416 |
| 687 | 3300038443 | Ga0395901_0001663 | Ga0395901_0001663_21587_22846 | 416 |
| 688 | 3300042005 | Ga0439448_0000429 | Ga0439448_0000429_5325_6764 | 416 |
| 689 | 3300044666 | Ga0466977_0056070 | Ga0466977_0056070_1030_2283 | 416 |
| 690 | 3300044683 | Ga0466965_0005911 | Ga0466965_0005911_577_1827 | 416 |
| 691 | 3300044684 | Ga0466966_0005527 | Ga0466966_0005527_3404_4678 | 416 |
| 692 | 3300044684 | Ga0466966_0085575 | Ga0466966_0085575_407_1657 | 416 |
| 693 | 3300044693 | Ga0466961_0013426 | Ga0466961_0013426_3939_5213 | 416 |
| 694 | 3300044693 | Ga0466961_0094159 | Ga0466961_0094159_122_1375 | 416 |
| 695 | 3300044765 | Ga0466970_0001740 | Ga0466970_0001740_5116_6390 | 416 |
| 696 | 3300044842 | Ga0466957_0083559 | Ga0466957_0083559_613_1917 | 416 |
| 697 | 3300045049 | Ga0466959_0005343 | Ga0466959_0005343_6341_7615 | 416 |
| 698 | 3300046454 | Ga0495592_0009220 | Ga0495592_0009220_4410_5660 | 416 |
| 699 | 3300046455 | Ga0495603_0006083 | Ga0495603_0006083_1519_2769 | 416 |
| 700 | 3300046455 | Ga0495603_0031509 | Ga0495603_0031509_1686_2936 | 416 |
| 701 | 3300046457 | Ga0495590_0003243 | Ga0495590_0003243_1612_2862 | 416 |
| 702 | 3300046457 | Ga0495590_0018895 | Ga0495590_0018895_1177_2427 | 416 |
| 703 | 3300046457 | Ga0495590_0021494 | Ga0495590_0021494_882_2180 | 416 |
| 704 | 3300046459 | Ga0495629_0000052 | Ga0495629_0000052_21521_22819 | 416 |
| 705 | 3300046459 | Ga0495629_0000162 | Ga0495629_0000162_2568_3818 | 416 |
| 706 | 3300046459 | Ga0495629_0000625 | Ga0495629_0000625_13545_14795 | 416 |
| 707 | 3300046459 | Ga0495629_0006110 | Ga0495629_0006110_461_1711 | 416 |
| 708 | 3300046460 | Ga0495638_0000875 | Ga0495638_0000875_13491_14741 | 416 |
| 709 | 3300046460 | Ga0495638_0011363 | Ga0495638_0011363_322_1572 | 416 |
| 710 | 3300046461 | Ga0495641_0015103 | Ga0495641_0015103_2603_3853 | 416 |
| 711 | 3300046463 | Ga0495653_0001943 | Ga0495653_0001943_9357_10655 | 416 |
| 712 | 3300046463 | Ga0495653_0003345 | Ga0495653_0003345_131_1381 | 416 |
| 713 | 3300046463 | Ga0495653_0012493 | Ga0495653_0012493_1349_2599 | 416 |
| 714 | 3300046471 | Ga0495650_0001711 | Ga0495650_0001711_13675_14925 | 416 |
| 715 | 3300046471 | Ga0495650_0010974 | Ga0495650_0010974_338_1588 | 416 |
| 716 | 3300046471 | Ga0495650_0012488 | Ga0495650_0012488_322_1572 | 416 |
| 717 | 3300046471 | Ga0495650_0037866 | Ga0495650_0037866_144_1394 | 416 |
| 718 | 3300046471 | Ga0495650_0054965 | Ga0495650_0054965_222_1472 | 416 |
| 719 | 3300046472 | Ga0495580_0004723 | Ga0495580_0004723_5606_6904 | 416 |
| 720 | 3300046472 | Ga0495580_0008529 | Ga0495580_0008529_1188_2438 | 416 |
| 721 | 3300046472 | Ga0495580_0009825 | Ga0495580_0009825_2285_3535 | 416 |
| 722 | 3300046472 | Ga0495580_0011040 | Ga0495580_0011040_4822_6120 | 416 |
| 723 | 3300046472 | Ga0495580_0183263 | Ga0495580_0183263_27_1277 | 416 |
| 724 | 3300046473 | Ga0495582_0018014 | Ga0495582_0018014_2137_3387 | 416 |
| 725 | 3300046474 | Ga0495605_0009236 | Ga0495605_0009236_3465_4715 | 416 |
| 726 | 3300046474 | Ga0495605_0013347 | Ga0495605_0013347_1058_2326 | 416 |
| 727 | 3300046474 | Ga0495605_0018915 | Ga0495605_0018915_1779_3029 | 416 |
| 728 | 3300046474 | Ga0495605_0022628 | Ga0495605_0022628_1180_2478 | 416 |
| 729 | 3300046474 | Ga0495605_0034044 | Ga0495605_0034044_439_1689 | 416 |
| 730 | 3300046477 | Ga0495664_0014580 | Ga0495664_0014580_822_2072 | 416 |
| 731 | 3300046492 | Ga0495585_0037697 | Ga0495585_0037697_1166_2416 | 416 |
| 732 | 3300046500 | Ga0495596_0008448 | Ga0495596_0008448_1242_2492 | 416 |
| 733 | 3300046500 | Ga0495596_0011681 | Ga0495596_0011681_237_1487 | 416 |
| 734 | 3300046500 | Ga0495596_0020553 | Ga0495596_0020553_1174_2472 | 416 |
| 735 | 3300046501 | Ga0495607_0021514 | Ga0495607_0021514_1506_2756 | 416 |
| 736 | 3300046506 | Ga0495583_0004759 | Ga0495583_0004759_4573_5823 | 416 |
| 737 | 3300046506 | Ga0495583_0006177 | Ga0495583_0006177_1502_2770 | 416 |
| 738 | 3300046507 | Ga0495606_0009474 | Ga0495606_0009474_5214_6542 | 416 |
| 739 | 3300046507 | Ga0495606_0012297 | Ga0495606_0012297_3773_5023 | 416 |
| 740 | 3300046507 | Ga0495606_0049375 | Ga0495606_0049375_1012_2262 | 416 |
| 741 | 3300046507 | Ga0495606_0100766 | Ga0495606_0100766_485_1735 | 416 |
| 742 | 3300046511 | Ga0495608_0002588 | Ga0495608_0002588_10519_11769 | 416 |
| 743 | 3300046513 | Ga0495616_0015844 | Ga0495616_0015844_2446_3714 | 416 |
| 744 | 3300046515 | Ga0495620_0033951 | Ga0495620_0033951_989_2239 | 416 |
| 745 | 3300046516 | Ga0495628_0005506 | Ga0495628_0005506_6803_8251 | 416 |
| 746 | 3300046517 | Ga0495630_0008386 | Ga0495630_0008386_3498_4796 | 416 |
| 747 | 3300046517 | Ga0495630_0122643 | Ga0495630_0122643_69_1319 | 416 |
| 748 | 3300046526 | Ga0495666_0001199 | Ga0495666_0001199_3990_5240 | 416 |
| 749 | 3300046526 | Ga0495666_0020219 | Ga0495666_0020219_1692_2942 | 416 |
| 750 | 3300046526 | Ga0495666_0100462 | Ga0495666_0100462_27_1277 | 416 |
| 751 | 3300046528 | Ga0495642_0050858 | Ga0495642_0050858_249_1499 | 416 |
| 752 | 3300046529 | Ga0495652_0126398 | Ga0495652_0126398_93_1343 | 416 |
| 753 | 3300046530 | Ga0495654_0011167 | Ga0495654_0011167_3303_4553 | 416 |
| 754 | 3300046531 | Ga0495665_0017510 | Ga0495665_0017510_2348_3646 | 416 |
| 755 | 3300046533 | Ga0495640_0006347 | Ga0495640_0006347_474_1724 | 416 |
| 756 | 3300046535 | Ga0495586_0083545 | Ga0495586_0083545_116_1366 | 416 |
| 757 | 3300046543 | Ga0495645_0001234 | Ga0495645_0001234_2969_4219 | 416 |
| 758 | 3300046642 | Ga0495634_0016709 | Ga0495634_0016709_1785_3035 | 416 |
| 759 | 3300046663 | Ga0495635_0000986 | Ga0495635_0000986_10233_11483 | 416 |
| 760 | 3300046665 | Ga0495661_0063515 | Ga0495661_0063515_759_2009 | 416 |
| 761 | 3300046679 | Ga0495623_0002524 | Ga0495623_0002524_5650_6900 | 416 |
| 762 | 3300046680 | Ga0495646_0004620 | Ga0495646_0004620_5956_7254 | 416 |
| 763 | 3300046684 | Ga0495669_0009470 | Ga0495669_0009470_1137_2387 | 416 |
| 764 | 3300046684 | Ga0495669_0076232 | Ga0495669_0076232_33_1283 | 416 |
| 765 | 3300046689 | Ga0495613_0029780 | Ga0495613_0029780_1340_2638 | 416 |
| 766 | 3300046689 | Ga0495613_0066860 | Ga0495613_0066860_1090_2340 | 416 |
| 767 | 3300046690 | Ga0495624_0003206 | Ga0495624_0003206_182_1432 | 416 |
| 768 | 3300046690 | Ga0495624_0007370 | Ga0495624_0007370_6267_7517 | 416 |
| 769 | 3300046690 | Ga0495624_0008497 | Ga0495624_0008497_5563_6861 | 416 |
| 770 | 3300046690 | Ga0495624_0041803 | Ga0495624_0041803_541_1791 | 416 |
| 771 | 3300046691 | Ga0495670_0014585 | Ga0495670_0014585_2012_3262 | 416 |
| 772 | 3300046692 | Ga0495671_0021994 | Ga0495671_0021994_1031_2329 | 416 |
| 773 | 3300046694 | Ga0495649_0001094 | Ga0495649_0001094_9140_10468 | 416 |
| 774 | 3300046694 | Ga0495649_0006432 | Ga0495649_0006432_1218_2468 | 416 |
| 775 | 3300046694 | Ga0495649_0027513 | Ga0495649_0027513_985_2253 | 416 |
| 776 | 3300046694 | Ga0495649_0053665 | Ga0495649_0053665_95_1345 | 416 |
| 777 | 3300046694 | Ga0495649_0071968 | Ga0495649_0071968_575_1825 | 416 |
| 778 | 3300046794 | Ga0495589_0027902 | Ga0495589_0027902_448_1698 | 416 |
| 779 | 3300047315 | Ga0495581_0009419 | Ga0495581_0009419_401_1651 | 416 |
| 780 | 3300047315 | Ga0495581_0014655 | Ga0495581_0014655_1335_2585 | 416 |
| 781 | 3300047317 | Ga0495604_0008712 | Ga0495604_0008712_6617_7867 | 416 |
| 782 | 3300047319 | Ga0495674_0004487 | Ga0495674_0004487_2619_3905 | 416 |
| 783 | 3300047319 | Ga0495674_0006941 | Ga0495674_0006941_3946_5244 | 416 |
| 784 | 3300047319 | Ga0495674_0014053 | Ga0495674_0014053_1752_3002 | 416 |
| 785 | 3300047319 | Ga0495674_0032066 | Ga0495674_0032066_1329_2579 | 416 |
| 786 | 3300047319 | Ga0495674_0035427 | Ga0495674_0035427_2469_3767 | 416 |
| 787 | 3300047319 | Ga0495674_0038188 | Ga0495674_0038188_180_1430 | 416 |
| 788 | 3300047319 | Ga0495674_0049395 | Ga0495674_0049395_1445_2713 | 416 |
| 789 | 3300047319 | Ga0495674_0049782 | Ga0495674_0049782_165_1415 | 416 |
| 790 | 3300047320 | Ga0495672_0037033 | Ga0495672_0037033_579_1877 | 416 |
| 791 | 3300047321 | Ga0495676_0113531 | Ga0495676_0113531_461_1759 | 416 |
| 792 | 3300047322 | Ga0495680_0026016 | Ga0495680_0026016_2234_3484 | 416 |
| 793 | 3300047322 | Ga0495680_0075404 | Ga0495680_0075404_1161_2411 | 416 |
| 794 | 3300047323 | Ga0495683_0006554 | Ga0495683_0006554_4819_6069 | 416 |
| 795 | 3300047323 | Ga0495683_0014346 | Ga0495683_0014346_1477_2775 | 416 |
| 796 | 3300047323 | Ga0495683_0022445 | Ga0495683_0022445_1134_2402 | 416 |
| 797 | 3300047443 | Ga0495687_000419 | Ga0495687_000419_13803_15083 | 416 |
| 798 | 3300047443 | Ga0495687_005432 | Ga0495687_005432_6401_7651 | 416 |
| 799 | 3300047443 | Ga0495687_029501 | Ga0495687_029501_1067_2317 | 416 |
| 800 | 3300047444 | Ga0495675_0075232 | Ga0495675_0075232_381_1631 | 416 |
| 801 | 3300047445 | Ga0495677_0060041 | Ga0495677_0060041_140_1390 | 416 |
| 802 | 3300047446 | Ga0495679_000023 | Ga0495679_000023_138023_139321 | 416 |
| 803 | 3300047446 | Ga0495679_001555 | Ga0495679_001555_11520_12770 | 416 |
| 804 | 3300047446 | Ga0495679_032091 | Ga0495679_032091_307_1557 | 416 |
| 805 | 3300047469 | Ga0495673_0008551 | Ga0495673_0008551_2969_4237 | 416 |
| 806 | 3300047469 | Ga0495673_0012722 | Ga0495673_0012722_464_1762 | 416 |
| 807 | 3300047471 | Ga0495684_0045511 | Ga0495684_0045511_1064_2314 | 416 |
| 808 | 3300047471 | Ga0495684_0050822 | Ga0495684_0050822_417_1667 | 416 |
| 809 | 3300047472 | Ga0495686_0000540 | Ga0495686_0000540_11457_12920 | 416 |
| 810 | 3300047472 | Ga0495686_0029484 | Ga0495686_0029484_43_1293 | 416 |
| 811 | 3300047673 | Ga0495593_0001681 | Ga0495593_0001681_11085_12383 | 416 |
| 812 | 3300047673 | Ga0495593_0027471 | Ga0495593_0027471_1643_2893 | 416 |
| 813 | 3300048089 | Ga0495614_0002282 | Ga0495614_0002282_6582_7832 | 416 |
| 814 | 3300048091 | Ga0495626_0013389 | Ga0495626_0013389_747_1997 | 416 |
| 815 | 3300048091 | Ga0495626_0067956 | Ga0495626_0067956_257_1507 | 416 |
| 816 | 3300048903 | Ga0496100_0022940 | Ga0496100_0022940_193_1464 | 416 |
| 817 | 3300048903 | Ga0496100_0127650 | Ga0496100_0127650_249_1499 | 416 |
| 818 | 3300048904 | Ga0496101_0005429 | Ga0496101_0005429_6774_8045 | 416 |
| 819 | 3300048904 | Ga0496101_0006077 | Ga0496101_0006077_6128_7396 | 416 |
| 820 | 3300048905 | Ga0496102_0002104 | Ga0496102_0002104_211_1482 | 416 |
| 821 | 3300048905 | Ga0496102_0014872 | Ga0496102_0014872_5037_6287 | 416 |
| 822 | 3300048905 | Ga0496102_0224552 | Ga0496102_0224552_197_1495 | 416 |
| 823 | 3300048906 | Ga0496103_0002058 | Ga0496103_0002058_3288_4559 | 416 |
| 824 | 3300048906 | Ga0496103_0017942 | Ga0496103_0017942_1870_3120 | 416 |
| 825 | 3300048907 | Ga0496104_0031075 | Ga0496104_0031075_1503_2753 | 416 |
| 826 | 3300048907 | Ga0496104_0068607 | Ga0496104_0068607_174_1445 | 416 |
| 827 | 3300048908 | Ga0496105_0088283 | Ga0496105_0088283_1268_2536 | 416 |
| 828 | 3300048909 | Ga0496106_0020212 | Ga0496106_0020212_2143_3393 | 416 |
| 829 | 3300048910 | Ga0496107_0248178 | Ga0496107_0248178_62_1312 | 416 |
| 830 | 3300048916 | Ga0496113_0066817 | Ga0496113_0066817_885_2153 | 416 |
| 831 | 3300048917 | Ga0496114_0013986 | Ga0496114_0013986_4367_5617 | 416 |
| 832 | 3300048917 | Ga0496114_0047284 | Ga0496114_0047284_2289_3539 | 416 |
| 833 | 3300048918 | Ga0496115_0061025 | Ga0496115_0061025_1758_3026 | 416 |
| 834 | 3300048919 | Ga0496116_0020794 | Ga0496116_0020794_3666_4916 | 416 |
| 835 | 3300048920 | Ga0496117_0005798 | Ga0496117_0005798_9713_10984 | 416 |
| 836 | 3300048920 | Ga0496117_0096298 | Ga0496117_0096298_28_1326 | 416 |
| 837 | 3300048921 | Ga0496118_0002552 | Ga0496118_0002552_12397_13647 | 416 |
| 838 | 3300048921 | Ga0496118_0004263 | Ga0496118_0004263_14292_15563 | 416 |
| 839 | 3300048921 | Ga0496118_0009356 | Ga0496118_0009356_168_1466 | 416 |
| 840 | 3300048921 | Ga0496118_0012795 | Ga0496118_0012795_5648_6898 | 416 |
| 841 | 3300048921 | Ga0496118_0160785 | Ga0496118_0160785_93_1343 | 416 |
| 842 | 3300048924 | Ga0496121_0002288 | Ga0496121_0002288_14347_15597 | 416 |
| 843 | 3300048924 | Ga0496121_0011728 | Ga0496121_0011728_5471_6742 | 416 |
| 844 | 3300048924 | Ga0496121_0015965 | Ga0496121_0015965_295_1563 | 416 |
| 845 | 3300048924 | Ga0496121_0028418 | Ga0496121_0028418_3582_4832 | 416 |
| 846 | 3300048924 | Ga0496121_0030932 | Ga0496121_0030932_1554_2804 | 416 |
| 847 | 3300048925 | Ga0496122_0064974 | Ga0496122_0064974_1008_2279 | 416 |
| 848 | 3300048926 | Ga0496123_0055509 | Ga0496123_0055509_146_1417 | 416 |
| 849 | 3300048928 | Ga0496125_0112109 | Ga0496125_0112109_674_1945 | 416 |
| 850 | 3300048929 | Ga0496126_0000538 | Ga0496126_0000538_36448_37698 | 416 |
| 851 | 3300048929 | Ga0496126_0002311 | Ga0496126_0002311_13115_14365 | 416 |
| 852 | 3300048929 | Ga0496126_0008981 | Ga0496126_0008981_3486_4736 | 416 |
| 853 | 3300049459 | Ga0495678_008464 | Ga0495678_008464_1656_2906 | 416 |
| 854 | 3300049460 | Ga0495682_0058461 | Ga0495682_0058461_115_1365 | 416 |
| 855 | iso_pu_bacteria | 2501025501 | 2501075098 | 416 |
| 856 | iso_pu_bacteria | 2501025504 | 2501412718 | 416 |
| 857 | iso_pu_bacteria | 2510917014 | 2511099864 | 416 |
| 858 | iso_pu_bacteria | 2510917015 | 2511102351 | 416 |
| 859 | iso_pu_bacteria | 2856287931 | 2856289320 | 416 |
| 860 | iso_pu_bacteria | 2857357740 | 2857362178 | 416 |
| 861 | iso_pu_bacteria | 2900634093 | 2900634623 | 416 |
| 862 | iso_pu_bacteria | 2928157003 | 2928163176 | 416 |
| 863 | iso_pu_bacteria | 2928163908 | 2928170078 | 416 |
| 864 | iso_pu_bacteria | 2981990288 | 2981995973 | 416 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5obu-assembly1.cif.gz_A | mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with amppnp. | 0.8353 | 1 | 416 |
| 6w6e-assembly1.cif.gz_I | the mycobacterium tuberculosis clpb disaggregase hexamer structure with a locally refined clpb middle domain and a dnak nucleotide binding domain | 0.8311 | 2 | 414 |
| 5obv-assembly1.cif.gz_A | mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with adp and pi. | 0.8303 | 1 | 416 |
| 4rtf-assembly1.cif.gz_D | crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv | 0.828 | 4 | 414 |
| 5oby-assembly1.cif.gz_A | mycoplasma genitalium dnak-nbd in complex with amp-pnp | 0.8258 | 1 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36928_307_378_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9351 | 271 | 340 | 3.30.420.40 |
| af_P36928_307_378_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.899 | 271 | 340 | 3.30.420.40 |
| af_A0A368UHA7_9_69_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8865 | 6 | 57 | 3.30.420.40 |
| 3d2eC01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8854 | 1 | 170 | 3.30.420.40 |
| 3d2eC03 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8619 | 173 | 395 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435E0U6-F1-model_v4 | Hsp70 family protein | 0.9809 | 2 | 156 |
GO:0005524
GO:0140662 |
| AF-A0A2D6ENX0-F1-model_v4 | Heat-shock protein | 0.9773 | 1 | 416 |
GO:0005524
GO:0140662 |
| AF-F0GJD4-F1-model_v4 | Molecular chaperone-like protein | 0.975 | 180 | 339 |
|
| AF-A0A2D6ENX0-F1-model_v4 | Heat-shock protein | 0.975 | 1 | 416 |
GO:0005524
GO:0140662 |
| AF-F0GJD4-F1-model_v4 | Molecular chaperone-like protein | 0.9574 | 180 | 339 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar