F483973

General Info

Members Datasets Scaffolds Average Seq Length
864 410 771 424

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_002855|Ga0500618_002855_4475_6013
Length 501
Sequence MPPRVFLSKIRQNQNTSFVNRNNVFPPLFDSFDCPHRLIVLKTLIHLHVQLIGRACDLTTQRRPIGESAHQAACNSALPDDLPPNIAEFRIMTFCAIDFGTSNSALALPALPSTNPDGSRLIALEGANRTLPTAVFFNADEHTQAFGRAAIAEYIDGYDGRLMRSLKSILGSPLALGSTEIGDGSALPFLDIIALFLEHLMKSARRAAGGPVDRAVMGRPVFFVDDDPKAARSVGLKEVVFQFEPIAAAFDYESRLDEERIVLVVDIGGGTSDFSLVRVGPQRIARLDRRDDVLGHHGVHVAGTDIDKRVALSSVMRELGYRSIDVEGREVPNRIYFDLATWHLVNTVYGVRRMAEFKLMRHIYADEAYPSRLERVFDHRLGHALIGVAEGAKIAVSAGGETAIDLHLIEDGLATEFDATRLAEASAEETHRIVAAALDTARQAGIAPQDVSALYFTGGSTGLKFLSSAISAAFPAAVAVHGDPLASVAKGLGIYAERVFG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
20 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
21 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
22 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
23 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
24 2643221585 Pelomonas sp. Root662 Isolate Unclassified
25 2643221591 Devosia sp. Root685 Isolate Unclassified
26 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
27 2643221656 Pelomonas sp. Root405 Isolate Unclassified
28 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
29 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
30 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
31 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
32 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
33 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
34 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
35 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
36 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
37 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
38 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
39 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
40 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
41 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
42 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
43 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
44 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
45 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
46 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
47 2818991450 Burkholderia sp. 604 Isolate Unclassified
48 2818991452 Burkholderia cepacia 561 Isolate Unclassified
49 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
50 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
51 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
52 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
53 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
54 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
55 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
56 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
57 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
58 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
59 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
60 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
61 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
62 2904564687 Burkholderia sp. 571 Isolate Unclassified
63 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
64 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
65 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
66 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
67 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
68 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
69 2928163908 Burkholderia sp. 567 Isolate Unclassified
70 2928170801 Burkholderia sp. 572 Isolate Unclassified
71 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
72 2928536128 Burkholderia sola 565 Isolate Unclassified
73 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
74 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
75 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
76 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
77 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
80 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
83 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
84 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
85 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
86 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
87 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
88 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
89 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
90 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
91 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
92 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
93 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
94 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
98 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
101 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
102 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
103 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
104 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
108 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
109 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
110 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
111 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
112 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
115 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
116 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
117 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
120 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
121 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
122 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
123 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
127 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
128 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
131 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
135 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
136 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
139 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
140 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
141 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
142 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
143 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
147 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
160 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
161 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
249 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
252 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
253 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
267 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
268 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
274 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
277 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
278 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
279 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
301 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
302 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
303 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
304 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
309 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
312 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
348 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
376 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
385 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
389 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
390 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
391 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
392 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
393 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
396 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
397 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
398 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
399 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
400 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
401 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
402 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
403 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
404 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
405 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
406 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
407 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
408 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
409 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
410 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 0
Isolates 10.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 2.2
Rhizoplane 5.44
Rhizosphere 72.22
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001229 3300001989 Bacteria 9626
2 JGI24739J22299_10007347 3300001989 Bacteria 4137
3 JGI24737J22298_10006947 3300001990 Bacteria 3838
4 JGI24735J21928_10000114 3300002067 Bacteria 29422
5 JGI24735J21928_10000535 3300002067 Bacteria 13420
6 JGI24738J21930_10002284 3300002075 Bacteria 5070
7 JGI25156J39149_1001087 3300002705 Bacteria 12480
8 JGI25156J39149_1001828 3300002705 Bacteria 8334
9 JGI25156J39149_1003877 3300002705 Bacteria 4748
10 JGI25157J39369_1000341 3300002741 Bacteria 33014
11 JGI25165J46597_1001604 3300003214 Bacteria 10840
12 rootH1_10013471 3300003316 Bacteria 2011
13 rootH1_10013482 3300003316 Bacteria 2247
14 rootH2_10025596 3300003320 Bacteria 5978
15 rootL2_10000022 3300003322 Bacteria 23388
16 rootL2_10032325 3300003322 Bacteria 2280
17 rootL2_10143345 3300003322 Bacteria 2871
18 rootH1_10003329 3300003323 Bacteria 20992
19 rootH1_10035876 3300003323 Bacteria 3021
20 rootH1_10049978 3300003323 Bacteria 4068
21 Ga0055539_1000414 3300003752 Bacteria 16123
22 Ga0055533_1000048 3300003756 Bacteria 212106
23 Ga0055533_1000068 3300003756 Bacteria 155215
24 Ga0055533_1000645 3300003756 Bacteria 11726
25 Ga0055533_1005548 3300003756 Bacteria 2008
26 Ga0055532_1000092 3300003758 Bacteria 103243
27 Ga0055525_1000036 3300003759 Bacteria 298878
28 Ga0055527_1000035 3300003760 Bacteria 138481
29 Ga0055527_1000575 3300003760 Bacteria 11999
30 Ga0055535_1000050 3300003761 Bacteria 138481
31 Ga0055535_1000252 3300003761 Bacteria 56714
32 Ga0055542_1000120 3300003762 Bacteria 103243
33 Ga0055529_1000089 3300003763 Bacteria 138481
34 Ga0055529_1000150 3300003763 Bacteria 99993
35 Ga0055529_1000883 3300003763 Bacteria 17034
36 Ga0055528_1001636 3300003790 Bacteria 13188
37 Ga0055531_10011470 3300003794 Bacteria 4267
38 Ga0058692_1009755 3300003856 Bacteria 2405
39 Ga0065165_1000648 3300005262 Bacteria 50260
40 Ga0070658_10005242 3300005327 Bacteria 10534
41 Ga0070658_10018761 3300005327 Bacteria 5541
42 Ga0070658_10077601 3300005327 Bacteria 2725
43 Ga0070658_10125676 3300005327 Bacteria 2134
44 Ga0070658_10135448 3300005327 Bacteria 2055
45 Ga0070676_10005469 3300005328 Bacteria 6766
46 Ga0070676_10008522 3300005328 Bacteria 5526
47 Ga0070676_10012132 3300005328 Bacteria 4698
48 Ga0070676_10014500 3300005328 Bacteria 4333
49 Ga0070690_100067482 3300005330 Bacteria 2318
50 Ga0070670_100008507 3300005331 Bacteria 8752
51 Ga0070670_100038836 3300005331 Bacteria 4093
52 Ga0070677_10030348 3300005333 Bacteria 2058
53 Ga0068869_100003849 3300005334 Bacteria 9258
54 Ga0068868_100004217 3300005338 Bacteria 10058
55 Ga0068868_100008329 3300005338 Bacteria 7419
56 Ga0068868_100101223 3300005338 Bacteria 2332
57 Ga0070660_100000144 3300005339 Bacteria 45562
58 Ga0070660_100011520 3300005339 Bacteria 6290
59 Ga0070660_100011761 3300005339 Bacteria 6232
60 Ga0070668_100016481 3300005347 Bacteria 5525
61 Ga0070669_100010392 3300005353 Bacteria 6609
62 Ga0070675_100000289 3300005354 Bacteria 33460
63 Ga0070675_100002040 3300005354 Bacteria 14995
64 Ga0070675_100002486 3300005354 Bacteria 13794
65 Ga0070675_100081164 3300005354 Bacteria 2704
66 Ga0070671_100000158 3300005355 Bacteria 44456
67 Ga0070671_100001245 3300005355 Bacteria 19079
68 Ga0070671_100038161 3300005355 Bacteria 3988
69 Ga0070671_100068975 3300005355 Bacteria 2949
70 Ga0070674_100004464 3300005356 Bacteria 7980
71 Ga0070674_100020277 3300005356 Bacteria 4242
72 Ga0070674_100034669 3300005356 Bacteria 3373
73 Ga0070673_100014996 3300005364 Bacteria 5423
74 Ga0070673_100056244 3300005364 Bacteria 3103
75 Ga0070659_100000156 3300005366 Bacteria 52480
76 Ga0070659_100016174 3300005366 Bacteria 5597
77 Ga0070659_100020101 3300005366 Bacteria 5070
78 Ga0070667_100007319 3300005367 Bacteria 9174
79 Ga0070667_100014781 3300005367 Bacteria 6449
80 Ga0070667_100025925 3300005367 Bacteria 4876
81 Ga0070700_100041725 3300005441 Bacteria 2814
82 Ga0070663_100007485 3300005455 Bacteria 6648
83 Ga0070663_100009183 3300005455 Bacteria 6113
84 Ga0070663_100011786 3300005455 Bacteria 5504
85 Ga0070678_100030616 3300005456 Bacteria 3702
86 Ga0070678_100074496 3300005456 Bacteria 2551
87 Ga0070678_100222162 3300005456 Bacteria 1571
88 Ga0070662_100005185 3300005457 Bacteria 8313
89 Ga0070662_100010999 3300005457 Bacteria 5963
90 Ga0070662_100035146 3300005457 Bacteria 3537
91 Ga0068867_100016036 3300005459 Bacteria 5318
92 Ga0068867_100074147 3300005459 Bacteria 2550
93 Ga0070685_10014350 3300005466 Bacteria 4196
94 Ga0070706_100000873 3300005467 Bacteria 33089
95 Ga0070707_100047413 3300005468 Bacteria 4114
96 Ga0070684_100259765 3300005535 Bacteria 1589
97 Ga0068853_100028409 3300005539 Bacteria 4704
98 Ga0068853_100155020 3300005539 Bacteria 2063
99 Ga0070672_100001393 3300005543 Bacteria 14909
100 Ga0070672_100007786 3300005543 Bacteria 7308
101 Ga0070693_100015902 3300005547 Bacteria 3883
102 Ga0070665_100000449 3300005548 Bacteria 59974
103 Ga0068855_100002740 3300005563 Bacteria 21700
104 Ga0068855_100004044 3300005563 Bacteria 17897
105 Ga0068855_100013478 3300005563 Bacteria 9855
106 Ga0068855_100018189 3300005563 Bacteria 8443
107 Ga0068855_100070586 3300005563 Bacteria 4063
108 Ga0070664_100058655 3300005564 Bacteria 3274
109 Ga0070664_100078849 3300005564 Bacteria 2833
110 Ga0068857_100030365 3300005577 Bacteria 4772
111 Ga0068857_100211128 3300005577 Bacteria 1771
112 Ga0068856_100003535 3300005614 Bacteria 15759
113 Ga0068856_100046209 3300005614 Bacteria 4289
114 Ga0068856_100105703 3300005614 Bacteria 2809
115 Ga0068856_100161365 3300005614 Bacteria 2252
116 Ga0068852_100005295 3300005616 Bacteria 9212
117 Ga0068852_100008251 3300005616 Bacteria 7660
118 Ga0068852_100037364 3300005616 Bacteria 4070
119 Ga0068852_100037797 3300005616 Bacteria 4051
120 Ga0068852_100088525 3300005616 Bacteria 2765
121 Ga0068864_100001456 3300005618 Bacteria 19511
122 Ga0068864_100005493 3300005618 Bacteria 10390
123 Ga0068864_100026924 3300005618 Bacteria 4850
124 Ga0068864_100032542 3300005618 Bacteria 4431
125 Ga0068861_100001086 3300005719 Bacteria 16821
126 Ga0068861_100056839 3300005719 Bacteria 2987
127 Ga0068861_100110832 3300005719 Bacteria 2198
128 Ga0068851_10009506 3300005834 Bacteria 4524
129 Ga0068851_10035389 3300005834 Bacteria 2496
130 Ga0068863_100002575 3300005841 Bacteria 17979
131 Ga0068863_100030532 3300005841 Bacteria 5145
132 Ga0068863_100080377 3300005841 Bacteria 3087
133 Ga0068858_100000259 3300005842 Bacteria 56570
134 Ga0068858_100005411 3300005842 Bacteria 12510
135 Ga0068858_100039138 3300005842 Bacteria 4398
136 Ga0068858_100065389 3300005842 Bacteria 3365
137 Ga0068860_100011221 3300005843 Bacteria 8831
138 Ga0068860_100178984 3300005843 Bacteria 2050
139 Ga0068862_100024393 3300005844 Bacteria 5074
140 Ga0075368_10056181 3300006042 Bacteria 1570
141 Ga0075367_10023384 3300006178 Bacteria 3476
142 Ga0075366_10050472 3300006195 Bacteria 2470
143 Ga0097621_100027144 3300006237 Bacteria 4499
144 Ga0097621_100084226 3300006237 Bacteria 2650
145 Ga0097621_100127022 3300006237 Bacteria 2167
146 Ga0075370_10002167 3300006353 Bacteria 8999
147 Ga0068871_100003953 3300006358 Bacteria 10231
148 Ga0068871_100009997 3300006358 Bacteria 6896
149 Ga0068871_100013951 3300006358 Bacteria 5975
150 Ga0068865_100020199 3300006881 Bacteria 4319
151 Ga0099823_1000003 3300006944 Bacteria 189058
152 Ga0105251_10000758 3300009011 Bacteria 29449
153 Ga0105251_10001262 3300009011 Bacteria 21860
154 Ga0105240_10001922 3300009093 Bacteria 34528
155 Ga0105240_10029364 3300009093 Bacteria 7165
156 Ga0105240_10031832 3300009093 Bacteria 6834
157 Ga0105240_10121643 3300009093 Bacteria 3142
158 Ga0105240_10128415 3300009093 Bacteria 3043
159 Ga0105240_10156360 3300009093 Bacteria 2711
160 Ga0105240_10226800 3300009093 Bacteria 2173
161 Ga0105245_10020932 3300009098 Bacteria 5734
162 Ga0105245_10108902 3300009098 Bacteria 2574
163 Ga0105243_10050239 3300009148 Bacteria 3294
164 Ga0105241_10047670 3300009174 Bacteria 3259
165 Ga0105242_10022980 3300009176 Bacteria 4912
166 Ga0105242_10034621 3300009176 Bacteria 4049
167 Ga0105248_10001469 3300009177 Bacteria 26234
168 Ga0105248_10007710 3300009177 Bacteria 11822
169 Ga0105248_10014364 3300009177 Bacteria 8714
170 Ga0105248_10033206 3300009177 Bacteria 5764
171 Ga0105248_10041858 3300009177 Bacteria 5136
172 Ga0105248_10063036 3300009177 Bacteria 4160
173 Ga0105248_10178667 3300009177 Bacteria 2392
174 Ga0105237_10021860 3300009545 Bacteria 6571
175 Ga0105237_10406141 3300009545 Bacteria 1367
176 Ga0105238_10003750 3300009551 Bacteria 15099
177 Ga0105238_10030242 3300009551 Bacteria 5512
178 Ga0105238_10031327 3300009551 Bacteria 5413
179 Ga0105238_10108170 3300009551 Bacteria 2761
180 Ga0105238_10149896 3300009551 Bacteria 2307
181 Ga0105249_10031828 3300009553 Bacteria 4772
182 Ga0105239_10003468 3300010375 Bacteria 19297
183 Ga0105239_10094132 3300010375 Bacteria 3309
184 Ga0157371_10008450 3300013102 Bacteria 8197
185 Ga0157370_10000439 3300013104 Bacteria 51955
186 Ga0157370_10002253 3300013104 Bacteria 23432
187 Ga0157369_10000410 3300013105 Bacteria 56813
188 Ga0157369_10001007 3300013105 Bacteria 35470
189 Ga0157369_10002529 3300013105 Bacteria 21858
190 Ga0157369_10157497 3300013105 Bacteria 2398
191 Ga0157374_10000146 3300013296 Bacteria 64549
192 Ga0157374_10002254 3300013296 Bacteria 16245
193 Ga0157374_10108736 3300013296 Bacteria 2665
194 Ga0157374_10361070 3300013296 Bacteria 1444
195 Ga0157378_10133474 3300013297 Bacteria 2300
196 Ga0163162_10000877 3300013306 Bacteria 28017
197 Ga0163162_10051354 3300013306 Bacteria 4138
198 Ga0157372_10000323 3300013307 Bacteria 52602
199 Ga0157372_10013139 3300013307 Bacteria 8834
200 Ga0157375_10002349 3300013308 Bacteria 16343
201 Ga0157375_10029847 3300013308 Bacteria 5133
202 Ga0157375_10030968 3300013308 Bacteria 5050
203 Ga0163163_10001655 3300014325 Bacteria 18774
204 Ga0157380_10175014 3300014326 Bacteria 1879
205 Ga0157379_10010791 3300014968 Bacteria 7963
206 Ga0157379_10021975 3300014968 Bacteria 5653
207 Ga0157379_10191344 3300014968 Bacteria 1849
208 Ga0157376_10007994 3300014969 Bacteria 7592
209 Ga0157376_10010441 3300014969 Bacteria 6793
210 Ga0182007_10003995 3300015262 Bacteria 6804
211 Ga0182005_1030737 3300015265 Bacteria 1463
212 Ga0183361_10015 3300016635 Bacteria 166772
213 Ga0163161_10006231 3300017792 Bacteria 8264
214 Ga0213872_10000021 3300021361 Bacteria 158749
215 Ga0213872_10000022 3300021361 Bacteria 158011
216 Ga0209566_101192 3300025225 Bacteria 9260
217 Ga0209674_100024 3300025226 Bacteria 535481
218 Ga0209674_100153 3300025226 Bacteria 94333
219 Ga0209674_100671 3300025226 Bacteria 12214
220 Ga0209672_100054 3300025228 Bacteria 222217
221 Ga0209672_100072 3300025228 Bacteria 167942
222 Ga0209672_100073 3300025228 Bacteria 166621
223 Ga0209672_100185 3300025228 Bacteria 50385
224 Ga0209147_100085 3300025229 Bacteria 185813
225 Ga0209147_100093 3300025229 Bacteria 167196
226 Ga0209147_100100 3300025229 Bacteria 162747
227 Ga0209147_100278 3300025229 Bacteria 44611
228 Ga0209563_100101 3300025230 Bacteria 152297
229 Ga0207427_100866 3300025231 Bacteria 13407
230 Ga0209258_100080 3300025242 Bacteria 255287
231 Ga0209258_100140 3300025242 Bacteria 167245
232 Ga0209258_100168 3300025242 Bacteria 145329
233 Ga0209258_100331 3300025242 Bacteria 71624
234 Ga0209258_101186 3300025242 Bacteria 10492
235 Ga0209646_1000012 3300025246 Bacteria 573300
236 Ga0209026_1000004 3300025250 Bacteria 949012
237 Ga0209677_100091 3300025253 Bacteria 106743
238 Ga0209677_100150 3300025253 Bacteria 64346
239 Ga0209677_100509 3300025253 Bacteria 21760
240 Ga0209148_1000140 3300025254 Bacteria 166819
241 Ga0209759_1000003 3300025256 Bacteria 792130
242 Ga0209759_1000067 3300025256 Bacteria 183764
243 Ga0209759_1000195 3300025256 Bacteria 96092
244 Ga0209759_1000329 3300025256 Bacteria 62253
245 Ga0209759_1000351 3300025256 Bacteria 59891
246 Ga0209759_1000827 3300025256 Bacteria 24481
247 Ga0209759_1000945 3300025256 Bacteria 20847
248 Ga0209759_1013933 3300025256 Bacteria 2151
249 Ga0209759_1014092 3300025256 Bacteria 2132
250 Ga0209233_1000173 3300025261 Bacteria 145995
251 Ga0209455_1000030 3300025272 Bacteria 533479
252 Ga0209455_1000125 3300025272 Bacteria 166819
253 Ga0209455_1000279 3300025272 Bacteria 55567
254 Ga0209673_1000098 3300025273 Bacteria 193352
255 Ga0209673_1022252 3300025273 Bacteria 2192
256 Ga0209564_1010959 3300025295 Bacteria 4114
257 Ga0209050_1003447 3300025298 Bacteria 11647
258 Ga0209256_1001730 3300025299 Bacteria 20913
259 Ga0207426_1000199 3300025302 Bacteria 145826
260 Ga0209051_1004239 3300025303 Bacteria 8937
261 Ga0209257_1013559 3300025304 Bacteria 3608
262 Ga0207656_10005850 3300025321 Bacteria 4382
263 Ga0207656_10007084 3300025321 Bacteria 4072
264 Ga0207656_10018683 3300025321 Bacteria 2732
265 Ga0207713_1000186 3300025735 Bacteria 87336
266 Ga0207713_1026239 3300025735 Bacteria 2674
267 Ga0207682_10004849 3300025893 Bacteria 5565
268 Ga0207688_10008118 3300025901 Bacteria 5706
269 Ga0207688_10008981 3300025901 Bacteria 5441
270 Ga0207680_10028032 3300025903 Bacteria 3145
271 Ga0207647_10000126 3300025904 Bacteria 59628
272 Ga0207647_10002464 3300025904 Bacteria 14022
273 Ga0207647_10003041 3300025904 Bacteria 12605
274 Ga0207647_10021302 3300025904 Bacteria 4329
275 Ga0207647_10030780 3300025904 Bacteria 3459
276 Ga0207645_10010523 3300025907 Bacteria 6353
277 Ga0207645_10017533 3300025907 Bacteria 4723
278 Ga0207645_10130543 3300025907 Bacteria 1635
279 Ga0207705_10000841 3300025909 Bacteria 25146
280 Ga0207705_10061699 3300025909 Bacteria 2708
281 Ga0207705_10162409 3300025909 Bacteria 1679
282 Ga0207684_10006340 3300025910 Bacteria 10788
283 Ga0207695_10000971 3300025913 Bacteria 51107
284 Ga0207695_10004600 3300025913 Bacteria 18738
285 Ga0207695_10005877 3300025913 Bacteria 16101
286 Ga0207695_10224610 3300025913 Bacteria 1784
287 Ga0207671_10009292 3300025914 Bacteria 8233
288 Ga0207657_10000096 3300025919 Bacteria 85043
289 Ga0207657_10011541 3300025919 Bacteria 8770
290 Ga0207657_10017325 3300025919 Bacteria 6911
291 Ga0207657_10025683 3300025919 Bacteria 5427
292 Ga0207657_10058343 3300025919 Bacteria 3322
293 Ga0207681_10001527 3300025923 Bacteria 14917
294 Ga0207681_10047020 3300025923 Bacteria 2904
295 Ga0207694_10046481 3300025924 Bacteria 3355
296 Ga0207650_10015466 3300025925 Bacteria 5314
297 Ga0207659_10003345 3300025926 Bacteria 9615
298 Ga0207659_10008152 3300025926 Bacteria 6485
299 Ga0207687_10011763 3300025927 Bacteria 5726
300 Ga0207644_10000042 3300025931 Bacteria 112685
301 Ga0207644_10002231 3300025931 Bacteria 12574
302 Ga0207644_10030996 3300025931 Bacteria 3724
303 Ga0207690_10000074 3300025932 Bacteria 87516
304 Ga0207690_10004028 3300025932 Bacteria 8678
305 Ga0207690_10019260 3300025932 Bacteria 4199
306 Ga0207690_10156025 3300025932 Bacteria 1697
307 Ga0207706_10005846 3300025933 Bacteria 11439
308 Ga0207686_10029246 3300025934 Bacteria 3248
309 Ga0207709_10027645 3300025935 Bacteria 3271
310 Ga0207709_10080988 3300025935 Bacteria 2092
311 Ga0207669_10096940 3300025937 Bacteria 1937
312 Ga0207669_10117912 3300025937 Bacteria 1795
313 Ga0207691_10018985 3300025940 Bacteria 6512
314 Ga0207691_10088071 3300025940 Bacteria 2784
315 Ga0207691_10128212 3300025940 Bacteria 2243
316 Ga0207711_10004500 3300025941 Bacteria 11878
317 Ga0207711_10011271 3300025941 Bacteria 7429
318 Ga0207711_10019217 3300025941 Bacteria 5689
319 Ga0207711_10039974 3300025941 Bacteria 3989
320 Ga0207711_10094057 3300025941 Bacteria 2641
321 Ga0207711_10134976 3300025941 Bacteria 2216
322 Ga0207689_10002702 3300025942 Bacteria 16400
323 Ga0207689_10016959 3300025942 Bacteria 6162
324 Ga0207661_10214939 3300025944 Bacteria 1696
325 Ga0207679_10061937 3300025945 Bacteria 2786
326 Ga0207679_10082688 3300025945 Bacteria 2459
327 Ga0207679_10114038 3300025945 Bacteria 2139
328 Ga0207679_10127450 3300025945 Bacteria 2036
329 Ga0207667_10011603 3300025949 Bacteria 10230
330 Ga0207667_10014189 3300025949 Bacteria 9092
331 Ga0207667_10018190 3300025949 Bacteria 7888
332 Ga0207667_10047603 3300025949 Bacteria 4538
333 Ga0207667_10074256 3300025949 Bacteria 3532
334 Ga0207667_10091752 3300025949 Bacteria 3137
335 Ga0207651_10002012 3300025960 Bacteria 9558
336 Ga0207651_10010282 3300025960 Bacteria 5177
337 Ga0207712_10016735 3300025961 Bacteria 4754
338 Ga0207668_10086755 3300025972 Bacteria 2287
339 Ga0207658_10016870 3300025986 Bacteria 5026
340 Ga0207658_10042895 3300025986 Bacteria 3285
341 Ga0207658_10043516 3300025986 Bacteria 3264
342 Ga0207677_10000498 3300026023 Bacteria 25465
343 Ga0207677_10004687 3300026023 Bacteria 7367
344 Ga0207703_10001748 3300026035 Bacteria 19439
345 Ga0207703_10026640 3300026035 Bacteria 4552
346 Ga0207703_10189629 3300026035 Bacteria 1820
347 Ga0207639_10006612 3300026041 Bacteria 7884
348 Ga0207678_10000061 3300026067 Bacteria 85413
349 Ga0207678_10077473 3300026067 Bacteria 2847
350 Ga0207708_10061685 3300026075 Bacteria 2863
351 Ga0207708_10081018 3300026075 Bacteria 2494
352 Ga0207702_10001911 3300026078 Bacteria 20342
353 Ga0207641_10002258 3300026088 Bacteria 17958
354 Ga0207641_10009577 3300026088 Bacteria 7981
355 Ga0207641_10031693 3300026088 Bacteria 4385
356 Ga0207641_10081318 3300026088 Bacteria 2813
357 Ga0207648_10011019 3300026089 Bacteria 8536
358 Ga0207648_10072782 3300026089 Bacteria 2995
359 Ga0207648_10189421 3300026089 Bacteria 1822
360 Ga0207648_10209599 3300026089 Bacteria 1729
361 Ga0207648_10234408 3300026089 Bacteria 1633
362 Ga0207676_10000660 3300026095 Bacteria 27633
363 Ga0207676_10010869 3300026095 Bacteria 6493
364 Ga0207676_10036534 3300026095 Bacteria 3738
365 Ga0207676_10145429 3300026095 Bacteria 2035
366 Ga0207674_10024284 3300026116 Bacteria 6480
367 Ga0207674_10049178 3300026116 Bacteria 4314
368 Ga0207675_100003111 3300026118 Bacteria 16274
369 Ga0207675_100003717 3300026118 Bacteria 14862
370 Ga0207675_100082236 3300026118 Bacteria 3020
371 Ga0207683_10003870 3300026121 Bacteria 12982
372 Ga0207683_10029618 3300026121 Bacteria 4740
373 Ga0207683_10072943 3300026121 Bacteria 3036
374 Ga0207698_10014920 3300026142 Bacteria 5184
375 Ga0207698_10021499 3300026142 Bacteria 4464
376 Ga0209371_1000141 3300027312 Bacteria 118767
377 Ga0209371_1001782 3300027312 Bacteria 13499
378 Ga0209970_1000308 3300027614 Bacteria 8052
379 Ga0268266_10000110 3300028379 Bacteria 171840
380 Ga0268265_10015132 3300028380 Bacteria 5272
381 Ga0268264_10035103 3300028381 Bacteria 4128
382 Ga0268264_10038718 3300028381 Bacteria 3936
383 Ga0268264_10278296 3300028381 Bacteria 1566
384 Ga0265336_10000030 3300028666 Bacteria 169335
385 Ga0307517_10068391 3300028786 Bacteria 3237
386 Ga0307515_10006245 3300028794 Bacteria 23915
387 Ga0265338_10000547 3300028800 Bacteria 65836
388 Ga0265324_10001751 3300029957 Bacteria 11936
389 Ga0268256_1000418 3300030500 Bacteria 38424
390 Ga0268256_1006262 3300030500 Bacteria 4461
391 Ga0265316_10064767 3300031344 Bacteria 2831
392 Ga0307408_100000422 3300031548 Bacteria 38013
393 Ga0307408_100182314 3300031548 Bacteria 1685
394 Ga0265313_10028117 3300031595 Bacteria 2929
395 Ga0307516_10004112 3300031730 Bacteria 18151
396 Ga0307516_10036065 3300031730 Bacteria 4953
397 Ga0307405_10005333 3300031731 Bacteria 6190
398 Ga0307405_10017781 3300031731 Bacteria 3909
399 Ga0307412_10000056 3300031911 Bacteria 145861
400 Ga0307409_100021088 3300031995 Bacteria 4459
401 Ga0307416_100006410 3300032002 Bacteria 7365
402 Ga0307416_100008384 3300032002 Bacteria 6663
403 Ga0307416_100165379 3300032002 Bacteria 2051
404 Ga0307414_10092059 3300032004 Bacteria 2255
405 Ga0307411_10062805 3300032005 Bacteria 2479
406 Ga0307411_10133060 3300032005 Bacteria 1821
407 Ga0373931_0008624 3300035691 Bacteria 4844
408 Ga0373931_0012132 3300035691 Bacteria 4171
409 Ga0373937_0314291 3300036401 Bacteria 1482
410 Ga0395899_0000080 3300037312 Bacteria 171568
411 Ga0395899_0122248 3300037312 Bacteria 1863
412 Ga0395899_0167878 3300037312 Bacteria 1547
413 Ga0395899_0248320 3300037312 Bacteria 1222
414 Ga0395900_0000087 3300037418 Bacteria 171568
415 Ga0395900_0000673 3300037418 Bacteria 45477
416 Ga0395900_0102356 3300037418 Bacteria 2942
417 Ga0395900_0103296 3300037418 Bacteria 2927
418 Ga0395900_0114951 3300037418 Bacteria 2762
419 Ga0395898_0000559 3300037466 Bacteria 69751
420 Ga0395898_0000679 3300037466 Bacteria 61481
421 Ga0395898_0009374 3300037466 Bacteria 10283
422 Ga0395898_0091789 3300037466 Bacteria 2921
423 Ga0395905_0000166 3300037471 Bacteria 108507
424 Ga0395905_0018424 3300037471 Bacteria 6626
425 Ga0395905_0084927 3300037471 Bacteria 2966
426 Ga0395901_0000053 3300038443 Bacteria 163807
427 Ga0395901_0000771 3300038443 Bacteria 35916
428 Ga0395901_0001663 3300038443 Bacteria 22943
429 Ga0395901_0088474 3300038443 Bacteria 3239
430 Ga0436365_1429793 3300039437 Bacteria 6961
431 Ga0436361_0354255 3300039447 Bacteria 247479
432 Ga0436361_0422241 3300039447 Bacteria 4417
433 Ga0436361_0446381 3300039447 Bacteria 3192
434 Ga0436361_0563595 3300039447 Bacteria 5414
435 Ga0436361_0675000 3300039447 Bacteria 73288
436 Ga0436361_0974052 3300039447 Bacteria 7812
437 Ga0439448_0000429 3300042005 Bacteria 9645
438 Ga0439464_0007495 3300042439 Bacteria 2854
439 Ga0466969_0000023 3300044656 Bacteria 97322
440 Ga0466969_0000833 3300044656 Bacteria 16765
441 Ga0466969_0002590 3300044656 Bacteria 9660
442 Ga0466969_0003181 3300044656 Bacteria 8752
443 Ga0466969_0008844 3300044656 Bacteria 5341
444 Ga0466969_0036269 3300044656 Bacteria 2491
445 Ga0466972_0003681 3300044658 Bacteria 7625
446 Ga0466972_0033238 3300044658 Bacteria 2530
447 Ga0466977_0056070 3300044666 Bacteria 2583
448 Ga0466965_0002202 3300044683 Bacteria 8202
449 Ga0466965_0005911 3300044683 Bacteria 5526
450 Ga0466965_0034444 3300044683 Bacteria 2477
451 Ga0466966_0000058 3300044684 Bacteria 81196
452 Ga0466966_0000731 3300044684 Bacteria 20893
453 Ga0466966_0002025 3300044684 Bacteria 13155
454 Ga0466966_0002795 3300044684 Bacteria 11476
455 Ga0466966_0005527 3300044684 Bacteria 8303
456 Ga0466966_0085575 3300044684 Bacteria 1960
457 Ga0466966_0113788 3300044684 Bacteria 1666
458 Ga0466961_0000204 3300044693 Bacteria 39748
459 Ga0466961_0000224 3300044693 Bacteria 38254
460 Ga0466961_0005061 3300044693 Bacteria 8292
461 Ga0466961_0013426 3300044693 Bacteria 5245
462 Ga0466961_0023727 3300044693 Bacteria 3947
463 Ga0466961_0094159 3300044693 Bacteria 1890
464 Ga0466963_0013557 3300044694 Bacteria 5005
465 Ga0466963_0018734 3300044694 Bacteria 4333
466 Ga0466964_0001232 3300044706 Bacteria 8681
467 Ga0466964_0017955 3300044706 Bacteria 2711
468 Ga0466971_0001186 3300044719 Bacteria 10818
469 Ga0466971_0001200 3300044719 Bacteria 10766
470 Ga0466971_0006019 3300044719 Bacteria 5279
471 Ga0466971_0026068 3300044719 Bacteria 2611
472 Ga0466968_0027880 3300044735 Bacteria 2326
473 Ga0466970_0001740 3300044765 Bacteria 10497
474 Ga0466970_0026559 3300044765 Bacteria 3034
475 Ga0466957_0000379 3300044842 Bacteria 21768
476 Ga0466957_0000621 3300044842 Bacteria 17927
477 Ga0466957_0008986 3300044842 Bacteria 5695
478 Ga0466957_0022364 3300044842 Bacteria 3731
479 Ga0466957_0022783 3300044842 Bacteria 3698
480 Ga0466957_0024748 3300044842 Bacteria 3555
481 Ga0466957_0036373 3300044842 Bacteria 2960
482 Ga0466957_0083559 3300044842 Bacteria 1992
483 Ga0466960_0011631 3300044901 Bacteria 3690
484 Ga0466959_0003971 3300045049 Bacteria 9831
485 Ga0466959_0005343 3300045049 Bacteria 8786
486 Ga0466959_0007366 3300045049 Bacteria 7716
487 Ga0466959_0014968 3300045049 Bacteria 5652
488 Ga0466959_0058527 3300045049 Bacteria 2806
489 Ga0466959_0080235 3300045049 Bacteria 2352
490 Ga0466959_0095375 3300045049 Bacteria 2133
491 Ga0451576_0131415 3300045051 Bacteria 2610
492 Ga0451576_0363745 3300045051 Bacteria 1515
493 Ga0466958_0003077 3300045836 Bacteria 8556
494 Ga0466958_0013227 3300045836 Bacteria 4694
495 Ga0466958_0017979 3300045836 Bacteria 4097
496 Ga0466958_0047061 3300045836 Bacteria 2603
497 Ga0495592_0005182 3300046454 Bacteria 9610
498 Ga0495592_0009220 3300046454 Bacteria 7424
499 Ga0495603_0006083 3300046455 Bacteria 7214
500 Ga0495603_0031509 3300046455 Bacteria 3192
501 Ga0495590_0003243 3300046457 Bacteria 6651
502 Ga0495590_0005892 3300046457 Bacteria 4811
503 Ga0495590_0018895 3300046457 Bacteria 2461
504 Ga0495590_0021494 3300046457 Bacteria 2286
505 Ga0495629_0000052 3300046459 Bacteria 106578
506 Ga0495629_0000162 3300046459 Bacteria 58860
507 Ga0495629_0000625 3300046459 Bacteria 28762
508 Ga0495629_0006110 3300046459 Bacteria 8951
509 Ga0495629_0006585 3300046459 Bacteria 8603
510 Ga0495638_0000875 3300046460 Bacteria 31213
511 Ga0495638_0011363 3300046460 Bacteria 6136
512 Ga0495641_0015103 3300046461 Bacteria 4145
513 Ga0495651_0013319 3300046462 Bacteria 6361
514 Ga0495651_0028962 3300046462 Bacteria 4319
515 Ga0495653_0001943 3300046463 Bacteria 16253
516 Ga0495653_0003345 3300046463 Bacteria 12886
517 Ga0495653_0012493 3300046463 Bacteria 6934
518 Ga0495653_0104553 3300046463 Bacteria 2046
519 Ga0495650_0001711 3300046471 Bacteria 20137
520 Ga0495650_0006659 3300046471 Bacteria 7161
521 Ga0495650_0010974 3300046471 Bacteria 5010
522 Ga0495650_0012488 3300046471 Bacteria 4566
523 Ga0495650_0037866 3300046471 Bacteria 2094
524 Ga0495650_0054965 3300046471 Bacteria 1622
525 Ga0495580_0001573 3300046472 Bacteria 20072
526 Ga0495580_0004723 3300046472 Bacteria 11417
527 Ga0495580_0008529 3300046472 Bacteria 8139
528 Ga0495580_0009825 3300046472 Bacteria 7503
529 Ga0495580_0011040 3300046472 Bacteria 7001
530 Ga0495580_0183263 3300046472 Bacteria 1445
531 Ga0495582_0018014 3300046473 Bacteria 3862
532 Ga0495582_0036915 3300046473 Bacteria 2688
533 Ga0495605_0009236 3300046474 Bacteria 5540
534 Ga0495605_0013347 3300046474 Bacteria 4530
535 Ga0495605_0018915 3300046474 Bacteria 3687
536 Ga0495605_0022628 3300046474 Bacteria 3316
537 Ga0495605_0034044 3300046474 Bacteria 2582
538 Ga0495639_0027429 3300046475 Bacteria 2521
539 Ga0495664_0014580 3300046477 Bacteria 4458
540 Ga0495664_0040265 3300046477 Bacteria 2762
541 Ga0495585_0037697 3300046492 Bacteria 2722
542 Ga0495585_0041066 3300046492 Bacteria 2595
543 Ga0495596_0001981 3300046500 Bacteria 11294
544 Ga0495596_0008448 3300046500 Bacteria 4581
545 Ga0495596_0011681 3300046500 Bacteria 3777
546 Ga0495596_0020553 3300046500 Bacteria 2702
547 Ga0495607_0021514 3300046501 Bacteria 4057
548 Ga0495583_0000022 3300046506 Bacteria 282544
549 Ga0495583_0004759 3300046506 Bacteria 9536
550 Ga0495583_0006177 3300046506 Bacteria 7886
551 Ga0495606_0001504 3300046507 Bacteria 30980
552 Ga0495606_0009474 3300046507 Bacteria 8234
553 Ga0495606_0012297 3300046507 Bacteria 6884
554 Ga0495606_0020562 3300046507 Bacteria 4861
555 Ga0495606_0049375 3300046507 Bacteria 2760
556 Ga0495606_0100766 3300046507 Bacteria 1758
557 Ga0495608_0002463 3300046511 Bacteria 13294
558 Ga0495608_0002588 3300046511 Bacteria 12995
559 Ga0495616_0015844 3300046513 Bacteria 4181
560 Ga0495620_0033951 3300046515 Bacteria 2310
561 Ga0495628_0005506 3300046516 Bacteria 11082
562 Ga0495628_0043834 3300046516 Bacteria 3561
563 Ga0495630_0008386 3300046517 Bacteria 7412
564 Ga0495630_0092137 3300046517 Bacteria 2291
565 Ga0495630_0122643 3300046517 Bacteria 1971
566 Ga0495648_0029036 3300046524 Bacteria 3675
567 Ga0495666_0001199 3300046526 Bacteria 12516
568 Ga0495666_0006602 3300046526 Bacteria 5835
569 Ga0495666_0020219 3300046526 Bacteria 3300
570 Ga0495666_0100462 3300046526 Bacteria 1363
571 Ga0495642_0050858 3300046528 Bacteria 1704
572 Ga0495652_0051652 3300046529 Bacteria 3509
573 Ga0495652_0126398 3300046529 Bacteria 2030
574 Ga0495654_0011167 3300046530 Bacteria 4875
575 Ga0495665_0017510 3300046531 Bacteria 3854
576 Ga0495665_0022274 3300046531 Bacteria 3405
577 Ga0495665_0023261 3300046531 Bacteria 3327
578 Ga0495640_0005048 3300046533 Bacteria 10481
579 Ga0495640_0006347 3300046533 Bacteria 9368
580 Ga0495586_0031274 3300046535 Bacteria 2850
581 Ga0495586_0083545 3300046535 Bacteria 1757
582 Ga0495598_0005706 3300046537 Bacteria 2776
583 Ga0495597_0015125 3300046542 Bacteria 3657
584 Ga0495645_0001234 3300046543 Bacteria 17452
585 Ga0495645_0089013 3300046543 Bacteria 2207
586 Ga0495667_0115902 3300046559 Bacteria 1731
587 Ga0495634_0016709 3300046642 Bacteria 5243
588 Ga0495634_0021151 3300046642 Bacteria 4603
589 Ga0495625_0050942 3300046660 Bacteria 2969
590 Ga0495635_0000986 3300046663 Bacteria 18758
591 Ga0495635_0004865 3300046663 Bacteria 9346
592 Ga0495635_0096718 3300046663 Bacteria 2018
593 Ga0495661_0009353 3300046665 Bacteria 6727
594 Ga0495661_0063515 3300046665 Bacteria 2182
595 Ga0495599_0025962 3300046678 Bacteria 3669
596 Ga0495623_0002524 3300046679 Bacteria 12120
597 Ga0495623_0005105 3300046679 Bacteria 8613
598 Ga0495623_0012250 3300046679 Bacteria 5554
599 Ga0495646_0003646 3300046680 Bacteria 9606
600 Ga0495646_0004620 3300046680 Bacteria 8670
601 Ga0495646_0037671 3300046680 Bacteria 2990
602 Ga0495646_0079441 3300046680 Bacteria 1915
603 Ga0495669_0009470 3300046684 Bacteria 4107
604 Ga0495669_0076232 3300046684 Bacteria 1535
605 Ga0495613_0001221 3300046689 Bacteria 19632
606 Ga0495613_0029780 3300046689 Bacteria 4058
607 Ga0495613_0066860 3300046689 Bacteria 2624
608 Ga0495624_0003206 3300046690 Bacteria 12190
609 Ga0495624_0007370 3300046690 Bacteria 7726
610 Ga0495624_0008497 3300046690 Bacteria 7152
611 Ga0495624_0041803 3300046690 Bacteria 2930
612 Ga0495624_0063016 3300046690 Bacteria 2318
613 Ga0495670_0014585 3300046691 Bacteria 3864
614 Ga0495671_0021994 3300046692 Bacteria 3344
615 Ga0495649_0000282 3300046694 Bacteria 44864
616 Ga0495649_0001094 3300046694 Bacteria 21155
617 Ga0495649_0006432 3300046694 Bacteria 7312
618 Ga0495649_0027513 3300046694 Bacteria 3155
619 Ga0495649_0053665 3300046694 Bacteria 2181
620 Ga0495649_0071968 3300046694 Bacteria 1853
621 Ga0495589_0003149 3300046794 Bacteria 9026
622 Ga0495589_0017268 3300046794 Bacteria 3705
623 Ga0495589_0027902 3300046794 Bacteria 2853
624 Ga0495581_0009419 3300047315 Bacteria 5650
625 Ga0495581_0014655 3300047315 Bacteria 4545
626 Ga0495604_0002265 3300047317 Bacteria 15403
627 Ga0495604_0008712 3300047317 Bacteria 8020
628 Ga0495604_0105331 3300047317 Bacteria 2064
629 Ga0495674_0004487 3300047319 Bacteria 13435
630 Ga0495674_0006941 3300047319 Bacteria 10832
631 Ga0495674_0014053 3300047319 Bacteria 7504
632 Ga0495674_0027200 3300047319 Bacteria 5227
633 Ga0495674_0032066 3300047319 Bacteria 4769
634 Ga0495674_0035427 3300047319 Bacteria 4503
635 Ga0495674_0038188 3300047319 Bacteria 4311
636 Ga0495674_0049395 3300047319 Bacteria 3718
637 Ga0495674_0049782 3300047319 Bacteria 3699
638 Ga0495672_0002522 3300047320 Bacteria 16718
639 Ga0495672_0037033 3300047320 Bacteria 2989
640 Ga0495676_0113531 3300047321 Bacteria 1983
641 Ga0495676_0189905 3300047321 Bacteria 1433
642 Ga0495680_0026016 3300047322 Bacteria 4832
643 Ga0495680_0036297 3300047322 Bacteria 3959
644 Ga0495680_0063701 3300047322 Bacteria 2830
645 Ga0495680_0064367 3300047322 Bacteria 2812
646 Ga0495680_0075404 3300047322 Bacteria 2559
647 Ga0495683_0001933 3300047323 Bacteria 12931
648 Ga0495683_0002777 3300047323 Bacteria 10424
649 Ga0495683_0006554 3300047323 Bacteria 6352
650 Ga0495683_0014346 3300047323 Bacteria 4128
651 Ga0495683_0022445 3300047323 Bacteria 3245
652 Ga0495687_000419 3300047443 Bacteria 52487
653 Ga0495687_005432 3300047443 Bacteria 8127
654 Ga0495687_029501 3300047443 Bacteria 2538
655 Ga0495687_041634 3300047443 Bacteria 2013
656 Ga0495675_0001691 3300047444 Bacteria 13223
657 Ga0495675_0024973 3300047444 Bacteria 3811
658 Ga0495675_0075232 3300047444 Bacteria 2128
659 Ga0495677_0060041 3300047445 Bacteria 1409
660 Ga0495679_000023 3300047446 Bacteria 209366
661 Ga0495679_001555 3300047446 Bacteria 12949
662 Ga0495679_001975 3300047446 Bacteria 10918
663 Ga0495679_032091 3300047446 Bacteria 1688
664 Ga0495673_0008551 3300047469 Bacteria 5743
665 Ga0495673_0008615 3300047469 Bacteria 5712
666 Ga0495673_0012722 3300047469 Bacteria 4445
667 Ga0495684_0045511 3300047471 Bacteria 3358
668 Ga0495684_0050822 3300047471 Bacteria 3164
669 Ga0495686_0000540 3300047472 Bacteria 54110
670 Ga0495686_0029484 3300047472 Bacteria 3569
671 Ga0495686_0074331 3300047472 Bacteria 2085
672 Ga0495593_0001681 3300047673 Bacteria 13120
673 Ga0495593_0022913 3300047673 Bacteria 3475
674 Ga0495593_0027471 3300047673 Bacteria 3133
675 Ga0495602_0015604 3300048088 Bacteria 7661
676 Ga0495602_0055386 3300048088 Bacteria 3492
677 Ga0495614_0002282 3300048089 Bacteria 8518
678 Ga0495614_0005163 3300048089 Bacteria 5893
679 Ga0495626_0013389 3300048091 Bacteria 4262
680 Ga0495626_0067956 3300048091 Bacteria 1608
681 Ga0496100_0004382 3300048903 Bacteria 7474
682 Ga0496100_0022940 3300048903 Bacteria 3783
683 Ga0496100_0127650 3300048903 Bacteria 1787
684 Ga0496101_0005429 3300048904 Bacteria 8122
685 Ga0496101_0006077 3300048904 Bacteria 7751
686 Ga0496101_0051807 3300048904 Bacteria 2958
687 Ga0496101_0062546 3300048904 Bacteria 2706
688 Ga0496101_0087085 3300048904 Bacteria 2318
689 Ga0496102_0002104 3300048905 Bacteria 17112
690 Ga0496102_0011493 3300048905 Bacteria 7635
691 Ga0496102_0014872 3300048905 Bacteria 6770
692 Ga0496102_0039452 3300048905 Bacteria 4267
693 Ga0496102_0162338 3300048905 Bacteria 2102
694 Ga0496102_0224552 3300048905 Bacteria 1771
695 Ga0496103_0002058 3300048906 Bacteria 12871
696 Ga0496103_0017942 3300048906 Bacteria 4241
697 Ga0496104_0031075 3300048907 Bacteria 4965
698 Ga0496104_0034573 3300048907 Bacteria 4714
699 Ga0496104_0067201 3300048907 Bacteria 3405
700 Ga0496104_0068607 3300048907 Bacteria 3369
701 Ga0496104_0074201 3300048907 Bacteria 3238
702 Ga0496105_0082639 3300048908 Bacteria 2653
703 Ga0496105_0088283 3300048908 Bacteria 2561
704 Ga0496106_0002866 3300048909 Bacteria 12808
705 Ga0496106_0015848 3300048909 Bacteria 5574
706 Ga0496106_0020212 3300048909 Bacteria 4940
707 Ga0496107_0015745 3300048910 Bacteria 5303
708 Ga0496107_0248178 3300048910 Bacteria 1324
709 Ga0496108_0087642 3300048911 Bacteria 2644
710 Ga0496109_0193613 3300048912 Bacteria 1910
711 Ga0496110_0021363 3300048913 Bacteria 5478
712 Ga0496110_0333871 3300048913 Bacteria 1381
713 Ga0496111_0008723 3300048914 Bacteria 6728
714 Ga0496112_0235650 3300048915 Bacteria 1784
715 Ga0496113_0015084 3300048916 Bacteria 5295
716 Ga0496113_0066817 3300048916 Bacteria 2724
717 Ga0496114_0013986 3300048917 Bacteria 6432
718 Ga0496114_0047284 3300048917 Bacteria 3579
719 Ga0496114_0144126 3300048917 Bacteria 2064
720 Ga0496114_0337058 3300048917 Bacteria 1333
721 Ga0496115_0061025 3300048918 Bacteria 3039
722 Ga0496115_0206707 3300048918 Bacteria 1622
723 Ga0496116_0014707 3300048919 Bacteria 6234
724 Ga0496116_0020794 3300048919 Bacteria 4972
725 Ga0496117_0003538 3300048920 Bacteria 18044
726 Ga0496117_0005798 3300048920 Bacteria 12808
727 Ga0496117_0096298 3300048920 Bacteria 1888
728 Ga0496118_0001951 3300048921 Bacteria 29216
729 Ga0496118_0002552 3300048921 Bacteria 24370
730 Ga0496118_0004263 3300048921 Bacteria 17109
731 Ga0496118_0006943 3300048921 Bacteria 12239
732 Ga0496118_0009356 3300048921 Bacteria 9921
733 Ga0496118_0012795 3300048921 Bacteria 8008
734 Ga0496118_0143341 3300048921 Bacteria 1509
735 Ga0496118_0160785 3300048921 Bacteria 1389
736 Ga0496121_0002288 3300048924 Bacteria 29774
737 Ga0496121_0011728 3300048924 Bacteria 9671
738 Ga0496121_0014464 3300048924 Bacteria 8369
739 Ga0496121_0015965 3300048924 Bacteria 7791
740 Ga0496121_0028418 3300048924 Bacteria 5205
741 Ga0496121_0030932 3300048924 Bacteria 4905
742 Ga0496122_0064974 3300048925 Bacteria 2650
743 Ga0496123_0055509 3300048926 Bacteria 2598
744 Ga0496124_0007316 3300048927 Bacteria 11773
745 Ga0496124_0026007 3300048927 Bacteria 5286
746 Ga0496124_0100115 3300048927 Bacteria 2350
747 Ga0496125_0000318 3300048928 Bacteria 93900
748 Ga0496125_0022100 3300048928 Bacteria 5914
749 Ga0496125_0112109 3300048928 Bacteria 1972
750 Ga0496125_0159337 3300048928 Bacteria 1536
751 Ga0496126_0000538 3300048929 Bacteria 73271
752 Ga0496126_0000908 3300048929 Bacteria 51277
753 Ga0496126_0002311 3300048929 Bacteria 26148
754 Ga0496126_0008981 3300048929 Bacteria 10696
755 Ga0496126_0053001 3300048929 Bacteria 3683
756 Ga0495678_008464 3300049459 Bacteria 5185
757 Ga0495682_0058461 3300049460 Bacteria 1394
758 nmdc:mga0k408_109898_c1 3300050493 Bacteria 1630
759 nmdc:mga07m45_21376_c1 3300050496 Bacteria 3523
760 nmdc:mga07m45_2201_c1 3300050496 Bacteria 9102
761 nmdc:mga07m45_25901_c1 3300050496 Bacteria 3221
762 Ga0500635_0000047 3300053080 Bacteria 84059
763 Ga0500647_0049245 3300053091 Bacteria 2026
764 Ga0500618_002855 3300053125 Bacteria 6196
765 Ga0500588_0005414 3300053146 Bacteria 2837
766 Ga0500604_0000228 3300053151 Bacteria 16039
767 Ga0500636_0021540 3300053177 Bacteria 3815
768 Ga0466962_0002532 3300061719 Bacteria 8682
769 Ga0466962_0004545 3300061719 Bacteria 6655
770 Ga0466962_0004735 3300061719 Bacteria 6540
771 Ga0466962_0012138 3300061719 Bacteria 4141

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_041634 Ga0495687_041634_380_1432 350
2 3300025907 Ga0207645_10130543 Ga0207645_101305431 378
3 3300025945 Ga0207679_10114038 Ga0207679_101140383 378
4 3300026142 Ga0207698_10021499 Ga0207698_100214996 378
5 3300048908 Ga0496105_0082639 Ga0496105_0082639_28_1260 379
6 3300037312 Ga0395899_0248320 Ga0395899_0248320_25_1203 380
7 3300044693 Ga0466961_0023727 Ga0466961_0023727_2140_3399 380
8 3300044842 Ga0466957_0008986 Ga0466957_0008986_433_1692 380
9 3300003322 rootL2_10000022 rootL2_100000229 382
10 3300025893 Ga0207682_10004849 Ga0207682_100048492 382
11 3300048904 Ga0496101_0051807 Ga0496101_0051807_1693_2931 386
12 3300003316 rootH1_10013482 rootH1_100134823 391
13 3300026075 Ga0207708_10081018 Ga0207708_100810182 392
14 3300037312 Ga0395899_0167878 Ga0395899_0167878_19_1227 392
15 3300028666 Ga0265336_10000030 Ga0265336_1000003083 393
16 3300029957 Ga0265324_10001751 Ga0265324_100017517 393
17 3300037471 Ga0395905_0018424 Ga0395905_0018424_111_1403 393
18 3300009011 Ga0105251_10001262 Ga0105251_100012629 394
19 3300025735 Ga0207713_1026239 Ga0207713_10262392 394
20 3300046457 Ga0495590_0005892 Ga0495590_0005892_1575_2858 394
21 3300046542 Ga0495597_0015125 Ga0495597_0015125_915_2165 394
22 3300048921 Ga0496118_0143341 Ga0496118_0143341_186_1439 394
23 3300048927 Ga0496124_0007316 Ga0496124_0007316_564_1847 394
24 3300005331 Ga0070670_100038836 Ga0070670_1000388364 395
25 3300009177 Ga0105248_10178667 Ga0105248_101786672 395
26 3300037471 Ga0395905_0084927 Ga0395905_0084927_1244_2494 395
27 3300025945 Ga0207679_10127450 Ga0207679_101274501 396
28 3300044719 Ga0466971_0001186 Ga0466971_0001186_4093_5460 396
29 3300044842 Ga0466957_0024748 Ga0466957_0024748_1961_3220 396
30 3300047320 Ga0495672_0002522 Ga0495672_0002522_12057_13307 396
31 3300048927 Ga0496124_0100115 Ga0496124_0100115_648_1910 396
32 3300061719 Ga0466962_0004735 Ga0466962_0004735_5201_6460 396
33 3300002067 JGI24735J21928_10000114 JGI24735J21928_1000011415 397
34 3300003322 rootL2_10143345 rootL2_101433452 397
35 3300005457 Ga0070662_100005185 Ga0070662_1000051852 397
36 3300025295 Ga0209564_1010959 Ga0209564_10109592 397
37 3300025932 Ga0207690_10004028 Ga0207690_100040287 397
38 3300046794 Ga0495589_0017268 Ga0495589_0017268_157_1425 397
39 3300047323 Ga0495683_0002777 Ga0495683_0002777_8905_10155 397
40 3300048903 Ga0496100_0004382 Ga0496100_0004382_5911_7161 397
41 3300048904 Ga0496101_0062546 Ga0496101_0062546_310_1560 397
42 3300048905 Ga0496102_0039452 Ga0496102_0039452_2747_3997 397
43 3300048909 Ga0496106_0002866 Ga0496106_0002866_10400_11650 397
44 3300048910 Ga0496107_0015745 Ga0496107_0015745_622_1872 397
45 3300048914 Ga0496111_0008723 Ga0496111_0008723_4242_5492 397
46 3300048916 Ga0496113_0015084 Ga0496113_0015084_1613_2863 397
47 3300048919 Ga0496116_0014707 Ga0496116_0014707_2422_3672 397
48 3300048920 Ga0496117_0003538 Ga0496117_0003538_3307_4587 397
49 3300048921 Ga0496118_0001951 Ga0496118_0001951_17542_18822 397
50 3300048921 Ga0496118_0006943 Ga0496118_0006943_10452_11702 397
51 3300048924 Ga0496121_0014464 Ga0496121_0014464_2202_3452 397
52 3300048928 Ga0496125_0022100 Ga0496125_0022100_3367_4617 397
53 3300048929 Ga0496126_0000908 Ga0496126_0000908_36581_37861 397
54 3300005354 Ga0070675_100081164 Ga0070675_1000811642 398
55 3300005356 Ga0070674_100034669 Ga0070674_1000346693 398
56 3300005457 Ga0070662_100035146 Ga0070662_1000351464 398
57 3300005618 Ga0068864_100032542 Ga0068864_1000325423 398
58 3300005843 Ga0068860_100011221 Ga0068860_1000112214 398
59 3300013308 Ga0157375_10029847 Ga0157375_100298474 398
60 3300025901 Ga0207688_10008981 Ga0207688_100089814 398
61 3300025923 Ga0207681_10001527 Ga0207681_1000152715 398
62 3300025941 Ga0207711_10134976 Ga0207711_101349761 398
63 3300026089 Ga0207648_10011019 Ga0207648_100110198 398
64 3300026089 Ga0207648_10189421 Ga0207648_101894212 398
65 3300028381 Ga0268264_10035103 Ga0268264_100351035 398
66 3300048911 Ga0496108_0087642 Ga0496108_0087642_838_2220 398
67 3300048912 Ga0496109_0193613 Ga0496109_0193613_115_1497 398
68 3300048918 Ga0496115_0206707 Ga0496115_0206707_266_1516 398
69 3300038443 Ga0395901_0000053 Ga0395901_0000053_51402_52661 399
70 3300044656 Ga0466969_0036269 Ga0466969_0036269_1203_2462 399
71 3300044684 Ga0466966_0000058 Ga0466966_0000058_36055_37314 399
72 3300044693 Ga0466961_0000204 Ga0466961_0000204_18150_19409 399
73 3300044694 Ga0466963_0013557 Ga0466963_0013557_372_1631 399
74 3300044842 Ga0466957_0036373 Ga0466957_0036373_291_1550 399
75 3300045049 Ga0466959_0014968 Ga0466959_0014968_2618_3877 399
76 3300045836 Ga0466958_0003077 Ga0466958_0003077_1103_2362 399
77 3300045836 Ga0466958_0013227 Ga0466958_0013227_2690_3949 399
78 3300061719 Ga0466962_0004545 Ga0466962_0004545_1848_3107 399
79 3300006353 Ga0075370_10002167 Ga0075370_100021671 400
80 3300039437 Ga0436365_1429793 Ga0436365_1429793_531_1844 400
81 3300048907 Ga0496104_0067201 Ga0496104_0067201_1316_2632 400
82 3300050496 nmdc:mga07m45_21376_c1 nmdc:mga07m45_21376_c1_1503_2789 400
83 3300005367 Ga0070667_100007319 Ga0070667_10000731910 401
84 3300005616 Ga0068852_100037364 Ga0068852_1000373644 401
85 3300005842 Ga0068858_100005411 Ga0068858_1000054117 401
86 3300013308 Ga0157375_10030968 Ga0157375_100309682 401
87 3300014968 Ga0157379_10191344 Ga0157379_101913441 401
88 3300025986 Ga0207658_10042895 Ga0207658_100428954 401
89 3300026035 Ga0207703_10026640 Ga0207703_100266404 401
90 3300028381 Ga0268264_10038718 Ga0268264_100387184 401
91 3300039447 Ga0436361_0446381 Ga0436361_0446381_1153_2463 401
92 3300046463 Ga0495653_0104553 Ga0495653_0104553_678_1928 401
93 3300047322 Ga0495680_0064367 Ga0495680_0064367_839_2089 401
94 3300021361 Ga0213872_10000022 Ga0213872_1000002261 402
95 3300039447 Ga0436361_0675000 Ga0436361_0675000_16366_17667 402
96 3300039447 Ga0436361_0974052 Ga0436361_0974052_3830_5176 402
97 3300046462 Ga0495651_0028962 Ga0495651_0028962_230_1480 402
98 3300046678 Ga0495599_0025962 Ga0495599_0025962_607_1857 402
99 3300046679 Ga0495623_0012250 Ga0495623_0012250_3849_5099 402
100 3300047317 Ga0495604_0002265 Ga0495604_0002265_11206_12456 402
101 3300047321 Ga0495676_0189905 Ga0495676_0189905_23_1231 402
102 3300047444 Ga0495675_0024973 Ga0495675_0024973_489_1739 402
103 3300053125 Ga0500618_002855 Ga0500618_002855_4475_6013 402
104 3300009093 Ga0105240_10156360 Ga0105240_101563602 403
105 3300009545 Ga0105237_10406141 Ga0105237_104061411 403
106 3300025225 Ga0209566_101192 Ga0209566_1011926 403
107 3300046507 Ga0495606_0020562 Ga0495606_0020562_937_2187 403
108 3300046517 Ga0495630_0092137 Ga0495630_0092137_227_1477 403
109 3300046531 Ga0495665_0022274 Ga0495665_0022274_791_2041 403
110 3300046543 Ga0495645_0089013 Ga0495645_0089013_531_1781 403
111 3300046663 Ga0495635_0096718 Ga0495635_0096718_292_1575 403
112 3300046680 Ga0495646_0037671 Ga0495646_0037671_265_1548 403
113 3300047322 Ga0495680_0036297 Ga0495680_0036297_1500_2750 403
114 3300048905 Ga0496102_0162338 Ga0496102_0162338_609_1859 403
115 3300048907 Ga0496104_0074201 Ga0496104_0074201_1479_2729 403
116 3300048917 Ga0496114_0337058 Ga0496114_0337058_67_1317 403
117 3300048928 Ga0496125_0159337 Ga0496125_0159337_94_1344 403
118 3300002705 JGI25156J39149_1001828 JGI25156J39149_10018282 404
119 3300002741 JGI25157J39369_1000341 JGI25157J39369_100034126 404
120 3300003760 Ga0055527_1000575 Ga0055527_100057512 404
121 3300003763 Ga0055529_1000883 Ga0055529_100088317 404
122 3300003790 Ga0055528_1001636 Ga0055528_10016363 404
123 3300003856 Ga0058692_1009755 Ga0058692_10097552 404
124 3300005535 Ga0070684_100259765 Ga0070684_1002597651 404
125 3300005539 Ga0068853_100155020 Ga0068853_1001550202 404
126 3300005577 Ga0068857_100030365 Ga0068857_1000303653 404
127 3300005577 Ga0068857_100211128 Ga0068857_1002111282 404
128 3300005614 Ga0068856_100003535 Ga0068856_10000353516 404
129 3300009093 Ga0105240_10121643 Ga0105240_101216432 404
130 3300009174 Ga0105241_10047670 Ga0105241_100476702 404
131 3300009551 Ga0105238_10031327 Ga0105238_100313272 404
132 3300025228 Ga0209672_100054 Ga0209672_10005443 404
133 3300025229 Ga0209147_100085 Ga0209147_100085147 404
134 3300025229 Ga0209147_100278 Ga0209147_10027822 404
135 3300025242 Ga0209258_100168 Ga0209258_100168146 404
136 3300025246 Ga0209646_1000012 Ga0209646_1000012194 404
137 3300025250 Ga0209026_1000004 Ga0209026_1000004424 404
138 3300025253 Ga0209677_100150 Ga0209677_10015025 404
139 3300025256 Ga0209759_1000003 Ga0209759_1000003302 404
140 3300025256 Ga0209759_1000067 Ga0209759_1000067113 404
141 3300025272 Ga0209455_1000279 Ga0209455_100027934 404
142 3300025273 Ga0209673_1000098 Ga0209673_100009844 404
143 3300025919 Ga0207657_10058343 Ga0207657_100583433 404
144 3300026078 Ga0207702_10001911 Ga0207702_100019114 404
145 3300026116 Ga0207674_10024284 Ga0207674_100242842 404
146 3300026116 Ga0207674_10049178 Ga0207674_100491782 404
147 3300027312 Ga0209371_1000141 Ga0209371_100014183 404
148 3300030500 Ga0268256_1000418 Ga0268256_10004183 404
149 3300037471 Ga0395905_0000166 Ga0395905_0000166_44603_45871 404
150 3300005328 Ga0070676_10012132 Ga0070676_100121326 405
151 3300005334 Ga0068869_100003849 Ga0068869_10000384910 405
152 3300005338 Ga0068868_100008329 Ga0068868_1000083295 405
153 3300005339 Ga0070660_100011520 Ga0070660_1000115204 405
154 3300005354 Ga0070675_100002486 Ga0070675_10000248614 405
155 3300005355 Ga0070671_100068975 Ga0070671_1000689752 405
156 3300005366 Ga0070659_100020101 Ga0070659_1000201014 405
157 3300005441 Ga0070700_100041725 Ga0070700_1000417252 405
158 3300005455 Ga0070663_100009183 Ga0070663_1000091835 405
159 3300005457 Ga0070662_100010999 Ga0070662_1000109994 405
160 3300005539 Ga0068853_100028409 Ga0068853_1000284094 405
161 3300005547 Ga0070693_100015902 Ga0070693_1000159025 405
162 3300005563 Ga0068855_100013478 Ga0068855_1000134785 405
163 3300005614 Ga0068856_100046209 Ga0068856_1000462093 405
164 3300005616 Ga0068852_100037797 Ga0068852_1000377973 405
165 3300005618 Ga0068864_100005493 Ga0068864_1000054939 405
166 3300005834 Ga0068851_10009506 Ga0068851_100095064 405
167 3300005842 Ga0068858_100039138 Ga0068858_1000391382 405
168 3300009093 Ga0105240_10029364 Ga0105240_100293646 405
169 3300009098 Ga0105245_10020932 Ga0105245_100209325 405
170 3300013296 Ga0157374_10002254 Ga0157374_1000225411 405
171 3300014968 Ga0157379_10010791 Ga0157379_100107916 405
172 3300016635 Ga0183361_10015 Ga0183361_10015138 405
173 3300017792 Ga0163161_10006231 Ga0163161_100062316 405
174 3300025321 Ga0207656_10005850 Ga0207656_100058502 405
175 3300025901 Ga0207688_10008118 Ga0207688_100081185 405
176 3300025913 Ga0207695_10000971 Ga0207695_1000097125 405
177 3300025919 Ga0207657_10017325 Ga0207657_100173255 405
178 3300025923 Ga0207681_10047020 Ga0207681_100470202 405
179 3300025926 Ga0207659_10003345 Ga0207659_100033452 405
180 3300025927 Ga0207687_10011763 Ga0207687_100117634 405
181 3300025933 Ga0207706_10005846 Ga0207706_100058465 405
182 3300025942 Ga0207689_10002702 Ga0207689_100027025 405
183 3300025944 Ga0207661_10214939 Ga0207661_102149392 405
184 3300025945 Ga0207679_10061937 Ga0207679_100619372 405
185 3300025949 Ga0207667_10014189 Ga0207667_100141895 405
186 3300026041 Ga0207639_10006612 Ga0207639_100066123 405
187 3300026075 Ga0207708_10061685 Ga0207708_100616852 405
188 3300026118 Ga0207675_100003111 Ga0207675_10000311116 405
189 3300031344 Ga0265316_10064767 Ga0265316_100647673 405
190 3300031595 Ga0265313_10028117 Ga0265313_100281172 405
191 3300035691 Ga0373931_0012132 Ga0373931_0012132_2151_3467 405
192 3300044656 Ga0466969_0000833 Ga0466969_0000833_8618_9877 405
193 3300044683 Ga0466965_0002202 Ga0466965_0002202_2501_3760 405
194 3300044693 Ga0466961_0000224 Ga0466961_0000224_611_1870 405
195 3300044706 Ga0466964_0017955 Ga0466964_0017955_104_1363 405
196 3300044719 Ga0466971_0001200 Ga0466971_0001200_2013_3272 405
197 3300044765 Ga0466970_0026559 Ga0466970_0026559_264_1523 405
198 3300044842 Ga0466957_0000621 Ga0466957_0000621_738_1997 405
199 3300045049 Ga0466959_0058527 Ga0466959_0058527_13_1272 405
200 3300048905 Ga0496102_0011493 Ga0496102_0011493_3338_4654 405
201 3300048913 Ga0496110_0021363 Ga0496110_0021363_974_2290 405
202 3300048917 Ga0496114_0144126 Ga0496114_0144126_92_1408 405
203 3300053091 Ga0500647_0049245 Ga0500647_0049245_110_1363 405
204 3300061719 Ga0466962_0012138 Ga0466962_0012138_214_1473 405
205 3300005330 Ga0070690_100067482 Ga0070690_1000674822 406
206 3300005719 Ga0068861_100001086 Ga0068861_10000108610 406
207 3300006358 Ga0068871_100003953 Ga0068871_1000039536 406
208 3300009177 Ga0105248_10007710 Ga0105248_100077106 406
209 3300013102 Ga0157371_10008450 Ga0157371_100084504 406
210 3300013105 Ga0157369_10000410 Ga0157369_1000041026 406
211 3300014969 Ga0157376_10007994 Ga0157376_100079944 406
212 3300021361 Ga0213872_10000021 Ga0213872_1000002183 406
213 3300026023 Ga0207677_10004687 Ga0207677_100046874 406
214 3300037312 Ga0395899_0000080 Ga0395899_0000080_42070_43329 406
215 3300037418 Ga0395900_0000087 Ga0395900_0000087_128240_129499 406
216 3300037418 Ga0395900_0102356 Ga0395900_0102356_377_1636 406
217 3300037466 Ga0395898_0000559 Ga0395898_0000559_10481_11740 406
218 3300037466 Ga0395898_0000679 Ga0395898_0000679_42070_43329 406
219 3300038443 Ga0395901_0088474 Ga0395901_0088474_1401_2660 406
220 3300039447 Ga0436361_0354255 Ga0436361_0354255_162654_163925 406
221 3300046454 Ga0495592_0005182 Ga0495592_0005182_3002_4261 406
222 3300046459 Ga0495629_0006585 Ga0495629_0006585_4394_5653 406
223 3300046462 Ga0495651_0013319 Ga0495651_0013319_170_1429 406
224 3300046472 Ga0495580_0001573 Ga0495580_0001573_10777_12036 406
225 3300046473 Ga0495582_0036915 Ga0495582_0036915_257_1516 406
226 3300046477 Ga0495664_0040265 Ga0495664_0040265_1256_2515 406
227 3300046500 Ga0495596_0001981 Ga0495596_0001981_1401_2660 406
228 3300046511 Ga0495608_0002463 Ga0495608_0002463_545_1804 406
229 3300046516 Ga0495628_0043834 Ga0495628_0043834_554_1813 406
230 3300046524 Ga0495648_0029036 Ga0495648_0029036_1891_3150 406
231 3300046526 Ga0495666_0006602 Ga0495666_0006602_145_1404 406
232 3300046529 Ga0495652_0051652 Ga0495652_0051652_1706_2965 406
233 3300046531 Ga0495665_0023261 Ga0495665_0023261_1823_3082 406
234 3300046533 Ga0495640_0005048 Ga0495640_0005048_9094_10344 406
235 3300046535 Ga0495586_0031274 Ga0495586_0031274_1402_2661 406
236 3300046559 Ga0495667_0115902 Ga0495667_0115902_327_1586 406
237 3300046642 Ga0495634_0021151 Ga0495634_0021151_3274_4533 406
238 3300046663 Ga0495635_0004865 Ga0495635_0004865_2260_3519 406
239 3300046665 Ga0495661_0009353 Ga0495661_0009353_1677_2936 406
240 3300046679 Ga0495623_0005105 Ga0495623_0005105_5863_7122 406
241 3300046680 Ga0495646_0003646 Ga0495646_0003646_3920_5179 406
242 3300046689 Ga0495613_0001221 Ga0495613_0001221_13946_15205 406
243 3300046690 Ga0495624_0063016 Ga0495624_0063016_654_1913 406
244 3300046794 Ga0495589_0003149 Ga0495589_0003149_3250_4509 406
245 3300047317 Ga0495604_0105331 Ga0495604_0105331_545_1804 406
246 3300047319 Ga0495674_0027200 Ga0495674_0027200_177_1436 406
247 3300047322 Ga0495680_0063701 Ga0495680_0063701_360_1619 406
248 3300047323 Ga0495683_0001933 Ga0495683_0001933_254_1513 406
249 3300047444 Ga0495675_0001691 Ga0495675_0001691_8045_9304 406
250 3300047446 Ga0495679_001975 Ga0495679_001975_9397_10656 406
251 3300047469 Ga0495673_0008615 Ga0495673_0008615_4191_5450 406
252 3300047673 Ga0495593_0022913 Ga0495593_0022913_1954_3213 406
253 3300048088 Ga0495602_0055386 Ga0495602_0055386_249_1508 406
254 3300048089 Ga0495614_0005163 Ga0495614_0005163_208_1467 406
255 3300048909 Ga0496106_0015848 Ga0496106_0015848_2981_4297 406
256 3300005328 Ga0070676_10014500 Ga0070676_100145004 407
257 3300005338 Ga0068868_100004217 Ga0068868_10000421711 407
258 3300005354 Ga0070675_100000289 Ga0070675_1000002892 407
259 3300005355 Ga0070671_100001245 Ga0070671_10000124517 407
260 3300005364 Ga0070673_100014996 Ga0070673_1000149964 407
261 3300005466 Ga0070685_10014350 Ga0070685_100143505 407
262 3300005841 Ga0068863_100002575 Ga0068863_10000257516 407
263 3300005842 Ga0068858_100000259 Ga0068858_10000025921 407
264 3300005843 Ga0068860_100178984 Ga0068860_1001789842 407
265 3300006237 Ga0097621_100027144 Ga0097621_1000271446 407
266 3300009177 Ga0105248_10014364 Ga0105248_100143645 407
267 3300013296 Ga0157374_10108736 Ga0157374_101087362 407
268 3300013306 Ga0163162_10051354 Ga0163162_100513544 407
269 3300014325 Ga0163163_10001655 Ga0163163_1000165511 407
270 3300014326 Ga0157380_10175014 Ga0157380_101750142 407
271 3300014968 Ga0157379_10021975 Ga0157379_100219752 407
272 3300025321 Ga0207656_10018683 Ga0207656_100186833 407
273 3300025907 Ga0207645_10010523 Ga0207645_100105236 407
274 3300025931 Ga0207644_10002231 Ga0207644_1000223110 407
275 3300025941 Ga0207711_10011271 Ga0207711_100112713 407
276 3300025960 Ga0207651_10002012 Ga0207651_100020124 407
277 3300026023 Ga0207677_10000498 Ga0207677_100004989 407
278 3300026035 Ga0207703_10001748 Ga0207703_1000174814 407
279 3300026088 Ga0207641_10002258 Ga0207641_1000225815 407
280 3300026089 Ga0207648_10234408 Ga0207648_102344082 407
281 3300026095 Ga0207676_10000660 Ga0207676_1000066018 407
282 3300026121 Ga0207683_10003870 Ga0207683_1000387011 407
283 iso_pu_bacteria 2643221585 2643934307 407
284 iso_pu_bacteria 2643221646 2644255906 407
285 iso_pu_bacteria 2643221656 2644315794 407
286 3300003323 rootH1_10049978 rootH1_100499785 409
287 3300003759 Ga0055525_1000036 Ga0055525_1000036193 409
288 3300037418 Ga0395900_0000673 Ga0395900_0000673_43864_45123 409
289 3300046680 Ga0495646_0079441 Ga0495646_0079441_487_1746 409
290 3300048088 Ga0495602_0015604 Ga0495602_0015604_6221_7480 409
291 3300005614 Ga0068856_100161365 Ga0068856_1001613652 410
292 3300044656 Ga0466969_0003181 Ga0466969_0003181_1862_3106 410
293 3300044684 Ga0466966_0000731 Ga0466966_0000731_14573_15817 410
294 3300044693 Ga0466961_0005061 Ga0466961_0005061_2567_3811 410
295 3300044694 Ga0466963_0018734 Ga0466963_0018734_864_2108 410
296 3300044842 Ga0466957_0022783 Ga0466957_0022783_933_2177 410
297 3300045049 Ga0466959_0007366 Ga0466959_0007366_3692_4936 410
298 3300045836 Ga0466958_0017979 Ga0466958_0017979_687_1931 410
299 iso_pu_bacteria 2643221591 2643964301 410
300 3300005356 Ga0070674_100004464 Ga0070674_1000044645 411
301 3300005467 Ga0070706_100000873 Ga0070706_1000008735 411
302 3300005468 Ga0070707_100047413 Ga0070707_1000474133 411
303 3300005563 Ga0068855_100018189 Ga0068855_1000181896 411
304 3300006042 Ga0075368_10056181 Ga0075368_100561812 411
305 3300006178 Ga0075367_10023384 Ga0075367_100233842 411
306 3300006195 Ga0075366_10050472 Ga0075366_100504722 411
307 3300025910 Ga0207684_10006340 Ga0207684_1000634010 411
308 3300025949 Ga0207667_10047603 Ga0207667_100476033 411
309 3300050493 nmdc:mga0k408_109898_c1 nmdc:mga0k408_109898_c1_199_1506 411
310 3300050496 nmdc:mga07m45_25901_c1 nmdc:mga07m45_25901_c1_337_1644 411
311 iso_pu_bacteria 2721755763 2723879739 411
312 iso_pu_bacteria 2904434214 2904439334 411
313 3300005327 Ga0070658_10135448 Ga0070658_101354482 412
314 3300005328 Ga0070676_10005469 Ga0070676_100054692 412
315 3300005328 Ga0070676_10008522 Ga0070676_100085225 412
316 3300005331 Ga0070670_100008507 Ga0070670_1000085072 412
317 3300005333 Ga0070677_10030348 Ga0070677_100303481 412
318 3300005338 Ga0068868_100101223 Ga0068868_1001012232 412
319 3300005339 Ga0070660_100011761 Ga0070660_1000117616 412
320 3300005353 Ga0070669_100010392 Ga0070669_1000103924 412
321 3300005354 Ga0070675_100002040 Ga0070675_1000020405 412
322 3300005355 Ga0070671_100000158 Ga0070671_10000015819 412
323 3300005355 Ga0070671_100038161 Ga0070671_1000381612 412
324 3300005367 Ga0070667_100014781 Ga0070667_1000147814 412
325 3300005456 Ga0070678_100074496 Ga0070678_1000744962 412
326 3300005456 Ga0070678_100222162 Ga0070678_1002221622 412
327 3300005459 Ga0068867_100074147 Ga0068867_1000741472 412
328 3300005543 Ga0070672_100001393 Ga0070672_1000013939 412
329 3300005543 Ga0070672_100007786 Ga0070672_1000077862 412
330 3300005564 Ga0070664_100058655 Ga0070664_1000586552 412
331 3300005564 Ga0070664_100078849 Ga0070664_1000788492 412
332 3300005616 Ga0068852_100005295 Ga0068852_1000052957 412
333 3300005616 Ga0068852_100088525 Ga0068852_1000885253 412
334 3300005618 Ga0068864_100001456 Ga0068864_10000145610 412
335 3300005618 Ga0068864_100026924 Ga0068864_1000269243 412
336 3300005719 Ga0068861_100056839 Ga0068861_1000568394 412
337 3300005834 Ga0068851_10035389 Ga0068851_100353891 412
338 3300005841 Ga0068863_100030532 Ga0068863_1000305326 412
339 3300005841 Ga0068863_100080377 Ga0068863_1000803772 412
340 3300005844 Ga0068862_100024393 Ga0068862_1000243936 412
341 3300006237 Ga0097621_100084226 Ga0097621_1000842262 412
342 3300006237 Ga0097621_100127022 Ga0097621_1001270222 412
343 3300006358 Ga0068871_100009997 Ga0068871_1000099976 412
344 3300006358 Ga0068871_100013951 Ga0068871_1000139516 412
345 3300006881 Ga0068865_100020199 Ga0068865_1000201993 412
346 3300009098 Ga0105245_10108902 Ga0105245_101089021 412
347 3300009176 Ga0105242_10034621 Ga0105242_100346212 412
348 3300009177 Ga0105248_10001469 Ga0105248_1000146925 412
349 3300009177 Ga0105248_10033206 Ga0105248_100332066 412
350 3300009551 Ga0105238_10030242 Ga0105238_100302426 412
351 3300009553 Ga0105249_10031828 Ga0105249_100318284 412
352 3300013105 Ga0157369_10002529 Ga0157369_100025298 412
353 3300013296 Ga0157374_10361070 Ga0157374_103610701 412
354 3300013307 Ga0157372_10013139 Ga0157372_1001313910 412
355 3300013308 Ga0157375_10002349 Ga0157375_1000234917 412
356 3300014969 Ga0157376_10010441 Ga0157376_100104414 412
357 3300025321 Ga0207656_10007084 Ga0207656_100070842 412
358 3300025903 Ga0207680_10028032 Ga0207680_100280322 412
359 3300025907 Ga0207645_10017533 Ga0207645_100175334 412
360 3300025919 Ga0207657_10025683 Ga0207657_100256834 412
361 3300025925 Ga0207650_10015466 Ga0207650_100154663 412
362 3300025926 Ga0207659_10008152 Ga0207659_100081522 412
363 3300025931 Ga0207644_10000042 Ga0207644_1000004225 412
364 3300025931 Ga0207644_10030996 Ga0207644_100309964 412
365 3300025934 Ga0207686_10029246 Ga0207686_100292462 412
366 3300025935 Ga0207709_10027645 Ga0207709_100276452 412
367 3300025937 Ga0207669_10096940 Ga0207669_100969402 412
368 3300025940 Ga0207691_10018985 Ga0207691_100189852 412
369 3300025940 Ga0207691_10128212 Ga0207691_101282122 412
370 3300025941 Ga0207711_10004500 Ga0207711_100045009 412
371 3300025941 Ga0207711_10019217 Ga0207711_100192172 412
372 3300025942 Ga0207689_10016959 Ga0207689_100169595 412
373 3300025945 Ga0207679_10082688 Ga0207679_100826882 412
374 3300025961 Ga0207712_10016735 Ga0207712_100167354 412
375 3300025986 Ga0207658_10043516 Ga0207658_100435164 412
376 3300026035 Ga0207703_10189629 Ga0207703_101896292 412
377 3300026088 Ga0207641_10009577 Ga0207641_100095775 412
378 3300026088 Ga0207641_10031693 Ga0207641_100316934 412
379 3300026088 Ga0207641_10081318 Ga0207641_100813183 412
380 3300026089 Ga0207648_10072782 Ga0207648_100727821 412
381 3300026089 Ga0207648_10209599 Ga0207648_102095992 412
382 3300026095 Ga0207676_10010869 Ga0207676_100108694 412
383 3300026095 Ga0207676_10036534 Ga0207676_100365342 412
384 3300026095 Ga0207676_10145429 Ga0207676_101454292 412
385 3300026118 Ga0207675_100003717 Ga0207675_10000371715 412
386 3300026121 Ga0207683_10072943 Ga0207683_100729432 412
387 3300027614 Ga0209970_1000308 Ga0209970_10003082 412
388 3300028380 Ga0268265_10015132 Ga0268265_100151324 412
389 3300031731 Ga0307405_10017781 Ga0307405_100177813 412
390 3300032002 Ga0307416_100006410 Ga0307416_1000064106 412
391 3300032002 Ga0307416_100165379 Ga0307416_1001653791 412
392 3300032005 Ga0307411_10062805 Ga0307411_100628052 412
393 3300036401 Ga0373937_0314291 Ga0373937_0314291_82_1380 412
394 3300039447 Ga0436361_0422241 Ga0436361_0422241_750_2096 412
395 3300044656 Ga0466969_0000023 Ga0466969_0000023_32369_33664 412
396 3300044656 Ga0466969_0008844 Ga0466969_0008844_3412_4692 412
397 3300044658 Ga0466972_0033238 Ga0466972_0033238_1124_2413 412
398 3300044683 Ga0466965_0034444 Ga0466965_0034444_969_2258 412
399 3300044684 Ga0466966_0002025 Ga0466966_0002025_2493_3788 412
400 3300044684 Ga0466966_0113788 Ga0466966_0113788_306_1586 412
401 3300044719 Ga0466971_0026068 Ga0466971_0026068_590_1870 412
402 3300044901 Ga0466960_0011631 Ga0466960_0011631_2054_3343 412
403 3300045049 Ga0466959_0080235 Ga0466959_0080235_457_1752 412
404 3300045049 Ga0466959_0095375 Ga0466959_0095375_675_1955 412
405 3300045051 Ga0451576_0363745 Ga0451576_0363745_128_1429 412
406 3300046471 Ga0495650_0006659 Ga0495650_0006659_4678_5958 412
407 iso_pu_bacteria 2508501125 2509130752 412
408 iso_pu_bacteria 2510065045 2510252492 412
409 iso_pu_bacteria 2512047030 2512348348 412
410 iso_pu_bacteria 2513237151 2513962692 412
411 iso_pu_bacteria 2513237166 2514050808 412
412 iso_pu_bacteria 2515154122 2515684766 412
413 iso_pu_bacteria 2519103095 2519457645 412
414 iso_pu_bacteria 2526164713 2527079936 412
415 iso_pu_bacteria 2562617112 2563061622 412
416 iso_pu_bacteria 2582581311 2585294035 412
417 iso_pu_bacteria 2599185239 2599741168 412
418 iso_pu_bacteria 2599185240 2599747726 412
419 iso_pu_bacteria 2599185355 2600209731 412
420 iso_pu_bacteria 2600255067 2600813925 412
421 iso_pu_bacteria 2675903129 2676745908 412
422 iso_pu_bacteria 2711768613 2713478511 412
423 iso_pu_bacteria 2718217991 2719641590 412
424 iso_pu_bacteria 2738541296 2738824578 412
425 iso_pu_bacteria 2738541298 2738837045 412
426 iso_pu_bacteria 2738541306 2738878575 412
427 iso_pu_bacteria 2738543002 2739190267 412
428 iso_pu_bacteria 2738543008 2739225168 412
429 iso_pu_bacteria 2744054900 2746087319 412
430 iso_pu_bacteria 2744054901 2746093174 412
431 iso_pu_bacteria 2751185846 2753566076 412
432 iso_pu_bacteria 2791355137 2792836975 412
433 iso_pu_bacteria 2808606384 2808972966 412
434 iso_pu_bacteria 2808606390 2809007869 412
435 iso_pu_bacteria 2808606391 2809015491 412
436 iso_pu_bacteria 2816332253 2817259839 412
437 iso_pu_bacteria 2816332256 2817277501 412
438 iso_pu_bacteria 2816332286 2817456633 412
439 iso_pu_bacteria 2818991450 2819624257 412
440 iso_pu_bacteria 2818991452 2819637023 412
441 iso_pu_bacteria 2842324504 2842332091 412
442 iso_pu_bacteria 2842348783 2842356457 412
443 iso_pu_bacteria 2842454564 2842461189 412
444 iso_pu_bacteria 2863421361 2863426373 412
445 iso_pu_bacteria 2870068957 2870069260 412
446 iso_pu_bacteria 2885270888 2885272460 412
447 iso_pu_bacteria 2900634093 2900637166 412
448 iso_pu_bacteria 2902682994 2902686772 412
449 iso_pu_bacteria 2904483920 2904490212 412
450 iso_pu_bacteria 2904564687 2904569512 412
451 iso_pu_bacteria 2904571731 2904576651 412
452 iso_pu_bacteria 2904615490 2904621475 412
453 iso_pu_bacteria 2919527303 2919533382 412
454 iso_pu_bacteria 2928108538 2928114117 412
455 iso_pu_bacteria 2928135762 2928141135 412
456 iso_pu_bacteria 2928170801 2928176188 412
457 iso_pu_bacteria 2928503688 2928509112 412
458 iso_pu_bacteria 2928536128 2928542133 412
459 iso_pu_bacteria 2945934425 2945934470 412
460 iso_pu_bacteria 2990703756 2990704970 412
461 iso_pu_bacteria 641736151 642426634 412
462 iso_pu_bacteria 641736154 642418382 412
463 iso_pu_bacteria 642555112 642594523 412
464 iso_pu_bacteria 642555113 642621785 412
465 iso_pu_bacteria 642555113 642623108 412
466 iso_pu_bacteria 8018845410 8018848778 412
467 iso_pu_bacteria 8020807995 8020810810 412
468 iso_pu_bacteria 8020938398 8020938913 412
469 iso_pu_bacteria 8020945358 8020950449 412
470 iso_pu_bacteria 8020953355 8020953543 412
471 iso_pu_bacteria 8021120328 8021127925 412
472 iso_pu_bacteria 8039098773 8039102041 412
473 iso_pu_bacteria 8040167225 8040172657 412
474 iso_pu_bacteria 8040173305 8040176385 412
475 iso_pu_bacteria 8055266321 8055269520 412
476 iso_pu_bacteria 8055301274 8055307318 412
477 3300003316 rootH1_10013471 rootH1_100134712 413
478 3300003320 rootH2_10025596 rootH2_100255964 413
479 3300003322 rootL2_10032325 rootL2_100323252 413
480 3300003323 rootH1_10003329 rootH1_100033298 413
481 3300003323 rootH1_10035876 rootH1_100358763 413
482 3300003752 Ga0055539_1000414 Ga0055539_10004149 413
483 3300003756 Ga0055533_1000048 Ga0055533_100004819 413
484 3300003756 Ga0055533_1000068 Ga0055533_100006864 413
485 3300003761 Ga0055535_1000252 Ga0055535_100025237 413
486 3300003763 Ga0055529_1000150 Ga0055529_100015081 413
487 3300003794 Ga0055531_10011470 Ga0055531_100114702 413
488 3300005327 Ga0070658_10077601 Ga0070658_100776012 413
489 3300005347 Ga0070668_100016481 Ga0070668_1000164813 413
490 3300005356 Ga0070674_100020277 Ga0070674_1000202775 413
491 3300005364 Ga0070673_100056244 Ga0070673_1000562442 413
492 3300005366 Ga0070659_100016174 Ga0070659_1000161743 413
493 3300005459 Ga0068867_100016036 Ga0068867_1000160365 413
494 3300005563 Ga0068855_100002740 Ga0068855_1000027404 413
495 3300005719 Ga0068861_100110832 Ga0068861_1001108322 413
496 3300006944 Ga0099823_1000003 Ga0099823_100000355 413
497 3300009093 Ga0105240_10226800 Ga0105240_102268001 413
498 3300009148 Ga0105243_10050239 Ga0105243_100502391 413
499 3300009176 Ga0105242_10022980 Ga0105242_100229802 413
500 3300009177 Ga0105248_10063036 Ga0105248_100630362 413
501 3300013297 Ga0157378_10133474 Ga0157378_101334741 413
502 3300025226 Ga0209674_100024 Ga0209674_100024315 413
503 3300025230 Ga0209563_100101 Ga0209563_10010165 413
504 3300025242 Ga0209258_100080 Ga0209258_10008019 413
505 3300025242 Ga0209258_101186 Ga0209258_1011863 413
506 3300025253 Ga0209677_100091 Ga0209677_10009147 413
507 3300025253 Ga0209677_100509 Ga0209677_1005095 413
508 3300025256 Ga0209759_1000827 Ga0209759_10008274 413
509 3300025256 Ga0209759_1000945 Ga0209759_100094523 413
510 3300025272 Ga0209455_1000030 Ga0209455_1000030480 413
511 3300025273 Ga0209673_1022252 Ga0209673_10222522 413
512 3300025298 Ga0209050_1003447 Ga0209050_10034471 413
513 3300025299 Ga0209256_1001730 Ga0209256_10017302 413
514 3300025303 Ga0209051_1004239 Ga0209051_10042392 413
515 3300025304 Ga0209257_1013559 Ga0209257_10135592 413
516 3300025909 Ga0207705_10061699 Ga0207705_100616992 413
517 3300025913 Ga0207695_10224610 Ga0207695_102246101 413
518 3300025932 Ga0207690_10156025 Ga0207690_101560251 413
519 3300025935 Ga0207709_10080988 Ga0207709_100809881 413
520 3300025937 Ga0207669_10117912 Ga0207669_101179121 413
521 3300025940 Ga0207691_10088071 Ga0207691_100880714 413
522 3300025941 Ga0207711_10039974 Ga0207711_100399745 413
523 3300025949 Ga0207667_10011603 Ga0207667_100116034 413
524 3300025960 Ga0207651_10010282 Ga0207651_100102823 413
525 3300025972 Ga0207668_10086755 Ga0207668_100867552 413
526 3300026118 Ga0207675_100082236 Ga0207675_1000822362 413
527 3300026142 Ga0207698_10014920 Ga0207698_100149203 413
528 3300028381 Ga0268264_10278296 Ga0268264_102782962 413
529 3300028786 Ga0307517_10068391 Ga0307517_100683912 413
530 3300028794 Ga0307515_10006245 Ga0307515_100062452 413
531 3300031730 Ga0307516_10004112 Ga0307516_1000411219 413
532 3300031730 Ga0307516_10036065 Ga0307516_100360651 413
533 3300032004 Ga0307414_10092059 Ga0307414_100920591 413
534 3300035691 Ga0373931_0008624 Ga0373931_0008624_1940_3265 413
535 3300039447 Ga0436361_0563595 Ga0436361_0563595_322_1632 413
536 3300042439 Ga0439464_0007495 Ga0439464_0007495_1380_2699 413
537 3300044656 Ga0466969_0002590 Ga0466969_0002590_144_1454 413
538 3300044658 Ga0466972_0003681 Ga0466972_0003681_742_2040 413
539 3300044684 Ga0466966_0002795 Ga0466966_0002795_1429_2739 413
540 3300044706 Ga0466964_0001232 Ga0466964_0001232_1022_2332 413
541 3300044719 Ga0466971_0006019 Ga0466971_0006019_2751_4061 413
542 3300044735 Ga0466968_0027880 Ga0466968_0027880_852_2162 413
543 3300044842 Ga0466957_0000379 Ga0466957_0000379_6697_8007 413
544 3300044842 Ga0466957_0022364 Ga0466957_0022364_2288_3598 413
545 3300045049 Ga0466959_0003971 Ga0466959_0003971_1341_2651 413
546 3300045836 Ga0466958_0047061 Ga0466958_0047061_200_1510 413
547 3300046475 Ga0495639_0027429 Ga0495639_0027429_276_1628 413
548 3300046492 Ga0495585_0041066 Ga0495585_0041066_1175_2500 413
549 3300046506 Ga0495583_0000022 Ga0495583_0000022_211192_212517 413
550 3300046507 Ga0495606_0001504 Ga0495606_0001504_11215_12540 413
551 3300046537 Ga0495598_0005706 Ga0495598_0005706_815_2146 413
552 3300046660 Ga0495625_0050942 Ga0495625_0050942_1486_2811 413
553 3300046694 Ga0495649_0000282 Ga0495649_0000282_32763_34088 413
554 3300047472 Ga0495686_0074331 Ga0495686_0074331_631_2070 413
555 3300048904 Ga0496101_0087085 Ga0496101_0087085_268_1596 413
556 3300048907 Ga0496104_0034573 Ga0496104_0034573_325_1638 413
557 3300048913 Ga0496110_0333871 Ga0496110_0333871_23_1282 413
558 3300048927 Ga0496124_0026007 Ga0496124_0026007_1235_2557 413
559 3300048928 Ga0496125_0000318 Ga0496125_0000318_78475_79734 413
560 3300048929 Ga0496126_0053001 Ga0496126_0053001_291_1547 413
561 3300050496 nmdc:mga07m45_2201_c1 nmdc:mga07m45_2201_c1_3567_4895 413
562 3300053080 Ga0500635_0000047 Ga0500635_0000047_17946_19307 413
563 3300053151 Ga0500604_0000228 Ga0500604_0000228_10330_11586 413
564 3300053177 Ga0500636_0021540 Ga0500636_0021540_1441_2763 413
565 3300061719 Ga0466962_0002532 Ga0466962_0002532_1219_2529 413
566 iso_pu_bacteria 2501025502 2501084031 413
567 iso_pu_bacteria 2510917013 2511093414 413
568 iso_pu_bacteria 2513237082 2513556059 413
569 iso_pu_bacteria 2513237083 2513564245 413
570 iso_pu_bacteria 2515154189 2516022358 413
571 iso_pu_bacteria 2883087390 2883091351 413
572 iso_pu_bacteria 8003955200 8003956737 413
573 3300005327 Ga0070658_10125676 Ga0070658_101256762 414
574 3300005548 Ga0070665_100000449 Ga0070665_10000044928 414
575 3300009551 Ga0105238_10108170 Ga0105238_101081702 414
576 3300028379 Ga0268266_10000110 Ga0268266_1000011041 414
577 3300031548 Ga0307408_100182314 Ga0307408_1001823141 414
578 3300048915 Ga0496112_0235650 Ga0496112_0235650_442_1695 414
579 3300045051 Ga0451576_0131415 Ga0451576_0131415_691_2031 415
580 3300053146 Ga0500588_0005414 Ga0500588_0005414_1388_2644 415
581 3300001989 JGI24739J22299_10001229 JGI24739J22299_1000122910 416
582 3300001989 JGI24739J22299_10007347 JGI24739J22299_100073474 416
583 3300001990 JGI24737J22298_10006947 JGI24737J22298_100069472 416
584 3300002067 JGI24735J21928_10000535 JGI24735J21928_1000053516 416
585 3300002075 JGI24738J21930_10002284 JGI24738J21930_100022842 416
586 3300002705 JGI25156J39149_1001087 JGI25156J39149_100108712 416
587 3300002705 JGI25156J39149_1003877 JGI25156J39149_10038771 416
588 3300003214 JGI25165J46597_1001604 JGI25165J46597_10016043 416
589 3300003756 Ga0055533_1000645 Ga0055533_10006457 416
590 3300003756 Ga0055533_1005548 Ga0055533_10055482 416
591 3300003758 Ga0055532_1000092 Ga0055532_100009267 416
592 3300003760 Ga0055527_1000035 Ga0055527_1000035105 416
593 3300003761 Ga0055535_1000050 Ga0055535_1000050105 416
594 3300003762 Ga0055542_1000120 Ga0055542_100012067 416
595 3300003763 Ga0055529_1000089 Ga0055529_1000089105 416
596 3300005262 Ga0065165_1000648 Ga0065165_100064841 416
597 3300005327 Ga0070658_10005242 Ga0070658_100052425 416
598 3300005327 Ga0070658_10018761 Ga0070658_100187613 416
599 3300005339 Ga0070660_100000144 Ga0070660_10000014436 416
600 3300005366 Ga0070659_100000156 Ga0070659_10000015636 416
601 3300005367 Ga0070667_100025925 Ga0070667_1000259253 416
602 3300005455 Ga0070663_100007485 Ga0070663_1000074854 416
603 3300005455 Ga0070663_100011786 Ga0070663_1000117865 416
604 3300005456 Ga0070678_100030616 Ga0070678_1000306164 416
605 3300005563 Ga0068855_100004044 Ga0068855_1000040446 416
606 3300005563 Ga0068855_100070586 Ga0068855_1000705864 416
607 3300005614 Ga0068856_100105703 Ga0068856_1001057032 416
608 3300005616 Ga0068852_100008251 Ga0068852_1000082517 416
609 3300005842 Ga0068858_100065389 Ga0068858_1000653893 416
610 3300009011 Ga0105251_10000758 Ga0105251_1000075817 416
611 3300009093 Ga0105240_10001922 Ga0105240_1000192222 416
612 3300009093 Ga0105240_10031832 Ga0105240_100318326 416
613 3300009093 Ga0105240_10128415 Ga0105240_101284153 416
614 3300009177 Ga0105248_10041858 Ga0105248_100418584 416
615 3300009545 Ga0105237_10021860 Ga0105237_100218605 416
616 3300009551 Ga0105238_10003750 Ga0105238_1000375012 416
617 3300009551 Ga0105238_10149896 Ga0105238_101498962 416
618 3300010375 Ga0105239_10003468 Ga0105239_1000346811 416
619 3300010375 Ga0105239_10094132 Ga0105239_100941323 416
620 3300013104 Ga0157370_10000439 Ga0157370_1000043929 416
621 3300013104 Ga0157370_10002253 Ga0157370_1000225317 416
622 3300013105 Ga0157369_10001007 Ga0157369_1000100718 416
623 3300013105 Ga0157369_10157497 Ga0157369_101574972 416
624 3300013296 Ga0157374_10000146 Ga0157374_1000014620 416
625 3300013306 Ga0163162_10000877 Ga0163162_1000087712 416
626 3300013307 Ga0157372_10000323 Ga0157372_100003235 416
627 3300015262 Ga0182007_10003995 Ga0182007_100039955 416
628 3300015265 Ga0182005_1030737 Ga0182005_10307372 416
629 3300025226 Ga0209674_100153 Ga0209674_1001532 416
630 3300025226 Ga0209674_100671 Ga0209674_1006712 416
631 3300025228 Ga0209672_100072 Ga0209672_100072124 416
632 3300025228 Ga0209672_100073 Ga0209672_10007342 416
633 3300025228 Ga0209672_100185 Ga0209672_10018531 416
634 3300025229 Ga0209147_100093 Ga0209147_10009342 416
635 3300025229 Ga0209147_100100 Ga0209147_100100116 416
636 3300025231 Ga0207427_100866 Ga0207427_1008664 416
637 3300025242 Ga0209258_100140 Ga0209258_10014042 416
638 3300025242 Ga0209258_100331 Ga0209258_10033125 416
639 3300025254 Ga0209148_1000140 Ga0209148_100014043 416
640 3300025256 Ga0209759_1000195 Ga0209759_100019518 416
641 3300025256 Ga0209759_1000329 Ga0209759_100032966 416
642 3300025256 Ga0209759_1000351 Ga0209759_100035146 416
643 3300025256 Ga0209759_1013933 Ga0209759_10139332 416
644 3300025256 Ga0209759_1014092 Ga0209759_10140922 416
645 3300025261 Ga0209233_1000173 Ga0209233_100017342 416
646 3300025272 Ga0209455_1000125 Ga0209455_100012543 416
647 3300025302 Ga0207426_1000199 Ga0207426_1000199112 416
648 3300025735 Ga0207713_1000186 Ga0207713_100018652 416
649 3300025904 Ga0207647_10000126 Ga0207647_1000012661 416
650 3300025904 Ga0207647_10002464 Ga0207647_100024643 416
651 3300025904 Ga0207647_10003041 Ga0207647_100030412 416
652 3300025904 Ga0207647_10021302 Ga0207647_100213022 416
653 3300025904 Ga0207647_10030780 Ga0207647_100307802 416
654 3300025909 Ga0207705_10000841 Ga0207705_1000084116 416
655 3300025909 Ga0207705_10162409 Ga0207705_101624091 416
656 3300025913 Ga0207695_10004600 Ga0207695_100046003 416
657 3300025913 Ga0207695_10005877 Ga0207695_100058776 416
658 3300025914 Ga0207671_10009292 Ga0207671_100092923 416
659 3300025919 Ga0207657_10000096 Ga0207657_1000009636 416
660 3300025919 Ga0207657_10011541 Ga0207657_100115413 416
661 3300025924 Ga0207694_10046481 Ga0207694_100464813 416
662 3300025932 Ga0207690_10000074 Ga0207690_1000007443 416
663 3300025932 Ga0207690_10019260 Ga0207690_100192603 416
664 3300025941 Ga0207711_10094057 Ga0207711_100940572 416
665 3300025949 Ga0207667_10018190 Ga0207667_100181905 416
666 3300025949 Ga0207667_10074256 Ga0207667_100742562 416
667 3300025949 Ga0207667_10091752 Ga0207667_100917523 416
668 3300025986 Ga0207658_10016870 Ga0207658_100168703 416
669 3300026067 Ga0207678_10000061 Ga0207678_1000006144 416
670 3300026067 Ga0207678_10077473 Ga0207678_100774734 416
671 3300026121 Ga0207683_10029618 Ga0207683_100296183 416
672 3300027312 Ga0209371_1001782 Ga0209371_100178210 416
673 3300028800 Ga0265338_10000547 Ga0265338_1000054737 416
674 3300030500 Ga0268256_1006262 Ga0268256_10062623 416
675 3300031548 Ga0307408_100000422 Ga0307408_10000042228 416
676 3300031731 Ga0307405_10005333 Ga0307405_100053333 416
677 3300031911 Ga0307412_10000056 Ga0307412_10000056118 416
678 3300031995 Ga0307409_100021088 Ga0307409_1000210883 416
679 3300032002 Ga0307416_100008384 Ga0307416_1000083843 416
680 3300032005 Ga0307411_10133060 Ga0307411_101330602 416
681 3300037312 Ga0395899_0122248 Ga0395899_0122248_64_1323 416
682 3300037418 Ga0395900_0103296 Ga0395900_0103296_597_1856 416
683 3300037418 Ga0395900_0114951 Ga0395900_0114951_154_1419 416
684 3300037466 Ga0395898_0009374 Ga0395898_0009374_423_1688 416
685 3300037466 Ga0395898_0091789 Ga0395898_0091789_1596_2855 416
686 3300038443 Ga0395901_0000771 Ga0395901_0000771_34329_35588 416
687 3300038443 Ga0395901_0001663 Ga0395901_0001663_21587_22846 416
688 3300042005 Ga0439448_0000429 Ga0439448_0000429_5325_6764 416
689 3300044666 Ga0466977_0056070 Ga0466977_0056070_1030_2283 416
690 3300044683 Ga0466965_0005911 Ga0466965_0005911_577_1827 416
691 3300044684 Ga0466966_0005527 Ga0466966_0005527_3404_4678 416
692 3300044684 Ga0466966_0085575 Ga0466966_0085575_407_1657 416
693 3300044693 Ga0466961_0013426 Ga0466961_0013426_3939_5213 416
694 3300044693 Ga0466961_0094159 Ga0466961_0094159_122_1375 416
695 3300044765 Ga0466970_0001740 Ga0466970_0001740_5116_6390 416
696 3300044842 Ga0466957_0083559 Ga0466957_0083559_613_1917 416
697 3300045049 Ga0466959_0005343 Ga0466959_0005343_6341_7615 416
698 3300046454 Ga0495592_0009220 Ga0495592_0009220_4410_5660 416
699 3300046455 Ga0495603_0006083 Ga0495603_0006083_1519_2769 416
700 3300046455 Ga0495603_0031509 Ga0495603_0031509_1686_2936 416
701 3300046457 Ga0495590_0003243 Ga0495590_0003243_1612_2862 416
702 3300046457 Ga0495590_0018895 Ga0495590_0018895_1177_2427 416
703 3300046457 Ga0495590_0021494 Ga0495590_0021494_882_2180 416
704 3300046459 Ga0495629_0000052 Ga0495629_0000052_21521_22819 416
705 3300046459 Ga0495629_0000162 Ga0495629_0000162_2568_3818 416
706 3300046459 Ga0495629_0000625 Ga0495629_0000625_13545_14795 416
707 3300046459 Ga0495629_0006110 Ga0495629_0006110_461_1711 416
708 3300046460 Ga0495638_0000875 Ga0495638_0000875_13491_14741 416
709 3300046460 Ga0495638_0011363 Ga0495638_0011363_322_1572 416
710 3300046461 Ga0495641_0015103 Ga0495641_0015103_2603_3853 416
711 3300046463 Ga0495653_0001943 Ga0495653_0001943_9357_10655 416
712 3300046463 Ga0495653_0003345 Ga0495653_0003345_131_1381 416
713 3300046463 Ga0495653_0012493 Ga0495653_0012493_1349_2599 416
714 3300046471 Ga0495650_0001711 Ga0495650_0001711_13675_14925 416
715 3300046471 Ga0495650_0010974 Ga0495650_0010974_338_1588 416
716 3300046471 Ga0495650_0012488 Ga0495650_0012488_322_1572 416
717 3300046471 Ga0495650_0037866 Ga0495650_0037866_144_1394 416
718 3300046471 Ga0495650_0054965 Ga0495650_0054965_222_1472 416
719 3300046472 Ga0495580_0004723 Ga0495580_0004723_5606_6904 416
720 3300046472 Ga0495580_0008529 Ga0495580_0008529_1188_2438 416
721 3300046472 Ga0495580_0009825 Ga0495580_0009825_2285_3535 416
722 3300046472 Ga0495580_0011040 Ga0495580_0011040_4822_6120 416
723 3300046472 Ga0495580_0183263 Ga0495580_0183263_27_1277 416
724 3300046473 Ga0495582_0018014 Ga0495582_0018014_2137_3387 416
725 3300046474 Ga0495605_0009236 Ga0495605_0009236_3465_4715 416
726 3300046474 Ga0495605_0013347 Ga0495605_0013347_1058_2326 416
727 3300046474 Ga0495605_0018915 Ga0495605_0018915_1779_3029 416
728 3300046474 Ga0495605_0022628 Ga0495605_0022628_1180_2478 416
729 3300046474 Ga0495605_0034044 Ga0495605_0034044_439_1689 416
730 3300046477 Ga0495664_0014580 Ga0495664_0014580_822_2072 416
731 3300046492 Ga0495585_0037697 Ga0495585_0037697_1166_2416 416
732 3300046500 Ga0495596_0008448 Ga0495596_0008448_1242_2492 416
733 3300046500 Ga0495596_0011681 Ga0495596_0011681_237_1487 416
734 3300046500 Ga0495596_0020553 Ga0495596_0020553_1174_2472 416
735 3300046501 Ga0495607_0021514 Ga0495607_0021514_1506_2756 416
736 3300046506 Ga0495583_0004759 Ga0495583_0004759_4573_5823 416
737 3300046506 Ga0495583_0006177 Ga0495583_0006177_1502_2770 416
738 3300046507 Ga0495606_0009474 Ga0495606_0009474_5214_6542 416
739 3300046507 Ga0495606_0012297 Ga0495606_0012297_3773_5023 416
740 3300046507 Ga0495606_0049375 Ga0495606_0049375_1012_2262 416
741 3300046507 Ga0495606_0100766 Ga0495606_0100766_485_1735 416
742 3300046511 Ga0495608_0002588 Ga0495608_0002588_10519_11769 416
743 3300046513 Ga0495616_0015844 Ga0495616_0015844_2446_3714 416
744 3300046515 Ga0495620_0033951 Ga0495620_0033951_989_2239 416
745 3300046516 Ga0495628_0005506 Ga0495628_0005506_6803_8251 416
746 3300046517 Ga0495630_0008386 Ga0495630_0008386_3498_4796 416
747 3300046517 Ga0495630_0122643 Ga0495630_0122643_69_1319 416
748 3300046526 Ga0495666_0001199 Ga0495666_0001199_3990_5240 416
749 3300046526 Ga0495666_0020219 Ga0495666_0020219_1692_2942 416
750 3300046526 Ga0495666_0100462 Ga0495666_0100462_27_1277 416
751 3300046528 Ga0495642_0050858 Ga0495642_0050858_249_1499 416
752 3300046529 Ga0495652_0126398 Ga0495652_0126398_93_1343 416
753 3300046530 Ga0495654_0011167 Ga0495654_0011167_3303_4553 416
754 3300046531 Ga0495665_0017510 Ga0495665_0017510_2348_3646 416
755 3300046533 Ga0495640_0006347 Ga0495640_0006347_474_1724 416
756 3300046535 Ga0495586_0083545 Ga0495586_0083545_116_1366 416
757 3300046543 Ga0495645_0001234 Ga0495645_0001234_2969_4219 416
758 3300046642 Ga0495634_0016709 Ga0495634_0016709_1785_3035 416
759 3300046663 Ga0495635_0000986 Ga0495635_0000986_10233_11483 416
760 3300046665 Ga0495661_0063515 Ga0495661_0063515_759_2009 416
761 3300046679 Ga0495623_0002524 Ga0495623_0002524_5650_6900 416
762 3300046680 Ga0495646_0004620 Ga0495646_0004620_5956_7254 416
763 3300046684 Ga0495669_0009470 Ga0495669_0009470_1137_2387 416
764 3300046684 Ga0495669_0076232 Ga0495669_0076232_33_1283 416
765 3300046689 Ga0495613_0029780 Ga0495613_0029780_1340_2638 416
766 3300046689 Ga0495613_0066860 Ga0495613_0066860_1090_2340 416
767 3300046690 Ga0495624_0003206 Ga0495624_0003206_182_1432 416
768 3300046690 Ga0495624_0007370 Ga0495624_0007370_6267_7517 416
769 3300046690 Ga0495624_0008497 Ga0495624_0008497_5563_6861 416
770 3300046690 Ga0495624_0041803 Ga0495624_0041803_541_1791 416
771 3300046691 Ga0495670_0014585 Ga0495670_0014585_2012_3262 416
772 3300046692 Ga0495671_0021994 Ga0495671_0021994_1031_2329 416
773 3300046694 Ga0495649_0001094 Ga0495649_0001094_9140_10468 416
774 3300046694 Ga0495649_0006432 Ga0495649_0006432_1218_2468 416
775 3300046694 Ga0495649_0027513 Ga0495649_0027513_985_2253 416
776 3300046694 Ga0495649_0053665 Ga0495649_0053665_95_1345 416
777 3300046694 Ga0495649_0071968 Ga0495649_0071968_575_1825 416
778 3300046794 Ga0495589_0027902 Ga0495589_0027902_448_1698 416
779 3300047315 Ga0495581_0009419 Ga0495581_0009419_401_1651 416
780 3300047315 Ga0495581_0014655 Ga0495581_0014655_1335_2585 416
781 3300047317 Ga0495604_0008712 Ga0495604_0008712_6617_7867 416
782 3300047319 Ga0495674_0004487 Ga0495674_0004487_2619_3905 416
783 3300047319 Ga0495674_0006941 Ga0495674_0006941_3946_5244 416
784 3300047319 Ga0495674_0014053 Ga0495674_0014053_1752_3002 416
785 3300047319 Ga0495674_0032066 Ga0495674_0032066_1329_2579 416
786 3300047319 Ga0495674_0035427 Ga0495674_0035427_2469_3767 416
787 3300047319 Ga0495674_0038188 Ga0495674_0038188_180_1430 416
788 3300047319 Ga0495674_0049395 Ga0495674_0049395_1445_2713 416
789 3300047319 Ga0495674_0049782 Ga0495674_0049782_165_1415 416
790 3300047320 Ga0495672_0037033 Ga0495672_0037033_579_1877 416
791 3300047321 Ga0495676_0113531 Ga0495676_0113531_461_1759 416
792 3300047322 Ga0495680_0026016 Ga0495680_0026016_2234_3484 416
793 3300047322 Ga0495680_0075404 Ga0495680_0075404_1161_2411 416
794 3300047323 Ga0495683_0006554 Ga0495683_0006554_4819_6069 416
795 3300047323 Ga0495683_0014346 Ga0495683_0014346_1477_2775 416
796 3300047323 Ga0495683_0022445 Ga0495683_0022445_1134_2402 416
797 3300047443 Ga0495687_000419 Ga0495687_000419_13803_15083 416
798 3300047443 Ga0495687_005432 Ga0495687_005432_6401_7651 416
799 3300047443 Ga0495687_029501 Ga0495687_029501_1067_2317 416
800 3300047444 Ga0495675_0075232 Ga0495675_0075232_381_1631 416
801 3300047445 Ga0495677_0060041 Ga0495677_0060041_140_1390 416
802 3300047446 Ga0495679_000023 Ga0495679_000023_138023_139321 416
803 3300047446 Ga0495679_001555 Ga0495679_001555_11520_12770 416
804 3300047446 Ga0495679_032091 Ga0495679_032091_307_1557 416
805 3300047469 Ga0495673_0008551 Ga0495673_0008551_2969_4237 416
806 3300047469 Ga0495673_0012722 Ga0495673_0012722_464_1762 416
807 3300047471 Ga0495684_0045511 Ga0495684_0045511_1064_2314 416
808 3300047471 Ga0495684_0050822 Ga0495684_0050822_417_1667 416
809 3300047472 Ga0495686_0000540 Ga0495686_0000540_11457_12920 416
810 3300047472 Ga0495686_0029484 Ga0495686_0029484_43_1293 416
811 3300047673 Ga0495593_0001681 Ga0495593_0001681_11085_12383 416
812 3300047673 Ga0495593_0027471 Ga0495593_0027471_1643_2893 416
813 3300048089 Ga0495614_0002282 Ga0495614_0002282_6582_7832 416
814 3300048091 Ga0495626_0013389 Ga0495626_0013389_747_1997 416
815 3300048091 Ga0495626_0067956 Ga0495626_0067956_257_1507 416
816 3300048903 Ga0496100_0022940 Ga0496100_0022940_193_1464 416
817 3300048903 Ga0496100_0127650 Ga0496100_0127650_249_1499 416
818 3300048904 Ga0496101_0005429 Ga0496101_0005429_6774_8045 416
819 3300048904 Ga0496101_0006077 Ga0496101_0006077_6128_7396 416
820 3300048905 Ga0496102_0002104 Ga0496102_0002104_211_1482 416
821 3300048905 Ga0496102_0014872 Ga0496102_0014872_5037_6287 416
822 3300048905 Ga0496102_0224552 Ga0496102_0224552_197_1495 416
823 3300048906 Ga0496103_0002058 Ga0496103_0002058_3288_4559 416
824 3300048906 Ga0496103_0017942 Ga0496103_0017942_1870_3120 416
825 3300048907 Ga0496104_0031075 Ga0496104_0031075_1503_2753 416
826 3300048907 Ga0496104_0068607 Ga0496104_0068607_174_1445 416
827 3300048908 Ga0496105_0088283 Ga0496105_0088283_1268_2536 416
828 3300048909 Ga0496106_0020212 Ga0496106_0020212_2143_3393 416
829 3300048910 Ga0496107_0248178 Ga0496107_0248178_62_1312 416
830 3300048916 Ga0496113_0066817 Ga0496113_0066817_885_2153 416
831 3300048917 Ga0496114_0013986 Ga0496114_0013986_4367_5617 416
832 3300048917 Ga0496114_0047284 Ga0496114_0047284_2289_3539 416
833 3300048918 Ga0496115_0061025 Ga0496115_0061025_1758_3026 416
834 3300048919 Ga0496116_0020794 Ga0496116_0020794_3666_4916 416
835 3300048920 Ga0496117_0005798 Ga0496117_0005798_9713_10984 416
836 3300048920 Ga0496117_0096298 Ga0496117_0096298_28_1326 416
837 3300048921 Ga0496118_0002552 Ga0496118_0002552_12397_13647 416
838 3300048921 Ga0496118_0004263 Ga0496118_0004263_14292_15563 416
839 3300048921 Ga0496118_0009356 Ga0496118_0009356_168_1466 416
840 3300048921 Ga0496118_0012795 Ga0496118_0012795_5648_6898 416
841 3300048921 Ga0496118_0160785 Ga0496118_0160785_93_1343 416
842 3300048924 Ga0496121_0002288 Ga0496121_0002288_14347_15597 416
843 3300048924 Ga0496121_0011728 Ga0496121_0011728_5471_6742 416
844 3300048924 Ga0496121_0015965 Ga0496121_0015965_295_1563 416
845 3300048924 Ga0496121_0028418 Ga0496121_0028418_3582_4832 416
846 3300048924 Ga0496121_0030932 Ga0496121_0030932_1554_2804 416
847 3300048925 Ga0496122_0064974 Ga0496122_0064974_1008_2279 416
848 3300048926 Ga0496123_0055509 Ga0496123_0055509_146_1417 416
849 3300048928 Ga0496125_0112109 Ga0496125_0112109_674_1945 416
850 3300048929 Ga0496126_0000538 Ga0496126_0000538_36448_37698 416
851 3300048929 Ga0496126_0002311 Ga0496126_0002311_13115_14365 416
852 3300048929 Ga0496126_0008981 Ga0496126_0008981_3486_4736 416
853 3300049459 Ga0495678_008464 Ga0495678_008464_1656_2906 416
854 3300049460 Ga0495682_0058461 Ga0495682_0058461_115_1365 416
855 iso_pu_bacteria 2501025501 2501075098 416
856 iso_pu_bacteria 2501025504 2501412718 416
857 iso_pu_bacteria 2510917014 2511099864 416
858 iso_pu_bacteria 2510917015 2511102351 416
859 iso_pu_bacteria 2856287931 2856289320 416
860 iso_pu_bacteria 2857357740 2857362178 416
861 iso_pu_bacteria 2900634093 2900634623 416
862 iso_pu_bacteria 2928157003 2928163176 416
863 iso_pu_bacteria 2928163908 2928170078 416
864 iso_pu_bacteria 2981990288 2981995973 416

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00012

HSP70

Hsp70 protein

94

310

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5obu-assembly1.cif.gz_A mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with amppnp. 0.8353 1 416
6w6e-assembly1.cif.gz_I the mycobacterium tuberculosis clpb disaggregase hexamer structure with a locally refined clpb middle domain and a dnak nucleotide binding domain 0.8311 2 414
5obv-assembly1.cif.gz_A mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with adp and pi. 0.8303 1 416
4rtf-assembly1.cif.gz_D crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv 0.828 4 414
5oby-assembly1.cif.gz_A mycoplasma genitalium dnak-nbd in complex with amp-pnp 0.8258 1 416
ID Description Score Start End Superfamily
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9351 271 340 3.30.420.40
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.899 271 340 3.30.420.40
af_A0A368UHA7_9_69_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8865 6 57 3.30.420.40
3d2eC01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8854 1 170 3.30.420.40
3d2eC03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8619 173 395 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A435E0U6-F1-model_v4 Hsp70 family protein 0.9809 2 156 GO:0005524
GO:0140662
AF-A0A2D6ENX0-F1-model_v4 Heat-shock protein 0.9773 1 416 GO:0005524
GO:0140662
AF-F0GJD4-F1-model_v4 Molecular chaperone-like protein 0.975 180 339
AF-A0A2D6ENX0-F1-model_v4 Heat-shock protein 0.975 1 416 GO:0005524
GO:0140662
AF-F0GJD4-F1-model_v4 Molecular chaperone-like protein 0.9574 180 339

Feature Viewer

pLDDT pTM Quality
93.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map