F483908

General Info

Members Datasets Scaffolds Average Seq Length
863 506 1726 149

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_101234707|Ga0070662_1012347072
Length 146
Sequence MSKEAPISRFTVITLGVSDMRTSIAFYESLGFARKFRATGEAVAFFDTGGTVIALYPWNLLARDAALPDQPRPKTFRGVTLAWNCNSAQEVDAVMDFAIARGASLLRPTDYGGYAGYFADPDGHAWEAVVAPRIVAGDDRRVHLPD

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
332 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
333 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
339 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
343 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
344 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
351 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
352 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
353 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
354 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
355 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
358 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
363 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
364 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
365 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
366 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
367 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
368 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
369 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
372 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
373 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
374 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
375 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
376 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
377 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
378 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
379 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
380 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
381 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
382 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
383 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
384 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
385 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
386 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
387 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
388 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
389 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
390 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
391 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
392 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
393 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
394 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
395 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
396 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
397 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
398 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
399 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
400 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
401 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
402 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
403 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
404 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
405 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
406 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
407 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
408 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
409 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
410 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
411 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
412 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
413 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
414 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
415 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
416 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
417 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
418 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
419 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
420 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
421 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
422 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
423 2922368715
424 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
425 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
426 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
427 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
428 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
429 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
430 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
431 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
432 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
433 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
434 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
435 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
436 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
437 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
438 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
439 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
440 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
441 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
442 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
443 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
444 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
445 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
446 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
447 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
448 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
449 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
450 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
451 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
452 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
453 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
454 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
455 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
456 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
457 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
458 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
459 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
460 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
461 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
462 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
463 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
464 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
465 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
466 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
467 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
468 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
469 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
470 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
471 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
472 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
473 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
474 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
475 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
476 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
477 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
478 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
479 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
480 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
481 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
482 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
483 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
484 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
485 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
486 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
487 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
488 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
489 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
490 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
491 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
492 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
493 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
494 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
495 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
496 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
497 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
498 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
499 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
500 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
501 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
502 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
503 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
504 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
505 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
506 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.22
Metatranscriptomes 0
Isolates 15.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.64
Nodule 13.09
Rhizoplane 5.33
Rhizosphere 56.43
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_101234707 3300005457 Bacteria 643
2 RicEn_FSXC5920_b1 2010549000 Bacteria 869
3 JGI24740J21852_10006849 3300001979 Bacteria 4678
4 JGI24739J22299_10015528 3300001989 Bacteria 2768
5 JGI24735J21928_10148914 3300002067 Bacteria 676
6 JGI25406J46586_10014410 3300003203 Bacteria 3363
7 JGI25160J50197_1065822 3300003354 Bacteria 707
8 JGI25404J52841_10010421 3300003659 Bacteria 1999
9 JGI25404J52841_10048059 3300003659 Bacteria 899
10 Ga0065165_1065894 3300005262 Bacteria 976
11 Ga0070658_10070829 3300005327 Bacteria 2855
12 Ga0070658_10310280 3300005327 Bacteria 1346
13 Ga0070683_101959971 3300005329 Bacteria 563
14 Ga0070670_100626562 3300005331 Bacteria 964
15 Ga0068869_100034105 3300005334 Bacteria 3598
16 Ga0070666_10951638 3300005335 Bacteria 636
17 Ga0070680_100041965 3300005336 Bacteria 3711
18 Ga0070682_100192565 3300005337 Bacteria 1432
19 Ga0070682_100299956 3300005337 Bacteria 1179
20 Ga0068868_100063075 3300005338 Bacteria 2939
21 Ga0070660_100651829 3300005339 Bacteria 882
22 Ga0070661_100186968 3300005344 Bacteria 1578
23 Ga0070668_100332490 3300005347 Bacteria 1282
24 Ga0070671_100088325 3300005355 Bacteria 2594
25 Ga0070674_100041445 3300005356 Bacteria 3121
26 Ga0070659_100220679 3300005366 Bacteria 1564
27 Ga0070659_100229876 3300005366 Bacteria 1533
28 Ga0070659_100981896 3300005366 Bacteria 741
29 Ga0070659_101644986 3300005366 Bacteria 574
30 Ga0070710_10960757 3300005437 Bacteria 620
31 Ga0070663_100012150 3300005455 Bacteria 5436
32 Ga0070663_100054565 3300005455 Bacteria 2856
33 Ga0070663_100088801 3300005455 Bacteria 2286
34 Ga0070663_100232792 3300005455 Bacteria 1451
35 Ga0070663_100456520 3300005455 Bacteria 1054
36 Ga0070678_100218116 3300005456 Bacteria 1584
37 Ga0070662_100080296 3300005457 Bacteria 2428
38 Ga0070681_10014445 3300005458 Bacteria 7858
39 Ga0068867_100267710 3300005459 Bacteria 1396
40 Ga0068867_100352115 3300005459 Bacteria 1229
41 Ga0068867_100918952 3300005459 Bacteria 789
42 Ga0070707_100099912 3300005468 Bacteria 2811
43 Ga0070679_100048460 3300005530 Bacteria 4233
44 Ga0070679_100405460 3300005530 Bacteria 1309
45 Ga0070679_101770788 3300005530 Bacteria 566
46 Ga0070684_101259064 3300005535 Bacteria 696
47 Ga0070697_100348847 3300005536 Bacteria 1278
48 Ga0068853_100036675 3300005539 Bacteria 4170
49 Ga0068853_100121014 3300005539 Bacteria 2335
50 Ga0068853_100130926 3300005539 Bacteria 2245
51 Ga0068853_100796786 3300005539 Bacteria 905
52 Ga0070672_100297728 3300005543 Bacteria 1367
53 Ga0070672_100389869 3300005543 Bacteria 1193
54 Ga0070693_100578113 3300005547 Bacteria 808
55 Ga0070665_100057532 3300005548 Bacteria 3898
56 Ga0070665_100087053 3300005548 Bacteria 3129
57 Ga0070665_100881564 3300005548 Bacteria 908
58 Ga0068855_100018040 3300005563 Bacteria 8480
59 Ga0068855_100048950 3300005563 Bacteria 4987
60 Ga0068855_100075037 3300005563 Bacteria 3926
61 Ga0068855_100144190 3300005563 Bacteria 2713
62 Ga0068855_100821339 3300005563 Bacteria 987
63 Ga0070664_100098883 3300005564 Bacteria 2535
64 Ga0070664_100524603 3300005564 Bacteria 1093
65 Ga0068857_100027804 3300005577 Bacteria 4987
66 Ga0068854_100024425 3300005578 Bacteria 4138
67 Ga0068856_100258989 3300005614 Bacteria 1755
68 Ga0068856_100325590 3300005614 Bacteria 1554
69 Ga0068852_100135869 3300005616 Bacteria 2270
70 Ga0068852_100309392 3300005616 Bacteria 1531
71 Ga0068852_100722257 3300005616 Bacteria 1007
72 Ga0068859_100049861 3300005617 Bacteria 4205
73 Ga0068859_101470478 3300005617 Bacteria 752
74 Ga0068859_101595512 3300005617 Bacteria 721
75 Ga0068859_101834492 3300005617 Bacteria 670
76 Ga0068864_100163037 3300005618 Bacteria 2027
77 Ga0068864_100391814 3300005618 Bacteria 1319
78 Ga0068861_100569878 3300005719 Bacteria 1035
79 Ga0068851_10001895 3300005834 Bacteria 9195
80 Ga0068851_10209633 3300005834 Bacteria 1091
81 Ga0068863_100030455 3300005841 Bacteria 5153
82 Ga0068858_100073747 3300005842 Bacteria 3168
83 Ga0068858_100193883 3300005842 Bacteria 1920
84 Ga0068858_100667196 3300005842 Bacteria 1011
85 Ga0068858_100829570 3300005842 Bacteria 903
86 Ga0068858_101026127 3300005842 Bacteria 809
87 Ga0068858_101255347 3300005842 Bacteria 729
88 Ga0068860_100000668 3300005843 Bacteria 39654
89 Ga0068860_100346905 3300005843 Bacteria 1460
90 Ga0068862_100174584 3300005844 Bacteria 1925
91 Ga0068862_100478484 3300005844 Bacteria 1178
92 Ga0081455_10004146 3300005937 Bacteria 16356
93 Ga0081455_10076590 3300005937 Bacteria 2755
94 Ga0081455_10102877 3300005937 Bacteria 2289
95 Ga0081455_10267940 3300005937 Bacteria 1241
96 Ga0081455_10389960 3300005937 Bacteria 970
97 Ga0081455_10594918 3300005937 Bacteria 722
98 Ga0081538_10210519 3300005981 Bacteria 784
99 Ga0081540_1003048 3300005983 Bacteria 13423
100 Ga0081540_1004117 3300005983 Bacteria 11226
101 Ga0081540_1014684 3300005983 Bacteria 5003
102 Ga0081540_1021588 3300005983 Bacteria 3827
103 Ga0081540_1023712 3300005983 Bacteria 3580
104 Ga0081540_1044101 3300005983 Bacteria 2280
105 Ga0081540_1082054 3300005983 Bacteria 1448
106 Ga0081540_1123178 3300005983 Bacteria 1072
107 Ga0081540_1128536 3300005983 Bacteria 1039
108 Ga0081539_10000306 3300005985 Bacteria 110402
109 Ga0070717_10377497 3300006028 Bacteria 1271
110 Ga0075365_10005845 3300006038 Bacteria 6689
111 Ga0075365_10052528 3300006038 Bacteria 2696
112 Ga0075365_10058758 3300006038 Bacteria 2561
113 Ga0075365_10074587 3300006038 Bacteria 2288
114 Ga0075368_10075664 3300006042 Bacteria 1365
115 Ga0075363_100065959 3300006048 Bacteria 1958
116 Ga0075363_100106898 3300006048 Bacteria 1552
117 Ga0075364_10132033 3300006051 Bacteria 1676
118 Ga0070715_10465477 3300006163 Bacteria 717
119 Ga0070716_100309753 3300006173 Bacteria 1102
120 Ga0070716_100657437 3300006173 Bacteria 795
121 Ga0070712_101221749 3300006175 Bacteria 654
122 Ga0075362_10060510 3300006177 Bacteria 1712
123 Ga0075367_10008298 3300006178 Bacteria 5378
124 Ga0075369_10030670 3300006186 Bacteria 2265
125 Ga0075369_10060788 3300006186 Bacteria 1648
126 Ga0075366_10440555 3300006195 Bacteria 803
127 Ga0097621_100195972 3300006237 Bacteria 1751
128 Ga0097621_100453538 3300006237 Bacteria 1155
129 Ga0075370_10023889 3300006353 Bacteria 3371
130 Ga0075370_10171421 3300006353 Bacteria 1276
131 Ga0068871_100053453 3300006358 Bacteria 3273
132 Ga0068871_100346120 3300006358 Bacteria 1314
133 Ga0068871_100745633 3300006358 Bacteria 900
134 Ga0075428_100026366 3300006844 Bacteria 6433
135 Ga0075434_101638766 3300006871 Bacteria 652
136 Ga0097620_100049852 3300006931 Bacteria 4205
137 Ga0097620_101470795 3300006931 Bacteria 752
138 Ga0097620_101595510 3300006931 Bacteria 721
139 Ga0097620_101834743 3300006931 Bacteria 670
140 Ga0099823_1012257 3300006944 Bacteria 8674
141 Ga0075435_100589315 3300007076 Bacteria 964
142 Ga0099794_10161669 3300007265 Bacteria 1139
143 Ga0099794_10194211 3300007265 Bacteria 1039
144 Ga0099795_10318256 3300007788 Bacteria 688
145 Ga0105240_10037752 3300009093 Bacteria 6205
146 Ga0105240_10545967 3300009093 Bacteria 1283
147 Ga0105240_10713543 3300009093 Bacteria 1093
148 Ga0105245_10040208 3300009098 Bacteria 4165
149 Ga0105245_10219895 3300009098 Bacteria 1832
150 Ga0105247_10110117 3300009101 Bacteria 1771
151 Ga0105247_10225937 3300009101 Bacteria 1269
152 Ga0105247_10260596 3300009101 Bacteria 1189
153 Ga0105243_10462787 3300009148 Bacteria 1193
154 Ga0105241_10013605 3300009174 Bacteria 5963
155 Ga0105241_10073291 3300009174 Bacteria 2663
156 Ga0105241_10183538 3300009174 Bacteria 1737
157 Ga0105242_11051335 3300009176 Bacteria 825
158 Ga0105242_11602880 3300009176 Bacteria 685
159 Ga0105248_11078437 3300009177 Bacteria 908
160 Ga0105237_10017484 3300009545 Bacteria 7432
161 Ga0105237_10068102 3300009545 Bacteria 3554
162 Ga0105237_10406134 3300009545 Bacteria 1367
163 Ga0105237_10851364 3300009545 Bacteria 919
164 Ga0105238_10003901 3300009551 Bacteria 14807
165 Ga0105238_10338495 3300009551 Bacteria 1492
166 Ga0105238_10366175 3300009551 Bacteria 1431
167 Ga0105238_11867648 3300009551 Bacteria 633
168 Ga0105249_11193052 3300009553 Bacteria 832
169 Ga0099796_10184481 3300010159 Bacteria 839
170 Ga0105239_10095984 3300010375 Bacteria 3275
171 Ga0105239_10140253 3300010375 Bacteria 2693
172 Ga0105239_10338589 3300010375 Bacteria 1697
173 Ga0105239_10419569 3300010375 Bacteria 1516
174 Ga0105239_10646374 3300010375 Bacteria 1208
175 Ga0105239_10914806 3300010375 Bacteria 1007
176 Ga0105239_10967168 3300010375 Bacteria 978
177 Ga0105239_12063062 3300010375 Bacteria 662
178 Ga0157371_10202031 3300013102 Bacteria 1425
179 Ga0157371_10660223 3300013102 Bacteria 781
180 Ga0157370_10065763 3300013104 Bacteria 3430
181 Ga0157374_10032356 3300013296 Bacteria 4761
182 Ga0157374_10217964 3300013296 Bacteria 1872
183 Ga0157374_10595660 3300013296 Bacteria 1115
184 Ga0157374_10682340 3300013296 Bacteria 1040
185 Ga0157374_10809194 3300013296 Bacteria 953
186 Ga0157378_10875402 3300013297 Bacteria 928
187 Ga0163162_10101720 3300013306 Bacteria 2966
188 Ga0163162_10541850 3300013306 Bacteria 1292
189 Ga0163162_10672844 3300013306 Bacteria 1158
190 Ga0163162_10898592 3300013306 Bacteria 999
191 Ga0163162_10999670 3300013306 Bacteria 946
192 Ga0157375_10663892 3300013308 Bacteria 1198
193 Ga0157375_10830622 3300013308 Bacteria 1071
194 Ga0157375_11138413 3300013308 Bacteria 914
195 Ga0163163_10380011 3300014325 Bacteria 1470
196 Ga0163163_10412574 3300014325 Bacteria 1409
197 Ga0163163_10513011 3300014325 Bacteria 1261
198 Ga0163163_11148792 3300014325 Bacteria 839
199 Ga0163163_11321291 3300014325 Bacteria 783
200 Ga0157380_13250646 3300014326 Bacteria 519
201 Ga0182008_10272707 3300014497 Bacteria 878
202 Ga0157377_10173594 3300014745 Bacteria 1350
203 Ga0157377_10369555 3300014745 Bacteria 968
204 Ga0157379_10107448 3300014968 Bacteria 2505
205 Ga0157379_10333410 3300014968 Bacteria 1386
206 Ga0157376_10046082 3300014969 Bacteria 3594
207 Ga0157376_10152279 3300014969 Bacteria 2087
208 Ga0157376_10873954 3300014969 Bacteria 916
209 Ga0163161_10626790 3300017792 Bacteria 889
210 Ga0213876_10175261 3300021384 Bacteria 1141
211 Ga0209563_101584 3300025230 Bacteria 5899
212 Ga0209677_125552 3300025253 Bacteria 637
213 Ga0209148_1001016 3300025254 Bacteria 17684
214 Ga0209233_1000874 3300025261 Bacteria 13255
215 Ga0209455_1003032 3300025272 Bacteria 6150
216 Ga0209455_1003687 3300025272 Bacteria 5301
217 Ga0209673_1015155 3300025273 Bacteria 2944
218 Ga0209564_1013948 3300025295 Bacteria 3374
219 Ga0209758_1008191 3300025297 Bacteria 6854
220 Ga0209758_1008316 3300025297 Bacteria 6770
221 Ga0209758_1011780 3300025297 Bacteria 5009
222 Ga0209758_1068038 3300025297 Bacteria 1136
223 Ga0207426_1004607 3300025302 Bacteria 6647
224 Ga0207426_1075867 3300025302 Bacteria 924
225 Ga0207426_1131865 3300025302 Bacteria 604
226 Ga0209051_1055072 3300025303 Bacteria 1293
227 Ga0207697_10331785 3300025315 Bacteria 675
228 Ga0207656_10002542 3300025321 Bacteria 6168
229 Ga0207642_10018123 3300025899 Bacteria 2695
230 Ga0207710_10083199 3300025900 Bacteria 1487
231 Ga0207710_10093031 3300025900 Bacteria 1414
232 Ga0207688_10062824 3300025901 Bacteria 2094
233 Ga0207705_10023185 3300025909 Bacteria 4428
234 Ga0207705_10966807 3300025909 Bacteria 658
235 Ga0207654_10000955 3300025911 Bacteria 15883
236 Ga0207654_10021910 3300025911 Bacteria 3404
237 Ga0207707_10040957 3300025912 Bacteria 4045
238 Ga0207695_10004855 3300025913 Bacteria 18146
239 Ga0207695_10081521 3300025913 Bacteria 3274
240 Ga0207671_10201955 3300025914 Bacteria 1553
241 Ga0207671_10216716 3300025914 Bacteria 1499
242 Ga0207671_10434151 3300025914 Bacteria 1045
243 Ga0207671_10466720 3300025914 Bacteria 1006
244 Ga0207671_10555666 3300025914 Bacteria 915
245 Ga0207660_10025153 3300025917 Bacteria 4039
246 Ga0207660_11371086 3300025917 Bacteria 573
247 Ga0207657_10045186 3300025919 Bacteria 3867
248 Ga0207657_10478893 3300025919 Bacteria 976
249 Ga0207657_10874087 3300025919 Bacteria 693
250 Ga0207657_11401068 3300025919 Bacteria 525
251 Ga0207649_10269076 3300025920 Bacteria 1234
252 Ga0207649_10302507 3300025920 Bacteria 1170
253 Ga0207652_10272658 3300025921 Bacteria 1526
254 Ga0207694_10000212 3300025924 Bacteria 56506
255 Ga0207694_10240238 3300025924 Bacteria 1480
256 Ga0207694_10371477 3300025924 Bacteria 1186
257 Ga0207694_11537124 3300025924 Bacteria 561
258 Ga0207687_10049937 3300025927 Bacteria 2910
259 Ga0207687_10320527 3300025927 Bacteria 1254
260 Ga0207644_10548104 3300025931 Bacteria 957
261 Ga0207690_10318744 3300025932 Bacteria 1221
262 Ga0207706_10069853 3300025933 Bacteria 3089
263 Ga0207706_10191923 3300025933 Bacteria 1793
264 Ga0207706_10511443 3300025933 Bacteria 1036
265 Ga0207669_10261317 3300025937 Bacteria 1295
266 Ga0207704_10479300 3300025938 Bacteria 998
267 Ga0207691_10502110 3300025940 Bacteria 1030
268 Ga0207711_10661229 3300025941 Bacteria 975
269 Ga0207689_10118416 3300025942 Bacteria 2178
270 Ga0207679_10022898 3300025945 Bacteria 4262
271 Ga0207679_10532071 3300025945 Bacteria 1052
272 Ga0207667_10049311 3300025949 Bacteria 4447
273 Ga0207667_10069085 3300025949 Bacteria 3678
274 Ga0207651_11446814 3300025960 Bacteria 619
275 Ga0207668_10138277 3300025972 Bacteria 1869
276 Ga0207668_10525724 3300025972 Bacteria 1021
277 Ga0207677_10092219 3300026023 Bacteria 2205
278 Ga0207677_10838960 3300026023 Bacteria 825
279 Ga0207703_10047558 3300026035 Bacteria 3459
280 Ga0207703_10119460 3300026035 Bacteria 2261
281 Ga0207703_10964213 3300026035 Bacteria 818
282 Ga0207703_11155705 3300026035 Bacteria 744
283 Ga0207639_10301922 3300026041 Bacteria 1416
284 Ga0207639_10382887 3300026041 Bacteria 1264
285 Ga0207678_10015936 3300026067 Bacteria 6601
286 Ga0207678_10048304 3300026067 Bacteria 3679
287 Ga0207678_10065414 3300026067 Bacteria 3122
288 Ga0207678_10096659 3300026067 Bacteria 2524
289 Ga0207678_10172617 3300026067 Bacteria 1846
290 Ga0207678_10260653 3300026067 Bacteria 1486
291 Ga0207678_10591503 3300026067 Bacteria 972
292 Ga0207702_10000003 3300026078 Bacteria 434196
293 Ga0207702_10039680 3300026078 Bacteria 3946
294 Ga0207702_10165141 3300026078 Bacteria 2025
295 Ga0207641_10039182 3300026088 Bacteria 3963
296 Ga0207641_10244073 3300026088 Bacteria 1675
297 Ga0207641_10826981 3300026088 Bacteria 917
298 Ga0207648_10181814 3300026089 Bacteria 1861
299 Ga0207676_10045716 3300026095 Bacteria 3384
300 Ga0207676_10402719 3300026095 Bacteria 1279
301 Ga0207674_10038438 3300026116 Bacteria 4966
302 Ga0207674_10121247 3300026116 Bacteria 2582
303 Ga0207675_100295802 3300026118 Bacteria 1576
304 Ga0207683_10087410 3300026121 Bacteria 2772
305 Ga0207683_10218391 3300026121 Bacteria 1736
306 Ga0207698_10307999 3300026142 Bacteria 1478
307 Ga0207698_10427471 3300026142 Bacteria 1273
308 Ga0207698_12259026 3300026142 Bacteria 556
309 Ga0209389_1000009 3300027296 Bacteria 226873
310 Ga0209489_100050 3300027361 Bacteria 154669
311 Ga0209700_100016 3300027363 Bacteria 252567
312 Ga0209588_1073644 3300027671 Bacteria 1103
313 Ga0209813_10050998 3300027866 Bacteria 1293
314 Ga0268266_10001711 3300028379 Bacteria 25121
315 Ga0268266_10023032 3300028379 Bacteria 5301
316 Ga0268266_10396376 3300028379 Bacteria 1304
317 Ga0268265_10184591 3300028380 Bacteria 1795
318 Ga0268265_10430163 3300028380 Bacteria 1228
319 Ga0268264_10000168 3300028381 Bacteria 146056
320 Ga0268264_10180328 3300028381 Bacteria 1917
321 Ga0268264_10321292 3300028381 Bacteria 1464
322 Ga0268264_10957682 3300028381 Bacteria 861
323 Ga0307517_10288377 3300028786 Bacteria 930
324 Ga0307511_10137253 3300030521 Bacteria 1451
325 Ga0307511_10262253 3300030521 Bacteria 818
326 Ga0265332_10019484 3300031238 Bacteria 2995
327 Ga0265340_10155396 3300031247 Bacteria 1041
328 Ga0265339_10015080 3300031249 Bacteria 4644
329 Ga0265339_10131261 3300031249 Bacteria 1281
330 Ga0265331_10046079 3300031250 Bacteria 2103
331 Ga0307509_10093235 3300031507 Bacteria 3074
332 Ga0307509_10303627 3300031507 Bacteria 1342
333 Ga0307509_10387421 3300031507 Bacteria 1108
334 Ga0307408_101408277 3300031548 Bacteria 657
335 Ga0307508_10000008 3300031616 Bacteria 265023
336 Ga0265314_10024248 3300031711 Bacteria 4602
337 Ga0265342_10006404 3300031712 Bacteria 8772
338 Ga0307516_10107081 3300031730 Bacteria 2605
339 Ga0307516_10385378 3300031730 Bacteria 1062
340 Ga0307518_10490375 3300031838 Bacteria 638
341 Ga0307416_101452889 3300032002 Bacteria 791
342 Ga0307507_10026887 3300033179 Bacteria 6187
343 Ga0307507_10265461 3300033179 Bacteria 1091
344 Ga0307507_10291377 3300033179 Bacteria 1010
345 Ga0307510_10188091 3300033180 Bacteria 1617
346 Ga0373936_0002189 3300035113 Bacteria 7292
347 Ga0373936_0014203 3300035113 Bacteria 3042
348 Ga0373945_0009070 3300035116 Bacteria 3250
349 Ga0373954_0143538 3300035118 Bacteria 1165
350 Ga0373956_0113003 3300035119 Bacteria 1265
351 Ga0373957_0116279 3300035120 Bacteria 1080
352 Ga0373946_0090807 3300035171 Bacteria 1353
353 Ga0373955_0165432 3300035172 Bacteria 1307
354 Ga0373935_0000103 3300035692 Bacteria 37897
355 Ga0373935_0903015 3300035692 Bacteria 654
356 Ga0373927_0000430 3300035695 Bacteria 32290
357 Ga0373927_0034206 3300035695 Bacteria 3306
358 Ga0373947_0000531 3300035725 Bacteria 22268
359 Ga0373937_0142218 3300036401 Bacteria 2245
360 Ga0373925_0000459 3300037068 Bacteria 41064
361 Ga0373925_0283145 3300037068 Bacteria 1335
362 Ga0395899_0252360 3300037312 Bacteria 1210
363 Ga0395900_0097073 3300037418 Bacteria 3028
364 Ga0395900_0146108 3300037418 Bacteria 2418
365 Ga0395900_0167120 3300037418 Bacteria 2241
366 Ga0395900_0888213 3300037418 Bacteria 815
367 Ga0395898_0568173 3300037466 Bacteria 1076
368 Ga0395898_1173915 3300037466 Bacteria 699
369 Ga0395905_0010872 3300037471 Bacteria 8816
370 Ga0395905_0039924 3300037471 Bacteria 4403
371 Ga0395905_0785514 3300037471 Bacteria 855
372 Ga0395901_0454791 3300038443 Bacteria 1309
373 Ga0436365_1391910 3300039437 Bacteria 638
374 Ga0436360_1070051 3300039438 Bacteria 1919
375 Ga0436361_0757981 3300039447 Bacteria 1653
376 Ga0436363_0496065 3300039450 Bacteria 642
377 Ga0436363_1716691 3300039450 Bacteria 3193
378 Ga0451798_0262550 3300041458 Bacteria 1153
379 Ga0451800_0290666 3300041459 Bacteria 612
380 Ga0451800_1604155 3300041459 Bacteria 695
381 Ga0451845_0975934 3300041501 Bacteria 982
382 Ga0451849_0227426 3300041505 Bacteria 892
383 Ga0451843_0718321 3300041509 Bacteria 1296
384 Ga0451843_1570541 3300041509 Bacteria 975
385 Ga0495617_112000 3300046452 Bacteria 882
386 Ga0495592_0020536 3300046454 Bacteria 5026
387 Ga0495592_0092064 3300046454 Bacteria 2173
388 Ga0495592_0303179 3300046454 Bacteria 1038
389 Ga0495603_0000368 3300046455 Bacteria 24418
390 Ga0495603_0058975 3300046455 Bacteria 2269
391 Ga0495603_0270164 3300046455 Bacteria 978
392 Ga0495603_0301584 3300046455 Bacteria 920
393 Ga0495603_0472233 3300046455 Bacteria 718
394 Ga0495590_0093616 3300046457 Bacteria 1064
395 Ga0495590_0195826 3300046457 Bacteria 741
396 Ga0495629_0000181 3300046459 Bacteria 56739
397 Ga0495629_0001342 3300046459 Bacteria 19369
398 Ga0495629_0532386 3300046459 Bacteria 790
399 Ga0495638_0126555 3300046460 Bacteria 1505
400 Ga0495638_0237863 3300046460 Bacteria 1010
401 Ga0495638_0274151 3300046460 Bacteria 919
402 Ga0495641_0002139 3300046461 Bacteria 15915
403 Ga0495651_0020323 3300046462 Bacteria 5155
404 Ga0495651_0097147 3300046462 Bacteria 2200
405 Ga0495651_0474678 3300046462 Bacteria 804
406 Ga0495653_0173498 3300046463 Bacteria 1486
407 Ga0495653_0224746 3300046463 Bacteria 1260
408 Ga0495650_0159342 3300046471 Bacteria 806
409 Ga0495580_0000823 3300046472 Bacteria 26904
410 Ga0495582_0000039 3300046473 Bacteria 66883
411 Ga0495582_0118434 3300046473 Bacteria 1491
412 Ga0495639_0000145 3300046475 Bacteria 36701
413 Ga0495639_0319811 3300046475 Bacteria 776
414 Ga0495662_0004742 3300046476 Bacteria 6812
415 Ga0495662_0150262 3300046476 Bacteria 1147
416 Ga0495664_0007045 3300046477 Bacteria 6227
417 Ga0495664_0079165 3300046477 Bacteria 1969
418 Ga0495584_0169552 3300046491 Bacteria 1109
419 Ga0495594_0002582 3300046499 Bacteria 9417
420 Ga0495607_0078860 3300046501 Bacteria 1816
421 Ga0495607_0250065 3300046501 Bacteria 854
422 Ga0495583_0136717 3300046506 Bacteria 1023
423 Ga0495606_0083583 3300046507 Bacteria 1979
424 Ga0495606_0120404 3300046507 Bacteria 1572
425 Ga0495606_0177737 3300046507 Bacteria 1230
426 Ga0495606_0199996 3300046507 Bacteria 1139
427 Ga0495606_0367538 3300046507 Bacteria 758
428 Ga0495608_0026445 3300046511 Bacteria 3956
429 Ga0495608_0199307 3300046511 Bacteria 1262
430 Ga0495616_0125971 3300046513 Bacteria 1178
431 Ga0495616_0209884 3300046513 Bacteria 852
432 Ga0495618_0040576 3300046514 Bacteria 2930
433 Ga0495620_0048921 3300046515 Bacteria 1812
434 Ga0495628_0058627 3300046516 Bacteria 3024
435 Ga0495628_0483898 3300046516 Bacteria 895
436 Ga0495630_0003137 3300046517 Bacteria 11459
437 Ga0495630_0315212 3300046517 Bacteria 1196
438 Ga0495631_0034142 3300046518 Bacteria 2282
439 Ga0495632_0145580 3300046519 Bacteria 1097
440 Ga0495632_0193544 3300046519 Bacteria 928
441 Ga0495632_0256226 3300046519 Bacteria 783
442 Ga0495643_0115471 3300046522 Bacteria 1361
443 Ga0495648_0020206 3300046524 Bacteria 4655
444 Ga0495666_0072379 3300046526 Bacteria 1637
445 Ga0495652_0227886 3300046529 Bacteria 1396
446 Ga0495665_0000192 3300046531 Bacteria 31523
447 Ga0495640_0006726 3300046533 Bacteria 9074
448 Ga0495640_0008957 3300046533 Bacteria 7815
449 Ga0495586_0199740 3300046535 Bacteria 1133
450 Ga0495587_0037472 3300046536 Bacteria 2911
451 Ga0495587_0373366 3300046536 Bacteria 794
452 Ga0495609_0241259 3300046538 Bacteria 746
453 Ga0495597_0266417 3300046542 Bacteria 670
454 Ga0495645_0098988 3300046543 Bacteria 2075
455 Ga0495622_0001325 3300046557 Bacteria 12680
456 Ga0495622_0006472 3300046557 Bacteria 5432
457 Ga0495622_0050796 3300046557 Bacteria 1923
458 Ga0495622_0080799 3300046557 Bacteria 1496
459 Ga0495622_0187133 3300046557 Bacteria 927
460 Ga0495667_0009298 3300046559 Bacteria 6663
461 Ga0495667_0045474 3300046559 Bacteria 2907
462 Ga0495668_0070756 3300046616 Bacteria 1918
463 Ga0495668_0145544 3300046616 Bacteria 1297
464 Ga0495668_0226222 3300046616 Bacteria 1024
465 Ga0495668_0270864 3300046616 Bacteria 930
466 Ga0495668_0574608 3300046616 Bacteria 622
467 Ga0495634_0406963 3300046642 Bacteria 807
468 Ga0495611_0057498 3300046648 Bacteria 1762
469 Ga0495611_0188970 3300046648 Bacteria 962
470 Ga0495625_0132211 3300046660 Bacteria 1690
471 Ga0495625_0193198 3300046660 Bacteria 1347
472 Ga0495625_0309282 3300046660 Bacteria 1009
473 Ga0495625_0382109 3300046660 Bacteria 883
474 Ga0495625_0467449 3300046660 Bacteria 776
475 Ga0495625_0600869 3300046660 Bacteria 660
476 Ga0495635_0001634 3300046663 Bacteria 15110
477 Ga0495635_0008096 3300046663 Bacteria 7345
478 Ga0495635_0348805 3300046663 Bacteria 987
479 Ga0495659_0295073 3300046664 Bacteria 684
480 Ga0495661_0107057 3300046665 Bacteria 1564
481 Ga0495661_0124965 3300046665 Bacteria 1417
482 Ga0495661_0510038 3300046665 Bacteria 573
483 Ga0495588_0025454 3300046674 Bacteria 2948
484 Ga0495588_0025495 3300046674 Bacteria 2946
485 Ga0495657_0001548 3300046675 Bacteria 19769
486 Ga0495657_0009050 3300046675 Bacteria 7572
487 Ga0495599_0033917 3300046678 Bacteria 3208
488 Ga0495623_0013295 3300046679 Bacteria 5339
489 Ga0495646_0003738 3300046680 Bacteria 9512
490 Ga0495646_0058082 3300046680 Bacteria 2313
491 Ga0495646_0137099 3300046680 Bacteria 1372
492 Ga0495647_0000902 3300046681 Bacteria 8896
493 Ga0495658_0000464 3300046683 Bacteria 22503
494 Ga0495658_0201241 3300046683 Bacteria 1241
495 Ga0495669_0433068 3300046684 Bacteria 638
496 Ga0495613_0038031 3300046689 Bacteria 3567
497 Ga0495613_0129158 3300046689 Bacteria 1810
498 Ga0495624_0001057 3300046690 Bacteria 21708
499 Ga0495624_0021107 3300046690 Bacteria 4324
500 Ga0495624_0221181 3300046690 Bacteria 1148
501 Ga0495671_0097601 3300046692 Bacteria 1437
502 Ga0495671_0141242 3300046692 Bacteria 1173
503 Ga0495671_0285682 3300046692 Bacteria 794
504 Ga0495649_0151777 3300046694 Bacteria 1217
505 Ga0495649_0215161 3300046694 Bacteria 995
506 Ga0495649_0250438 3300046694 Bacteria 910
507 Ga0495600_0038783 3300046809 Bacteria 3101
508 Ga0495600_0216433 3300046809 Bacteria 1226
509 Ga0495581_0000024 3300047315 Bacteria 55574
510 Ga0495581_0222307 3300047315 Bacteria 1104
511 Ga0495604_0002429 3300047317 Bacteria 14909
512 Ga0495604_0003330 3300047317 Bacteria 12806
513 Ga0495604_0170017 3300047317 Bacteria 1534
514 Ga0495604_0398923 3300047317 Bacteria 906
515 Ga0495674_0001709 3300047319 Bacteria 21590
516 Ga0495674_0033747 3300047319 Bacteria 4632
517 Ga0495676_0006724 3300047321 Bacteria 10580
518 Ga0495683_0244726 3300047323 Bacteria 790
519 Ga0495675_0017581 3300047444 Bacteria 4533
520 Ga0495679_084252 3300047446 Bacteria 899
521 Ga0495673_0006867 3300047469 Bacteria 6633
522 Ga0495673_0093220 3300047469 Bacteria 1228
523 Ga0495684_0063061 3300047471 Bacteria 2818
524 Ga0495684_0727845 3300047471 Bacteria 655
525 Ga0495686_0056898 3300047472 Bacteria 2442
526 Ga0495686_0365791 3300047472 Bacteria 781
527 Ga0495593_0000019 3300047673 Bacteria 74042
528 Ga0495593_0184559 3300047673 Bacteria 1050
529 Ga0495602_0025757 3300048088 Bacteria 5687
530 Ga0495602_0051465 3300048088 Bacteria 3667
531 Ga0495602_0380037 3300048088 Bacteria 1012
532 Ga0495602_0560441 3300048088 Bacteria 791
533 Ga0495614_0026157 3300048089 Bacteria 2515
534 Ga0495614_0063497 3300048089 Bacteria 1588
535 Ga0495626_0170958 3300048091 Bacteria 906
536 Ga0496100_0017570 3300048903 Bacteria 4225
537 Ga0496101_0013403 3300048904 Bacteria 5490
538 Ga0496101_0189252 3300048904 Bacteria 1588
539 Ga0496101_0380757 3300048904 Bacteria 1110
540 Ga0496102_0002405 3300048905 Bacteria 15976
541 Ga0496102_0202455 3300048905 Bacteria 1871
542 Ga0496102_0970176 3300048905 Bacteria 771
543 Ga0496103_0158328 3300048906 Bacteria 1452
544 Ga0496104_0001719 3300048907 Bacteria 18899
545 Ga0496104_0400137 3300048907 Bacteria 1285
546 Ga0496104_1092947 3300048907 Bacteria 701
547 Ga0496105_0001495 3300048908 Bacteria 16519
548 Ga0496105_0016588 3300048908 Bacteria 5881
549 Ga0496105_0146005 3300048908 Bacteria 1945
550 Ga0496106_0002034 3300048909 Bacteria 15210
551 Ga0496106_0011569 3300048909 Bacteria 6522
552 Ga0496106_0578354 3300048909 Bacteria 900
553 Ga0496106_0760785 3300048909 Bacteria 770
554 Ga0496107_0004725 3300048910 Bacteria 9256
555 Ga0496107_0192539 3300048910 Bacteria 1515
556 Ga0496107_0195806 3300048910 Bacteria 1502
557 Ga0496108_0023849 3300048911 Bacteria 5036
558 Ga0496108_0032948 3300048911 Bacteria 4304
559 Ga0496108_0520061 3300048911 Bacteria 1039
560 Ga0496109_0054911 3300048912 Bacteria 3633
561 Ga0496109_1769765 3300048912 Bacteria 551
562 Ga0496110_0111785 3300048913 Bacteria 2456
563 Ga0496111_0438479 3300048914 Bacteria 964
564 Ga0496112_0036252 3300048915 Bacteria 4810
565 Ga0496112_0357228 3300048915 Bacteria 1403
566 Ga0496112_1013050 3300048915 Bacteria 750
567 Ga0496113_0007905 3300048916 Bacteria 6883
568 Ga0496113_0040252 3300048916 Bacteria 3443
569 Ga0496113_0542229 3300048916 Bacteria 933
570 Ga0496114_0075478 3300048917 Bacteria 2840
571 Ga0496114_0105537 3300048917 Bacteria 2410
572 Ga0496114_0132105 3300048917 Bacteria 2156
573 Ga0496114_0671493 3300048917 Bacteria 910
574 Ga0496115_0011400 3300048918 Bacteria 6663
575 Ga0496115_0100293 3300048918 Bacteria 2373
576 Ga0496115_0106008 3300048918 Bacteria 2307
577 Ga0496115_0258511 3300048918 Bacteria 1432
578 Ga0496115_0390680 3300048918 Bacteria 1130
579 Ga0496116_0031930 3300048919 Bacteria 3760
580 Ga0496117_0098226 3300048920 Bacteria 1862
581 Ga0496118_0002563 3300048921 Bacteria 24298
582 Ga0496118_0036703 3300048921 Bacteria 3957
583 Ga0496119_0008626 3300048922 Bacteria 8920
584 Ga0496119_0246334 3300048922 Bacteria 903
585 Ga0496120_0276124 3300048923 Bacteria 779
586 Ga0496120_0282383 3300048923 Bacteria 767
587 Ga0496120_0307078 3300048923 Bacteria 725
588 Ga0496121_0000506 3300048924 Bacteria 74537
589 Ga0496121_0023082 3300048924 Bacteria 6007
590 Ga0496121_0052224 3300048924 Bacteria 3435
591 Ga0496121_0080278 3300048924 Bacteria 2587
592 Ga0496121_0175740 3300048924 Bacteria 1550
593 Ga0496121_0239794 3300048924 Bacteria 1264
594 Ga0496121_0297336 3300048924 Bacteria 1097
595 Ga0496121_0355012 3300048924 Bacteria 975
596 Ga0496122_0370918 3300048925 Bacteria 739
597 Ga0496124_0001588 3300048927 Bacteria 32724
598 Ga0496124_0215732 3300048927 Bacteria 1448
599 Ga0496124_0220697 3300048927 Bacteria 1426
600 Ga0496125_0054625 3300048928 Bacteria 3262
601 Ga0496125_0154505 3300048928 Bacteria 1570
602 Ga0496125_0266324 3300048928 Bacteria 1071
603 Ga0496125_0341045 3300048928 Bacteria 899
604 Ga0496126_0019221 3300048929 Bacteria 6733
605 Ga0496126_0019757 3300048929 Bacteria 6628
606 Ga0496126_0037640 3300048929 Bacteria 4512
607 Ga0496126_0104829 3300048929 Bacteria 2470
608 Ga0496126_0160326 3300048929 Bacteria 1922
609 Ga0496126_0248664 3300048929 Bacteria 1482
610 Ga0496126_0547998 3300048929 Bacteria 918
611 Ga0495682_0016737 3300049460 Bacteria 2774
612 Ga0495682_0154216 3300049460 Bacteria 819
613 Ga0495682_0158840 3300049460 Bacteria 805
614 Ga0501046_0292767 3300049580 Bacteria 1190
615 Ga0501046_1121919 3300049580 Unclassified 543
616 Ga0501067_0422609 3300049583 Bacteria 744
617 Ga0501072_0113461 3300049588 Bacteria 2158
618 Ga0501074_0118454 3300049590 Bacteria 1894
619 Ga0501044_0830742 3300049823 Bacteria 802
620 nmdc:mga03683_430673_c1 3300050489 Bacteria 633
621 nmdc:mga03n38_625_c1 3300050490 Bacteria 9066
622 nmdc:mga00v17_193849_c1 3300050491 Bacteria 1313
623 nmdc:mga00v17_196675_c1 3300050491 Bacteria 1303
624 nmdc:mga0yw44_126455_c1 3300050492 Bacteria 1651
625 nmdc:mga0yw44_164991_c1 3300050492 Bacteria 1452
626 nmdc:mga0yw44_22931_c1 3300050492 Bacteria 3509
627 nmdc:mga0yw44_461462_c1 3300050492 Bacteria 861
628 nmdc:mga0yw44_584384_c1 3300050492 Bacteria 759
629 nmdc:mga0yw44_9592_c1 3300050492 Bacteria 4906
630 nmdc:mga0k408_271895_c1 3300050493 Bacteria 1012
631 nmdc:mga0k408_359660_c1 3300050493 Bacteria 867
632 nmdc:mga06z11_12130_c1 3300050494 Bacteria 3739
633 nmdc:mga04h51_59941_c1 3300050495 Bacteria 1302
634 nmdc:mga07m45_557406_c1 3300050496 Bacteria 663
635 nmdc:mga07m45_63777_c1 3300050496 Bacteria 2090
636 nmdc:mga07m45_666096_c1 3300050496 Bacteria 599
637 nmdc:mga05p37_490418_c1 3300050507 Bacteria 1413
638 nmdc:mga0n895_1270415_c1 3300050512 Bacteria 708
639 nmdc:mga0n895_131033_c1 3300050512 Bacteria 2532
640 nmdc:mga0rr50_952983_c1 3300050513 Bacteria 731
641 nmdc:mga0sz30_70004_c1 3300050516 Bacteria 1051
642 nmdc:mga0sz30_99472_c1 3300050516 Bacteria 1270
643 Ga0495601_0221057 3300053077 Bacteria 1237
644 Ga0495601_0973415 3300053077 Bacteria 534
645 Ga0500635_0008838 3300053080 Bacteria 2776
646 Ga0500635_0058510 3300053080 Bacteria 1338
647 Ga0495619_0240923 3300053085 Bacteria 1253
648 Ga0500578_0217800 3300053086 Bacteria 1162
649 Ga0500578_0679631 3300053086 Bacteria 556
650 Ga0500644_0064609 3300053088 Bacteria 1301
651 Ga0500646_0130222 3300053090 Bacteria 817
652 Ga0500647_0004979 3300053091 Bacteria 5441
653 Ga0500647_0040510 3300053091 Bacteria 2235
654 Ga0500651_0113750 3300053093 Bacteria 1649
655 Ga0500651_0125272 3300053093 Bacteria 1556
656 Ga0500651_0299351 3300053093 Bacteria 923
657 Ga0500566_0000087 3300053094 Bacteria 45921
658 Ga0500566_0001056 3300053094 Bacteria 15962
659 Ga0500566_0120913 3300053094 Bacteria 1412
660 Ga0500566_0520285 3300053094 Bacteria 509
661 Ga0500640_000234 3300053095 Bacteria 12188
662 Ga0500641_0018365 3300053096 Bacteria 2630
663 Ga0500641_0032574 3300053096 Bacteria 2063
664 Ga0500641_0081967 3300053096 Bacteria 1370
665 Ga0500650_0254993 3300053098 Bacteria 786
666 Ga0500555_002988 3300053103 Bacteria 4839
667 Ga0500557_000006 3300053105 Bacteria 141252
668 Ga0500562_077020 3300053108 Bacteria 901
669 Ga0500569_145503 3300053109 Bacteria 798
670 Ga0500572_000303 3300053111 Bacteria 17455
671 Ga0500591_184197 3300053115 Bacteria 749
672 Ga0500595_000846 3300053119 Bacteria 17477
673 Ga0500595_008816 3300053119 Bacteria 4100
674 Ga0500595_023187 3300053119 Bacteria 2185
675 Ga0500595_024907 3300053119 Bacteria 2082
676 Ga0500595_027420 3300053119 Bacteria 1951
677 Ga0500595_151818 3300053119 Bacteria 647
678 Ga0500608_049279 3300053122 Bacteria 2025
679 Ga0500614_000432 3300053123 Bacteria 10918
680 Ga0500621_132065 3300053126 Bacteria 955
681 Ga0500621_267827 3300053126 Bacteria 564
682 Ga0500626_222471 3300053128 Bacteria 726
683 Ga0500642_0000040 3300053130 Bacteria 96160
684 Ga0500642_0293958 3300053130 Bacteria 735
685 Ga0500658_0139717 3300053134 Bacteria 1085
686 Ga0500658_0287849 3300053134 Bacteria 755
687 Ga0500559_0005172 3300053136 Bacteria 6024
688 Ga0500559_0016685 3300053136 Bacteria 3102
689 Ga0500559_0037273 3300053136 Bacteria 2107
690 Ga0500559_0113328 3300053136 Bacteria 1257
691 Ga0500568_0077428 3300053139 Bacteria 1265
692 Ga0500568_0101060 3300053139 Bacteria 1082
693 Ga0500577_0017639 3300053142 Bacteria 2278
694 Ga0500577_0113190 3300053142 Bacteria 1122
695 Ga0500577_0124783 3300053142 Bacteria 1074
696 Ga0500588_0044391 3300053146 Bacteria 1356
697 Ga0500588_0355830 3300053146 Bacteria 556
698 Ga0500589_196112 3300053147 Bacteria 780
699 Ga0500590_067085 3300053148 Bacteria 1791
700 Ga0500590_342681 3300053148 Bacteria 538
701 Ga0500603_000494 3300053150 Bacteria 10077
702 Ga0500603_087339 3300053150 Bacteria 911
703 Ga0500619_121684 3300053154 Bacteria 889
704 Ga0500622_0150774 3300053156 Bacteria 1099
705 Ga0500627_0054028 3300053158 Bacteria 1756
706 Ga0500630_006784 3300053159 Bacteria 5617
707 Ga0500634_0086797 3300053161 Bacteria 1598
708 Ga0500634_0202621 3300053161 Bacteria 870
709 Ga0500634_0269015 3300053161 Bacteria 695
710 Ga0500638_041852 3300053162 Bacteria 2225
711 Ga0500638_043801 3300053162 Bacteria 2173
712 Ga0500638_201809 3300053162 Bacteria 840
713 Ga0500639_000135 3300053163 Bacteria 35350
714 Ga0500636_0172645 3300053177 Bacteria 1168
715 Ga0500637_0027600 3300053178 Bacteria 3135
716 Ga0500637_0462386 3300053178 Bacteria 640
717 Ga0500649_091083 3300053722 Bacteria 1223
718 Ga0500576_066819 3300053725 Bacteria 1557
719 Ga0500625_014649 3300053729 Bacteria 3626
720 Ga0500645_146574 3300053730 Bacteria 651
721 Ga0500552_000979 3300053733 Bacteria 2697
722 Ga0500552_068826 3300053733 Bacteria 632
723 Ga0500596_001590 3300053735 Bacteria 4605
724 Ga0500596_063423 3300053735 Bacteria 621
725 Ga0500601_000271 3300053737 Bacteria 9801
726 Ga0500661_020533 3300055283 Bacteria 1174
727 2507507241 2507262055 Bacteria 8048963
728 2508541294 2508501009 Bacteria 7784016
729 2508693375 2508501042 Bacteria 8719808
730 2513637128 2513237094 Bacteria 8789602
731 2513693232 2513237101 Bacteria 7952346
732 2513704660 2513237102 Bacteria 7703324
733 2513876696 2513237139 Bacteria 8737671
734 2515628738 2515154112 Bacteria 8294334
735 2524440637 2524023205 Bacteria 8918781
736 2528853634 2528768022 Bacteria 10457665
737 2617347948 2617270735 Bacteria 9163226
738 2745077901 2744054633 Bacteria 8678936
739 2805918676 2802429603 Bacteria 8777136
740 2824625026 2824617872 Bacteria 8814715
741 2824633920 2824626560 Bacteria 8813858
742 2824641332 2824635225 Bacteria 8785348
743 2824651605 2824644064 Bacteria 8743947
744 2824668974 2824661429 Bacteria 9877870
745 2824677465 2824671348 Bacteria 8369588
746 2824693909 2824687955 Bacteria 8360029
747 2824702341 2824696289 Bacteria 8335049
748 2824709128 2824704595 Bacteria 9667483
749 2824722537 2824714736 Bacteria 8717648
750 2824731835 2824723954 Bacteria 8758240
751 2824761719 2824753945 Bacteria 9787441
752 2824770702 2824763712 Bacteria 9792355
753 2824776062 2824773399 Bacteria 8360218
754 2841955888 2841949485 Bacteria 8680857
755 2842041182 2842038055 Bacteria 8002051
756 2842045873 2842045827 Bacteria 8006841
757 2847937966 2847930680 Bacteria 9342022
758 2847939899 2847939898 Bacteria 8606328
759 2847948201 2847939898 Bacteria 8606328
760 2874596022 2874590934 Bacteria 8299676
761 2874607824 2874604998 Bacteria 7834745
762 2874625778 2874620515 Bacteria 8290088
763 2874632884 2874628541 Bacteria 8630250
764 2874650846 2874645413 Bacteria 8214782
765 2876768638 2876761206 Bacteria 10111113
766 2876776150 2876771140 Bacteria 8287509
767 2876813792 2876808645 Bacteria 8824342
768 2876822110 2876818435 Bacteria 8274608
769 2879080239 2879074833 Bacteria 8279565
770 2879105369 2879099564 Bacteria 10442239
771 2879110762 2879110137 Bacteria 8907982
772 2879129163 2879127579 Bacteria 8294491
773 2879147491 2879142872 Bacteria 8267021
774 2881370385 2881364244 Bacteria 7710352
775 2885409907 2885409591 Bacteria 9235467
776 2888392368 2888388044 Bacteria 7304136
777 2903732911 2903727486 Bacteria 8281579
778 2904673861 2904666416 Bacteria 8226587
779 2904711455 2904711408 Bacteria 9771557
780 2922376254
781 2929623025 2929615660 Bacteria 9193770
782 2929631620 2929624759 Bacteria 9339455
783 2932789408 2932784394 Bacteria 9704911
784 2932816456 2932809354 Bacteria 9135765
785 2932827184 2932818245 Bacteria 9955613
786 2932832015 2932828146 Bacteria 9745859
787 2933584771 2933577622 Bacteria 9116884
788 2935610380 2935608549 Bacteria 8203142
789 2935621954 2935616580 Bacteria 9032984
790 2935644037 2935638405 Bacteria 10015038
791 2935651356 2935648319 Bacteria 8801166
792 2935659536 2935656913 Bacteria 8965014
793 2935669049 2935665750 Bacteria 9571747
794 2935683394 2935675223 Bacteria 9928132
795 2935692334 2935684952 Bacteria 9590419
796 2935700495 2935694250 Bacteria 9291695
797 2935708877 2935703347 Bacteria 10242284
798 2935720428 2935713505 Bacteria 9608509
799 2935729709 2935722832 Bacteria 9608746
800 2935739309 2935732158 Bacteria 9706831
801 2935748150 2935741537 Bacteria 9707219
802 2935758353 2935750917 Bacteria 9590372
803 2935767431 2935760218 Bacteria 9817913
804 2935771086 2935769743 Bacteria 7878163
805 2935781254 2935777560 Bacteria 8077691
806 2935786213 2935785616 Bacteria 7962367
807 2935793990 2935793552 Bacteria 8012592
808 2935805765 2935801545 Bacteria 9301974
809 2935815678 2935810662 Bacteria 9401221
810 2935823541 2935819856 Bacteria 8261050
811 2935833288 2935827899 Bacteria 10038562
812 2935843136 2935837841 Bacteria 9454360
813 2935849066 2935847175 Bacteria 8228321
814 2935860201 2935855204 Bacteria 9035059
815 2935867597 2935864058 Bacteria 9784707
816 2935878592 2935873716 Bacteria 9632195
817 2935912845 2935908558 Bacteria 8568796
818 2935922836 2935916978 Bacteria 9113783
819 2935930261 2935926038 Bacteria 8601059
820 2935939162 2935934488 Bacteria 8602579
821 2935946109 2935942939 Bacteria 8599779
822 2935955446 2935951376 Bacteria 8602333
823 2935972183 2935967501 Bacteria 8603075
824 2935976108 2935975950 Bacteria 8347125
825 2935986398 2935984226 Bacteria 8302647
826 2935998130 2935992306 Bacteria 9802711
827 2936006831 2936002035 Bacteria 9362176
828 2936013951 2936011229 Bacteria 8801034
829 2936022525 2936019824 Bacteria 8804134
830 2936035556 2936028420 Bacteria 8965941
831 2936040916 2936037263 Bacteria 9446081
832 2936049057 2936046547 Bacteria 8903709
833 2936060365 2936055302 Bacteria 8785755
834 2940564257 2940556831 Bacteria 9590747
835 2941544682 2941538514 Bacteria 9402094
836 8007000884 8006994254 Bacteria 8309700
837 8016520154 8016511872 Bacteria 9921665
838 8016528064 8016522445 Bacteria 8156687
839 8016533190 8016530956 Bacteria 8155261
840 8016546431 8016539877 Bacteria 8155419
841 8016555700 8016548790 Bacteria 8155074
842 8016571512 8016566248 Bacteria 8158151
843 8016575762 8016575299 Bacteria 8154085
844 8016594930 8016583857 Bacteria 10421953
845 8016601760 8016595262 Bacteria 8149947
846 8016616374 8016613128 Bacteria 8794220
847 8016624761 8016622563 Bacteria 7999408
848 8016638257 8016630954 Bacteria 9217207
849 8017065400 8017057580 Bacteria 10023680
850 8019532984 8019530166 Bacteria 8155624
851 8019546864 8019538911 Bacteria 7872763
852 8019551802 8019547302 Bacteria 7996444
853 8019584793 8019576017 Bacteria 10049540
854 8019592741 8019586578 Bacteria 10212056
855 8019598705 8019597564 Bacteria 10041141
856 8019647088 8019638758 Bacteria 9062356
857 8019655614 8019648815 Bacteria 10014479
858 8019660702 8019659431 Bacteria 8577854
859 8019670117 8019668869 Bacteria 8791617
860 8019685979 8019678201 Bacteria 8863603
861 8019692139 8019687851 Bacteria 8712826
862 8055744613 8055742211 Bacteria 9226248
863 8056971897 8056967851 Bacteria 9038162
864 Ga0070662_101234707
865 RicEn_FSXC5920_b1
866 JGI24740J21852_10006849
867 JGI24739J22299_10015528
868 JGI24735J21928_10148914
869 JGI25406J46586_10014410
870 JGI25160J50197_1065822
871 JGI25404J52841_10010421
872 JGI25404J52841_10048059
873 Ga0065165_1065894
874 Ga0070658_10070829
875 Ga0070658_10310280
876 Ga0070683_101959971
877 Ga0070670_100626562
878 Ga0068869_100034105
879 Ga0070666_10951638
880 Ga0070680_100041965
881 Ga0070682_100192565
882 Ga0070682_100299956
883 Ga0068868_100063075
884 Ga0070660_100651829
885 Ga0070661_100186968
886 Ga0070668_100332490
887 Ga0070671_100088325
888 Ga0070674_100041445
889 Ga0070659_100220679
890 Ga0070659_100229876
891 Ga0070659_100981896
892 Ga0070659_101644986
893 Ga0070710_10960757
894 Ga0070663_100012150
895 Ga0070663_100054565
896 Ga0070663_100088801
897 Ga0070663_100232792
898 Ga0070663_100456520
899 Ga0070678_100218116
900 Ga0070662_100080296
901 Ga0070681_10014445
902 Ga0068867_100267710
903 Ga0068867_100352115
904 Ga0068867_100918952
905 Ga0070707_100099912
906 Ga0070679_100048460
907 Ga0070679_100405460
908 Ga0070679_101770788
909 Ga0070684_101259064
910 Ga0070697_100348847
911 Ga0068853_100036675
912 Ga0068853_100121014
913 Ga0068853_100130926
914 Ga0068853_100796786
915 Ga0070672_100297728
916 Ga0070672_100389869
917 Ga0070693_100578113
918 Ga0070665_100057532
919 Ga0070665_100087053
920 Ga0070665_100881564
921 Ga0068855_100018040
922 Ga0068855_100048950
923 Ga0068855_100075037
924 Ga0068855_100144190
925 Ga0068855_100821339
926 Ga0070664_100098883
927 Ga0070664_100524603
928 Ga0068857_100027804
929 Ga0068854_100024425
930 Ga0068856_100258989
931 Ga0068856_100325590
932 Ga0068852_100135869
933 Ga0068852_100309392
934 Ga0068852_100722257
935 Ga0068859_100049861
936 Ga0068859_101470478
937 Ga0068859_101595512
938 Ga0068859_101834492
939 Ga0068864_100163037
940 Ga0068864_100391814
941 Ga0068861_100569878
942 Ga0068851_10001895
943 Ga0068851_10209633
944 Ga0068863_100030455
945 Ga0068858_100073747
946 Ga0068858_100193883
947 Ga0068858_100667196
948 Ga0068858_100829570
949 Ga0068858_101026127
950 Ga0068858_101255347
951 Ga0068860_100000668
952 Ga0068860_100346905
953 Ga0068862_100174584
954 Ga0068862_100478484
955 Ga0081455_10004146
956 Ga0081455_10076590
957 Ga0081455_10102877
958 Ga0081455_10267940
959 Ga0081455_10389960
960 Ga0081455_10594918
961 Ga0081538_10210519
962 Ga0081540_1003048
963 Ga0081540_1004117
964 Ga0081540_1014684
965 Ga0081540_1021588
966 Ga0081540_1023712
967 Ga0081540_1044101
968 Ga0081540_1082054
969 Ga0081540_1123178
970 Ga0081540_1128536
971 Ga0081539_10000306
972 Ga0070717_10377497
973 Ga0075365_10005845
974 Ga0075365_10052528
975 Ga0075365_10058758
976 Ga0075365_10074587
977 Ga0075368_10075664
978 Ga0075363_100065959
979 Ga0075363_100106898
980 Ga0075364_10132033
981 Ga0070715_10465477
982 Ga0070716_100309753
983 Ga0070716_100657437
984 Ga0070712_101221749
985 Ga0075362_10060510
986 Ga0075367_10008298
987 Ga0075369_10030670
988 Ga0075369_10060788
989 Ga0075366_10440555
990 Ga0097621_100195972
991 Ga0097621_100453538
992 Ga0075370_10023889
993 Ga0075370_10171421
994 Ga0068871_100053453
995 Ga0068871_100346120
996 Ga0068871_100745633
997 Ga0075428_100026366
998 Ga0075434_101638766
999 Ga0097620_100049852
1000 Ga0097620_101470795
1001 Ga0097620_101595510
1002 Ga0097620_101834743
1003 Ga0099823_1012257
1004 Ga0075435_100589315
1005 Ga0099794_10161669
1006 Ga0099794_10194211
1007 Ga0099795_10318256
1008 Ga0105240_10037752
1009 Ga0105240_10545967
1010 Ga0105240_10713543
1011 Ga0105245_10040208
1012 Ga0105245_10219895
1013 Ga0105247_10110117
1014 Ga0105247_10225937
1015 Ga0105247_10260596
1016 Ga0105243_10462787
1017 Ga0105241_10013605
1018 Ga0105241_10073291
1019 Ga0105241_10183538
1020 Ga0105242_11051335
1021 Ga0105242_11602880
1022 Ga0105248_11078437
1023 Ga0105237_10017484
1024 Ga0105237_10068102
1025 Ga0105237_10406134
1026 Ga0105237_10851364
1027 Ga0105238_10003901
1028 Ga0105238_10338495
1029 Ga0105238_10366175
1030 Ga0105238_11867648
1031 Ga0105249_11193052
1032 Ga0099796_10184481
1033 Ga0105239_10095984
1034 Ga0105239_10140253
1035 Ga0105239_10338589
1036 Ga0105239_10419569
1037 Ga0105239_10646374
1038 Ga0105239_10914806
1039 Ga0105239_10967168
1040 Ga0105239_12063062
1041 Ga0157371_10202031
1042 Ga0157371_10660223
1043 Ga0157370_10065763
1044 Ga0157374_10032356
1045 Ga0157374_10217964
1046 Ga0157374_10595660
1047 Ga0157374_10682340
1048 Ga0157374_10809194
1049 Ga0157378_10875402
1050 Ga0163162_10101720
1051 Ga0163162_10541850
1052 Ga0163162_10672844
1053 Ga0163162_10898592
1054 Ga0163162_10999670
1055 Ga0157375_10663892
1056 Ga0157375_10830622
1057 Ga0157375_11138413
1058 Ga0163163_10380011
1059 Ga0163163_10412574
1060 Ga0163163_10513011
1061 Ga0163163_11148792
1062 Ga0163163_11321291
1063 Ga0157380_13250646
1064 Ga0182008_10272707
1065 Ga0157377_10173594
1066 Ga0157377_10369555
1067 Ga0157379_10107448
1068 Ga0157379_10333410
1069 Ga0157376_10046082
1070 Ga0157376_10152279
1071 Ga0157376_10873954
1072 Ga0163161_10626790
1073 Ga0213876_10175261
1074 Ga0209563_101584
1075 Ga0209677_125552
1076 Ga0209148_1001016
1077 Ga0209233_1000874
1078 Ga0209455_1003032
1079 Ga0209455_1003687
1080 Ga0209673_1015155
1081 Ga0209564_1013948
1082 Ga0209758_1008191
1083 Ga0209758_1008316
1084 Ga0209758_1011780
1085 Ga0209758_1068038
1086 Ga0207426_1004607
1087 Ga0207426_1075867
1088 Ga0207426_1131865
1089 Ga0209051_1055072
1090 Ga0207697_10331785
1091 Ga0207656_10002542
1092 Ga0207642_10018123
1093 Ga0207710_10083199
1094 Ga0207710_10093031
1095 Ga0207688_10062824
1096 Ga0207705_10023185
1097 Ga0207705_10966807
1098 Ga0207654_10000955
1099 Ga0207654_10021910
1100 Ga0207707_10040957
1101 Ga0207695_10004855
1102 Ga0207695_10081521
1103 Ga0207671_10201955
1104 Ga0207671_10216716
1105 Ga0207671_10434151
1106 Ga0207671_10466720
1107 Ga0207671_10555666
1108 Ga0207660_10025153
1109 Ga0207660_11371086
1110 Ga0207657_10045186
1111 Ga0207657_10478893
1112 Ga0207657_10874087
1113 Ga0207657_11401068
1114 Ga0207649_10269076
1115 Ga0207649_10302507
1116 Ga0207652_10272658
1117 Ga0207694_10000212
1118 Ga0207694_10240238
1119 Ga0207694_10371477
1120 Ga0207694_11537124
1121 Ga0207687_10049937
1122 Ga0207687_10320527
1123 Ga0207644_10548104
1124 Ga0207690_10318744
1125 Ga0207706_10069853
1126 Ga0207706_10191923
1127 Ga0207706_10511443
1128 Ga0207669_10261317
1129 Ga0207704_10479300
1130 Ga0207691_10502110
1131 Ga0207711_10661229
1132 Ga0207689_10118416
1133 Ga0207679_10022898
1134 Ga0207679_10532071
1135 Ga0207667_10049311
1136 Ga0207667_10069085
1137 Ga0207651_11446814
1138 Ga0207668_10138277
1139 Ga0207668_10525724
1140 Ga0207677_10092219
1141 Ga0207677_10838960
1142 Ga0207703_10047558
1143 Ga0207703_10119460
1144 Ga0207703_10964213
1145 Ga0207703_11155705
1146 Ga0207639_10301922
1147 Ga0207639_10382887
1148 Ga0207678_10015936
1149 Ga0207678_10048304
1150 Ga0207678_10065414
1151 Ga0207678_10096659
1152 Ga0207678_10172617
1153 Ga0207678_10260653
1154 Ga0207678_10591503
1155 Ga0207702_10000003
1156 Ga0207702_10039680
1157 Ga0207702_10165141
1158 Ga0207641_10039182
1159 Ga0207641_10244073
1160 Ga0207641_10826981
1161 Ga0207648_10181814
1162 Ga0207676_10045716
1163 Ga0207676_10402719
1164 Ga0207674_10038438
1165 Ga0207674_10121247
1166 Ga0207675_100295802
1167 Ga0207683_10087410
1168 Ga0207683_10218391
1169 Ga0207698_10307999
1170 Ga0207698_10427471
1171 Ga0207698_12259026
1172 Ga0209389_1000009
1173 Ga0209489_100050
1174 Ga0209700_100016
1175 Ga0209588_1073644
1176 Ga0209813_10050998
1177 Ga0268266_10001711
1178 Ga0268266_10023032
1179 Ga0268266_10396376
1180 Ga0268265_10184591
1181 Ga0268265_10430163
1182 Ga0268264_10000168
1183 Ga0268264_10180328
1184 Ga0268264_10321292
1185 Ga0268264_10957682
1186 Ga0307517_10288377
1187 Ga0307511_10137253
1188 Ga0307511_10262253
1189 Ga0265332_10019484
1190 Ga0265340_10155396
1191 Ga0265339_10015080
1192 Ga0265339_10131261
1193 Ga0265331_10046079
1194 Ga0307509_10093235
1195 Ga0307509_10303627
1196 Ga0307509_10387421
1197 Ga0307408_101408277
1198 Ga0307508_10000008
1199 Ga0265314_10024248
1200 Ga0265342_10006404
1201 Ga0307516_10107081
1202 Ga0307516_10385378
1203 Ga0307518_10490375
1204 Ga0307416_101452889
1205 Ga0307507_10026887
1206 Ga0307507_10265461
1207 Ga0307507_10291377
1208 Ga0307510_10188091
1209 Ga0373936_0002189
1210 Ga0373936_0014203
1211 Ga0373945_0009070
1212 Ga0373954_0143538
1213 Ga0373956_0113003
1214 Ga0373957_0116279
1215 Ga0373946_0090807
1216 Ga0373955_0165432
1217 Ga0373935_0000103
1218 Ga0373935_0903015
1219 Ga0373927_0000430
1220 Ga0373927_0034206
1221 Ga0373947_0000531
1222 Ga0373937_0142218
1223 Ga0373925_0000459
1224 Ga0373925_0283145
1225 Ga0395899_0252360
1226 Ga0395900_0097073
1227 Ga0395900_0146108
1228 Ga0395900_0167120
1229 Ga0395900_0888213
1230 Ga0395898_0568173
1231 Ga0395898_1173915
1232 Ga0395905_0010872
1233 Ga0395905_0039924
1234 Ga0395905_0785514
1235 Ga0395901_0454791
1236 Ga0436365_1391910
1237 Ga0436360_1070051
1238 Ga0436361_0757981
1239 Ga0436363_0496065
1240 Ga0436363_1716691
1241 Ga0451798_0262550
1242 Ga0451800_0290666
1243 Ga0451800_1604155
1244 Ga0451845_0975934
1245 Ga0451849_0227426
1246 Ga0451843_0718321
1247 Ga0451843_1570541
1248 Ga0495617_112000
1249 Ga0495592_0020536
1250 Ga0495592_0092064
1251 Ga0495592_0303179
1252 Ga0495603_0000368
1253 Ga0495603_0058975
1254 Ga0495603_0270164
1255 Ga0495603_0301584
1256 Ga0495603_0472233
1257 Ga0495590_0093616
1258 Ga0495590_0195826
1259 Ga0495629_0000181
1260 Ga0495629_0001342
1261 Ga0495629_0532386
1262 Ga0495638_0126555
1263 Ga0495638_0237863
1264 Ga0495638_0274151
1265 Ga0495641_0002139
1266 Ga0495651_0020323
1267 Ga0495651_0097147
1268 Ga0495651_0474678
1269 Ga0495653_0173498
1270 Ga0495653_0224746
1271 Ga0495650_0159342
1272 Ga0495580_0000823
1273 Ga0495582_0000039
1274 Ga0495582_0118434
1275 Ga0495639_0000145
1276 Ga0495639_0319811
1277 Ga0495662_0004742
1278 Ga0495662_0150262
1279 Ga0495664_0007045
1280 Ga0495664_0079165
1281 Ga0495584_0169552
1282 Ga0495594_0002582
1283 Ga0495607_0078860
1284 Ga0495607_0250065
1285 Ga0495583_0136717
1286 Ga0495606_0083583
1287 Ga0495606_0120404
1288 Ga0495606_0177737
1289 Ga0495606_0199996
1290 Ga0495606_0367538
1291 Ga0495608_0026445
1292 Ga0495608_0199307
1293 Ga0495616_0125971
1294 Ga0495616_0209884
1295 Ga0495618_0040576
1296 Ga0495620_0048921
1297 Ga0495628_0058627
1298 Ga0495628_0483898
1299 Ga0495630_0003137
1300 Ga0495630_0315212
1301 Ga0495631_0034142
1302 Ga0495632_0145580
1303 Ga0495632_0193544
1304 Ga0495632_0256226
1305 Ga0495643_0115471
1306 Ga0495648_0020206
1307 Ga0495666_0072379
1308 Ga0495652_0227886
1309 Ga0495665_0000192
1310 Ga0495640_0006726
1311 Ga0495640_0008957
1312 Ga0495586_0199740
1313 Ga0495587_0037472
1314 Ga0495587_0373366
1315 Ga0495609_0241259
1316 Ga0495597_0266417
1317 Ga0495645_0098988
1318 Ga0495622_0001325
1319 Ga0495622_0006472
1320 Ga0495622_0050796
1321 Ga0495622_0080799
1322 Ga0495622_0187133
1323 Ga0495667_0009298
1324 Ga0495667_0045474
1325 Ga0495668_0070756
1326 Ga0495668_0145544
1327 Ga0495668_0226222
1328 Ga0495668_0270864
1329 Ga0495668_0574608
1330 Ga0495634_0406963
1331 Ga0495611_0057498
1332 Ga0495611_0188970
1333 Ga0495625_0132211
1334 Ga0495625_0193198
1335 Ga0495625_0309282
1336 Ga0495625_0382109
1337 Ga0495625_0467449
1338 Ga0495625_0600869
1339 Ga0495635_0001634
1340 Ga0495635_0008096
1341 Ga0495635_0348805
1342 Ga0495659_0295073
1343 Ga0495661_0107057
1344 Ga0495661_0124965
1345 Ga0495661_0510038
1346 Ga0495588_0025454
1347 Ga0495588_0025495
1348 Ga0495657_0001548
1349 Ga0495657_0009050
1350 Ga0495599_0033917
1351 Ga0495623_0013295
1352 Ga0495646_0003738
1353 Ga0495646_0058082
1354 Ga0495646_0137099
1355 Ga0495647_0000902
1356 Ga0495658_0000464
1357 Ga0495658_0201241
1358 Ga0495669_0433068
1359 Ga0495613_0038031
1360 Ga0495613_0129158
1361 Ga0495624_0001057
1362 Ga0495624_0021107
1363 Ga0495624_0221181
1364 Ga0495671_0097601
1365 Ga0495671_0141242
1366 Ga0495671_0285682
1367 Ga0495649_0151777
1368 Ga0495649_0215161
1369 Ga0495649_0250438
1370 Ga0495600_0038783
1371 Ga0495600_0216433
1372 Ga0495581_0000024
1373 Ga0495581_0222307
1374 Ga0495604_0002429
1375 Ga0495604_0003330
1376 Ga0495604_0170017
1377 Ga0495604_0398923
1378 Ga0495674_0001709
1379 Ga0495674_0033747
1380 Ga0495676_0006724
1381 Ga0495683_0244726
1382 Ga0495675_0017581
1383 Ga0495679_084252
1384 Ga0495673_0006867
1385 Ga0495673_0093220
1386 Ga0495684_0063061
1387 Ga0495684_0727845
1388 Ga0495686_0056898
1389 Ga0495686_0365791
1390 Ga0495593_0000019
1391 Ga0495593_0184559
1392 Ga0495602_0025757
1393 Ga0495602_0051465
1394 Ga0495602_0380037
1395 Ga0495602_0560441
1396 Ga0495614_0026157
1397 Ga0495614_0063497
1398 Ga0495626_0170958
1399 Ga0496100_0017570
1400 Ga0496101_0013403
1401 Ga0496101_0189252
1402 Ga0496101_0380757
1403 Ga0496102_0002405
1404 Ga0496102_0202455
1405 Ga0496102_0970176
1406 Ga0496103_0158328
1407 Ga0496104_0001719
1408 Ga0496104_0400137
1409 Ga0496104_1092947
1410 Ga0496105_0001495
1411 Ga0496105_0016588
1412 Ga0496105_0146005
1413 Ga0496106_0002034
1414 Ga0496106_0011569
1415 Ga0496106_0578354
1416 Ga0496106_0760785
1417 Ga0496107_0004725
1418 Ga0496107_0192539
1419 Ga0496107_0195806
1420 Ga0496108_0023849
1421 Ga0496108_0032948
1422 Ga0496108_0520061
1423 Ga0496109_0054911
1424 Ga0496109_1769765
1425 Ga0496110_0111785
1426 Ga0496111_0438479
1427 Ga0496112_0036252
1428 Ga0496112_0357228
1429 Ga0496112_1013050
1430 Ga0496113_0007905
1431 Ga0496113_0040252
1432 Ga0496113_0542229
1433 Ga0496114_0075478
1434 Ga0496114_0105537
1435 Ga0496114_0132105
1436 Ga0496114_0671493
1437 Ga0496115_0011400
1438 Ga0496115_0100293
1439 Ga0496115_0106008
1440 Ga0496115_0258511
1441 Ga0496115_0390680
1442 Ga0496116_0031930
1443 Ga0496117_0098226
1444 Ga0496118_0002563
1445 Ga0496118_0036703
1446 Ga0496119_0008626
1447 Ga0496119_0246334
1448 Ga0496120_0276124
1449 Ga0496120_0282383
1450 Ga0496120_0307078
1451 Ga0496121_0000506
1452 Ga0496121_0023082
1453 Ga0496121_0052224
1454 Ga0496121_0080278
1455 Ga0496121_0175740
1456 Ga0496121_0239794
1457 Ga0496121_0297336
1458 Ga0496121_0355012
1459 Ga0496122_0370918
1460 Ga0496124_0001588
1461 Ga0496124_0215732
1462 Ga0496124_0220697
1463 Ga0496125_0054625
1464 Ga0496125_0154505
1465 Ga0496125_0266324
1466 Ga0496125_0341045
1467 Ga0496126_0019221
1468 Ga0496126_0019757
1469 Ga0496126_0037640
1470 Ga0496126_0104829
1471 Ga0496126_0160326
1472 Ga0496126_0248664
1473 Ga0496126_0547998
1474 Ga0495682_0016737
1475 Ga0495682_0154216
1476 Ga0495682_0158840
1477 Ga0501046_0292767
1478 Ga0501046_1121919
1479 Ga0501067_0422609
1480 Ga0501072_0113461
1481 Ga0501074_0118454
1482 Ga0501044_0830742
1483 nmdc:mga03683_430673_c1
1484 nmdc:mga03n38_625_c1
1485 nmdc:mga00v17_193849_c1
1486 nmdc:mga00v17_196675_c1
1487 nmdc:mga0yw44_126455_c1
1488 nmdc:mga0yw44_164991_c1
1489 nmdc:mga0yw44_22931_c1
1490 nmdc:mga0yw44_461462_c1
1491 nmdc:mga0yw44_584384_c1
1492 nmdc:mga0yw44_9592_c1
1493 nmdc:mga0k408_271895_c1
1494 nmdc:mga0k408_359660_c1
1495 nmdc:mga06z11_12130_c1
1496 nmdc:mga04h51_59941_c1
1497 nmdc:mga07m45_557406_c1
1498 nmdc:mga07m45_63777_c1
1499 nmdc:mga07m45_666096_c1
1500 nmdc:mga05p37_490418_c1
1501 nmdc:mga0n895_1270415_c1
1502 nmdc:mga0n895_131033_c1
1503 nmdc:mga0rr50_952983_c1
1504 nmdc:mga0sz30_70004_c1
1505 nmdc:mga0sz30_99472_c1
1506 Ga0495601_0221057
1507 Ga0495601_0973415
1508 Ga0500635_0008838
1509 Ga0500635_0058510
1510 Ga0495619_0240923
1511 Ga0500578_0217800
1512 Ga0500578_0679631
1513 Ga0500644_0064609
1514 Ga0500646_0130222
1515 Ga0500647_0004979
1516 Ga0500647_0040510
1517 Ga0500651_0113750
1518 Ga0500651_0125272
1519 Ga0500651_0299351
1520 Ga0500566_0000087
1521 Ga0500566_0001056
1522 Ga0500566_0120913
1523 Ga0500566_0520285
1524 Ga0500640_000234
1525 Ga0500641_0018365
1526 Ga0500641_0032574
1527 Ga0500641_0081967
1528 Ga0500650_0254993
1529 Ga0500555_002988
1530 Ga0500557_000006
1531 Ga0500562_077020
1532 Ga0500569_145503
1533 Ga0500572_000303
1534 Ga0500591_184197
1535 Ga0500595_000846
1536 Ga0500595_008816
1537 Ga0500595_023187
1538 Ga0500595_024907
1539 Ga0500595_027420
1540 Ga0500595_151818
1541 Ga0500608_049279
1542 Ga0500614_000432
1543 Ga0500621_132065
1544 Ga0500621_267827
1545 Ga0500626_222471
1546 Ga0500642_0000040
1547 Ga0500642_0293958
1548 Ga0500658_0139717
1549 Ga0500658_0287849
1550 Ga0500559_0005172
1551 Ga0500559_0016685
1552 Ga0500559_0037273
1553 Ga0500559_0113328
1554 Ga0500568_0077428
1555 Ga0500568_0101060
1556 Ga0500577_0017639
1557 Ga0500577_0113190
1558 Ga0500577_0124783
1559 Ga0500588_0044391
1560 Ga0500588_0355830
1561 Ga0500589_196112
1562 Ga0500590_067085
1563 Ga0500590_342681
1564 Ga0500603_000494
1565 Ga0500603_087339
1566 Ga0500619_121684
1567 Ga0500622_0150774
1568 Ga0500627_0054028
1569 Ga0500630_006784
1570 Ga0500634_0086797
1571 Ga0500634_0202621
1572 Ga0500634_0269015
1573 Ga0500638_041852
1574 Ga0500638_043801
1575 Ga0500638_201809
1576 Ga0500639_000135
1577 Ga0500636_0172645
1578 Ga0500637_0027600
1579 Ga0500637_0462386
1580 Ga0500649_091083
1581 Ga0500576_066819
1582 Ga0500625_014649
1583 Ga0500645_146574
1584 Ga0500552_000979
1585 Ga0500552_068826
1586 Ga0500596_001590
1587 Ga0500596_063423
1588 Ga0500601_000271
1589 Ga0500661_020533
1590 2507507241
1591 2508541294
1592 2508693375
1593 2513637128
1594 2513693232
1595 2513704660
1596 2513876696
1597 2515628738
1598 2524440637
1599 2528853634
1600 2617347948
1601 2745077901
1602 2805918676
1603 2824625026
1604 2824633920
1605 2824641332
1606 2824651605
1607 2824668974
1608 2824677465
1609 2824693909
1610 2824702341
1611 2824709128
1612 2824722537
1613 2824731835
1614 2824761719
1615 2824770702
1616 2824776062
1617 2841955888
1618 2842041182
1619 2842045873
1620 2847937966
1621 2847939899
1622 2847948201
1623 2874596022
1624 2874607824
1625 2874625778
1626 2874632884
1627 2874650846
1628 2876768638
1629 2876776150
1630 2876813792
1631 2876822110
1632 2879080239
1633 2879105369
1634 2879110762
1635 2879129163
1636 2879147491
1637 2881370385
1638 2885409907
1639 2888392368
1640 2903732911
1641 2904673861
1642 2904711455
1643 2922376254
1644 2929623025
1645 2929631620
1646 2932789408
1647 2932816456
1648 2932827184
1649 2932832015
1650 2933584771
1651 2935610380
1652 2935621954
1653 2935644037
1654 2935651356
1655 2935659536
1656 2935669049
1657 2935683394
1658 2935692334
1659 2935700495
1660 2935708877
1661 2935720428
1662 2935729709
1663 2935739309
1664 2935748150
1665 2935758353
1666 2935767431
1667 2935771086
1668 2935781254
1669 2935786213
1670 2935793990
1671 2935805765
1672 2935815678
1673 2935823541
1674 2935833288
1675 2935843136
1676 2935849066
1677 2935860201
1678 2935867597
1679 2935878592
1680 2935912845
1681 2935922836
1682 2935930261
1683 2935939162
1684 2935946109
1685 2935955446
1686 2935972183
1687 2935976108
1688 2935986398
1689 2935998130
1690 2936006831
1691 2936013951
1692 2936022525
1693 2936035556
1694 2936040916
1695 2936049057
1696 2936060365
1697 2940564257
1698 2941544682
1699 8007000884
1700 8016520154
1701 8016528064
1702 8016533190
1703 8016546431
1704 8016555700
1705 8016571512
1706 8016575762
1707 8016594930
1708 8016601760
1709 8016616374
1710 8016624761
1711 8016638257
1712 8017065400
1713 8019532984
1714 8019546864
1715 8019551802
1716 8019584793
1717 8019592741
1718 8019598705
1719 8019647088
1720 8019655614
1721 8019660702
1722 8019670117
1723 8019685979
1724 8019692139
1725 8055744613
1726 8056971897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

128

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8489 14 135
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8147 14 135
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7618 11 135
3kvv-assembly1.cif.gz_C trapping of an oxocarbenium ion intermediate in up crystals 0.7558 82 135
3fwp-assembly1.cif.gz_A x-ray structure of uridine nucleoside phosphorylease from salmonella typhimurium complexed with phosphate and its inhibitor 2,2'-anhydrouridine at 1.86 a resolution 0.7495 84 135
ID Description Score Start End Superfamily
3rheA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8411 14 135 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8206 82 136 3.30.720.110
3rheA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8076 14 135 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8076 84 135 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7942 82 136 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A537NX92-F1-model_v4 VOC family protein 0.971 85 137
AF-A0A431R9P7-F1-model_v4 VOC family protein 0.9685 84 137
AF-A0A644Z272-F1-model_v4 VOC domain-containing protein 0.9684 84 135
AF-A0A6L7X5H9-F1-model_v4 VOC family protein 0.9661 84 137
AF-A9WMY4-F1-model_v4 Glyoxalase family protein 0.9614 82 133

Map