F483904

General Info

Members Datasets Scaffolds Average Seq Length
862 406 1724 178

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2795385470|2795781257
Length 201
Sequence SRRTPAPSPGEGVGVSAWTIAGSLTPMPALERPELLAEPVVAALAALPADQAARIAVAAIDPGLADTAAFCAEYGSPLEASANCVVVSGKREGQVRYAACLVLATTRADVNGVVRKRLDVRKASFAPMDTAVELSGMAYGGITPIGLPSAWPLLIDAAVAKAPELVVGSGIRGSKLLVPGDVLAALPGAEVVDDLGKPVLS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
185 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
249 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
362 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
368 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
369 2558860280 Kutzneria sp. 744 Isolate Unclassified
370 2582580736 Prauserella sp. Am3 Isolate Unclassified
371 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
372 2643221597 Microbacterium sp. Root180 Isolate Unclassified
373 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
374 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
375 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
376 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
377 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
378 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
379 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
380 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
381 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
382 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
383 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
384 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
385 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
386 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
387 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
388 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
389 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
390 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
391 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
392 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
393 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
394 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
395 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
396 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
397 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
398 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
399 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
400 2928153084 Leifsonia sp. 563 Isolate Unclassified
401 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
402 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
403 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
404 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
405 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
406 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 1.04
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 6.5
Rhizosphere 84.92
Stem 0
Stem Tuber 0.12
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10003386 3300002067 Bacteria 5441
2 JGI25406J46586_10002808 3300003203 Bacteria 8193
3 rootH1_10163609 3300003323 Bacteria 3001
4 Ga0006562J51391_1047355 3300003578 Bacteria 16570
5 Ga0006562J51391_1047356 3300003578 Bacteria 11420
6 JGI25405J52794_10016996 3300003911 Bacteria 1441
7 Ga0070658_10033585 3300005327 Bacteria 4128
8 Ga0070658_10400331 3300005327 Bacteria 1179
9 Ga0070658_10566819 3300005327 Bacteria 983
10 Ga0070683_100265627 3300005329 Bacteria 1632
11 Ga0070683_100765296 3300005329 Bacteria 925
12 Ga0070690_100214758 3300005330 Bacteria 1345
13 Ga0070670_100008432 3300005331 Bacteria 8790
14 Ga0070670_101257718 3300005331 Bacteria 677
15 Ga0068869_100004366 3300005334 Bacteria 8780
16 Ga0068869_100037117 3300005334 Bacteria 3463
17 Ga0070680_100001022 3300005336 Bacteria 19997
18 Ga0070680_100023433 3300005336 Bacteria 4923
19 Ga0070680_100078505 3300005336 Bacteria 2720
20 Ga0070680_100321637 3300005336 Bacteria 1313
21 Ga0070682_100039292 3300005337 Bacteria 2907
22 Ga0070682_100520951 3300005337 Bacteria 925
23 Ga0068868_100067604 3300005338 Bacteria 2844
24 Ga0068868_100116848 3300005338 Bacteria 2172
25 Ga0068868_100318784 3300005338 Bacteria 1324
26 Ga0068868_100741172 3300005338 Bacteria 882
27 Ga0070660_100234868 3300005339 Bacteria 1492
28 Ga0070660_100311149 3300005339 Bacteria 1292
29 Ga0070660_100344594 3300005339 Bacteria 1226
30 Ga0070689_100042620 3300005340 Bacteria 3485
31 Ga0070687_100098834 3300005343 Bacteria 1630
32 Ga0070661_100044086 3300005344 Bacteria 3258
33 Ga0070692_10063267 3300005345 Bacteria 1954
34 Ga0070668_100119510 3300005347 Bacteria 2105
35 Ga0070668_100153867 3300005347 Bacteria 1862
36 Ga0070668_100241165 3300005347 Bacteria 1497
37 Ga0070669_100301847 3300005353 Bacteria 1288
38 Ga0070675_100004898 3300005354 Bacteria 10214
39 Ga0070675_100040523 3300005354 Bacteria 3802
40 Ga0070671_100000788 3300005355 Bacteria 22834
41 Ga0070671_100027321 3300005355 Bacteria 4696
42 Ga0070671_100464712 3300005355 Bacteria 1086
43 Ga0070674_100095515 3300005356 Bacteria 2155
44 Ga0070688_100056016 3300005365 Bacteria 2475
45 Ga0070659_100058286 3300005366 Bacteria 3047
46 Ga0070659_100268360 3300005366 Bacteria 1417
47 Ga0070667_100005829 3300005367 Bacteria 10276
48 Ga0070667_100076075 3300005367 Bacteria 2866
49 Ga0070667_100332012 3300005367 Bacteria 1374
50 Ga0070709_10006691 3300005434 Bacteria 6293
51 Ga0070709_10141383 3300005434 Bacteria 1654
52 Ga0070709_10259301 3300005434 Bacteria 1255
53 Ga0070709_10547332 3300005434 Bacteria 885
54 Ga0070714_100012058 3300005435 Bacteria 6880
55 Ga0070714_100058285 3300005435 Bacteria 3308
56 Ga0070714_100319134 3300005435 Bacteria 1452
57 Ga0070714_100559150 3300005435 Bacteria 1096
58 Ga0070713_100001594 3300005436 Bacteria 14532
59 Ga0070713_100497324 3300005436 Bacteria 1150
60 Ga0070713_100677714 3300005436 Bacteria 983
61 Ga0070710_10000158 3300005437 Bacteria 31424
62 Ga0070710_10029894 3300005437 Bacteria 2926
63 Ga0070710_10292154 3300005437 Bacteria 1061
64 Ga0070711_100004649 3300005439 Bacteria 8126
65 Ga0070711_100440873 3300005439 Bacteria 1064
66 Ga0070700_100163203 3300005441 Bacteria 1536
67 Ga0070700_100769095 3300005441 Bacteria 772
68 Ga0070708_100138617 3300005445 Bacteria 2255
69 Ga0070708_100502169 3300005445 Bacteria 1144
70 Ga0070663_100000894 3300005455 Bacteria 16203
71 Ga0070663_100036261 3300005455 Bacteria 3426
72 Ga0070663_100037750 3300005455 Bacteria 3365
73 Ga0070662_100134846 3300005457 Bacteria 1908
74 Ga0070681_10000077 3300005458 Bacteria 72675
75 Ga0070681_10010387 3300005458 Bacteria 9195
76 Ga0070681_10753888 3300005458 Bacteria 890
77 Ga0070685_10048131 3300005466 Bacteria 2455
78 Ga0070685_10202488 3300005466 Bacteria 1291
79 Ga0070706_100002832 3300005467 Bacteria 17327
80 Ga0070706_100018428 3300005467 Bacteria 6440
81 Ga0070706_100105633 3300005467 Bacteria 2620
82 Ga0070706_100176641 3300005467 Bacteria 1994
83 Ga0070706_100330254 3300005467 Bacteria 1422
84 Ga0070706_100820602 3300005467 Bacteria 860
85 Ga0070707_100001616 3300005468 Bacteria 21835
86 Ga0070707_100005349 3300005468 Bacteria 12019
87 Ga0070707_100016947 3300005468 Bacteria 6844
88 Ga0070707_100050761 3300005468 Bacteria 3977
89 Ga0070707_100130225 3300005468 Bacteria 2446
90 Ga0070698_100003363 3300005471 Bacteria 17601
91 Ga0070698_100194581 3300005471 Bacteria 1965
92 Ga0070699_100523896 3300005518 Bacteria 1078
93 Ga0070679_100000135 3300005530 Bacteria 59584
94 Ga0070679_100030963 3300005530 Bacteria 5285
95 Ga0070684_100503425 3300005535 Bacteria 1122
96 Ga0070684_100635194 3300005535 Bacteria 993
97 Ga0070684_100675410 3300005535 Bacteria 962
98 Ga0068853_100052520 3300005539 Bacteria 3511
99 Ga0068853_100797608 3300005539 Bacteria 904
100 Ga0070672_100070075 3300005543 Bacteria 2785
101 Ga0070686_100491859 3300005544 Bacteria 950
102 Ga0070693_100013519 3300005547 Bacteria 4159
103 Ga0070665_100001822 3300005548 Bacteria 24187
104 Ga0070665_100016770 3300005548 Bacteria 7343
105 Ga0070665_100040243 3300005548 Bacteria 4699
106 Ga0070665_100082987 3300005548 Bacteria 3210
107 Ga0070665_100925952 3300005548 Bacteria 884
108 Ga0070704_100424603 3300005549 Bacteria 1139
109 Ga0068855_100087663 3300005563 Bacteria 3596
110 Ga0070664_100046271 3300005564 Bacteria 3675
111 Ga0068857_100025063 3300005577 Bacteria 5254
112 Ga0068857_100142564 3300005577 Bacteria 2166
113 Ga0068856_100029765 3300005614 Bacteria 5335
114 Ga0068856_100037302 3300005614 Bacteria 4769
115 Ga0068856_100109464 3300005614 Bacteria 2759
116 Ga0070702_100000249 3300005615 Bacteria 18368
117 Ga0068852_100033570 3300005616 Bacteria 4262
118 Ga0068852_100038284 3300005616 Bacteria 4029
119 Ga0068859_100100847 3300005617 Bacteria 2943
120 Ga0068864_100104390 3300005618 Bacteria 2517
121 Ga0068864_100261981 3300005618 Bacteria 1608
122 Ga0068864_100346725 3300005618 Bacteria 1400
123 Ga0068870_10000485 3300005840 Bacteria 15062
124 Ga0068870_10061606 3300005840 Bacteria 2018
125 Ga0068863_100000825 3300005841 Bacteria 31093
126 Ga0068863_100002727 3300005841 Bacteria 17453
127 Ga0068863_100006552 3300005841 Bacteria 11429
128 Ga0068863_100113603 3300005841 Bacteria 2580
129 Ga0068863_100323707 3300005841 Bacteria 1498
130 Ga0068863_100663579 3300005841 Bacteria 1035
131 Ga0068863_101087344 3300005841 Bacteria 804
132 Ga0068858_100039022 3300005842 Bacteria 4405
133 Ga0068858_100219548 3300005842 Bacteria 1800
134 Ga0068860_100000067 3300005843 Bacteria 180176
135 Ga0068860_100046376 3300005843 Bacteria 4144
136 Ga0068860_100110967 3300005843 Bacteria 2622
137 Ga0068862_100016456 3300005844 Bacteria 6155
138 Ga0081455_10000692 3300005937 Bacteria 43780
139 Ga0081455_10008638 3300005937 Bacteria 10561
140 Ga0081538_10000016 3300005981 Bacteria 147022
141 Ga0081540_1073793 3300005983 Bacteria 1566
142 Ga0081539_10000401 3300005985 Bacteria 92875
143 Ga0070717_10036632 3300006028 Bacteria 3979
144 Ga0070717_10091250 3300006028 Bacteria 2572
145 Ga0070717_10096071 3300006028 Bacteria 2509
146 Ga0070717_10106141 3300006028 Bacteria 2391
147 Ga0070717_10771629 3300006028 Bacteria 874
148 Ga0070717_10885321 3300006028 Bacteria 813
149 Ga0075365_10088197 3300006038 Bacteria 2110
150 Ga0075368_10287904 3300006042 Bacteria 707
151 Ga0075364_10031406 3300006051 Bacteria 3412
152 Ga0070715_10008053 3300006163 Bacteria 3656
153 Ga0070716_100014341 3300006173 Bacteria 4058
154 Ga0070716_100134791 3300006173 Bacteria 1566
155 Ga0070712_100143777 3300006175 Bacteria 1823
156 Ga0070712_100542480 3300006175 Bacteria 979
157 Ga0075367_10002964 3300006178 Bacteria 7935
158 Ga0097621_100079102 3300006237 Bacteria 2732
159 Ga0075370_10142347 3300006353 Bacteria 1402
160 Ga0075428_100005695 3300006844 Bacteria 13850
161 Ga0075428_100107508 3300006844 Bacteria 3040
162 Ga0075428_100114469 3300006844 Bacteria 2938
163 Ga0075428_100842658 3300006844 Bacteria 974
164 Ga0075430_100002967 3300006846 Bacteria 14208
165 Ga0075430_100012455 3300006846 Bacteria 7236
166 Ga0075430_100021018 3300006846 Bacteria 5548
167 Ga0075430_100194709 3300006846 Bacteria 1684
168 Ga0075431_100014674 3300006847 Bacteria 7928
169 Ga0075431_100040656 3300006847 Bacteria 4792
170 Ga0075431_100113732 3300006847 Bacteria 2794
171 Ga0075431_100182363 3300006847 Bacteria 2154
172 Ga0075431_100562800 3300006847 Bacteria 1126
173 Ga0075433_10016144 3300006852 Bacteria 6143
174 Ga0075433_10085559 3300006852 Bacteria 2783
175 Ga0075434_100000965 3300006871 Bacteria 23178
176 Ga0075434_100011948 3300006871 Bacteria 8213
177 Ga0075434_100113850 3300006871 Bacteria 2717
178 Ga0075429_100007259 3300006880 Bacteria 9612
179 Ga0075429_100012278 3300006880 Bacteria 7428
180 Ga0075429_100057852 3300006880 Bacteria 3376
181 Ga0075429_100092771 3300006880 Bacteria 2633
182 Ga0075429_101037636 3300006880 Bacteria 716
183 Ga0068865_100065162 3300006881 Bacteria 2566
184 Ga0068865_100324869 3300006881 Bacteria 1239
185 Ga0075436_100000682 3300006914 Bacteria 22349
186 Ga0075436_100060296 3300006914 Bacteria 2620
187 Ga0097620_100100847 3300006931 Bacteria 2943
188 Ga0075435_100007979 3300007076 Bacteria 7577
189 Ga0075435_100449943 3300007076 Bacteria 1110
190 Ga0075435_100636079 3300007076 Bacteria 926
191 Ga0099794_10104014 3300007265 Bacteria 1419
192 Ga0105250_10067032 3300009092 Bacteria 1448
193 Ga0105240_10058886 3300009093 Bacteria 4795
194 Ga0105240_10358895 3300009093 Bacteria 1651
195 Ga0111539_10296595 3300009094 Bacteria 1881
196 Ga0105245_10001147 3300009098 Bacteria 23949
197 Ga0105245_10016486 3300009098 Bacteria 6447
198 Ga0105247_10599976 3300009101 Bacteria 816
199 Ga0114129_10000557 3300009147 Bacteria 45780
200 Ga0114129_10058757 3300009147 Bacteria 5379
201 Ga0114129_10161046 3300009147 Bacteria 3065
202 Ga0114129_10184086 3300009147 Bacteria 2840
203 Ga0114129_10915361 3300009147 Bacteria 1110
204 Ga0105243_10233384 3300009148 Bacteria 1633
205 Ga0105243_11297091 3300009148 Bacteria 745
206 Ga0105241_10004400 3300009174 Bacteria 10414
207 Ga0105241_10118932 3300009174 Bacteria 2125
208 Ga0105241_10297368 3300009174 Bacteria 1384
209 Ga0105248_10010638 3300009177 Bacteria 10147
210 Ga0105248_10053245 3300009177 Bacteria 4541
211 Ga0105237_10078667 3300009545 Bacteria 3287
212 Ga0105237_10129074 3300009545 Bacteria 2522
213 Ga0105238_10009854 3300009551 Bacteria 9573
214 Ga0105238_10085457 3300009551 Bacteria 3142
215 Ga0105238_10272592 3300009551 Bacteria 1673
216 Ga0105238_10385716 3300009551 Bacteria 1393
217 Ga0105249_10368751 3300009553 Bacteria 1459
218 Ga0105249_10394849 3300009553 Bacteria 1412
219 Ga0105249_11343836 3300009553 Bacteria 786
220 Ga0105033_104027 3300009986 Bacteria 1250
221 Ga0105239_10120671 3300010375 Bacteria 2911
222 Ga0105239_10410737 3300010375 Bacteria 1533
223 Ga0105246_10000043 3300011119 Bacteria 47690
224 Ga0105246_10745099 3300011119 Bacteria 863
225 Ga0157317_1003027 3300012475 Bacteria 1025
226 Ga0157373_10055589 3300013100 Bacteria 2812
227 Ga0157371_10534289 3300013102 Bacteria 868
228 Ga0157370_10011499 3300013104 Bacteria 9248
229 Ga0157370_10098631 3300013104 Bacteria 2739
230 Ga0157370_10147401 3300013104 Bacteria 2191
231 Ga0157369_10295797 3300013105 Bacteria 1685
232 Ga0157369_11219879 3300013105 Bacteria 768
233 Ga0157369_11311859 3300013105 Bacteria 738
234 Ga0157369_11506491 3300013105 Bacteria 684
235 Ga0157374_11065189 3300013296 Bacteria 828
236 Ga0157372_10000043 3300013307 Bacteria 153958
237 Ga0157372_10111537 3300013307 Bacteria 3134
238 Ga0157372_11076395 3300013307 Bacteria 930
239 Ga0157375_10226622 3300013308 Bacteria 2028
240 Ga0163163_10005228 3300014325 Bacteria 11192
241 Ga0163163_10307621 3300014325 Bacteria 1637
242 Ga0163163_10594637 3300014325 Bacteria 1170
243 Ga0163163_10786935 3300014325 Bacteria 1014
244 Ga0163163_11435954 3300014325 Bacteria 751
245 Ga0163163_11477646 3300014325 Bacteria 741
246 Ga0157377_10034027 3300014745 Bacteria 2786
247 Ga0157377_10310550 3300014745 Bacteria 1044
248 Ga0157379_10025353 3300014968 Bacteria 5267
249 Ga0157379_10032051 3300014968 Bacteria 4683
250 Ga0157379_10203740 3300014968 Bacteria 1790
251 Ga0157376_10011635 3300014969 Bacteria 6494
252 Ga0157376_10164065 3300014969 Bacteria 2017
253 Ga0206356_10781422 3300020070 Bacteria 1774
254 Ga0206356_11371595 3300020070 Bacteria 2940
255 Ga0206351_10984482 3300020077 Bacteria 749
256 Ga0206353_11838987 3300020082 Bacteria 695
257 Ga0206353_11915281 3300020082 Bacteria 2650
258 Ga0206353_12028661 3300020082 Bacteria 8725
259 Ga0213875_10001574 3300021388 Bacteria 14573
260 Ga0209677_100375 3300025253 Bacteria 27361
261 Ga0207692_10001172 3300025898 Bacteria 9689
262 Ga0207692_10002461 3300025898 Bacteria 7108
263 Ga0207692_10048263 3300025898 Bacteria 2142
264 Ga0207710_10103916 3300025900 Bacteria 1343
265 Ga0207688_10000704 3300025901 Bacteria 16517
266 Ga0207680_10019495 3300025903 Bacteria 3628
267 Ga0207685_10077039 3300025905 Bacteria 1369
268 Ga0207699_10003198 3300025906 Bacteria 7800
269 Ga0207699_10032994 3300025906 Bacteria 2922
270 Ga0207699_10049509 3300025906 Bacteria 2474
271 Ga0207699_10066106 3300025906 Bacteria 2194
272 Ga0207699_10149393 3300025906 Bacteria 1544
273 Ga0207699_10300012 3300025906 Bacteria 1122
274 Ga0207643_10000255 3300025908 Bacteria 37233
275 Ga0207643_10061711 3300025908 Bacteria 2141
276 Ga0207705_10025237 3300025909 Bacteria 4243
277 Ga0207705_10170195 3300025909 Bacteria 1640
278 Ga0207705_10213785 3300025909 Bacteria 1463
279 Ga0207705_10578852 3300025909 Bacteria 873
280 Ga0207684_10010471 3300025910 Bacteria 8161
281 Ga0207684_10015809 3300025910 Bacteria 6489
282 Ga0207684_10213547 3300025910 Bacteria 1664
283 Ga0207684_10310661 3300025910 Bacteria 1359
284 Ga0207684_10863730 3300025910 Bacteria 762
285 Ga0207654_10018194 3300025911 Bacteria 3684
286 Ga0207707_10000089 3300025912 Bacteria 90919
287 Ga0207707_10054688 3300025912 Bacteria 3474
288 Ga0207695_10061148 3300025913 Bacteria 3894
289 Ga0207671_10164128 3300025914 Bacteria 1721
290 Ga0207693_10019042 3300025915 Bacteria 5464
291 Ga0207693_10150444 3300025915 Bacteria 1831
292 Ga0207693_10206818 3300025915 Bacteria 1543
293 Ga0207693_10473026 3300025915 Bacteria 979
294 Ga0207663_10073799 3300025916 Bacteria 2209
295 Ga0207663_10075252 3300025916 Bacteria 2191
296 Ga0207660_10001907 3300025917 Bacteria 13892
297 Ga0207660_10002528 3300025917 Bacteria 12018
298 Ga0207660_10267695 3300025917 Bacteria 1353
299 Ga0207662_10122244 3300025918 Bacteria 1634
300 Ga0207657_10017121 3300025919 Bacteria 6965
301 Ga0207649_10007713 3300025920 Bacteria 5852
302 Ga0207652_10000015 3300025921 Bacteria 193042
303 Ga0207652_10015476 3300025921 Bacteria 6202
304 Ga0207646_10000731 3300025922 Bacteria 42637
305 Ga0207646_10009013 3300025922 Bacteria 9918
306 Ga0207646_10048380 3300025922 Bacteria 3811
307 Ga0207646_10116996 3300025922 Bacteria 2394
308 Ga0207646_10403354 3300025922 Bacteria 1234
309 Ga0207646_11218803 3300025922 Bacteria 659
310 Ga0207681_10136888 3300025923 Bacteria 1819
311 Ga0207694_10025217 3300025924 Bacteria 4518
312 Ga0207694_10110096 3300025924 Bacteria 2190
313 Ga0207650_10001380 3300025925 Bacteria 17521
314 Ga0207659_10008047 3300025926 Bacteria 6527
315 Ga0207659_10252210 3300025926 Bacteria 1432
316 Ga0207687_10004511 3300025927 Bacteria 9263
317 Ga0207687_10250138 3300025927 Bacteria 1409
318 Ga0207700_10035538 3300025928 Bacteria 3590
319 Ga0207700_10154973 3300025928 Bacteria 1897
320 Ga0207700_10196572 3300025928 Bacteria 1697
321 Ga0207700_10402338 3300025928 Bacteria 1200
322 Ga0207700_10688340 3300025928 Bacteria 912
323 Ga0207664_10009298 3300025929 Bacteria 6892
324 Ga0207664_10023058 3300025929 Bacteria 4658
325 Ga0207664_10049093 3300025929 Bacteria 3321
326 Ga0207664_10049924 3300025929 Bacteria 3296
327 Ga0207664_10049971 3300025929 Bacteria 3295
328 Ga0207644_10000647 3300025931 Bacteria 22018
329 Ga0207644_10019645 3300025931 Bacteria 4588
330 Ga0207690_10018313 3300025932 Bacteria 4294
331 Ga0207690_10384941 3300025932 Bacteria 1115
332 Ga0207706_10061473 3300025933 Bacteria 3308
333 Ga0207706_10200245 3300025933 Bacteria 1751
334 Ga0207709_10281390 3300025935 Bacteria 1229
335 Ga0207670_10176633 3300025936 Bacteria 1605
336 Ga0207669_10075981 3300025937 Bacteria 2131
337 Ga0207704_10066480 3300025938 Bacteria 2263
338 Ga0207665_10029654 3300025939 Bacteria 3615
339 Ga0207691_10025726 3300025940 Bacteria 5523
340 Ga0207711_10827028 3300025941 Bacteria 862
341 Ga0207689_10003676 3300025942 Bacteria 13985
342 Ga0207689_10099783 3300025942 Bacteria 2386
343 Ga0207661_10041234 3300025944 Bacteria 3633
344 Ga0207661_10098684 3300025944 Bacteria 2448
345 Ga0207661_10126896 3300025944 Bacteria 2180
346 Ga0207661_10146991 3300025944 Bacteria 2034
347 Ga0207661_10233247 3300025944 Bacteria 1630
348 Ga0207661_10591621 3300025944 Bacteria 1018
349 Ga0207679_10001781 3300025945 Bacteria 13403
350 Ga0207679_10140684 3300025945 Bacteria 1950
351 Ga0207667_10029004 3300025949 Bacteria 6007
352 Ga0207667_10117863 3300025949 Bacteria 2736
353 Ga0207651_10022933 3300025960 Bacteria 3829
354 Ga0207668_10022464 3300025972 Bacteria 4040
355 Ga0207668_10108700 3300025972 Bacteria 2076
356 Ga0207668_10199949 3300025972 Bacteria 1590
357 Ga0207640_10078681 3300025981 Bacteria 2245
358 Ga0207658_10002268 3300025986 Bacteria 14222
359 Ga0207658_10060272 3300025986 Bacteria 2831
360 Ga0207677_10044300 3300026023 Bacteria 2964
361 Ga0207677_10074779 3300026023 Bacteria 2405
362 Ga0207703_10035233 3300026035 Bacteria 3977
363 Ga0207703_10035764 3300026035 Bacteria 3948
364 Ga0207639_10926897 3300026041 Bacteria 815
365 Ga0207678_10000120 3300026067 Bacteria 65114
366 Ga0207678_10000346 3300026067 Bacteria 41986
367 Ga0207678_10054836 3300026067 Bacteria 3433
368 Ga0207708_10372890 3300026075 Bacteria 1175
369 Ga0207702_10001514 3300026078 Bacteria 22967
370 Ga0207702_10041795 3300026078 Bacteria 3844
371 Ga0207702_10073412 3300026078 Bacteria 2949
372 Ga0207702_10085630 3300026078 Bacteria 2747
373 Ga0207702_10147451 3300026078 Bacteria 2137
374 Ga0207702_10459294 3300026078 Bacteria 1237
375 Ga0207641_10003465 3300026088 Bacteria 13978
376 Ga0207641_10005835 3300026088 Bacteria 10451
377 Ga0207641_10020496 3300026088 Bacteria 5430
378 Ga0207641_10081134 3300026088 Bacteria 2816
379 Ga0207641_10082921 3300026088 Bacteria 2787
380 Ga0207641_10380490 3300026088 Bacteria 1352
381 Ga0207676_10000914 3300026095 Bacteria 22844
382 Ga0207676_10407544 3300026095 Bacteria 1272
383 Ga0207676_10642923 3300026095 Bacteria 1023
384 Ga0207676_10743268 3300026095 Bacteria 953
385 Ga0207674_10020943 3300026116 Bacteria 7053
386 Ga0207674_10090197 3300026116 Bacteria 3057
387 Ga0207674_10346953 3300026116 Bacteria 1435
388 Ga0207675_100020646 3300026118 Bacteria 6140
389 Ga0207683_10001990 3300026121 Bacteria 18093
390 Ga0207683_10335841 3300026121 Bacteria 1385
391 Ga0207698_10003656 3300026142 Bacteria 9283
392 Ga0207698_10236724 3300026142 Bacteria 1661
393 Ga0207428_10001605 3300027907 Bacteria 23495
394 Ga0268266_10004303 3300028379 Bacteria 13708
395 Ga0268266_10015983 3300028379 Bacteria 6419
396 Ga0268266_10057047 3300028379 Bacteria 3360
397 Ga0268266_10083185 3300028379 Bacteria 2794
398 Ga0268264_10000114 3300028381 Bacteria 203211
399 Ga0268264_10044861 3300028381 Bacteria 3669
400 Ga0307515_10142969 3300028794 Bacteria 2554
401 Ga0307515_10238616 3300028794 Bacteria 1594
402 Ga0307511_10001747 3300030521 Bacteria 22882
403 Ga0307512_10079030 3300030522 Bacteria 2379
404 Ga0314311_1200767 3300030733 Bacteria 2021
405 Ga0316180_1017775 3300030736 Bacteria 4604
406 Ga0307513_10034844 3300031456 Bacteria 5641
407 Ga0307509_10056168 3300031507 Bacteria 4180
408 Ga0307509_10261811 3300031507 Bacteria 1504
409 Ga0307408_100132511 3300031548 Bacteria 1946
410 Ga0307508_10011315 3300031616 Bacteria 8158
411 Ga0316575_10037052 3300031665 Bacteria 1920
412 Ga0307405_10042305 3300031731 Bacteria 2772
413 Ga0307405_10986081 3300031731 Bacteria 718
414 Ga0307413_10049467 3300031824 Bacteria 2520
415 Ga0307518_10000517 3300031838 Bacteria 29360
416 Ga0307410_10057630 3300031852 Bacteria 2646
417 Ga0307410_10870975 3300031852 Bacteria 770
418 Ga0307406_10027269 3300031901 Bacteria 3441
419 Ga0307406_10365759 3300031901 Bacteria 1132
420 Ga0307407_10012377 3300031903 Bacteria 4098
421 Ga0307412_10059506 3300031911 Bacteria 2561
422 Ga0307412_10586734 3300031911 Bacteria 942
423 Ga0307409_100000307 3300031995 Bacteria 19995
424 Ga0307409_100069674 3300031995 Bacteria 2788
425 Ga0307409_100095284 3300031995 Bacteria 2452
426 Ga0307416_100001292 3300032002 Bacteria 13503
427 Ga0307416_100242948 3300032002 Bacteria 1746
428 Ga0307416_100515423 3300032002 Bacteria 1263
429 Ga0307416_102139783 3300032002 Bacteria 661
430 Ga0307411_10140942 3300032005 Bacteria 1778
431 Ga0307411_10150169 3300032005 Bacteria 1730
432 Ga0307415_100000008 3300032126 Bacteria 90898
433 Ga0307415_100027555 3300032126 Bacteria 3602
434 Ga0307415_100028203 3300032126 Bacteria 3568
435 Ga0316585_10084182 3300032137 Bacteria 1037
436 Ga0373930_0007860 3300034816 Bacteria 1848
437 Ga0373958_0063072 3300034819 Bacteria 807
438 Ga0373959_0047484 3300034820 Bacteria 918
439 Ga0373938_0046063 3300034957 Bacteria 983
440 Ga0373928_0037626 3300035084 Bacteria 1099
441 Ga0373934_0000049 3300035086 Bacteria 40994
442 Ga0373934_0006516 3300035086 Bacteria 4332
443 Ga0373944_0046946 3300035089 Bacteria 1352
444 Ga0373949_0040472 3300035090 Bacteria 1144
445 Ga0373951_0010768 3300035091 Bacteria 2055
446 Ga0373923_0010142 3300035111 Bacteria 3419
447 Ga0373923_0032238 3300035111 Bacteria 2116
448 Ga0373936_0119956 3300035113 Bacteria 1123
449 Ga0373939_0007613 3300035114 Bacteria 2633
450 Ga0373941_0041616 3300035115 Bacteria 1423
451 Ga0373945_0043214 3300035116 Bacteria 1634
452 Ga0373953_0000077 3300035117 Bacteria 23684
453 Ga0373954_0016600 3300035118 Bacteria 3298
454 Ga0373954_0088020 3300035118 Bacteria 1489
455 Ga0373954_0130781 3300035118 Bacteria 1222
456 Ga0373956_0000086 3300035119 Bacteria 31023
457 Ga0373956_0026508 3300035119 Bacteria 2511
458 Ga0373956_0053578 3300035119 Bacteria 1816
459 Ga0373956_0065695 3300035119 Bacteria 1649
460 Ga0373957_0000167 3300035120 Bacteria 16896
461 Ga0373957_0014145 3300035120 Bacteria 2722
462 Ga0373960_0113817 3300035121 Bacteria 890
463 Ga0373943_0072646 3300035170 Bacteria 1745
464 Ga0373943_0213120 3300035170 Bacteria 1073
465 Ga0373946_0130329 3300035171 Bacteria 1156
466 Ga0373955_0000252 3300035172 Bacteria 22257
467 Ga0373955_0005539 3300035172 Bacteria 5678
468 Ga0373955_0018911 3300035172 Bacteria 3435
469 Ga0373942_0066185 3300035207 Bacteria 1045
470 Ga0373962_0006236 3300035242 Bacteria 2885
471 Ga0373924_0002022 3300035410 Bacteria 6757
472 Ga0373924_0063603 3300035410 Bacteria 1548
473 Ga0373931_0105780 3300035691 Bacteria 1589
474 Ga0373931_0125620 3300035691 Bacteria 1471
475 Ga0373927_0477916 3300035695 Bacteria 823
476 Ga0373933_0000051 3300035724 Bacteria 71384
477 Ga0373933_0007530 3300035724 Bacteria 5948
478 Ga0373933_0013021 3300035724 Bacteria 4603
479 Ga0373933_0039454 3300035724 Bacteria 2778
480 Ga0373947_0017493 3300035725 Bacteria 4123
481 Ga0373947_0669888 3300035725 Bacteria 707
482 Ga0373937_0000289 3300036401 Bacteria 47874
483 Ga0373937_0040374 3300036401 Bacteria 4253
484 Ga0373937_0065355 3300036401 Bacteria 3348
485 Ga0373937_0252813 3300036401 Bacteria 1661
486 Ga0373925_1039755 3300037068 Bacteria 674
487 Ga0395899_0006426 3300037312 Bacteria 9106
488 Ga0395900_0091467 3300037418 Bacteria 3127
489 Ga0395900_0098140 3300037418 Bacteria 3010
490 Ga0395898_0226597 3300037466 Bacteria 1783
491 Ga0395898_0973423 3300037466 Bacteria 785
492 Ga0436364_0580980 3300037853 Bacteria 2990
493 Ga0436364_1139642 3300037853 Bacteria 14414
494 Ga0395901_0205522 3300038443 Bacteria 2063
495 Ga0395901_0260051 3300038443 Bacteria 1807
496 Ga0395901_1424094 3300038443 Bacteria 651
497 Ga0436365_1884406 3300039437 Bacteria 5877
498 Ga0436362_1009491 3300039453 Bacteria 1977
499 Ga0439465_0003486 3300041413 Bacteria 5131
500 Ga0451795_0390901 3300041456 Bacteria 940
501 Ga0451833_1468397 3300041491 Bacteria 725
502 Ga0451853_0401476 3300041512 Bacteria 961
503 Ga0439448_0033838 3300042005 Bacteria 1631
504 Ga0439449_0131494 3300042007 Bacteria 930
505 Ga0439449_0189735 3300042007 Bacteria 769
506 Ga0439463_002459 3300042016 Bacteria 4710
507 Ga0450900_024085 3300042136 Bacteria 862
508 Ga0450902_036331 3300042137 Bacteria 834
509 Ga0439458_0003635 3300042157 Bacteria 3586
510 Ga0439459_0003127 3300042438 Bacteria 2602
511 Ga0466969_0004684 3300044656 Bacteria 7287
512 Ga0466972_0009347 3300044658 Bacteria 4928
513 Ga0466972_0009858 3300044658 Bacteria 4796
514 Ga0466972_0030426 3300044658 Bacteria 2658
515 Ga0466972_0265932 3300044658 Bacteria 801
516 Ga0466965_0000884 3300044683 Bacteria 11446
517 Ga0466965_0001772 3300044683 Bacteria 8925
518 Ga0466965_0052304 3300044683 Bacteria 2028
519 Ga0466965_0366892 3300044683 Bacteria 791
520 Ga0466966_0001055 3300044684 Bacteria 17604
521 Ga0466966_0141958 3300044684 Unclassified 1467
522 Ga0466966_0148139 3300044684 Bacteria 1432
523 Ga0466966_0154428 3300044684 Bacteria 1399
524 Ga0466966_0221615 3300044684 Bacteria 1142
525 Ga0466961_0013186 3300044693 Bacteria 5286
526 Ga0466961_0018939 3300044693 Bacteria 4430
527 Ga0466961_0024716 3300044693 Bacteria 3864
528 Ga0466961_0042768 3300044693 Bacteria 2904
529 Ga0466961_0046415 3300044693 Bacteria 2778
530 Ga0466961_0057207 3300044693 Bacteria 2483
531 Ga0466961_0182478 3300044693 Bacteria 1302
532 Ga0466963_0003782 3300044694 Bacteria 8723
533 Ga0466963_0009176 3300044694 Bacteria 5949
534 Ga0466963_0128484 3300044694 Bacteria 1749
535 Ga0466963_0149388 3300044694 Bacteria 1622
536 Ga0466963_0240440 3300044694 Bacteria 1270
537 Ga0466963_0272816 3300044694 Bacteria 1188
538 Ga0466964_0312671 3300044706 Bacteria 796
539 Ga0466964_0323366 3300044706 Bacteria 784
540 Ga0466971_0003749 3300044719 Bacteria 6507
541 Ga0466971_0044272 3300044719 Bacteria 1999
542 Ga0466971_0078749 3300044719 Bacteria 1502
543 Ga0466971_0153913 3300044719 Bacteria 1074
544 Ga0466968_0073794 3300044735 Bacteria 1489
545 Ga0466968_0086864 3300044735 Bacteria 1381
546 Ga0466968_0156784 3300044735 Bacteria 1049
547 Ga0466970_0001375 3300044765 Bacteria 11716
548 Ga0466970_0006135 3300044765 Bacteria 5987
549 Ga0466970_0049465 3300044765 Bacteria 2242
550 Ga0466970_0097043 3300044765 Bacteria 1603
551 Ga0466970_0170974 3300044765 Bacteria 1204
552 Ga0466970_0181219 3300044765 Bacteria 1169
553 Ga0466970_0212236 3300044765 Bacteria 1079
554 Ga0466970_0251857 3300044765 Bacteria 989
555 Ga0466957_0012389 3300044842 Bacteria 4936
556 Ga0466957_0025827 3300044842 Bacteria 3482
557 Ga0466957_0036271 3300044842 Bacteria 2964
558 Ga0466957_0070187 3300044842 Bacteria 2165
559 Ga0466957_0129670 3300044842 Bacteria 1614
560 Ga0466957_0257477 3300044842 Bacteria 1162
561 Ga0466960_0005629 3300044901 Bacteria 4972
562 Ga0466960_0007203 3300044901 Bacteria 4504
563 Ga0466960_0023038 3300044901 Bacteria 2791
564 Ga0466960_0042396 3300044901 Bacteria 2161
565 Ga0466960_0058805 3300044901 Bacteria 1878
566 Ga0466960_0073691 3300044901 Bacteria 1704
567 Ga0466960_0229956 3300044901 Bacteria 1023
568 Ga0466959_0038275 3300045049 Bacteria 3544
569 Ga0466959_0073752 3300045049 Bacteria 2468
570 Ga0466959_0088762 3300045049 Bacteria 2222
571 Ga0466959_0188439 3300045049 Bacteria 1440
572 Ga0466959_0281505 3300045049 Bacteria 1141
573 Ga0466958_0014164 3300045836 Bacteria 4551
574 Ga0466958_0015139 3300045836 Bacteria 4414
575 Ga0466958_0024266 3300045836 Bacteria 3568
576 Ga0466958_0175807 3300045836 Bacteria 1357
577 Ga0466958_0249031 3300045836 Bacteria 1136
578 Ga0466967_0008682 3300045976 Bacteria 7477
579 Ga0466967_0009725 3300045976 Bacteria 7161
580 Ga0466967_0020980 3300045976 Bacteria 5293
581 Ga0466967_0051580 3300045976 Bacteria 3606
582 Ga0466967_0090564 3300045976 Bacteria 2779
583 Ga0466967_0124968 3300045976 Bacteria 2382
584 Ga0466967_0126909 3300045976 Bacteria 2364
585 Ga0466967_0294427 3300045976 Bacteria 1560
586 Ga0466967_1926534 3300045976 Bacteria 588
587 Ga0495592_0000111 3300046454 Bacteria 71400
588 Ga0495592_0144718 3300046454 Bacteria 1649
589 Ga0495592_0351801 3300046454 Bacteria 944
590 Ga0495603_0365842 3300046455 Bacteria 827
591 Ga0495629_0009858 3300046459 Bacteria 6972
592 Ga0495629_0011492 3300046459 Bacteria 6431
593 Ga0495629_0461698 3300046459 Bacteria 859
594 Ga0495641_0036119 3300046461 Bacteria 2324
595 Ga0495641_0343409 3300046461 Bacteria 674
596 Ga0495651_0000068 3300046462 Bacteria 76489
597 Ga0495651_0008120 3300046462 Bacteria 8047
598 Ga0495651_0028073 3300046462 Bacteria 4386
599 Ga0495651_0056235 3300046462 Bacteria 3023
600 Ga0495653_0006022 3300046463 Bacteria 9934
601 Ga0495653_0259887 3300046463 Bacteria 1148
602 Ga0495653_0682139 3300046463 Bacteria 625
603 Ga0495580_0490807 3300046472 Bacteria 820
604 Ga0495582_0125596 3300046473 Bacteria 1447
605 Ga0495639_0363735 3300046475 Bacteria 727
606 Ga0495662_0178557 3300046476 Bacteria 1046
607 Ga0495662_0244597 3300046476 Bacteria 884
608 Ga0495664_0006291 3300046477 Bacteria 6555
609 Ga0495664_0036186 3300046477 Bacteria 2909
610 Ga0495664_0378524 3300046477 Bacteria 851
611 Ga0495594_0317364 3300046499 Bacteria 888
612 Ga0495608_0000160 3300046511 Bacteria 48626
613 Ga0495608_0005659 3300046511 Bacteria 8919
614 Ga0495608_0014575 3300046511 Bacteria 5454
615 Ga0495608_0037195 3300046511 Bacteria 3274
616 Ga0495608_0076266 3300046511 Bacteria 2184
617 Ga0495618_0035874 3300046514 Bacteria 3112
618 Ga0495618_0109181 3300046514 Bacteria 1771
619 Ga0495628_0001952 3300046516 Bacteria 18703
620 Ga0495628_0051285 3300046516 Bacteria 3262
621 Ga0495628_0119344 3300046516 Bacteria 2024
622 Ga0495628_0224652 3300046516 Bacteria 1409
623 Ga0495628_0546007 3300046516 Bacteria 832
624 Ga0495630_0073467 3300046517 Bacteria 2575
625 Ga0495630_0271984 3300046517 Bacteria 1294
626 Ga0495630_0336367 3300046517 Bacteria 1155
627 Ga0495666_0043595 3300046526 Bacteria 2167
628 Ga0495666_0315880 3300046526 Bacteria 705
629 Ga0495652_0000440 3300046529 Bacteria 48629
630 Ga0495652_0006040 3300046529 Bacteria 11325
631 Ga0495652_0007093 3300046529 Bacteria 10344
632 Ga0495652_0119915 3300046529 Bacteria 2100
633 Ga0495652_0305175 3300046529 Bacteria 1155
634 Ga0495665_0011687 3300046531 Bacteria 4757
635 Ga0495640_0025998 3300046533 Bacteria 4238
636 Ga0495640_0074262 3300046533 Bacteria 2274
637 Ga0495640_0188589 3300046533 Bacteria 1311
638 Ga0495587_0000056 3300046536 Bacteria 96726
639 Ga0495587_0020297 3300046536 Bacteria 4102
640 Ga0495587_0028292 3300046536 Bacteria 3409
641 Ga0495587_0041551 3300046536 Bacteria 2743
642 Ga0495645_0043469 3300046543 Bacteria 3277
643 Ga0495645_0108658 3300046543 Bacteria 1964
644 Ga0495667_0000078 3300046559 Bacteria 71356
645 Ga0495667_0008381 3300046559 Bacteria 7011
646 Ga0495667_0016093 3300046559 Bacteria 5055
647 Ga0495667_0057070 3300046559 Bacteria 2567
648 Ga0495667_0060306 3300046559 Bacteria 2488
649 Ga0495625_0481392 3300046660 Bacteria 762
650 Ga0495635_0037440 3300046663 Bacteria 3358
651 Ga0495635_0040265 3300046663 Bacteria 3229
652 Ga0495635_0091804 3300046663 Bacteria 2076
653 Ga0495635_0364193 3300046663 Bacteria 963
654 Ga0495657_0000444 3300046675 Bacteria 38608
655 Ga0495657_0016199 3300046675 Bacteria 5435
656 Ga0495657_0018538 3300046675 Bacteria 5031
657 Ga0495599_0000625 3300046678 Bacteria 20013
658 Ga0495599_0016217 3300046678 Bacteria 4624
659 Ga0495599_0041303 3300046678 Bacteria 2897
660 Ga0495623_0000209 3300046679 Bacteria 37387
661 Ga0495623_0055275 3300046679 Bacteria 2503
662 Ga0495646_0015181 3300046680 Bacteria 4892
663 Ga0495646_0066101 3300046680 Bacteria 2139
664 Ga0495646_0091405 3300046680 Bacteria 1756
665 Ga0495646_0118110 3300046680 Bacteria 1503
666 Ga0495658_0027682 3300046683 Bacteria 3053
667 Ga0495613_0140514 3300046689 Bacteria 1725
668 Ga0495624_0031289 3300046690 Bacteria 3461
669 Ga0495600_0171064 3300046809 Bacteria 1402
670 Ga0495581_0010214 3300047315 Bacteria 5431
671 Ga0495604_0000105 3300047317 Bacteria 71375
672 Ga0495604_0015336 3300047317 Bacteria 6115
673 Ga0495604_0024226 3300047317 Bacteria 4843
674 Ga0495604_0077661 3300047317 Bacteria 2495
675 Ga0495604_1013031 3300047317 Bacteria 513
676 Ga0495674_0069525 3300047319 Bacteria 3044
677 Ga0495674_0080143 3300047319 Bacteria 2802
678 Ga0495674_0121775 3300047319 Bacteria 2203
679 Ga0495680_0000115 3300047322 Bacteria 76480
680 Ga0495680_0007061 3300047322 Bacteria 10350
681 Ga0495680_0017293 3300047322 Bacteria 6162
682 Ga0495680_0215801 3300047322 Bacteria 1371
683 Ga0495680_0248673 3300047322 Bacteria 1261
684 Ga0495675_0000962 3300047444 Bacteria 17511
685 Ga0495675_0009775 3300047444 Bacteria 5982
686 Ga0495675_0032186 3300047444 Bacteria 3346
687 Ga0495684_0037245 3300047471 Bacteria 3730
688 Ga0495684_0201596 3300047471 Bacteria 1466
689 Ga0495593_0040335 3300047673 Bacteria 2513
690 Ga0495593_0083721 3300047673 Bacteria 1647
691 Ga0495593_0145291 3300047673 Bacteria 1200
692 Ga0495602_0000114 3300048088 Bacteria 76491
693 Ga0495602_0023251 3300048088 Bacteria 6044
694 Ga0496100_0050680 3300048903 Bacteria 2691
695 Ga0496100_0636961 3300048903 Bacteria 829
696 Ga0496101_0035974 3300048904 Bacteria 3505
697 Ga0496101_0178834 3300048904 Bacteria 1633
698 Ga0496101_1148206 3300048904 Bacteria 609
699 Ga0496102_0000144 3300048905 Bacteria 96509
700 Ga0496102_0019635 3300048905 Bacteria 5954
701 Ga0496102_0070174 3300048905 Bacteria 3217
702 Ga0496102_0149607 3300048905 Bacteria 2193
703 Ga0496103_0000109 3300048906 Bacteria 90550
704 Ga0496104_0000401 3300048907 Bacteria 37983
705 Ga0496104_0021286 3300048907 Bacteria 5951
706 Ga0496104_0124449 3300048907 Bacteria 2475
707 Ga0496104_0277620 3300048907 Bacteria 1588
708 Ga0496104_0414646 3300048907 Bacteria 1259
709 Ga0496104_0758718 3300048907 Bacteria 877
710 Ga0496105_0040230 3300048908 Bacteria 3853
711 Ga0496105_0043102 3300048908 Bacteria 3722
712 Ga0496105_0211368 3300048908 Bacteria 1581
713 Ga0496106_0041444 3300048909 Bacteria 3450
714 Ga0496106_0082843 3300048909 Bacteria 2466
715 Ga0496106_0637560 3300048909 Bacteria 852
716 Ga0496107_0111512 3300048910 Bacteria 2010
717 Ga0496108_0004478 3300048911 Bacteria 11249
718 Ga0496108_0011840 3300048911 Bacteria 7097
719 Ga0496108_0313451 3300048911 Bacteria 1367
720 Ga0496110_0008191 3300048913 Bacteria 8400
721 Ga0496110_0186184 3300048913 Bacteria 1885
722 Ga0496111_0001523 3300048914 Bacteria 13301
723 Ga0496111_0085172 3300048914 Bacteria 2311
724 Ga0496111_0830020 3300048914 Bacteria 668
725 Ga0496112_0006557 3300048915 Bacteria 10243
726 Ga0496112_0023068 3300048915 Bacteria 5939
727 Ga0496112_0035669 3300048915 Bacteria 4847
728 Ga0496112_0076015 3300048915 Bacteria 3321
729 Ga0496112_0119358 3300048915 Bacteria 2607
730 Ga0496112_0164085 3300048915 Bacteria 2187
731 Ga0496112_0514026 3300048915 Bacteria 1132
732 Ga0496113_0003731 3300048916 Bacteria 9184
733 Ga0496113_0035198 3300048916 Bacteria 3661
734 Ga0496113_0124132 3300048916 Bacteria 2021
735 Ga0496113_0141023 3300048916 Bacteria 1896
736 Ga0496113_0291762 3300048916 Bacteria 1305
737 Ga0496113_0497512 3300048916 Bacteria 979
738 Ga0496113_0662143 3300048916 Bacteria 834
739 Ga0496114_0024846 3300048917 Bacteria 4891
740 Ga0496114_0094110 3300048917 Bacteria 2548
741 Ga0496114_0149572 3300048917 Bacteria 2025
742 Ga0496114_0369150 3300048917 Unclassified 1270
743 Ga0496114_1540627 3300048917 Bacteria 553
744 Ga0496115_0051555 3300048918 Bacteria 3299
745 Ga0496115_0124166 3300048918 Bacteria 2126
746 Ga0496115_0134687 3300048918 Bacteria 2037
747 Ga0496115_0155943 3300048918 Bacteria 1886
748 Ga0496115_0174837 3300048918 Bacteria 1775
749 Ga0496116_0000128 3300048919 Bacteria 158700
750 Ga0496117_0000034 3300048920 Bacteria 328334
751 Ga0496117_0000356 3300048920 Bacteria 80485
752 Ga0496117_0006770 3300048920 Bacteria 11440
753 Ga0496118_0000631 3300048921 Bacteria 57803
754 Ga0496119_0007264 3300048922 Bacteria 10021
755 Ga0496120_0002945 3300048923 Bacteria 16222
756 Ga0496122_0076243 3300048925 Bacteria 2360
757 Ga0496123_0088431 3300048926 Bacteria 1850
758 Ga0496124_0049763 3300048927 Bacteria 3573
759 Ga0496125_0023870 3300048928 Bacteria 5634
760 Ga0496126_0000379 3300048929 Bacteria 92123
761 Ga0496126_0000772 3300048929 Bacteria 57832
762 Ga0501310_000323 3300049130 Bacteria 4369
763 Ga0501034_0611195 3300049571 Bacteria 995
764 Ga0501040_0167717 3300049576 Bacteria 1554
765 Ga0501042_0047380 3300049578 Bacteria 3065
766 Ga0501074_0202457 3300049590 Bacteria 1415
767 Ga0501075_0592049 3300049591 Bacteria 846
768 Ga0501077_0286336 3300049593 Bacteria 1049
769 Ga0501079_0532430 3300049741 Bacteria 924
770 Ga0501081_0074720 3300049743 Bacteria 2365
771 Ga0501044_0579362 3300049823 Bacteria 1017
772 nmdc:mga03683_250625_c1 3300050489 Bacteria 822
773 nmdc:mga00v17_254089_c1 3300050491 Bacteria 1140
774 nmdc:mga0yw44_231449_c1 3300050492 Bacteria 1227
775 nmdc:mga06z11_20923_c1 3300050494 Bacteria 3031
776 nmdc:mga07m45_163378_c1 3300050496 Bacteria 1293
777 nmdc:mga05p37_146143_c1 3300050507 Bacteria 2895
778 nmdc:mga05p37_330264_c1 3300050507 Bacteria 1801
779 nmdc:mga05p37_421744_c1 3300050507 Bacteria 1552
780 nmdc:mga05p37_612356_c1 3300050507 Bacteria 1227
781 nmdc:mga05p37_61_c1 3300050507 Bacteria 94943
782 nmdc:mga05p37_945076_c1 3300050507 Bacteria 923
783 nmdc:mga09592_173256_c1 3300050508 Bacteria 1866
784 nmdc:mga09592_17_c1 3300050508 Bacteria 95560
785 nmdc:mga09592_193090_c1 3300050508 Bacteria 1762
786 nmdc:mga09592_202018_c1 3300050508 Bacteria 1721
787 nmdc:mga0qj67_251_c1 3300050509 Bacteria 36682
788 nmdc:mga0qj67_32_c1 3300050509 Bacteria 98555
789 nmdc:mga06r32_26_c1 3300050510 Bacteria 90558
790 nmdc:mga06r32_309247_c1 3300050510 Bacteria 1566
791 nmdc:mga06r32_357223_c1 3300050510 Bacteria 1445
792 nmdc:mga06r32_36371_c1 3300050510 Bacteria 4651
793 nmdc:mga08y16_11871_c1 3300050511 Bacteria 9152
794 nmdc:mga08y16_599300_c1 3300050511 Bacteria 1111
795 nmdc:mga08y16_938130_c1 3300050511 Bacteria 849
796 nmdc:mga0n895_119064_c1 3300050512 Bacteria 2662
797 nmdc:mga0n895_482230_c1 3300050512 Bacteria 1250
798 nmdc:mga0n895_5449_c1 3300050512 Bacteria 10639
799 nmdc:mga0rr50_101408_c1 3300050513 Bacteria 2263
800 nmdc:mga0rr50_121734_c1 3300050513 Bacteria 2078
801 nmdc:mga0rr50_4411_c1 3300050513 Bacteria 8271
802 nmdc:mga08x19_127119_c1 3300050514 Bacteria 1712
803 nmdc:mga08x19_14540_c1 3300050514 Bacteria 4774
804 nmdc:mga08x19_26800_c1 3300050514 Bacteria 3599
805 nmdc:mga0a205_104928_c1 3300050515 Bacteria 2725
806 nmdc:mga0a205_18307_c1 3300050515 Bacteria 6584
807 nmdc:mga0sz30_422088_c1 3300050516 Bacteria 598
808 Ga0495601_0202590 3300053077 Bacteria 1296
809 Ga0495595_0000926 3300053084 Bacteria 11317
810 Ga0495595_0055755 3300053084 Bacteria 1840
811 Ga0495595_0150537 3300053084 Bacteria 1145
812 Ga0495619_0023221 3300053085 Bacteria 3975
813 Ga0495619_0169957 3300053085 Bacteria 1507
814 Ga0500559_0002209 3300053136 Bacteria 10282
815 Ga0500559_0013186 3300053136 Bacteria 3501
816 Ga0500577_0001516 3300053142 Bacteria 5919
817 Ga0500616_0000269 3300053153 Bacteria 77807
818 Ga0500637_0212150 3300053178 Bacteria 1098
819 Ga0500645_003326 3300053730 Bacteria 6599
820 Ga0501084_0255272 3300054114 Bacteria 1480
821 Ga0466962_0006353 3300061719 Bacteria 5674
822 Ga0466962_0013272 3300061719 Bacteria 3962
823 Ga0466962_0177033 3300061719 Bacteria 1039
824 2795781257 2795385470 Bacteria 8317180
825 2559428537 2558860280 Bacteria 11429938
826 2583148814 2582580736 Bacteria 5325865
827 2586064763 2585427649 Bacteria 9053857
828 2643996672 2643221597 Bacteria 3347721
829 2676475006 2675903058 Bacteria 6822861
830 2753069749 2751185734 Bacteria 8863695
831 2776377725 2775506925 Bacteria 7237746
832 2791913881 2791354901 Bacteria 8322202
833 2795791853 2795385472 Bacteria 6627535
834 2809586002 2808606522 Bacteria 9488490
835 2821271037 2821268502 Bacteria 3750023
836 2827630825 2827628540 Bacteria 6858585
837 2832005296 2832004796 Bacteria 6538017
838 2833712056 2833709550 Bacteria 4008291
839 2844842158 2844841374 Bacteria 3917147
840 2862509783 2862507626 Bacteria 9425308
841 2863070140 2863067949 Bacteria 8541735
842 2866068977 2866065130 Bacteria 6518152
843 2866555750 2866552031 Bacteria 5824618
844 2866617309 2866612099 Bacteria 7543886
845 2867318933 2867312974 Bacteria 7058875
846 2867323917 2867319477 Bacteria 7069771
847 2870727738 2870721527 Bacteria 9689237
848 2891331679 2891326441 Bacteria 6439512
849 2899361202 2899359706 Bacteria 10940472
850 2899373690 2899370129 Bacteria 6781179
851 2915359419 2915358134 Bacteria 6050864
852 2915773095 2915768154 Bacteria 8424322
853 2917745358 2917736166 Bacteria 9690793
854 2919057804 2919055335 Bacteria 3875751
855 2919524205 2919523602 Bacteria 3788128
856 2928156185 2928153084 Bacteria 4020257
857 3006394603 3006393351 Bacteria 6615579
858 8003320899 8003314358 Bacteria 10575343
859 8003860141 8003856774 Bacteria 7675274
860 8047718493 8047710418 Bacteria 11023148
861 8054475565 8054472261 Bacteria 7464355
862 8056211027 8056207758 Bacteria 8639239
863 JGI24735J21928_10003386
864 JGI25406J46586_10002808
865 rootH1_10163609
866 Ga0006562J51391_1047355
867 Ga0006562J51391_1047356
868 JGI25405J52794_10016996
869 Ga0070658_10033585
870 Ga0070658_10400331
871 Ga0070658_10566819
872 Ga0070683_100265627
873 Ga0070683_100765296
874 Ga0070690_100214758
875 Ga0070670_100008432
876 Ga0070670_101257718
877 Ga0068869_100004366
878 Ga0068869_100037117
879 Ga0070680_100001022
880 Ga0070680_100023433
881 Ga0070680_100078505
882 Ga0070680_100321637
883 Ga0070682_100039292
884 Ga0070682_100520951
885 Ga0068868_100067604
886 Ga0068868_100116848
887 Ga0068868_100318784
888 Ga0068868_100741172
889 Ga0070660_100234868
890 Ga0070660_100311149
891 Ga0070660_100344594
892 Ga0070689_100042620
893 Ga0070687_100098834
894 Ga0070661_100044086
895 Ga0070692_10063267
896 Ga0070668_100119510
897 Ga0070668_100153867
898 Ga0070668_100241165
899 Ga0070669_100301847
900 Ga0070675_100004898
901 Ga0070675_100040523
902 Ga0070671_100000788
903 Ga0070671_100027321
904 Ga0070671_100464712
905 Ga0070674_100095515
906 Ga0070688_100056016
907 Ga0070659_100058286
908 Ga0070659_100268360
909 Ga0070667_100005829
910 Ga0070667_100076075
911 Ga0070667_100332012
912 Ga0070709_10006691
913 Ga0070709_10141383
914 Ga0070709_10259301
915 Ga0070709_10547332
916 Ga0070714_100012058
917 Ga0070714_100058285
918 Ga0070714_100319134
919 Ga0070714_100559150
920 Ga0070713_100001594
921 Ga0070713_100497324
922 Ga0070713_100677714
923 Ga0070710_10000158
924 Ga0070710_10029894
925 Ga0070710_10292154
926 Ga0070711_100004649
927 Ga0070711_100440873
928 Ga0070700_100163203
929 Ga0070700_100769095
930 Ga0070708_100138617
931 Ga0070708_100502169
932 Ga0070663_100000894
933 Ga0070663_100036261
934 Ga0070663_100037750
935 Ga0070662_100134846
936 Ga0070681_10000077
937 Ga0070681_10010387
938 Ga0070681_10753888
939 Ga0070685_10048131
940 Ga0070685_10202488
941 Ga0070706_100002832
942 Ga0070706_100018428
943 Ga0070706_100105633
944 Ga0070706_100176641
945 Ga0070706_100330254
946 Ga0070706_100820602
947 Ga0070707_100001616
948 Ga0070707_100005349
949 Ga0070707_100016947
950 Ga0070707_100050761
951 Ga0070707_100130225
952 Ga0070698_100003363
953 Ga0070698_100194581
954 Ga0070699_100523896
955 Ga0070679_100000135
956 Ga0070679_100030963
957 Ga0070684_100503425
958 Ga0070684_100635194
959 Ga0070684_100675410
960 Ga0068853_100052520
961 Ga0068853_100797608
962 Ga0070672_100070075
963 Ga0070686_100491859
964 Ga0070693_100013519
965 Ga0070665_100001822
966 Ga0070665_100016770
967 Ga0070665_100040243
968 Ga0070665_100082987
969 Ga0070665_100925952
970 Ga0070704_100424603
971 Ga0068855_100087663
972 Ga0070664_100046271
973 Ga0068857_100025063
974 Ga0068857_100142564
975 Ga0068856_100029765
976 Ga0068856_100037302
977 Ga0068856_100109464
978 Ga0070702_100000249
979 Ga0068852_100033570
980 Ga0068852_100038284
981 Ga0068859_100100847
982 Ga0068864_100104390
983 Ga0068864_100261981
984 Ga0068864_100346725
985 Ga0068870_10000485
986 Ga0068870_10061606
987 Ga0068863_100000825
988 Ga0068863_100002727
989 Ga0068863_100006552
990 Ga0068863_100113603
991 Ga0068863_100323707
992 Ga0068863_100663579
993 Ga0068863_101087344
994 Ga0068858_100039022
995 Ga0068858_100219548
996 Ga0068860_100000067
997 Ga0068860_100046376
998 Ga0068860_100110967
999 Ga0068862_100016456
1000 Ga0081455_10000692
1001 Ga0081455_10008638
1002 Ga0081538_10000016
1003 Ga0081540_1073793
1004 Ga0081539_10000401
1005 Ga0070717_10036632
1006 Ga0070717_10091250
1007 Ga0070717_10096071
1008 Ga0070717_10106141
1009 Ga0070717_10771629
1010 Ga0070717_10885321
1011 Ga0075365_10088197
1012 Ga0075368_10287904
1013 Ga0075364_10031406
1014 Ga0070715_10008053
1015 Ga0070716_100014341
1016 Ga0070716_100134791
1017 Ga0070712_100143777
1018 Ga0070712_100542480
1019 Ga0075367_10002964
1020 Ga0097621_100079102
1021 Ga0075370_10142347
1022 Ga0075428_100005695
1023 Ga0075428_100107508
1024 Ga0075428_100114469
1025 Ga0075428_100842658
1026 Ga0075430_100002967
1027 Ga0075430_100012455
1028 Ga0075430_100021018
1029 Ga0075430_100194709
1030 Ga0075431_100014674
1031 Ga0075431_100040656
1032 Ga0075431_100113732
1033 Ga0075431_100182363
1034 Ga0075431_100562800
1035 Ga0075433_10016144
1036 Ga0075433_10085559
1037 Ga0075434_100000965
1038 Ga0075434_100011948
1039 Ga0075434_100113850
1040 Ga0075429_100007259
1041 Ga0075429_100012278
1042 Ga0075429_100057852
1043 Ga0075429_100092771
1044 Ga0075429_101037636
1045 Ga0068865_100065162
1046 Ga0068865_100324869
1047 Ga0075436_100000682
1048 Ga0075436_100060296
1049 Ga0097620_100100847
1050 Ga0075435_100007979
1051 Ga0075435_100449943
1052 Ga0075435_100636079
1053 Ga0099794_10104014
1054 Ga0105250_10067032
1055 Ga0105240_10058886
1056 Ga0105240_10358895
1057 Ga0111539_10296595
1058 Ga0105245_10001147
1059 Ga0105245_10016486
1060 Ga0105247_10599976
1061 Ga0114129_10000557
1062 Ga0114129_10058757
1063 Ga0114129_10161046
1064 Ga0114129_10184086
1065 Ga0114129_10915361
1066 Ga0105243_10233384
1067 Ga0105243_11297091
1068 Ga0105241_10004400
1069 Ga0105241_10118932
1070 Ga0105241_10297368
1071 Ga0105248_10010638
1072 Ga0105248_10053245
1073 Ga0105237_10078667
1074 Ga0105237_10129074
1075 Ga0105238_10009854
1076 Ga0105238_10085457
1077 Ga0105238_10272592
1078 Ga0105238_10385716
1079 Ga0105249_10368751
1080 Ga0105249_10394849
1081 Ga0105249_11343836
1082 Ga0105033_104027
1083 Ga0105239_10120671
1084 Ga0105239_10410737
1085 Ga0105246_10000043
1086 Ga0105246_10745099
1087 Ga0157317_1003027
1088 Ga0157373_10055589
1089 Ga0157371_10534289
1090 Ga0157370_10011499
1091 Ga0157370_10098631
1092 Ga0157370_10147401
1093 Ga0157369_10295797
1094 Ga0157369_11219879
1095 Ga0157369_11311859
1096 Ga0157369_11506491
1097 Ga0157374_11065189
1098 Ga0157372_10000043
1099 Ga0157372_10111537
1100 Ga0157372_11076395
1101 Ga0157375_10226622
1102 Ga0163163_10005228
1103 Ga0163163_10307621
1104 Ga0163163_10594637
1105 Ga0163163_10786935
1106 Ga0163163_11435954
1107 Ga0163163_11477646
1108 Ga0157377_10034027
1109 Ga0157377_10310550
1110 Ga0157379_10025353
1111 Ga0157379_10032051
1112 Ga0157379_10203740
1113 Ga0157376_10011635
1114 Ga0157376_10164065
1115 Ga0206356_10781422
1116 Ga0206356_11371595
1117 Ga0206351_10984482
1118 Ga0206353_11838987
1119 Ga0206353_11915281
1120 Ga0206353_12028661
1121 Ga0213875_10001574
1122 Ga0209677_100375
1123 Ga0207692_10001172
1124 Ga0207692_10002461
1125 Ga0207692_10048263
1126 Ga0207710_10103916
1127 Ga0207688_10000704
1128 Ga0207680_10019495
1129 Ga0207685_10077039
1130 Ga0207699_10003198
1131 Ga0207699_10032994
1132 Ga0207699_10049509
1133 Ga0207699_10066106
1134 Ga0207699_10149393
1135 Ga0207699_10300012
1136 Ga0207643_10000255
1137 Ga0207643_10061711
1138 Ga0207705_10025237
1139 Ga0207705_10170195
1140 Ga0207705_10213785
1141 Ga0207705_10578852
1142 Ga0207684_10010471
1143 Ga0207684_10015809
1144 Ga0207684_10213547
1145 Ga0207684_10310661
1146 Ga0207684_10863730
1147 Ga0207654_10018194
1148 Ga0207707_10000089
1149 Ga0207707_10054688
1150 Ga0207695_10061148
1151 Ga0207671_10164128
1152 Ga0207693_10019042
1153 Ga0207693_10150444
1154 Ga0207693_10206818
1155 Ga0207693_10473026
1156 Ga0207663_10073799
1157 Ga0207663_10075252
1158 Ga0207660_10001907
1159 Ga0207660_10002528
1160 Ga0207660_10267695
1161 Ga0207662_10122244
1162 Ga0207657_10017121
1163 Ga0207649_10007713
1164 Ga0207652_10000015
1165 Ga0207652_10015476
1166 Ga0207646_10000731
1167 Ga0207646_10009013
1168 Ga0207646_10048380
1169 Ga0207646_10116996
1170 Ga0207646_10403354
1171 Ga0207646_11218803
1172 Ga0207681_10136888
1173 Ga0207694_10025217
1174 Ga0207694_10110096
1175 Ga0207650_10001380
1176 Ga0207659_10008047
1177 Ga0207659_10252210
1178 Ga0207687_10004511
1179 Ga0207687_10250138
1180 Ga0207700_10035538
1181 Ga0207700_10154973
1182 Ga0207700_10196572
1183 Ga0207700_10402338
1184 Ga0207700_10688340
1185 Ga0207664_10009298
1186 Ga0207664_10023058
1187 Ga0207664_10049093
1188 Ga0207664_10049924
1189 Ga0207664_10049971
1190 Ga0207644_10000647
1191 Ga0207644_10019645
1192 Ga0207690_10018313
1193 Ga0207690_10384941
1194 Ga0207706_10061473
1195 Ga0207706_10200245
1196 Ga0207709_10281390
1197 Ga0207670_10176633
1198 Ga0207669_10075981
1199 Ga0207704_10066480
1200 Ga0207665_10029654
1201 Ga0207691_10025726
1202 Ga0207711_10827028
1203 Ga0207689_10003676
1204 Ga0207689_10099783
1205 Ga0207661_10041234
1206 Ga0207661_10098684
1207 Ga0207661_10126896
1208 Ga0207661_10146991
1209 Ga0207661_10233247
1210 Ga0207661_10591621
1211 Ga0207679_10001781
1212 Ga0207679_10140684
1213 Ga0207667_10029004
1214 Ga0207667_10117863
1215 Ga0207651_10022933
1216 Ga0207668_10022464
1217 Ga0207668_10108700
1218 Ga0207668_10199949
1219 Ga0207640_10078681
1220 Ga0207658_10002268
1221 Ga0207658_10060272
1222 Ga0207677_10044300
1223 Ga0207677_10074779
1224 Ga0207703_10035233
1225 Ga0207703_10035764
1226 Ga0207639_10926897
1227 Ga0207678_10000120
1228 Ga0207678_10000346
1229 Ga0207678_10054836
1230 Ga0207708_10372890
1231 Ga0207702_10001514
1232 Ga0207702_10041795
1233 Ga0207702_10073412
1234 Ga0207702_10085630
1235 Ga0207702_10147451
1236 Ga0207702_10459294
1237 Ga0207641_10003465
1238 Ga0207641_10005835
1239 Ga0207641_10020496
1240 Ga0207641_10081134
1241 Ga0207641_10082921
1242 Ga0207641_10380490
1243 Ga0207676_10000914
1244 Ga0207676_10407544
1245 Ga0207676_10642923
1246 Ga0207676_10743268
1247 Ga0207674_10020943
1248 Ga0207674_10090197
1249 Ga0207674_10346953
1250 Ga0207675_100020646
1251 Ga0207683_10001990
1252 Ga0207683_10335841
1253 Ga0207698_10003656
1254 Ga0207698_10236724
1255 Ga0207428_10001605
1256 Ga0268266_10004303
1257 Ga0268266_10015983
1258 Ga0268266_10057047
1259 Ga0268266_10083185
1260 Ga0268264_10000114
1261 Ga0268264_10044861
1262 Ga0307515_10142969
1263 Ga0307515_10238616
1264 Ga0307511_10001747
1265 Ga0307512_10079030
1266 Ga0314311_1200767
1267 Ga0316180_1017775
1268 Ga0307513_10034844
1269 Ga0307509_10056168
1270 Ga0307509_10261811
1271 Ga0307408_100132511
1272 Ga0307508_10011315
1273 Ga0316575_10037052
1274 Ga0307405_10042305
1275 Ga0307405_10986081
1276 Ga0307413_10049467
1277 Ga0307518_10000517
1278 Ga0307410_10057630
1279 Ga0307410_10870975
1280 Ga0307406_10027269
1281 Ga0307406_10365759
1282 Ga0307407_10012377
1283 Ga0307412_10059506
1284 Ga0307412_10586734
1285 Ga0307409_100000307
1286 Ga0307409_100069674
1287 Ga0307409_100095284
1288 Ga0307416_100001292
1289 Ga0307416_100242948
1290 Ga0307416_100515423
1291 Ga0307416_102139783
1292 Ga0307411_10140942
1293 Ga0307411_10150169
1294 Ga0307415_100000008
1295 Ga0307415_100027555
1296 Ga0307415_100028203
1297 Ga0316585_10084182
1298 Ga0373930_0007860
1299 Ga0373958_0063072
1300 Ga0373959_0047484
1301 Ga0373938_0046063
1302 Ga0373928_0037626
1303 Ga0373934_0000049
1304 Ga0373934_0006516
1305 Ga0373944_0046946
1306 Ga0373949_0040472
1307 Ga0373951_0010768
1308 Ga0373923_0010142
1309 Ga0373923_0032238
1310 Ga0373936_0119956
1311 Ga0373939_0007613
1312 Ga0373941_0041616
1313 Ga0373945_0043214
1314 Ga0373953_0000077
1315 Ga0373954_0016600
1316 Ga0373954_0088020
1317 Ga0373954_0130781
1318 Ga0373956_0000086
1319 Ga0373956_0026508
1320 Ga0373956_0053578
1321 Ga0373956_0065695
1322 Ga0373957_0000167
1323 Ga0373957_0014145
1324 Ga0373960_0113817
1325 Ga0373943_0072646
1326 Ga0373943_0213120
1327 Ga0373946_0130329
1328 Ga0373955_0000252
1329 Ga0373955_0005539
1330 Ga0373955_0018911
1331 Ga0373942_0066185
1332 Ga0373962_0006236
1333 Ga0373924_0002022
1334 Ga0373924_0063603
1335 Ga0373931_0105780
1336 Ga0373931_0125620
1337 Ga0373927_0477916
1338 Ga0373933_0000051
1339 Ga0373933_0007530
1340 Ga0373933_0013021
1341 Ga0373933_0039454
1342 Ga0373947_0017493
1343 Ga0373947_0669888
1344 Ga0373937_0000289
1345 Ga0373937_0040374
1346 Ga0373937_0065355
1347 Ga0373937_0252813
1348 Ga0373925_1039755
1349 Ga0395899_0006426
1350 Ga0395900_0091467
1351 Ga0395900_0098140
1352 Ga0395898_0226597
1353 Ga0395898_0973423
1354 Ga0436364_0580980
1355 Ga0436364_1139642
1356 Ga0395901_0205522
1357 Ga0395901_0260051
1358 Ga0395901_1424094
1359 Ga0436365_1884406
1360 Ga0436362_1009491
1361 Ga0439465_0003486
1362 Ga0451795_0390901
1363 Ga0451833_1468397
1364 Ga0451853_0401476
1365 Ga0439448_0033838
1366 Ga0439449_0131494
1367 Ga0439449_0189735
1368 Ga0439463_002459
1369 Ga0450900_024085
1370 Ga0450902_036331
1371 Ga0439458_0003635
1372 Ga0439459_0003127
1373 Ga0466969_0004684
1374 Ga0466972_0009347
1375 Ga0466972_0009858
1376 Ga0466972_0030426
1377 Ga0466972_0265932
1378 Ga0466965_0000884
1379 Ga0466965_0001772
1380 Ga0466965_0052304
1381 Ga0466965_0366892
1382 Ga0466966_0001055
1383 Ga0466966_0141958
1384 Ga0466966_0148139
1385 Ga0466966_0154428
1386 Ga0466966_0221615
1387 Ga0466961_0013186
1388 Ga0466961_0018939
1389 Ga0466961_0024716
1390 Ga0466961_0042768
1391 Ga0466961_0046415
1392 Ga0466961_0057207
1393 Ga0466961_0182478
1394 Ga0466963_0003782
1395 Ga0466963_0009176
1396 Ga0466963_0128484
1397 Ga0466963_0149388
1398 Ga0466963_0240440
1399 Ga0466963_0272816
1400 Ga0466964_0312671
1401 Ga0466964_0323366
1402 Ga0466971_0003749
1403 Ga0466971_0044272
1404 Ga0466971_0078749
1405 Ga0466971_0153913
1406 Ga0466968_0073794
1407 Ga0466968_0086864
1408 Ga0466968_0156784
1409 Ga0466970_0001375
1410 Ga0466970_0006135
1411 Ga0466970_0049465
1412 Ga0466970_0097043
1413 Ga0466970_0170974
1414 Ga0466970_0181219
1415 Ga0466970_0212236
1416 Ga0466970_0251857
1417 Ga0466957_0012389
1418 Ga0466957_0025827
1419 Ga0466957_0036271
1420 Ga0466957_0070187
1421 Ga0466957_0129670
1422 Ga0466957_0257477
1423 Ga0466960_0005629
1424 Ga0466960_0007203
1425 Ga0466960_0023038
1426 Ga0466960_0042396
1427 Ga0466960_0058805
1428 Ga0466960_0073691
1429 Ga0466960_0229956
1430 Ga0466959_0038275
1431 Ga0466959_0073752
1432 Ga0466959_0088762
1433 Ga0466959_0188439
1434 Ga0466959_0281505
1435 Ga0466958_0014164
1436 Ga0466958_0015139
1437 Ga0466958_0024266
1438 Ga0466958_0175807
1439 Ga0466958_0249031
1440 Ga0466967_0008682
1441 Ga0466967_0009725
1442 Ga0466967_0020980
1443 Ga0466967_0051580
1444 Ga0466967_0090564
1445 Ga0466967_0124968
1446 Ga0466967_0126909
1447 Ga0466967_0294427
1448 Ga0466967_1926534
1449 Ga0495592_0000111
1450 Ga0495592_0144718
1451 Ga0495592_0351801
1452 Ga0495603_0365842
1453 Ga0495629_0009858
1454 Ga0495629_0011492
1455 Ga0495629_0461698
1456 Ga0495641_0036119
1457 Ga0495641_0343409
1458 Ga0495651_0000068
1459 Ga0495651_0008120
1460 Ga0495651_0028073
1461 Ga0495651_0056235
1462 Ga0495653_0006022
1463 Ga0495653_0259887
1464 Ga0495653_0682139
1465 Ga0495580_0490807
1466 Ga0495582_0125596
1467 Ga0495639_0363735
1468 Ga0495662_0178557
1469 Ga0495662_0244597
1470 Ga0495664_0006291
1471 Ga0495664_0036186
1472 Ga0495664_0378524
1473 Ga0495594_0317364
1474 Ga0495608_0000160
1475 Ga0495608_0005659
1476 Ga0495608_0014575
1477 Ga0495608_0037195
1478 Ga0495608_0076266
1479 Ga0495618_0035874
1480 Ga0495618_0109181
1481 Ga0495628_0001952
1482 Ga0495628_0051285
1483 Ga0495628_0119344
1484 Ga0495628_0224652
1485 Ga0495628_0546007
1486 Ga0495630_0073467
1487 Ga0495630_0271984
1488 Ga0495630_0336367
1489 Ga0495666_0043595
1490 Ga0495666_0315880
1491 Ga0495652_0000440
1492 Ga0495652_0006040
1493 Ga0495652_0007093
1494 Ga0495652_0119915
1495 Ga0495652_0305175
1496 Ga0495665_0011687
1497 Ga0495640_0025998
1498 Ga0495640_0074262
1499 Ga0495640_0188589
1500 Ga0495587_0000056
1501 Ga0495587_0020297
1502 Ga0495587_0028292
1503 Ga0495587_0041551
1504 Ga0495645_0043469
1505 Ga0495645_0108658
1506 Ga0495667_0000078
1507 Ga0495667_0008381
1508 Ga0495667_0016093
1509 Ga0495667_0057070
1510 Ga0495667_0060306
1511 Ga0495625_0481392
1512 Ga0495635_0037440
1513 Ga0495635_0040265
1514 Ga0495635_0091804
1515 Ga0495635_0364193
1516 Ga0495657_0000444
1517 Ga0495657_0016199
1518 Ga0495657_0018538
1519 Ga0495599_0000625
1520 Ga0495599_0016217
1521 Ga0495599_0041303
1522 Ga0495623_0000209
1523 Ga0495623_0055275
1524 Ga0495646_0015181
1525 Ga0495646_0066101
1526 Ga0495646_0091405
1527 Ga0495646_0118110
1528 Ga0495658_0027682
1529 Ga0495613_0140514
1530 Ga0495624_0031289
1531 Ga0495600_0171064
1532 Ga0495581_0010214
1533 Ga0495604_0000105
1534 Ga0495604_0015336
1535 Ga0495604_0024226
1536 Ga0495604_0077661
1537 Ga0495604_1013031
1538 Ga0495674_0069525
1539 Ga0495674_0080143
1540 Ga0495674_0121775
1541 Ga0495680_0000115
1542 Ga0495680_0007061
1543 Ga0495680_0017293
1544 Ga0495680_0215801
1545 Ga0495680_0248673
1546 Ga0495675_0000962
1547 Ga0495675_0009775
1548 Ga0495675_0032186
1549 Ga0495684_0037245
1550 Ga0495684_0201596
1551 Ga0495593_0040335
1552 Ga0495593_0083721
1553 Ga0495593_0145291
1554 Ga0495602_0000114
1555 Ga0495602_0023251
1556 Ga0496100_0050680
1557 Ga0496100_0636961
1558 Ga0496101_0035974
1559 Ga0496101_0178834
1560 Ga0496101_1148206
1561 Ga0496102_0000144
1562 Ga0496102_0019635
1563 Ga0496102_0070174
1564 Ga0496102_0149607
1565 Ga0496103_0000109
1566 Ga0496104_0000401
1567 Ga0496104_0021286
1568 Ga0496104_0124449
1569 Ga0496104_0277620
1570 Ga0496104_0414646
1571 Ga0496104_0758718
1572 Ga0496105_0040230
1573 Ga0496105_0043102
1574 Ga0496105_0211368
1575 Ga0496106_0041444
1576 Ga0496106_0082843
1577 Ga0496106_0637560
1578 Ga0496107_0111512
1579 Ga0496108_0004478
1580 Ga0496108_0011840
1581 Ga0496108_0313451
1582 Ga0496110_0008191
1583 Ga0496110_0186184
1584 Ga0496111_0001523
1585 Ga0496111_0085172
1586 Ga0496111_0830020
1587 Ga0496112_0006557
1588 Ga0496112_0023068
1589 Ga0496112_0035669
1590 Ga0496112_0076015
1591 Ga0496112_0119358
1592 Ga0496112_0164085
1593 Ga0496112_0514026
1594 Ga0496113_0003731
1595 Ga0496113_0035198
1596 Ga0496113_0124132
1597 Ga0496113_0141023
1598 Ga0496113_0291762
1599 Ga0496113_0497512
1600 Ga0496113_0662143
1601 Ga0496114_0024846
1602 Ga0496114_0094110
1603 Ga0496114_0149572
1604 Ga0496114_0369150
1605 Ga0496114_1540627
1606 Ga0496115_0051555
1607 Ga0496115_0124166
1608 Ga0496115_0134687
1609 Ga0496115_0155943
1610 Ga0496115_0174837
1611 Ga0496116_0000128
1612 Ga0496117_0000034
1613 Ga0496117_0000356
1614 Ga0496117_0006770
1615 Ga0496118_0000631
1616 Ga0496119_0007264
1617 Ga0496120_0002945
1618 Ga0496122_0076243
1619 Ga0496123_0088431
1620 Ga0496124_0049763
1621 Ga0496125_0023870
1622 Ga0496126_0000379
1623 Ga0496126_0000772
1624 Ga0501310_000323
1625 Ga0501034_0611195
1626 Ga0501040_0167717
1627 Ga0501042_0047380
1628 Ga0501074_0202457
1629 Ga0501075_0592049
1630 Ga0501077_0286336
1631 Ga0501079_0532430
1632 Ga0501081_0074720
1633 Ga0501044_0579362
1634 nmdc:mga03683_250625_c1
1635 nmdc:mga00v17_254089_c1
1636 nmdc:mga0yw44_231449_c1
1637 nmdc:mga06z11_20923_c1
1638 nmdc:mga07m45_163378_c1
1639 nmdc:mga05p37_146143_c1
1640 nmdc:mga05p37_330264_c1
1641 nmdc:mga05p37_421744_c1
1642 nmdc:mga05p37_612356_c1
1643 nmdc:mga05p37_61_c1
1644 nmdc:mga05p37_945076_c1
1645 nmdc:mga09592_173256_c1
1646 nmdc:mga09592_17_c1
1647 nmdc:mga09592_193090_c1
1648 nmdc:mga09592_202018_c1
1649 nmdc:mga0qj67_251_c1
1650 nmdc:mga0qj67_32_c1
1651 nmdc:mga06r32_26_c1
1652 nmdc:mga06r32_309247_c1
1653 nmdc:mga06r32_357223_c1
1654 nmdc:mga06r32_36371_c1
1655 nmdc:mga08y16_11871_c1
1656 nmdc:mga08y16_599300_c1
1657 nmdc:mga08y16_938130_c1
1658 nmdc:mga0n895_119064_c1
1659 nmdc:mga0n895_482230_c1
1660 nmdc:mga0n895_5449_c1
1661 nmdc:mga0rr50_101408_c1
1662 nmdc:mga0rr50_121734_c1
1663 nmdc:mga0rr50_4411_c1
1664 nmdc:mga08x19_127119_c1
1665 nmdc:mga08x19_14540_c1
1666 nmdc:mga08x19_26800_c1
1667 nmdc:mga0a205_104928_c1
1668 nmdc:mga0a205_18307_c1
1669 nmdc:mga0sz30_422088_c1
1670 Ga0495601_0202590
1671 Ga0495595_0000926
1672 Ga0495595_0055755
1673 Ga0495595_0150537
1674 Ga0495619_0023221
1675 Ga0495619_0169957
1676 Ga0500559_0002209
1677 Ga0500559_0013186
1678 Ga0500577_0001516
1679 Ga0500616_0000269
1680 Ga0500637_0212150
1681 Ga0500645_003326
1682 Ga0501084_0255272
1683 Ga0466962_0006353
1684 Ga0466962_0013272
1685 Ga0466962_0177033
1686 2795781257
1687 2559428537
1688 2583148814
1689 2586064763
1690 2643996672
1691 2676475006
1692 2753069749
1693 2776377725
1694 2791913881
1695 2795791853
1696 2809586002
1697 2821271037
1698 2827630825
1699 2832005296
1700 2833712056
1701 2844842158
1702 2862509783
1703 2863070140
1704 2866068977
1705 2866555750
1706 2866617309
1707 2867318933
1708 2867323917
1709 2870727738
1710 2891331679
1711 2899361202
1712 2899373690
1713 2915359419
1714 2915773095
1715 2917745358
1716 2919057804
1717 2919524205
1718 2928156185
1719 3006394603
1720 8003320899
1721 8003860141
1722 8047718493
1723 8054475565
1724 8056211027

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

61

186

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8967 24 180
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8857 24 180
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.8591 24 181
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8526 22 182
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.8489 24 181
ID Description Score Start End Superfamily
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8833 24 180 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8724 24 180 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8585 22 176 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8508 24 181 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8407 24 181 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A538LED0-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9931 1 184 GO:0002161
AF-A0A7Z0D435-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.9908 4 180 GO:0002161
AF-A0A6P1FBU5-F1-model_v4 Uncharacterized protein 0.9885 4 182 GO:0002161
GO:0016020
GO:0030416
AF-A0A3A1TZV6-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9878 1 180 GO:0002161
AF-A0A538LED0-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9878 1 184 GO:0002161

Map