F483904
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 862 | 406 | 1724 | 178 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2795385470|2795781257 |
| Length | 201 |
| Sequence | SRRTPAPSPGEGVGVSAWTIAGSLTPMPALERPELLAEPVVAALAALPADQAARIAVAAIDPGLADTAAFCAEYGSPLEASANCVVVSGKREGQVRYAACLVLATTRADVNGVVRKRLDVRKASFAPMDTAVELSGMAYGGITPIGLPSAWPLLIDAAVAKAPELVVGSGIRGSKLLVPGDVLAALPGAEVVDDLGKPVLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 184 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 185 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 242 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 249 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 254 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 260 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 328 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 329 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 362 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 368 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 369 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 370 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 371 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 372 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 373 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 374 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 375 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 376 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 377 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 378 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 379 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 380 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 381 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 382 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 383 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 384 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 385 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 386 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 387 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 388 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 389 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 390 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 391 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 392 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 393 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 394 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 395 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 396 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 397 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 398 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 399 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 400 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 401 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 402 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 403 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 404 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 405 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 406 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.43 |
| Metatranscriptomes | 1.04 |
| Isolates | 4.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.09 |
| Nodule | 0 |
| Rhizoplane | 6.5 |
| Rhizosphere | 84.92 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10003386 | 3300002067 | Bacteria | 5441 |
| 2 | JGI25406J46586_10002808 | 3300003203 | Bacteria | 8193 |
| 3 | rootH1_10163609 | 3300003323 | Bacteria | 3001 |
| 4 | Ga0006562J51391_1047355 | 3300003578 | Bacteria | 16570 |
| 5 | Ga0006562J51391_1047356 | 3300003578 | Bacteria | 11420 |
| 6 | JGI25405J52794_10016996 | 3300003911 | Bacteria | 1441 |
| 7 | Ga0070658_10033585 | 3300005327 | Bacteria | 4128 |
| 8 | Ga0070658_10400331 | 3300005327 | Bacteria | 1179 |
| 9 | Ga0070658_10566819 | 3300005327 | Bacteria | 983 |
| 10 | Ga0070683_100265627 | 3300005329 | Bacteria | 1632 |
| 11 | Ga0070683_100765296 | 3300005329 | Bacteria | 925 |
| 12 | Ga0070690_100214758 | 3300005330 | Bacteria | 1345 |
| 13 | Ga0070670_100008432 | 3300005331 | Bacteria | 8790 |
| 14 | Ga0070670_101257718 | 3300005331 | Bacteria | 677 |
| 15 | Ga0068869_100004366 | 3300005334 | Bacteria | 8780 |
| 16 | Ga0068869_100037117 | 3300005334 | Bacteria | 3463 |
| 17 | Ga0070680_100001022 | 3300005336 | Bacteria | 19997 |
| 18 | Ga0070680_100023433 | 3300005336 | Bacteria | 4923 |
| 19 | Ga0070680_100078505 | 3300005336 | Bacteria | 2720 |
| 20 | Ga0070680_100321637 | 3300005336 | Bacteria | 1313 |
| 21 | Ga0070682_100039292 | 3300005337 | Bacteria | 2907 |
| 22 | Ga0070682_100520951 | 3300005337 | Bacteria | 925 |
| 23 | Ga0068868_100067604 | 3300005338 | Bacteria | 2844 |
| 24 | Ga0068868_100116848 | 3300005338 | Bacteria | 2172 |
| 25 | Ga0068868_100318784 | 3300005338 | Bacteria | 1324 |
| 26 | Ga0068868_100741172 | 3300005338 | Bacteria | 882 |
| 27 | Ga0070660_100234868 | 3300005339 | Bacteria | 1492 |
| 28 | Ga0070660_100311149 | 3300005339 | Bacteria | 1292 |
| 29 | Ga0070660_100344594 | 3300005339 | Bacteria | 1226 |
| 30 | Ga0070689_100042620 | 3300005340 | Bacteria | 3485 |
| 31 | Ga0070687_100098834 | 3300005343 | Bacteria | 1630 |
| 32 | Ga0070661_100044086 | 3300005344 | Bacteria | 3258 |
| 33 | Ga0070692_10063267 | 3300005345 | Bacteria | 1954 |
| 34 | Ga0070668_100119510 | 3300005347 | Bacteria | 2105 |
| 35 | Ga0070668_100153867 | 3300005347 | Bacteria | 1862 |
| 36 | Ga0070668_100241165 | 3300005347 | Bacteria | 1497 |
| 37 | Ga0070669_100301847 | 3300005353 | Bacteria | 1288 |
| 38 | Ga0070675_100004898 | 3300005354 | Bacteria | 10214 |
| 39 | Ga0070675_100040523 | 3300005354 | Bacteria | 3802 |
| 40 | Ga0070671_100000788 | 3300005355 | Bacteria | 22834 |
| 41 | Ga0070671_100027321 | 3300005355 | Bacteria | 4696 |
| 42 | Ga0070671_100464712 | 3300005355 | Bacteria | 1086 |
| 43 | Ga0070674_100095515 | 3300005356 | Bacteria | 2155 |
| 44 | Ga0070688_100056016 | 3300005365 | Bacteria | 2475 |
| 45 | Ga0070659_100058286 | 3300005366 | Bacteria | 3047 |
| 46 | Ga0070659_100268360 | 3300005366 | Bacteria | 1417 |
| 47 | Ga0070667_100005829 | 3300005367 | Bacteria | 10276 |
| 48 | Ga0070667_100076075 | 3300005367 | Bacteria | 2866 |
| 49 | Ga0070667_100332012 | 3300005367 | Bacteria | 1374 |
| 50 | Ga0070709_10006691 | 3300005434 | Bacteria | 6293 |
| 51 | Ga0070709_10141383 | 3300005434 | Bacteria | 1654 |
| 52 | Ga0070709_10259301 | 3300005434 | Bacteria | 1255 |
| 53 | Ga0070709_10547332 | 3300005434 | Bacteria | 885 |
| 54 | Ga0070714_100012058 | 3300005435 | Bacteria | 6880 |
| 55 | Ga0070714_100058285 | 3300005435 | Bacteria | 3308 |
| 56 | Ga0070714_100319134 | 3300005435 | Bacteria | 1452 |
| 57 | Ga0070714_100559150 | 3300005435 | Bacteria | 1096 |
| 58 | Ga0070713_100001594 | 3300005436 | Bacteria | 14532 |
| 59 | Ga0070713_100497324 | 3300005436 | Bacteria | 1150 |
| 60 | Ga0070713_100677714 | 3300005436 | Bacteria | 983 |
| 61 | Ga0070710_10000158 | 3300005437 | Bacteria | 31424 |
| 62 | Ga0070710_10029894 | 3300005437 | Bacteria | 2926 |
| 63 | Ga0070710_10292154 | 3300005437 | Bacteria | 1061 |
| 64 | Ga0070711_100004649 | 3300005439 | Bacteria | 8126 |
| 65 | Ga0070711_100440873 | 3300005439 | Bacteria | 1064 |
| 66 | Ga0070700_100163203 | 3300005441 | Bacteria | 1536 |
| 67 | Ga0070700_100769095 | 3300005441 | Bacteria | 772 |
| 68 | Ga0070708_100138617 | 3300005445 | Bacteria | 2255 |
| 69 | Ga0070708_100502169 | 3300005445 | Bacteria | 1144 |
| 70 | Ga0070663_100000894 | 3300005455 | Bacteria | 16203 |
| 71 | Ga0070663_100036261 | 3300005455 | Bacteria | 3426 |
| 72 | Ga0070663_100037750 | 3300005455 | Bacteria | 3365 |
| 73 | Ga0070662_100134846 | 3300005457 | Bacteria | 1908 |
| 74 | Ga0070681_10000077 | 3300005458 | Bacteria | 72675 |
| 75 | Ga0070681_10010387 | 3300005458 | Bacteria | 9195 |
| 76 | Ga0070681_10753888 | 3300005458 | Bacteria | 890 |
| 77 | Ga0070685_10048131 | 3300005466 | Bacteria | 2455 |
| 78 | Ga0070685_10202488 | 3300005466 | Bacteria | 1291 |
| 79 | Ga0070706_100002832 | 3300005467 | Bacteria | 17327 |
| 80 | Ga0070706_100018428 | 3300005467 | Bacteria | 6440 |
| 81 | Ga0070706_100105633 | 3300005467 | Bacteria | 2620 |
| 82 | Ga0070706_100176641 | 3300005467 | Bacteria | 1994 |
| 83 | Ga0070706_100330254 | 3300005467 | Bacteria | 1422 |
| 84 | Ga0070706_100820602 | 3300005467 | Bacteria | 860 |
| 85 | Ga0070707_100001616 | 3300005468 | Bacteria | 21835 |
| 86 | Ga0070707_100005349 | 3300005468 | Bacteria | 12019 |
| 87 | Ga0070707_100016947 | 3300005468 | Bacteria | 6844 |
| 88 | Ga0070707_100050761 | 3300005468 | Bacteria | 3977 |
| 89 | Ga0070707_100130225 | 3300005468 | Bacteria | 2446 |
| 90 | Ga0070698_100003363 | 3300005471 | Bacteria | 17601 |
| 91 | Ga0070698_100194581 | 3300005471 | Bacteria | 1965 |
| 92 | Ga0070699_100523896 | 3300005518 | Bacteria | 1078 |
| 93 | Ga0070679_100000135 | 3300005530 | Bacteria | 59584 |
| 94 | Ga0070679_100030963 | 3300005530 | Bacteria | 5285 |
| 95 | Ga0070684_100503425 | 3300005535 | Bacteria | 1122 |
| 96 | Ga0070684_100635194 | 3300005535 | Bacteria | 993 |
| 97 | Ga0070684_100675410 | 3300005535 | Bacteria | 962 |
| 98 | Ga0068853_100052520 | 3300005539 | Bacteria | 3511 |
| 99 | Ga0068853_100797608 | 3300005539 | Bacteria | 904 |
| 100 | Ga0070672_100070075 | 3300005543 | Bacteria | 2785 |
| 101 | Ga0070686_100491859 | 3300005544 | Bacteria | 950 |
| 102 | Ga0070693_100013519 | 3300005547 | Bacteria | 4159 |
| 103 | Ga0070665_100001822 | 3300005548 | Bacteria | 24187 |
| 104 | Ga0070665_100016770 | 3300005548 | Bacteria | 7343 |
| 105 | Ga0070665_100040243 | 3300005548 | Bacteria | 4699 |
| 106 | Ga0070665_100082987 | 3300005548 | Bacteria | 3210 |
| 107 | Ga0070665_100925952 | 3300005548 | Bacteria | 884 |
| 108 | Ga0070704_100424603 | 3300005549 | Bacteria | 1139 |
| 109 | Ga0068855_100087663 | 3300005563 | Bacteria | 3596 |
| 110 | Ga0070664_100046271 | 3300005564 | Bacteria | 3675 |
| 111 | Ga0068857_100025063 | 3300005577 | Bacteria | 5254 |
| 112 | Ga0068857_100142564 | 3300005577 | Bacteria | 2166 |
| 113 | Ga0068856_100029765 | 3300005614 | Bacteria | 5335 |
| 114 | Ga0068856_100037302 | 3300005614 | Bacteria | 4769 |
| 115 | Ga0068856_100109464 | 3300005614 | Bacteria | 2759 |
| 116 | Ga0070702_100000249 | 3300005615 | Bacteria | 18368 |
| 117 | Ga0068852_100033570 | 3300005616 | Bacteria | 4262 |
| 118 | Ga0068852_100038284 | 3300005616 | Bacteria | 4029 |
| 119 | Ga0068859_100100847 | 3300005617 | Bacteria | 2943 |
| 120 | Ga0068864_100104390 | 3300005618 | Bacteria | 2517 |
| 121 | Ga0068864_100261981 | 3300005618 | Bacteria | 1608 |
| 122 | Ga0068864_100346725 | 3300005618 | Bacteria | 1400 |
| 123 | Ga0068870_10000485 | 3300005840 | Bacteria | 15062 |
| 124 | Ga0068870_10061606 | 3300005840 | Bacteria | 2018 |
| 125 | Ga0068863_100000825 | 3300005841 | Bacteria | 31093 |
| 126 | Ga0068863_100002727 | 3300005841 | Bacteria | 17453 |
| 127 | Ga0068863_100006552 | 3300005841 | Bacteria | 11429 |
| 128 | Ga0068863_100113603 | 3300005841 | Bacteria | 2580 |
| 129 | Ga0068863_100323707 | 3300005841 | Bacteria | 1498 |
| 130 | Ga0068863_100663579 | 3300005841 | Bacteria | 1035 |
| 131 | Ga0068863_101087344 | 3300005841 | Bacteria | 804 |
| 132 | Ga0068858_100039022 | 3300005842 | Bacteria | 4405 |
| 133 | Ga0068858_100219548 | 3300005842 | Bacteria | 1800 |
| 134 | Ga0068860_100000067 | 3300005843 | Bacteria | 180176 |
| 135 | Ga0068860_100046376 | 3300005843 | Bacteria | 4144 |
| 136 | Ga0068860_100110967 | 3300005843 | Bacteria | 2622 |
| 137 | Ga0068862_100016456 | 3300005844 | Bacteria | 6155 |
| 138 | Ga0081455_10000692 | 3300005937 | Bacteria | 43780 |
| 139 | Ga0081455_10008638 | 3300005937 | Bacteria | 10561 |
| 140 | Ga0081538_10000016 | 3300005981 | Bacteria | 147022 |
| 141 | Ga0081540_1073793 | 3300005983 | Bacteria | 1566 |
| 142 | Ga0081539_10000401 | 3300005985 | Bacteria | 92875 |
| 143 | Ga0070717_10036632 | 3300006028 | Bacteria | 3979 |
| 144 | Ga0070717_10091250 | 3300006028 | Bacteria | 2572 |
| 145 | Ga0070717_10096071 | 3300006028 | Bacteria | 2509 |
| 146 | Ga0070717_10106141 | 3300006028 | Bacteria | 2391 |
| 147 | Ga0070717_10771629 | 3300006028 | Bacteria | 874 |
| 148 | Ga0070717_10885321 | 3300006028 | Bacteria | 813 |
| 149 | Ga0075365_10088197 | 3300006038 | Bacteria | 2110 |
| 150 | Ga0075368_10287904 | 3300006042 | Bacteria | 707 |
| 151 | Ga0075364_10031406 | 3300006051 | Bacteria | 3412 |
| 152 | Ga0070715_10008053 | 3300006163 | Bacteria | 3656 |
| 153 | Ga0070716_100014341 | 3300006173 | Bacteria | 4058 |
| 154 | Ga0070716_100134791 | 3300006173 | Bacteria | 1566 |
| 155 | Ga0070712_100143777 | 3300006175 | Bacteria | 1823 |
| 156 | Ga0070712_100542480 | 3300006175 | Bacteria | 979 |
| 157 | Ga0075367_10002964 | 3300006178 | Bacteria | 7935 |
| 158 | Ga0097621_100079102 | 3300006237 | Bacteria | 2732 |
| 159 | Ga0075370_10142347 | 3300006353 | Bacteria | 1402 |
| 160 | Ga0075428_100005695 | 3300006844 | Bacteria | 13850 |
| 161 | Ga0075428_100107508 | 3300006844 | Bacteria | 3040 |
| 162 | Ga0075428_100114469 | 3300006844 | Bacteria | 2938 |
| 163 | Ga0075428_100842658 | 3300006844 | Bacteria | 974 |
| 164 | Ga0075430_100002967 | 3300006846 | Bacteria | 14208 |
| 165 | Ga0075430_100012455 | 3300006846 | Bacteria | 7236 |
| 166 | Ga0075430_100021018 | 3300006846 | Bacteria | 5548 |
| 167 | Ga0075430_100194709 | 3300006846 | Bacteria | 1684 |
| 168 | Ga0075431_100014674 | 3300006847 | Bacteria | 7928 |
| 169 | Ga0075431_100040656 | 3300006847 | Bacteria | 4792 |
| 170 | Ga0075431_100113732 | 3300006847 | Bacteria | 2794 |
| 171 | Ga0075431_100182363 | 3300006847 | Bacteria | 2154 |
| 172 | Ga0075431_100562800 | 3300006847 | Bacteria | 1126 |
| 173 | Ga0075433_10016144 | 3300006852 | Bacteria | 6143 |
| 174 | Ga0075433_10085559 | 3300006852 | Bacteria | 2783 |
| 175 | Ga0075434_100000965 | 3300006871 | Bacteria | 23178 |
| 176 | Ga0075434_100011948 | 3300006871 | Bacteria | 8213 |
| 177 | Ga0075434_100113850 | 3300006871 | Bacteria | 2717 |
| 178 | Ga0075429_100007259 | 3300006880 | Bacteria | 9612 |
| 179 | Ga0075429_100012278 | 3300006880 | Bacteria | 7428 |
| 180 | Ga0075429_100057852 | 3300006880 | Bacteria | 3376 |
| 181 | Ga0075429_100092771 | 3300006880 | Bacteria | 2633 |
| 182 | Ga0075429_101037636 | 3300006880 | Bacteria | 716 |
| 183 | Ga0068865_100065162 | 3300006881 | Bacteria | 2566 |
| 184 | Ga0068865_100324869 | 3300006881 | Bacteria | 1239 |
| 185 | Ga0075436_100000682 | 3300006914 | Bacteria | 22349 |
| 186 | Ga0075436_100060296 | 3300006914 | Bacteria | 2620 |
| 187 | Ga0097620_100100847 | 3300006931 | Bacteria | 2943 |
| 188 | Ga0075435_100007979 | 3300007076 | Bacteria | 7577 |
| 189 | Ga0075435_100449943 | 3300007076 | Bacteria | 1110 |
| 190 | Ga0075435_100636079 | 3300007076 | Bacteria | 926 |
| 191 | Ga0099794_10104014 | 3300007265 | Bacteria | 1419 |
| 192 | Ga0105250_10067032 | 3300009092 | Bacteria | 1448 |
| 193 | Ga0105240_10058886 | 3300009093 | Bacteria | 4795 |
| 194 | Ga0105240_10358895 | 3300009093 | Bacteria | 1651 |
| 195 | Ga0111539_10296595 | 3300009094 | Bacteria | 1881 |
| 196 | Ga0105245_10001147 | 3300009098 | Bacteria | 23949 |
| 197 | Ga0105245_10016486 | 3300009098 | Bacteria | 6447 |
| 198 | Ga0105247_10599976 | 3300009101 | Bacteria | 816 |
| 199 | Ga0114129_10000557 | 3300009147 | Bacteria | 45780 |
| 200 | Ga0114129_10058757 | 3300009147 | Bacteria | 5379 |
| 201 | Ga0114129_10161046 | 3300009147 | Bacteria | 3065 |
| 202 | Ga0114129_10184086 | 3300009147 | Bacteria | 2840 |
| 203 | Ga0114129_10915361 | 3300009147 | Bacteria | 1110 |
| 204 | Ga0105243_10233384 | 3300009148 | Bacteria | 1633 |
| 205 | Ga0105243_11297091 | 3300009148 | Bacteria | 745 |
| 206 | Ga0105241_10004400 | 3300009174 | Bacteria | 10414 |
| 207 | Ga0105241_10118932 | 3300009174 | Bacteria | 2125 |
| 208 | Ga0105241_10297368 | 3300009174 | Bacteria | 1384 |
| 209 | Ga0105248_10010638 | 3300009177 | Bacteria | 10147 |
| 210 | Ga0105248_10053245 | 3300009177 | Bacteria | 4541 |
| 211 | Ga0105237_10078667 | 3300009545 | Bacteria | 3287 |
| 212 | Ga0105237_10129074 | 3300009545 | Bacteria | 2522 |
| 213 | Ga0105238_10009854 | 3300009551 | Bacteria | 9573 |
| 214 | Ga0105238_10085457 | 3300009551 | Bacteria | 3142 |
| 215 | Ga0105238_10272592 | 3300009551 | Bacteria | 1673 |
| 216 | Ga0105238_10385716 | 3300009551 | Bacteria | 1393 |
| 217 | Ga0105249_10368751 | 3300009553 | Bacteria | 1459 |
| 218 | Ga0105249_10394849 | 3300009553 | Bacteria | 1412 |
| 219 | Ga0105249_11343836 | 3300009553 | Bacteria | 786 |
| 220 | Ga0105033_104027 | 3300009986 | Bacteria | 1250 |
| 221 | Ga0105239_10120671 | 3300010375 | Bacteria | 2911 |
| 222 | Ga0105239_10410737 | 3300010375 | Bacteria | 1533 |
| 223 | Ga0105246_10000043 | 3300011119 | Bacteria | 47690 |
| 224 | Ga0105246_10745099 | 3300011119 | Bacteria | 863 |
| 225 | Ga0157317_1003027 | 3300012475 | Bacteria | 1025 |
| 226 | Ga0157373_10055589 | 3300013100 | Bacteria | 2812 |
| 227 | Ga0157371_10534289 | 3300013102 | Bacteria | 868 |
| 228 | Ga0157370_10011499 | 3300013104 | Bacteria | 9248 |
| 229 | Ga0157370_10098631 | 3300013104 | Bacteria | 2739 |
| 230 | Ga0157370_10147401 | 3300013104 | Bacteria | 2191 |
| 231 | Ga0157369_10295797 | 3300013105 | Bacteria | 1685 |
| 232 | Ga0157369_11219879 | 3300013105 | Bacteria | 768 |
| 233 | Ga0157369_11311859 | 3300013105 | Bacteria | 738 |
| 234 | Ga0157369_11506491 | 3300013105 | Bacteria | 684 |
| 235 | Ga0157374_11065189 | 3300013296 | Bacteria | 828 |
| 236 | Ga0157372_10000043 | 3300013307 | Bacteria | 153958 |
| 237 | Ga0157372_10111537 | 3300013307 | Bacteria | 3134 |
| 238 | Ga0157372_11076395 | 3300013307 | Bacteria | 930 |
| 239 | Ga0157375_10226622 | 3300013308 | Bacteria | 2028 |
| 240 | Ga0163163_10005228 | 3300014325 | Bacteria | 11192 |
| 241 | Ga0163163_10307621 | 3300014325 | Bacteria | 1637 |
| 242 | Ga0163163_10594637 | 3300014325 | Bacteria | 1170 |
| 243 | Ga0163163_10786935 | 3300014325 | Bacteria | 1014 |
| 244 | Ga0163163_11435954 | 3300014325 | Bacteria | 751 |
| 245 | Ga0163163_11477646 | 3300014325 | Bacteria | 741 |
| 246 | Ga0157377_10034027 | 3300014745 | Bacteria | 2786 |
| 247 | Ga0157377_10310550 | 3300014745 | Bacteria | 1044 |
| 248 | Ga0157379_10025353 | 3300014968 | Bacteria | 5267 |
| 249 | Ga0157379_10032051 | 3300014968 | Bacteria | 4683 |
| 250 | Ga0157379_10203740 | 3300014968 | Bacteria | 1790 |
| 251 | Ga0157376_10011635 | 3300014969 | Bacteria | 6494 |
| 252 | Ga0157376_10164065 | 3300014969 | Bacteria | 2017 |
| 253 | Ga0206356_10781422 | 3300020070 | Bacteria | 1774 |
| 254 | Ga0206356_11371595 | 3300020070 | Bacteria | 2940 |
| 255 | Ga0206351_10984482 | 3300020077 | Bacteria | 749 |
| 256 | Ga0206353_11838987 | 3300020082 | Bacteria | 695 |
| 257 | Ga0206353_11915281 | 3300020082 | Bacteria | 2650 |
| 258 | Ga0206353_12028661 | 3300020082 | Bacteria | 8725 |
| 259 | Ga0213875_10001574 | 3300021388 | Bacteria | 14573 |
| 260 | Ga0209677_100375 | 3300025253 | Bacteria | 27361 |
| 261 | Ga0207692_10001172 | 3300025898 | Bacteria | 9689 |
| 262 | Ga0207692_10002461 | 3300025898 | Bacteria | 7108 |
| 263 | Ga0207692_10048263 | 3300025898 | Bacteria | 2142 |
| 264 | Ga0207710_10103916 | 3300025900 | Bacteria | 1343 |
| 265 | Ga0207688_10000704 | 3300025901 | Bacteria | 16517 |
| 266 | Ga0207680_10019495 | 3300025903 | Bacteria | 3628 |
| 267 | Ga0207685_10077039 | 3300025905 | Bacteria | 1369 |
| 268 | Ga0207699_10003198 | 3300025906 | Bacteria | 7800 |
| 269 | Ga0207699_10032994 | 3300025906 | Bacteria | 2922 |
| 270 | Ga0207699_10049509 | 3300025906 | Bacteria | 2474 |
| 271 | Ga0207699_10066106 | 3300025906 | Bacteria | 2194 |
| 272 | Ga0207699_10149393 | 3300025906 | Bacteria | 1544 |
| 273 | Ga0207699_10300012 | 3300025906 | Bacteria | 1122 |
| 274 | Ga0207643_10000255 | 3300025908 | Bacteria | 37233 |
| 275 | Ga0207643_10061711 | 3300025908 | Bacteria | 2141 |
| 276 | Ga0207705_10025237 | 3300025909 | Bacteria | 4243 |
| 277 | Ga0207705_10170195 | 3300025909 | Bacteria | 1640 |
| 278 | Ga0207705_10213785 | 3300025909 | Bacteria | 1463 |
| 279 | Ga0207705_10578852 | 3300025909 | Bacteria | 873 |
| 280 | Ga0207684_10010471 | 3300025910 | Bacteria | 8161 |
| 281 | Ga0207684_10015809 | 3300025910 | Bacteria | 6489 |
| 282 | Ga0207684_10213547 | 3300025910 | Bacteria | 1664 |
| 283 | Ga0207684_10310661 | 3300025910 | Bacteria | 1359 |
| 284 | Ga0207684_10863730 | 3300025910 | Bacteria | 762 |
| 285 | Ga0207654_10018194 | 3300025911 | Bacteria | 3684 |
| 286 | Ga0207707_10000089 | 3300025912 | Bacteria | 90919 |
| 287 | Ga0207707_10054688 | 3300025912 | Bacteria | 3474 |
| 288 | Ga0207695_10061148 | 3300025913 | Bacteria | 3894 |
| 289 | Ga0207671_10164128 | 3300025914 | Bacteria | 1721 |
| 290 | Ga0207693_10019042 | 3300025915 | Bacteria | 5464 |
| 291 | Ga0207693_10150444 | 3300025915 | Bacteria | 1831 |
| 292 | Ga0207693_10206818 | 3300025915 | Bacteria | 1543 |
| 293 | Ga0207693_10473026 | 3300025915 | Bacteria | 979 |
| 294 | Ga0207663_10073799 | 3300025916 | Bacteria | 2209 |
| 295 | Ga0207663_10075252 | 3300025916 | Bacteria | 2191 |
| 296 | Ga0207660_10001907 | 3300025917 | Bacteria | 13892 |
| 297 | Ga0207660_10002528 | 3300025917 | Bacteria | 12018 |
| 298 | Ga0207660_10267695 | 3300025917 | Bacteria | 1353 |
| 299 | Ga0207662_10122244 | 3300025918 | Bacteria | 1634 |
| 300 | Ga0207657_10017121 | 3300025919 | Bacteria | 6965 |
| 301 | Ga0207649_10007713 | 3300025920 | Bacteria | 5852 |
| 302 | Ga0207652_10000015 | 3300025921 | Bacteria | 193042 |
| 303 | Ga0207652_10015476 | 3300025921 | Bacteria | 6202 |
| 304 | Ga0207646_10000731 | 3300025922 | Bacteria | 42637 |
| 305 | Ga0207646_10009013 | 3300025922 | Bacteria | 9918 |
| 306 | Ga0207646_10048380 | 3300025922 | Bacteria | 3811 |
| 307 | Ga0207646_10116996 | 3300025922 | Bacteria | 2394 |
| 308 | Ga0207646_10403354 | 3300025922 | Bacteria | 1234 |
| 309 | Ga0207646_11218803 | 3300025922 | Bacteria | 659 |
| 310 | Ga0207681_10136888 | 3300025923 | Bacteria | 1819 |
| 311 | Ga0207694_10025217 | 3300025924 | Bacteria | 4518 |
| 312 | Ga0207694_10110096 | 3300025924 | Bacteria | 2190 |
| 313 | Ga0207650_10001380 | 3300025925 | Bacteria | 17521 |
| 314 | Ga0207659_10008047 | 3300025926 | Bacteria | 6527 |
| 315 | Ga0207659_10252210 | 3300025926 | Bacteria | 1432 |
| 316 | Ga0207687_10004511 | 3300025927 | Bacteria | 9263 |
| 317 | Ga0207687_10250138 | 3300025927 | Bacteria | 1409 |
| 318 | Ga0207700_10035538 | 3300025928 | Bacteria | 3590 |
| 319 | Ga0207700_10154973 | 3300025928 | Bacteria | 1897 |
| 320 | Ga0207700_10196572 | 3300025928 | Bacteria | 1697 |
| 321 | Ga0207700_10402338 | 3300025928 | Bacteria | 1200 |
| 322 | Ga0207700_10688340 | 3300025928 | Bacteria | 912 |
| 323 | Ga0207664_10009298 | 3300025929 | Bacteria | 6892 |
| 324 | Ga0207664_10023058 | 3300025929 | Bacteria | 4658 |
| 325 | Ga0207664_10049093 | 3300025929 | Bacteria | 3321 |
| 326 | Ga0207664_10049924 | 3300025929 | Bacteria | 3296 |
| 327 | Ga0207664_10049971 | 3300025929 | Bacteria | 3295 |
| 328 | Ga0207644_10000647 | 3300025931 | Bacteria | 22018 |
| 329 | Ga0207644_10019645 | 3300025931 | Bacteria | 4588 |
| 330 | Ga0207690_10018313 | 3300025932 | Bacteria | 4294 |
| 331 | Ga0207690_10384941 | 3300025932 | Bacteria | 1115 |
| 332 | Ga0207706_10061473 | 3300025933 | Bacteria | 3308 |
| 333 | Ga0207706_10200245 | 3300025933 | Bacteria | 1751 |
| 334 | Ga0207709_10281390 | 3300025935 | Bacteria | 1229 |
| 335 | Ga0207670_10176633 | 3300025936 | Bacteria | 1605 |
| 336 | Ga0207669_10075981 | 3300025937 | Bacteria | 2131 |
| 337 | Ga0207704_10066480 | 3300025938 | Bacteria | 2263 |
| 338 | Ga0207665_10029654 | 3300025939 | Bacteria | 3615 |
| 339 | Ga0207691_10025726 | 3300025940 | Bacteria | 5523 |
| 340 | Ga0207711_10827028 | 3300025941 | Bacteria | 862 |
| 341 | Ga0207689_10003676 | 3300025942 | Bacteria | 13985 |
| 342 | Ga0207689_10099783 | 3300025942 | Bacteria | 2386 |
| 343 | Ga0207661_10041234 | 3300025944 | Bacteria | 3633 |
| 344 | Ga0207661_10098684 | 3300025944 | Bacteria | 2448 |
| 345 | Ga0207661_10126896 | 3300025944 | Bacteria | 2180 |
| 346 | Ga0207661_10146991 | 3300025944 | Bacteria | 2034 |
| 347 | Ga0207661_10233247 | 3300025944 | Bacteria | 1630 |
| 348 | Ga0207661_10591621 | 3300025944 | Bacteria | 1018 |
| 349 | Ga0207679_10001781 | 3300025945 | Bacteria | 13403 |
| 350 | Ga0207679_10140684 | 3300025945 | Bacteria | 1950 |
| 351 | Ga0207667_10029004 | 3300025949 | Bacteria | 6007 |
| 352 | Ga0207667_10117863 | 3300025949 | Bacteria | 2736 |
| 353 | Ga0207651_10022933 | 3300025960 | Bacteria | 3829 |
| 354 | Ga0207668_10022464 | 3300025972 | Bacteria | 4040 |
| 355 | Ga0207668_10108700 | 3300025972 | Bacteria | 2076 |
| 356 | Ga0207668_10199949 | 3300025972 | Bacteria | 1590 |
| 357 | Ga0207640_10078681 | 3300025981 | Bacteria | 2245 |
| 358 | Ga0207658_10002268 | 3300025986 | Bacteria | 14222 |
| 359 | Ga0207658_10060272 | 3300025986 | Bacteria | 2831 |
| 360 | Ga0207677_10044300 | 3300026023 | Bacteria | 2964 |
| 361 | Ga0207677_10074779 | 3300026023 | Bacteria | 2405 |
| 362 | Ga0207703_10035233 | 3300026035 | Bacteria | 3977 |
| 363 | Ga0207703_10035764 | 3300026035 | Bacteria | 3948 |
| 364 | Ga0207639_10926897 | 3300026041 | Bacteria | 815 |
| 365 | Ga0207678_10000120 | 3300026067 | Bacteria | 65114 |
| 366 | Ga0207678_10000346 | 3300026067 | Bacteria | 41986 |
| 367 | Ga0207678_10054836 | 3300026067 | Bacteria | 3433 |
| 368 | Ga0207708_10372890 | 3300026075 | Bacteria | 1175 |
| 369 | Ga0207702_10001514 | 3300026078 | Bacteria | 22967 |
| 370 | Ga0207702_10041795 | 3300026078 | Bacteria | 3844 |
| 371 | Ga0207702_10073412 | 3300026078 | Bacteria | 2949 |
| 372 | Ga0207702_10085630 | 3300026078 | Bacteria | 2747 |
| 373 | Ga0207702_10147451 | 3300026078 | Bacteria | 2137 |
| 374 | Ga0207702_10459294 | 3300026078 | Bacteria | 1237 |
| 375 | Ga0207641_10003465 | 3300026088 | Bacteria | 13978 |
| 376 | Ga0207641_10005835 | 3300026088 | Bacteria | 10451 |
| 377 | Ga0207641_10020496 | 3300026088 | Bacteria | 5430 |
| 378 | Ga0207641_10081134 | 3300026088 | Bacteria | 2816 |
| 379 | Ga0207641_10082921 | 3300026088 | Bacteria | 2787 |
| 380 | Ga0207641_10380490 | 3300026088 | Bacteria | 1352 |
| 381 | Ga0207676_10000914 | 3300026095 | Bacteria | 22844 |
| 382 | Ga0207676_10407544 | 3300026095 | Bacteria | 1272 |
| 383 | Ga0207676_10642923 | 3300026095 | Bacteria | 1023 |
| 384 | Ga0207676_10743268 | 3300026095 | Bacteria | 953 |
| 385 | Ga0207674_10020943 | 3300026116 | Bacteria | 7053 |
| 386 | Ga0207674_10090197 | 3300026116 | Bacteria | 3057 |
| 387 | Ga0207674_10346953 | 3300026116 | Bacteria | 1435 |
| 388 | Ga0207675_100020646 | 3300026118 | Bacteria | 6140 |
| 389 | Ga0207683_10001990 | 3300026121 | Bacteria | 18093 |
| 390 | Ga0207683_10335841 | 3300026121 | Bacteria | 1385 |
| 391 | Ga0207698_10003656 | 3300026142 | Bacteria | 9283 |
| 392 | Ga0207698_10236724 | 3300026142 | Bacteria | 1661 |
| 393 | Ga0207428_10001605 | 3300027907 | Bacteria | 23495 |
| 394 | Ga0268266_10004303 | 3300028379 | Bacteria | 13708 |
| 395 | Ga0268266_10015983 | 3300028379 | Bacteria | 6419 |
| 396 | Ga0268266_10057047 | 3300028379 | Bacteria | 3360 |
| 397 | Ga0268266_10083185 | 3300028379 | Bacteria | 2794 |
| 398 | Ga0268264_10000114 | 3300028381 | Bacteria | 203211 |
| 399 | Ga0268264_10044861 | 3300028381 | Bacteria | 3669 |
| 400 | Ga0307515_10142969 | 3300028794 | Bacteria | 2554 |
| 401 | Ga0307515_10238616 | 3300028794 | Bacteria | 1594 |
| 402 | Ga0307511_10001747 | 3300030521 | Bacteria | 22882 |
| 403 | Ga0307512_10079030 | 3300030522 | Bacteria | 2379 |
| 404 | Ga0314311_1200767 | 3300030733 | Bacteria | 2021 |
| 405 | Ga0316180_1017775 | 3300030736 | Bacteria | 4604 |
| 406 | Ga0307513_10034844 | 3300031456 | Bacteria | 5641 |
| 407 | Ga0307509_10056168 | 3300031507 | Bacteria | 4180 |
| 408 | Ga0307509_10261811 | 3300031507 | Bacteria | 1504 |
| 409 | Ga0307408_100132511 | 3300031548 | Bacteria | 1946 |
| 410 | Ga0307508_10011315 | 3300031616 | Bacteria | 8158 |
| 411 | Ga0316575_10037052 | 3300031665 | Bacteria | 1920 |
| 412 | Ga0307405_10042305 | 3300031731 | Bacteria | 2772 |
| 413 | Ga0307405_10986081 | 3300031731 | Bacteria | 718 |
| 414 | Ga0307413_10049467 | 3300031824 | Bacteria | 2520 |
| 415 | Ga0307518_10000517 | 3300031838 | Bacteria | 29360 |
| 416 | Ga0307410_10057630 | 3300031852 | Bacteria | 2646 |
| 417 | Ga0307410_10870975 | 3300031852 | Bacteria | 770 |
| 418 | Ga0307406_10027269 | 3300031901 | Bacteria | 3441 |
| 419 | Ga0307406_10365759 | 3300031901 | Bacteria | 1132 |
| 420 | Ga0307407_10012377 | 3300031903 | Bacteria | 4098 |
| 421 | Ga0307412_10059506 | 3300031911 | Bacteria | 2561 |
| 422 | Ga0307412_10586734 | 3300031911 | Bacteria | 942 |
| 423 | Ga0307409_100000307 | 3300031995 | Bacteria | 19995 |
| 424 | Ga0307409_100069674 | 3300031995 | Bacteria | 2788 |
| 425 | Ga0307409_100095284 | 3300031995 | Bacteria | 2452 |
| 426 | Ga0307416_100001292 | 3300032002 | Bacteria | 13503 |
| 427 | Ga0307416_100242948 | 3300032002 | Bacteria | 1746 |
| 428 | Ga0307416_100515423 | 3300032002 | Bacteria | 1263 |
| 429 | Ga0307416_102139783 | 3300032002 | Bacteria | 661 |
| 430 | Ga0307411_10140942 | 3300032005 | Bacteria | 1778 |
| 431 | Ga0307411_10150169 | 3300032005 | Bacteria | 1730 |
| 432 | Ga0307415_100000008 | 3300032126 | Bacteria | 90898 |
| 433 | Ga0307415_100027555 | 3300032126 | Bacteria | 3602 |
| 434 | Ga0307415_100028203 | 3300032126 | Bacteria | 3568 |
| 435 | Ga0316585_10084182 | 3300032137 | Bacteria | 1037 |
| 436 | Ga0373930_0007860 | 3300034816 | Bacteria | 1848 |
| 437 | Ga0373958_0063072 | 3300034819 | Bacteria | 807 |
| 438 | Ga0373959_0047484 | 3300034820 | Bacteria | 918 |
| 439 | Ga0373938_0046063 | 3300034957 | Bacteria | 983 |
| 440 | Ga0373928_0037626 | 3300035084 | Bacteria | 1099 |
| 441 | Ga0373934_0000049 | 3300035086 | Bacteria | 40994 |
| 442 | Ga0373934_0006516 | 3300035086 | Bacteria | 4332 |
| 443 | Ga0373944_0046946 | 3300035089 | Bacteria | 1352 |
| 444 | Ga0373949_0040472 | 3300035090 | Bacteria | 1144 |
| 445 | Ga0373951_0010768 | 3300035091 | Bacteria | 2055 |
| 446 | Ga0373923_0010142 | 3300035111 | Bacteria | 3419 |
| 447 | Ga0373923_0032238 | 3300035111 | Bacteria | 2116 |
| 448 | Ga0373936_0119956 | 3300035113 | Bacteria | 1123 |
| 449 | Ga0373939_0007613 | 3300035114 | Bacteria | 2633 |
| 450 | Ga0373941_0041616 | 3300035115 | Bacteria | 1423 |
| 451 | Ga0373945_0043214 | 3300035116 | Bacteria | 1634 |
| 452 | Ga0373953_0000077 | 3300035117 | Bacteria | 23684 |
| 453 | Ga0373954_0016600 | 3300035118 | Bacteria | 3298 |
| 454 | Ga0373954_0088020 | 3300035118 | Bacteria | 1489 |
| 455 | Ga0373954_0130781 | 3300035118 | Bacteria | 1222 |
| 456 | Ga0373956_0000086 | 3300035119 | Bacteria | 31023 |
| 457 | Ga0373956_0026508 | 3300035119 | Bacteria | 2511 |
| 458 | Ga0373956_0053578 | 3300035119 | Bacteria | 1816 |
| 459 | Ga0373956_0065695 | 3300035119 | Bacteria | 1649 |
| 460 | Ga0373957_0000167 | 3300035120 | Bacteria | 16896 |
| 461 | Ga0373957_0014145 | 3300035120 | Bacteria | 2722 |
| 462 | Ga0373960_0113817 | 3300035121 | Bacteria | 890 |
| 463 | Ga0373943_0072646 | 3300035170 | Bacteria | 1745 |
| 464 | Ga0373943_0213120 | 3300035170 | Bacteria | 1073 |
| 465 | Ga0373946_0130329 | 3300035171 | Bacteria | 1156 |
| 466 | Ga0373955_0000252 | 3300035172 | Bacteria | 22257 |
| 467 | Ga0373955_0005539 | 3300035172 | Bacteria | 5678 |
| 468 | Ga0373955_0018911 | 3300035172 | Bacteria | 3435 |
| 469 | Ga0373942_0066185 | 3300035207 | Bacteria | 1045 |
| 470 | Ga0373962_0006236 | 3300035242 | Bacteria | 2885 |
| 471 | Ga0373924_0002022 | 3300035410 | Bacteria | 6757 |
| 472 | Ga0373924_0063603 | 3300035410 | Bacteria | 1548 |
| 473 | Ga0373931_0105780 | 3300035691 | Bacteria | 1589 |
| 474 | Ga0373931_0125620 | 3300035691 | Bacteria | 1471 |
| 475 | Ga0373927_0477916 | 3300035695 | Bacteria | 823 |
| 476 | Ga0373933_0000051 | 3300035724 | Bacteria | 71384 |
| 477 | Ga0373933_0007530 | 3300035724 | Bacteria | 5948 |
| 478 | Ga0373933_0013021 | 3300035724 | Bacteria | 4603 |
| 479 | Ga0373933_0039454 | 3300035724 | Bacteria | 2778 |
| 480 | Ga0373947_0017493 | 3300035725 | Bacteria | 4123 |
| 481 | Ga0373947_0669888 | 3300035725 | Bacteria | 707 |
| 482 | Ga0373937_0000289 | 3300036401 | Bacteria | 47874 |
| 483 | Ga0373937_0040374 | 3300036401 | Bacteria | 4253 |
| 484 | Ga0373937_0065355 | 3300036401 | Bacteria | 3348 |
| 485 | Ga0373937_0252813 | 3300036401 | Bacteria | 1661 |
| 486 | Ga0373925_1039755 | 3300037068 | Bacteria | 674 |
| 487 | Ga0395899_0006426 | 3300037312 | Bacteria | 9106 |
| 488 | Ga0395900_0091467 | 3300037418 | Bacteria | 3127 |
| 489 | Ga0395900_0098140 | 3300037418 | Bacteria | 3010 |
| 490 | Ga0395898_0226597 | 3300037466 | Bacteria | 1783 |
| 491 | Ga0395898_0973423 | 3300037466 | Bacteria | 785 |
| 492 | Ga0436364_0580980 | 3300037853 | Bacteria | 2990 |
| 493 | Ga0436364_1139642 | 3300037853 | Bacteria | 14414 |
| 494 | Ga0395901_0205522 | 3300038443 | Bacteria | 2063 |
| 495 | Ga0395901_0260051 | 3300038443 | Bacteria | 1807 |
| 496 | Ga0395901_1424094 | 3300038443 | Bacteria | 651 |
| 497 | Ga0436365_1884406 | 3300039437 | Bacteria | 5877 |
| 498 | Ga0436362_1009491 | 3300039453 | Bacteria | 1977 |
| 499 | Ga0439465_0003486 | 3300041413 | Bacteria | 5131 |
| 500 | Ga0451795_0390901 | 3300041456 | Bacteria | 940 |
| 501 | Ga0451833_1468397 | 3300041491 | Bacteria | 725 |
| 502 | Ga0451853_0401476 | 3300041512 | Bacteria | 961 |
| 503 | Ga0439448_0033838 | 3300042005 | Bacteria | 1631 |
| 504 | Ga0439449_0131494 | 3300042007 | Bacteria | 930 |
| 505 | Ga0439449_0189735 | 3300042007 | Bacteria | 769 |
| 506 | Ga0439463_002459 | 3300042016 | Bacteria | 4710 |
| 507 | Ga0450900_024085 | 3300042136 | Bacteria | 862 |
| 508 | Ga0450902_036331 | 3300042137 | Bacteria | 834 |
| 509 | Ga0439458_0003635 | 3300042157 | Bacteria | 3586 |
| 510 | Ga0439459_0003127 | 3300042438 | Bacteria | 2602 |
| 511 | Ga0466969_0004684 | 3300044656 | Bacteria | 7287 |
| 512 | Ga0466972_0009347 | 3300044658 | Bacteria | 4928 |
| 513 | Ga0466972_0009858 | 3300044658 | Bacteria | 4796 |
| 514 | Ga0466972_0030426 | 3300044658 | Bacteria | 2658 |
| 515 | Ga0466972_0265932 | 3300044658 | Bacteria | 801 |
| 516 | Ga0466965_0000884 | 3300044683 | Bacteria | 11446 |
| 517 | Ga0466965_0001772 | 3300044683 | Bacteria | 8925 |
| 518 | Ga0466965_0052304 | 3300044683 | Bacteria | 2028 |
| 519 | Ga0466965_0366892 | 3300044683 | Bacteria | 791 |
| 520 | Ga0466966_0001055 | 3300044684 | Bacteria | 17604 |
| 521 | Ga0466966_0141958 | 3300044684 | Unclassified | 1467 |
| 522 | Ga0466966_0148139 | 3300044684 | Bacteria | 1432 |
| 523 | Ga0466966_0154428 | 3300044684 | Bacteria | 1399 |
| 524 | Ga0466966_0221615 | 3300044684 | Bacteria | 1142 |
| 525 | Ga0466961_0013186 | 3300044693 | Bacteria | 5286 |
| 526 | Ga0466961_0018939 | 3300044693 | Bacteria | 4430 |
| 527 | Ga0466961_0024716 | 3300044693 | Bacteria | 3864 |
| 528 | Ga0466961_0042768 | 3300044693 | Bacteria | 2904 |
| 529 | Ga0466961_0046415 | 3300044693 | Bacteria | 2778 |
| 530 | Ga0466961_0057207 | 3300044693 | Bacteria | 2483 |
| 531 | Ga0466961_0182478 | 3300044693 | Bacteria | 1302 |
| 532 | Ga0466963_0003782 | 3300044694 | Bacteria | 8723 |
| 533 | Ga0466963_0009176 | 3300044694 | Bacteria | 5949 |
| 534 | Ga0466963_0128484 | 3300044694 | Bacteria | 1749 |
| 535 | Ga0466963_0149388 | 3300044694 | Bacteria | 1622 |
| 536 | Ga0466963_0240440 | 3300044694 | Bacteria | 1270 |
| 537 | Ga0466963_0272816 | 3300044694 | Bacteria | 1188 |
| 538 | Ga0466964_0312671 | 3300044706 | Bacteria | 796 |
| 539 | Ga0466964_0323366 | 3300044706 | Bacteria | 784 |
| 540 | Ga0466971_0003749 | 3300044719 | Bacteria | 6507 |
| 541 | Ga0466971_0044272 | 3300044719 | Bacteria | 1999 |
| 542 | Ga0466971_0078749 | 3300044719 | Bacteria | 1502 |
| 543 | Ga0466971_0153913 | 3300044719 | Bacteria | 1074 |
| 544 | Ga0466968_0073794 | 3300044735 | Bacteria | 1489 |
| 545 | Ga0466968_0086864 | 3300044735 | Bacteria | 1381 |
| 546 | Ga0466968_0156784 | 3300044735 | Bacteria | 1049 |
| 547 | Ga0466970_0001375 | 3300044765 | Bacteria | 11716 |
| 548 | Ga0466970_0006135 | 3300044765 | Bacteria | 5987 |
| 549 | Ga0466970_0049465 | 3300044765 | Bacteria | 2242 |
| 550 | Ga0466970_0097043 | 3300044765 | Bacteria | 1603 |
| 551 | Ga0466970_0170974 | 3300044765 | Bacteria | 1204 |
| 552 | Ga0466970_0181219 | 3300044765 | Bacteria | 1169 |
| 553 | Ga0466970_0212236 | 3300044765 | Bacteria | 1079 |
| 554 | Ga0466970_0251857 | 3300044765 | Bacteria | 989 |
| 555 | Ga0466957_0012389 | 3300044842 | Bacteria | 4936 |
| 556 | Ga0466957_0025827 | 3300044842 | Bacteria | 3482 |
| 557 | Ga0466957_0036271 | 3300044842 | Bacteria | 2964 |
| 558 | Ga0466957_0070187 | 3300044842 | Bacteria | 2165 |
| 559 | Ga0466957_0129670 | 3300044842 | Bacteria | 1614 |
| 560 | Ga0466957_0257477 | 3300044842 | Bacteria | 1162 |
| 561 | Ga0466960_0005629 | 3300044901 | Bacteria | 4972 |
| 562 | Ga0466960_0007203 | 3300044901 | Bacteria | 4504 |
| 563 | Ga0466960_0023038 | 3300044901 | Bacteria | 2791 |
| 564 | Ga0466960_0042396 | 3300044901 | Bacteria | 2161 |
| 565 | Ga0466960_0058805 | 3300044901 | Bacteria | 1878 |
| 566 | Ga0466960_0073691 | 3300044901 | Bacteria | 1704 |
| 567 | Ga0466960_0229956 | 3300044901 | Bacteria | 1023 |
| 568 | Ga0466959_0038275 | 3300045049 | Bacteria | 3544 |
| 569 | Ga0466959_0073752 | 3300045049 | Bacteria | 2468 |
| 570 | Ga0466959_0088762 | 3300045049 | Bacteria | 2222 |
| 571 | Ga0466959_0188439 | 3300045049 | Bacteria | 1440 |
| 572 | Ga0466959_0281505 | 3300045049 | Bacteria | 1141 |
| 573 | Ga0466958_0014164 | 3300045836 | Bacteria | 4551 |
| 574 | Ga0466958_0015139 | 3300045836 | Bacteria | 4414 |
| 575 | Ga0466958_0024266 | 3300045836 | Bacteria | 3568 |
| 576 | Ga0466958_0175807 | 3300045836 | Bacteria | 1357 |
| 577 | Ga0466958_0249031 | 3300045836 | Bacteria | 1136 |
| 578 | Ga0466967_0008682 | 3300045976 | Bacteria | 7477 |
| 579 | Ga0466967_0009725 | 3300045976 | Bacteria | 7161 |
| 580 | Ga0466967_0020980 | 3300045976 | Bacteria | 5293 |
| 581 | Ga0466967_0051580 | 3300045976 | Bacteria | 3606 |
| 582 | Ga0466967_0090564 | 3300045976 | Bacteria | 2779 |
| 583 | Ga0466967_0124968 | 3300045976 | Bacteria | 2382 |
| 584 | Ga0466967_0126909 | 3300045976 | Bacteria | 2364 |
| 585 | Ga0466967_0294427 | 3300045976 | Bacteria | 1560 |
| 586 | Ga0466967_1926534 | 3300045976 | Bacteria | 588 |
| 587 | Ga0495592_0000111 | 3300046454 | Bacteria | 71400 |
| 588 | Ga0495592_0144718 | 3300046454 | Bacteria | 1649 |
| 589 | Ga0495592_0351801 | 3300046454 | Bacteria | 944 |
| 590 | Ga0495603_0365842 | 3300046455 | Bacteria | 827 |
| 591 | Ga0495629_0009858 | 3300046459 | Bacteria | 6972 |
| 592 | Ga0495629_0011492 | 3300046459 | Bacteria | 6431 |
| 593 | Ga0495629_0461698 | 3300046459 | Bacteria | 859 |
| 594 | Ga0495641_0036119 | 3300046461 | Bacteria | 2324 |
| 595 | Ga0495641_0343409 | 3300046461 | Bacteria | 674 |
| 596 | Ga0495651_0000068 | 3300046462 | Bacteria | 76489 |
| 597 | Ga0495651_0008120 | 3300046462 | Bacteria | 8047 |
| 598 | Ga0495651_0028073 | 3300046462 | Bacteria | 4386 |
| 599 | Ga0495651_0056235 | 3300046462 | Bacteria | 3023 |
| 600 | Ga0495653_0006022 | 3300046463 | Bacteria | 9934 |
| 601 | Ga0495653_0259887 | 3300046463 | Bacteria | 1148 |
| 602 | Ga0495653_0682139 | 3300046463 | Bacteria | 625 |
| 603 | Ga0495580_0490807 | 3300046472 | Bacteria | 820 |
| 604 | Ga0495582_0125596 | 3300046473 | Bacteria | 1447 |
| 605 | Ga0495639_0363735 | 3300046475 | Bacteria | 727 |
| 606 | Ga0495662_0178557 | 3300046476 | Bacteria | 1046 |
| 607 | Ga0495662_0244597 | 3300046476 | Bacteria | 884 |
| 608 | Ga0495664_0006291 | 3300046477 | Bacteria | 6555 |
| 609 | Ga0495664_0036186 | 3300046477 | Bacteria | 2909 |
| 610 | Ga0495664_0378524 | 3300046477 | Bacteria | 851 |
| 611 | Ga0495594_0317364 | 3300046499 | Bacteria | 888 |
| 612 | Ga0495608_0000160 | 3300046511 | Bacteria | 48626 |
| 613 | Ga0495608_0005659 | 3300046511 | Bacteria | 8919 |
| 614 | Ga0495608_0014575 | 3300046511 | Bacteria | 5454 |
| 615 | Ga0495608_0037195 | 3300046511 | Bacteria | 3274 |
| 616 | Ga0495608_0076266 | 3300046511 | Bacteria | 2184 |
| 617 | Ga0495618_0035874 | 3300046514 | Bacteria | 3112 |
| 618 | Ga0495618_0109181 | 3300046514 | Bacteria | 1771 |
| 619 | Ga0495628_0001952 | 3300046516 | Bacteria | 18703 |
| 620 | Ga0495628_0051285 | 3300046516 | Bacteria | 3262 |
| 621 | Ga0495628_0119344 | 3300046516 | Bacteria | 2024 |
| 622 | Ga0495628_0224652 | 3300046516 | Bacteria | 1409 |
| 623 | Ga0495628_0546007 | 3300046516 | Bacteria | 832 |
| 624 | Ga0495630_0073467 | 3300046517 | Bacteria | 2575 |
| 625 | Ga0495630_0271984 | 3300046517 | Bacteria | 1294 |
| 626 | Ga0495630_0336367 | 3300046517 | Bacteria | 1155 |
| 627 | Ga0495666_0043595 | 3300046526 | Bacteria | 2167 |
| 628 | Ga0495666_0315880 | 3300046526 | Bacteria | 705 |
| 629 | Ga0495652_0000440 | 3300046529 | Bacteria | 48629 |
| 630 | Ga0495652_0006040 | 3300046529 | Bacteria | 11325 |
| 631 | Ga0495652_0007093 | 3300046529 | Bacteria | 10344 |
| 632 | Ga0495652_0119915 | 3300046529 | Bacteria | 2100 |
| 633 | Ga0495652_0305175 | 3300046529 | Bacteria | 1155 |
| 634 | Ga0495665_0011687 | 3300046531 | Bacteria | 4757 |
| 635 | Ga0495640_0025998 | 3300046533 | Bacteria | 4238 |
| 636 | Ga0495640_0074262 | 3300046533 | Bacteria | 2274 |
| 637 | Ga0495640_0188589 | 3300046533 | Bacteria | 1311 |
| 638 | Ga0495587_0000056 | 3300046536 | Bacteria | 96726 |
| 639 | Ga0495587_0020297 | 3300046536 | Bacteria | 4102 |
| 640 | Ga0495587_0028292 | 3300046536 | Bacteria | 3409 |
| 641 | Ga0495587_0041551 | 3300046536 | Bacteria | 2743 |
| 642 | Ga0495645_0043469 | 3300046543 | Bacteria | 3277 |
| 643 | Ga0495645_0108658 | 3300046543 | Bacteria | 1964 |
| 644 | Ga0495667_0000078 | 3300046559 | Bacteria | 71356 |
| 645 | Ga0495667_0008381 | 3300046559 | Bacteria | 7011 |
| 646 | Ga0495667_0016093 | 3300046559 | Bacteria | 5055 |
| 647 | Ga0495667_0057070 | 3300046559 | Bacteria | 2567 |
| 648 | Ga0495667_0060306 | 3300046559 | Bacteria | 2488 |
| 649 | Ga0495625_0481392 | 3300046660 | Bacteria | 762 |
| 650 | Ga0495635_0037440 | 3300046663 | Bacteria | 3358 |
| 651 | Ga0495635_0040265 | 3300046663 | Bacteria | 3229 |
| 652 | Ga0495635_0091804 | 3300046663 | Bacteria | 2076 |
| 653 | Ga0495635_0364193 | 3300046663 | Bacteria | 963 |
| 654 | Ga0495657_0000444 | 3300046675 | Bacteria | 38608 |
| 655 | Ga0495657_0016199 | 3300046675 | Bacteria | 5435 |
| 656 | Ga0495657_0018538 | 3300046675 | Bacteria | 5031 |
| 657 | Ga0495599_0000625 | 3300046678 | Bacteria | 20013 |
| 658 | Ga0495599_0016217 | 3300046678 | Bacteria | 4624 |
| 659 | Ga0495599_0041303 | 3300046678 | Bacteria | 2897 |
| 660 | Ga0495623_0000209 | 3300046679 | Bacteria | 37387 |
| 661 | Ga0495623_0055275 | 3300046679 | Bacteria | 2503 |
| 662 | Ga0495646_0015181 | 3300046680 | Bacteria | 4892 |
| 663 | Ga0495646_0066101 | 3300046680 | Bacteria | 2139 |
| 664 | Ga0495646_0091405 | 3300046680 | Bacteria | 1756 |
| 665 | Ga0495646_0118110 | 3300046680 | Bacteria | 1503 |
| 666 | Ga0495658_0027682 | 3300046683 | Bacteria | 3053 |
| 667 | Ga0495613_0140514 | 3300046689 | Bacteria | 1725 |
| 668 | Ga0495624_0031289 | 3300046690 | Bacteria | 3461 |
| 669 | Ga0495600_0171064 | 3300046809 | Bacteria | 1402 |
| 670 | Ga0495581_0010214 | 3300047315 | Bacteria | 5431 |
| 671 | Ga0495604_0000105 | 3300047317 | Bacteria | 71375 |
| 672 | Ga0495604_0015336 | 3300047317 | Bacteria | 6115 |
| 673 | Ga0495604_0024226 | 3300047317 | Bacteria | 4843 |
| 674 | Ga0495604_0077661 | 3300047317 | Bacteria | 2495 |
| 675 | Ga0495604_1013031 | 3300047317 | Bacteria | 513 |
| 676 | Ga0495674_0069525 | 3300047319 | Bacteria | 3044 |
| 677 | Ga0495674_0080143 | 3300047319 | Bacteria | 2802 |
| 678 | Ga0495674_0121775 | 3300047319 | Bacteria | 2203 |
| 679 | Ga0495680_0000115 | 3300047322 | Bacteria | 76480 |
| 680 | Ga0495680_0007061 | 3300047322 | Bacteria | 10350 |
| 681 | Ga0495680_0017293 | 3300047322 | Bacteria | 6162 |
| 682 | Ga0495680_0215801 | 3300047322 | Bacteria | 1371 |
| 683 | Ga0495680_0248673 | 3300047322 | Bacteria | 1261 |
| 684 | Ga0495675_0000962 | 3300047444 | Bacteria | 17511 |
| 685 | Ga0495675_0009775 | 3300047444 | Bacteria | 5982 |
| 686 | Ga0495675_0032186 | 3300047444 | Bacteria | 3346 |
| 687 | Ga0495684_0037245 | 3300047471 | Bacteria | 3730 |
| 688 | Ga0495684_0201596 | 3300047471 | Bacteria | 1466 |
| 689 | Ga0495593_0040335 | 3300047673 | Bacteria | 2513 |
| 690 | Ga0495593_0083721 | 3300047673 | Bacteria | 1647 |
| 691 | Ga0495593_0145291 | 3300047673 | Bacteria | 1200 |
| 692 | Ga0495602_0000114 | 3300048088 | Bacteria | 76491 |
| 693 | Ga0495602_0023251 | 3300048088 | Bacteria | 6044 |
| 694 | Ga0496100_0050680 | 3300048903 | Bacteria | 2691 |
| 695 | Ga0496100_0636961 | 3300048903 | Bacteria | 829 |
| 696 | Ga0496101_0035974 | 3300048904 | Bacteria | 3505 |
| 697 | Ga0496101_0178834 | 3300048904 | Bacteria | 1633 |
| 698 | Ga0496101_1148206 | 3300048904 | Bacteria | 609 |
| 699 | Ga0496102_0000144 | 3300048905 | Bacteria | 96509 |
| 700 | Ga0496102_0019635 | 3300048905 | Bacteria | 5954 |
| 701 | Ga0496102_0070174 | 3300048905 | Bacteria | 3217 |
| 702 | Ga0496102_0149607 | 3300048905 | Bacteria | 2193 |
| 703 | Ga0496103_0000109 | 3300048906 | Bacteria | 90550 |
| 704 | Ga0496104_0000401 | 3300048907 | Bacteria | 37983 |
| 705 | Ga0496104_0021286 | 3300048907 | Bacteria | 5951 |
| 706 | Ga0496104_0124449 | 3300048907 | Bacteria | 2475 |
| 707 | Ga0496104_0277620 | 3300048907 | Bacteria | 1588 |
| 708 | Ga0496104_0414646 | 3300048907 | Bacteria | 1259 |
| 709 | Ga0496104_0758718 | 3300048907 | Bacteria | 877 |
| 710 | Ga0496105_0040230 | 3300048908 | Bacteria | 3853 |
| 711 | Ga0496105_0043102 | 3300048908 | Bacteria | 3722 |
| 712 | Ga0496105_0211368 | 3300048908 | Bacteria | 1581 |
| 713 | Ga0496106_0041444 | 3300048909 | Bacteria | 3450 |
| 714 | Ga0496106_0082843 | 3300048909 | Bacteria | 2466 |
| 715 | Ga0496106_0637560 | 3300048909 | Bacteria | 852 |
| 716 | Ga0496107_0111512 | 3300048910 | Bacteria | 2010 |
| 717 | Ga0496108_0004478 | 3300048911 | Bacteria | 11249 |
| 718 | Ga0496108_0011840 | 3300048911 | Bacteria | 7097 |
| 719 | Ga0496108_0313451 | 3300048911 | Bacteria | 1367 |
| 720 | Ga0496110_0008191 | 3300048913 | Bacteria | 8400 |
| 721 | Ga0496110_0186184 | 3300048913 | Bacteria | 1885 |
| 722 | Ga0496111_0001523 | 3300048914 | Bacteria | 13301 |
| 723 | Ga0496111_0085172 | 3300048914 | Bacteria | 2311 |
| 724 | Ga0496111_0830020 | 3300048914 | Bacteria | 668 |
| 725 | Ga0496112_0006557 | 3300048915 | Bacteria | 10243 |
| 726 | Ga0496112_0023068 | 3300048915 | Bacteria | 5939 |
| 727 | Ga0496112_0035669 | 3300048915 | Bacteria | 4847 |
| 728 | Ga0496112_0076015 | 3300048915 | Bacteria | 3321 |
| 729 | Ga0496112_0119358 | 3300048915 | Bacteria | 2607 |
| 730 | Ga0496112_0164085 | 3300048915 | Bacteria | 2187 |
| 731 | Ga0496112_0514026 | 3300048915 | Bacteria | 1132 |
| 732 | Ga0496113_0003731 | 3300048916 | Bacteria | 9184 |
| 733 | Ga0496113_0035198 | 3300048916 | Bacteria | 3661 |
| 734 | Ga0496113_0124132 | 3300048916 | Bacteria | 2021 |
| 735 | Ga0496113_0141023 | 3300048916 | Bacteria | 1896 |
| 736 | Ga0496113_0291762 | 3300048916 | Bacteria | 1305 |
| 737 | Ga0496113_0497512 | 3300048916 | Bacteria | 979 |
| 738 | Ga0496113_0662143 | 3300048916 | Bacteria | 834 |
| 739 | Ga0496114_0024846 | 3300048917 | Bacteria | 4891 |
| 740 | Ga0496114_0094110 | 3300048917 | Bacteria | 2548 |
| 741 | Ga0496114_0149572 | 3300048917 | Bacteria | 2025 |
| 742 | Ga0496114_0369150 | 3300048917 | Unclassified | 1270 |
| 743 | Ga0496114_1540627 | 3300048917 | Bacteria | 553 |
| 744 | Ga0496115_0051555 | 3300048918 | Bacteria | 3299 |
| 745 | Ga0496115_0124166 | 3300048918 | Bacteria | 2126 |
| 746 | Ga0496115_0134687 | 3300048918 | Bacteria | 2037 |
| 747 | Ga0496115_0155943 | 3300048918 | Bacteria | 1886 |
| 748 | Ga0496115_0174837 | 3300048918 | Bacteria | 1775 |
| 749 | Ga0496116_0000128 | 3300048919 | Bacteria | 158700 |
| 750 | Ga0496117_0000034 | 3300048920 | Bacteria | 328334 |
| 751 | Ga0496117_0000356 | 3300048920 | Bacteria | 80485 |
| 752 | Ga0496117_0006770 | 3300048920 | Bacteria | 11440 |
| 753 | Ga0496118_0000631 | 3300048921 | Bacteria | 57803 |
| 754 | Ga0496119_0007264 | 3300048922 | Bacteria | 10021 |
| 755 | Ga0496120_0002945 | 3300048923 | Bacteria | 16222 |
| 756 | Ga0496122_0076243 | 3300048925 | Bacteria | 2360 |
| 757 | Ga0496123_0088431 | 3300048926 | Bacteria | 1850 |
| 758 | Ga0496124_0049763 | 3300048927 | Bacteria | 3573 |
| 759 | Ga0496125_0023870 | 3300048928 | Bacteria | 5634 |
| 760 | Ga0496126_0000379 | 3300048929 | Bacteria | 92123 |
| 761 | Ga0496126_0000772 | 3300048929 | Bacteria | 57832 |
| 762 | Ga0501310_000323 | 3300049130 | Bacteria | 4369 |
| 763 | Ga0501034_0611195 | 3300049571 | Bacteria | 995 |
| 764 | Ga0501040_0167717 | 3300049576 | Bacteria | 1554 |
| 765 | Ga0501042_0047380 | 3300049578 | Bacteria | 3065 |
| 766 | Ga0501074_0202457 | 3300049590 | Bacteria | 1415 |
| 767 | Ga0501075_0592049 | 3300049591 | Bacteria | 846 |
| 768 | Ga0501077_0286336 | 3300049593 | Bacteria | 1049 |
| 769 | Ga0501079_0532430 | 3300049741 | Bacteria | 924 |
| 770 | Ga0501081_0074720 | 3300049743 | Bacteria | 2365 |
| 771 | Ga0501044_0579362 | 3300049823 | Bacteria | 1017 |
| 772 | nmdc:mga03683_250625_c1 | 3300050489 | Bacteria | 822 |
| 773 | nmdc:mga00v17_254089_c1 | 3300050491 | Bacteria | 1140 |
| 774 | nmdc:mga0yw44_231449_c1 | 3300050492 | Bacteria | 1227 |
| 775 | nmdc:mga06z11_20923_c1 | 3300050494 | Bacteria | 3031 |
| 776 | nmdc:mga07m45_163378_c1 | 3300050496 | Bacteria | 1293 |
| 777 | nmdc:mga05p37_146143_c1 | 3300050507 | Bacteria | 2895 |
| 778 | nmdc:mga05p37_330264_c1 | 3300050507 | Bacteria | 1801 |
| 779 | nmdc:mga05p37_421744_c1 | 3300050507 | Bacteria | 1552 |
| 780 | nmdc:mga05p37_612356_c1 | 3300050507 | Bacteria | 1227 |
| 781 | nmdc:mga05p37_61_c1 | 3300050507 | Bacteria | 94943 |
| 782 | nmdc:mga05p37_945076_c1 | 3300050507 | Bacteria | 923 |
| 783 | nmdc:mga09592_173256_c1 | 3300050508 | Bacteria | 1866 |
| 784 | nmdc:mga09592_17_c1 | 3300050508 | Bacteria | 95560 |
| 785 | nmdc:mga09592_193090_c1 | 3300050508 | Bacteria | 1762 |
| 786 | nmdc:mga09592_202018_c1 | 3300050508 | Bacteria | 1721 |
| 787 | nmdc:mga0qj67_251_c1 | 3300050509 | Bacteria | 36682 |
| 788 | nmdc:mga0qj67_32_c1 | 3300050509 | Bacteria | 98555 |
| 789 | nmdc:mga06r32_26_c1 | 3300050510 | Bacteria | 90558 |
| 790 | nmdc:mga06r32_309247_c1 | 3300050510 | Bacteria | 1566 |
| 791 | nmdc:mga06r32_357223_c1 | 3300050510 | Bacteria | 1445 |
| 792 | nmdc:mga06r32_36371_c1 | 3300050510 | Bacteria | 4651 |
| 793 | nmdc:mga08y16_11871_c1 | 3300050511 | Bacteria | 9152 |
| 794 | nmdc:mga08y16_599300_c1 | 3300050511 | Bacteria | 1111 |
| 795 | nmdc:mga08y16_938130_c1 | 3300050511 | Bacteria | 849 |
| 796 | nmdc:mga0n895_119064_c1 | 3300050512 | Bacteria | 2662 |
| 797 | nmdc:mga0n895_482230_c1 | 3300050512 | Bacteria | 1250 |
| 798 | nmdc:mga0n895_5449_c1 | 3300050512 | Bacteria | 10639 |
| 799 | nmdc:mga0rr50_101408_c1 | 3300050513 | Bacteria | 2263 |
| 800 | nmdc:mga0rr50_121734_c1 | 3300050513 | Bacteria | 2078 |
| 801 | nmdc:mga0rr50_4411_c1 | 3300050513 | Bacteria | 8271 |
| 802 | nmdc:mga08x19_127119_c1 | 3300050514 | Bacteria | 1712 |
| 803 | nmdc:mga08x19_14540_c1 | 3300050514 | Bacteria | 4774 |
| 804 | nmdc:mga08x19_26800_c1 | 3300050514 | Bacteria | 3599 |
| 805 | nmdc:mga0a205_104928_c1 | 3300050515 | Bacteria | 2725 |
| 806 | nmdc:mga0a205_18307_c1 | 3300050515 | Bacteria | 6584 |
| 807 | nmdc:mga0sz30_422088_c1 | 3300050516 | Bacteria | 598 |
| 808 | Ga0495601_0202590 | 3300053077 | Bacteria | 1296 |
| 809 | Ga0495595_0000926 | 3300053084 | Bacteria | 11317 |
| 810 | Ga0495595_0055755 | 3300053084 | Bacteria | 1840 |
| 811 | Ga0495595_0150537 | 3300053084 | Bacteria | 1145 |
| 812 | Ga0495619_0023221 | 3300053085 | Bacteria | 3975 |
| 813 | Ga0495619_0169957 | 3300053085 | Bacteria | 1507 |
| 814 | Ga0500559_0002209 | 3300053136 | Bacteria | 10282 |
| 815 | Ga0500559_0013186 | 3300053136 | Bacteria | 3501 |
| 816 | Ga0500577_0001516 | 3300053142 | Bacteria | 5919 |
| 817 | Ga0500616_0000269 | 3300053153 | Bacteria | 77807 |
| 818 | Ga0500637_0212150 | 3300053178 | Bacteria | 1098 |
| 819 | Ga0500645_003326 | 3300053730 | Bacteria | 6599 |
| 820 | Ga0501084_0255272 | 3300054114 | Bacteria | 1480 |
| 821 | Ga0466962_0006353 | 3300061719 | Bacteria | 5674 |
| 822 | Ga0466962_0013272 | 3300061719 | Bacteria | 3962 |
| 823 | Ga0466962_0177033 | 3300061719 | Bacteria | 1039 |
| 824 | 2795781257 | 2795385470 | Bacteria | 8317180 |
| 825 | 2559428537 | 2558860280 | Bacteria | 11429938 |
| 826 | 2583148814 | 2582580736 | Bacteria | 5325865 |
| 827 | 2586064763 | 2585427649 | Bacteria | 9053857 |
| 828 | 2643996672 | 2643221597 | Bacteria | 3347721 |
| 829 | 2676475006 | 2675903058 | Bacteria | 6822861 |
| 830 | 2753069749 | 2751185734 | Bacteria | 8863695 |
| 831 | 2776377725 | 2775506925 | Bacteria | 7237746 |
| 832 | 2791913881 | 2791354901 | Bacteria | 8322202 |
| 833 | 2795791853 | 2795385472 | Bacteria | 6627535 |
| 834 | 2809586002 | 2808606522 | Bacteria | 9488490 |
| 835 | 2821271037 | 2821268502 | Bacteria | 3750023 |
| 836 | 2827630825 | 2827628540 | Bacteria | 6858585 |
| 837 | 2832005296 | 2832004796 | Bacteria | 6538017 |
| 838 | 2833712056 | 2833709550 | Bacteria | 4008291 |
| 839 | 2844842158 | 2844841374 | Bacteria | 3917147 |
| 840 | 2862509783 | 2862507626 | Bacteria | 9425308 |
| 841 | 2863070140 | 2863067949 | Bacteria | 8541735 |
| 842 | 2866068977 | 2866065130 | Bacteria | 6518152 |
| 843 | 2866555750 | 2866552031 | Bacteria | 5824618 |
| 844 | 2866617309 | 2866612099 | Bacteria | 7543886 |
| 845 | 2867318933 | 2867312974 | Bacteria | 7058875 |
| 846 | 2867323917 | 2867319477 | Bacteria | 7069771 |
| 847 | 2870727738 | 2870721527 | Bacteria | 9689237 |
| 848 | 2891331679 | 2891326441 | Bacteria | 6439512 |
| 849 | 2899361202 | 2899359706 | Bacteria | 10940472 |
| 850 | 2899373690 | 2899370129 | Bacteria | 6781179 |
| 851 | 2915359419 | 2915358134 | Bacteria | 6050864 |
| 852 | 2915773095 | 2915768154 | Bacteria | 8424322 |
| 853 | 2917745358 | 2917736166 | Bacteria | 9690793 |
| 854 | 2919057804 | 2919055335 | Bacteria | 3875751 |
| 855 | 2919524205 | 2919523602 | Bacteria | 3788128 |
| 856 | 2928156185 | 2928153084 | Bacteria | 4020257 |
| 857 | 3006394603 | 3006393351 | Bacteria | 6615579 |
| 858 | 8003320899 | 8003314358 | Bacteria | 10575343 |
| 859 | 8003860141 | 8003856774 | Bacteria | 7675274 |
| 860 | 8047718493 | 8047710418 | Bacteria | 11023148 |
| 861 | 8054475565 | 8054472261 | Bacteria | 7464355 |
| 862 | 8056211027 | 8056207758 | Bacteria | 8639239 |
| 863 | JGI24735J21928_10003386 | |||
| 864 | JGI25406J46586_10002808 | |||
| 865 | rootH1_10163609 | |||
| 866 | Ga0006562J51391_1047355 | |||
| 867 | Ga0006562J51391_1047356 | |||
| 868 | JGI25405J52794_10016996 | |||
| 869 | Ga0070658_10033585 | |||
| 870 | Ga0070658_10400331 | |||
| 871 | Ga0070658_10566819 | |||
| 872 | Ga0070683_100265627 | |||
| 873 | Ga0070683_100765296 | |||
| 874 | Ga0070690_100214758 | |||
| 875 | Ga0070670_100008432 | |||
| 876 | Ga0070670_101257718 | |||
| 877 | Ga0068869_100004366 | |||
| 878 | Ga0068869_100037117 | |||
| 879 | Ga0070680_100001022 | |||
| 880 | Ga0070680_100023433 | |||
| 881 | Ga0070680_100078505 | |||
| 882 | Ga0070680_100321637 | |||
| 883 | Ga0070682_100039292 | |||
| 884 | Ga0070682_100520951 | |||
| 885 | Ga0068868_100067604 | |||
| 886 | Ga0068868_100116848 | |||
| 887 | Ga0068868_100318784 | |||
| 888 | Ga0068868_100741172 | |||
| 889 | Ga0070660_100234868 | |||
| 890 | Ga0070660_100311149 | |||
| 891 | Ga0070660_100344594 | |||
| 892 | Ga0070689_100042620 | |||
| 893 | Ga0070687_100098834 | |||
| 894 | Ga0070661_100044086 | |||
| 895 | Ga0070692_10063267 | |||
| 896 | Ga0070668_100119510 | |||
| 897 | Ga0070668_100153867 | |||
| 898 | Ga0070668_100241165 | |||
| 899 | Ga0070669_100301847 | |||
| 900 | Ga0070675_100004898 | |||
| 901 | Ga0070675_100040523 | |||
| 902 | Ga0070671_100000788 | |||
| 903 | Ga0070671_100027321 | |||
| 904 | Ga0070671_100464712 | |||
| 905 | Ga0070674_100095515 | |||
| 906 | Ga0070688_100056016 | |||
| 907 | Ga0070659_100058286 | |||
| 908 | Ga0070659_100268360 | |||
| 909 | Ga0070667_100005829 | |||
| 910 | Ga0070667_100076075 | |||
| 911 | Ga0070667_100332012 | |||
| 912 | Ga0070709_10006691 | |||
| 913 | Ga0070709_10141383 | |||
| 914 | Ga0070709_10259301 | |||
| 915 | Ga0070709_10547332 | |||
| 916 | Ga0070714_100012058 | |||
| 917 | Ga0070714_100058285 | |||
| 918 | Ga0070714_100319134 | |||
| 919 | Ga0070714_100559150 | |||
| 920 | Ga0070713_100001594 | |||
| 921 | Ga0070713_100497324 | |||
| 922 | Ga0070713_100677714 | |||
| 923 | Ga0070710_10000158 | |||
| 924 | Ga0070710_10029894 | |||
| 925 | Ga0070710_10292154 | |||
| 926 | Ga0070711_100004649 | |||
| 927 | Ga0070711_100440873 | |||
| 928 | Ga0070700_100163203 | |||
| 929 | Ga0070700_100769095 | |||
| 930 | Ga0070708_100138617 | |||
| 931 | Ga0070708_100502169 | |||
| 932 | Ga0070663_100000894 | |||
| 933 | Ga0070663_100036261 | |||
| 934 | Ga0070663_100037750 | |||
| 935 | Ga0070662_100134846 | |||
| 936 | Ga0070681_10000077 | |||
| 937 | Ga0070681_10010387 | |||
| 938 | Ga0070681_10753888 | |||
| 939 | Ga0070685_10048131 | |||
| 940 | Ga0070685_10202488 | |||
| 941 | Ga0070706_100002832 | |||
| 942 | Ga0070706_100018428 | |||
| 943 | Ga0070706_100105633 | |||
| 944 | Ga0070706_100176641 | |||
| 945 | Ga0070706_100330254 | |||
| 946 | Ga0070706_100820602 | |||
| 947 | Ga0070707_100001616 | |||
| 948 | Ga0070707_100005349 | |||
| 949 | Ga0070707_100016947 | |||
| 950 | Ga0070707_100050761 | |||
| 951 | Ga0070707_100130225 | |||
| 952 | Ga0070698_100003363 | |||
| 953 | Ga0070698_100194581 | |||
| 954 | Ga0070699_100523896 | |||
| 955 | Ga0070679_100000135 | |||
| 956 | Ga0070679_100030963 | |||
| 957 | Ga0070684_100503425 | |||
| 958 | Ga0070684_100635194 | |||
| 959 | Ga0070684_100675410 | |||
| 960 | Ga0068853_100052520 | |||
| 961 | Ga0068853_100797608 | |||
| 962 | Ga0070672_100070075 | |||
| 963 | Ga0070686_100491859 | |||
| 964 | Ga0070693_100013519 | |||
| 965 | Ga0070665_100001822 | |||
| 966 | Ga0070665_100016770 | |||
| 967 | Ga0070665_100040243 | |||
| 968 | Ga0070665_100082987 | |||
| 969 | Ga0070665_100925952 | |||
| 970 | Ga0070704_100424603 | |||
| 971 | Ga0068855_100087663 | |||
| 972 | Ga0070664_100046271 | |||
| 973 | Ga0068857_100025063 | |||
| 974 | Ga0068857_100142564 | |||
| 975 | Ga0068856_100029765 | |||
| 976 | Ga0068856_100037302 | |||
| 977 | Ga0068856_100109464 | |||
| 978 | Ga0070702_100000249 | |||
| 979 | Ga0068852_100033570 | |||
| 980 | Ga0068852_100038284 | |||
| 981 | Ga0068859_100100847 | |||
| 982 | Ga0068864_100104390 | |||
| 983 | Ga0068864_100261981 | |||
| 984 | Ga0068864_100346725 | |||
| 985 | Ga0068870_10000485 | |||
| 986 | Ga0068870_10061606 | |||
| 987 | Ga0068863_100000825 | |||
| 988 | Ga0068863_100002727 | |||
| 989 | Ga0068863_100006552 | |||
| 990 | Ga0068863_100113603 | |||
| 991 | Ga0068863_100323707 | |||
| 992 | Ga0068863_100663579 | |||
| 993 | Ga0068863_101087344 | |||
| 994 | Ga0068858_100039022 | |||
| 995 | Ga0068858_100219548 | |||
| 996 | Ga0068860_100000067 | |||
| 997 | Ga0068860_100046376 | |||
| 998 | Ga0068860_100110967 | |||
| 999 | Ga0068862_100016456 | |||
| 1000 | Ga0081455_10000692 | |||
| 1001 | Ga0081455_10008638 | |||
| 1002 | Ga0081538_10000016 | |||
| 1003 | Ga0081540_1073793 | |||
| 1004 | Ga0081539_10000401 | |||
| 1005 | Ga0070717_10036632 | |||
| 1006 | Ga0070717_10091250 | |||
| 1007 | Ga0070717_10096071 | |||
| 1008 | Ga0070717_10106141 | |||
| 1009 | Ga0070717_10771629 | |||
| 1010 | Ga0070717_10885321 | |||
| 1011 | Ga0075365_10088197 | |||
| 1012 | Ga0075368_10287904 | |||
| 1013 | Ga0075364_10031406 | |||
| 1014 | Ga0070715_10008053 | |||
| 1015 | Ga0070716_100014341 | |||
| 1016 | Ga0070716_100134791 | |||
| 1017 | Ga0070712_100143777 | |||
| 1018 | Ga0070712_100542480 | |||
| 1019 | Ga0075367_10002964 | |||
| 1020 | Ga0097621_100079102 | |||
| 1021 | Ga0075370_10142347 | |||
| 1022 | Ga0075428_100005695 | |||
| 1023 | Ga0075428_100107508 | |||
| 1024 | Ga0075428_100114469 | |||
| 1025 | Ga0075428_100842658 | |||
| 1026 | Ga0075430_100002967 | |||
| 1027 | Ga0075430_100012455 | |||
| 1028 | Ga0075430_100021018 | |||
| 1029 | Ga0075430_100194709 | |||
| 1030 | Ga0075431_100014674 | |||
| 1031 | Ga0075431_100040656 | |||
| 1032 | Ga0075431_100113732 | |||
| 1033 | Ga0075431_100182363 | |||
| 1034 | Ga0075431_100562800 | |||
| 1035 | Ga0075433_10016144 | |||
| 1036 | Ga0075433_10085559 | |||
| 1037 | Ga0075434_100000965 | |||
| 1038 | Ga0075434_100011948 | |||
| 1039 | Ga0075434_100113850 | |||
| 1040 | Ga0075429_100007259 | |||
| 1041 | Ga0075429_100012278 | |||
| 1042 | Ga0075429_100057852 | |||
| 1043 | Ga0075429_100092771 | |||
| 1044 | Ga0075429_101037636 | |||
| 1045 | Ga0068865_100065162 | |||
| 1046 | Ga0068865_100324869 | |||
| 1047 | Ga0075436_100000682 | |||
| 1048 | Ga0075436_100060296 | |||
| 1049 | Ga0097620_100100847 | |||
| 1050 | Ga0075435_100007979 | |||
| 1051 | Ga0075435_100449943 | |||
| 1052 | Ga0075435_100636079 | |||
| 1053 | Ga0099794_10104014 | |||
| 1054 | Ga0105250_10067032 | |||
| 1055 | Ga0105240_10058886 | |||
| 1056 | Ga0105240_10358895 | |||
| 1057 | Ga0111539_10296595 | |||
| 1058 | Ga0105245_10001147 | |||
| 1059 | Ga0105245_10016486 | |||
| 1060 | Ga0105247_10599976 | |||
| 1061 | Ga0114129_10000557 | |||
| 1062 | Ga0114129_10058757 | |||
| 1063 | Ga0114129_10161046 | |||
| 1064 | Ga0114129_10184086 | |||
| 1065 | Ga0114129_10915361 | |||
| 1066 | Ga0105243_10233384 | |||
| 1067 | Ga0105243_11297091 | |||
| 1068 | Ga0105241_10004400 | |||
| 1069 | Ga0105241_10118932 | |||
| 1070 | Ga0105241_10297368 | |||
| 1071 | Ga0105248_10010638 | |||
| 1072 | Ga0105248_10053245 | |||
| 1073 | Ga0105237_10078667 | |||
| 1074 | Ga0105237_10129074 | |||
| 1075 | Ga0105238_10009854 | |||
| 1076 | Ga0105238_10085457 | |||
| 1077 | Ga0105238_10272592 | |||
| 1078 | Ga0105238_10385716 | |||
| 1079 | Ga0105249_10368751 | |||
| 1080 | Ga0105249_10394849 | |||
| 1081 | Ga0105249_11343836 | |||
| 1082 | Ga0105033_104027 | |||
| 1083 | Ga0105239_10120671 | |||
| 1084 | Ga0105239_10410737 | |||
| 1085 | Ga0105246_10000043 | |||
| 1086 | Ga0105246_10745099 | |||
| 1087 | Ga0157317_1003027 | |||
| 1088 | Ga0157373_10055589 | |||
| 1089 | Ga0157371_10534289 | |||
| 1090 | Ga0157370_10011499 | |||
| 1091 | Ga0157370_10098631 | |||
| 1092 | Ga0157370_10147401 | |||
| 1093 | Ga0157369_10295797 | |||
| 1094 | Ga0157369_11219879 | |||
| 1095 | Ga0157369_11311859 | |||
| 1096 | Ga0157369_11506491 | |||
| 1097 | Ga0157374_11065189 | |||
| 1098 | Ga0157372_10000043 | |||
| 1099 | Ga0157372_10111537 | |||
| 1100 | Ga0157372_11076395 | |||
| 1101 | Ga0157375_10226622 | |||
| 1102 | Ga0163163_10005228 | |||
| 1103 | Ga0163163_10307621 | |||
| 1104 | Ga0163163_10594637 | |||
| 1105 | Ga0163163_10786935 | |||
| 1106 | Ga0163163_11435954 | |||
| 1107 | Ga0163163_11477646 | |||
| 1108 | Ga0157377_10034027 | |||
| 1109 | Ga0157377_10310550 | |||
| 1110 | Ga0157379_10025353 | |||
| 1111 | Ga0157379_10032051 | |||
| 1112 | Ga0157379_10203740 | |||
| 1113 | Ga0157376_10011635 | |||
| 1114 | Ga0157376_10164065 | |||
| 1115 | Ga0206356_10781422 | |||
| 1116 | Ga0206356_11371595 | |||
| 1117 | Ga0206351_10984482 | |||
| 1118 | Ga0206353_11838987 | |||
| 1119 | Ga0206353_11915281 | |||
| 1120 | Ga0206353_12028661 | |||
| 1121 | Ga0213875_10001574 | |||
| 1122 | Ga0209677_100375 | |||
| 1123 | Ga0207692_10001172 | |||
| 1124 | Ga0207692_10002461 | |||
| 1125 | Ga0207692_10048263 | |||
| 1126 | Ga0207710_10103916 | |||
| 1127 | Ga0207688_10000704 | |||
| 1128 | Ga0207680_10019495 | |||
| 1129 | Ga0207685_10077039 | |||
| 1130 | Ga0207699_10003198 | |||
| 1131 | Ga0207699_10032994 | |||
| 1132 | Ga0207699_10049509 | |||
| 1133 | Ga0207699_10066106 | |||
| 1134 | Ga0207699_10149393 | |||
| 1135 | Ga0207699_10300012 | |||
| 1136 | Ga0207643_10000255 | |||
| 1137 | Ga0207643_10061711 | |||
| 1138 | Ga0207705_10025237 | |||
| 1139 | Ga0207705_10170195 | |||
| 1140 | Ga0207705_10213785 | |||
| 1141 | Ga0207705_10578852 | |||
| 1142 | Ga0207684_10010471 | |||
| 1143 | Ga0207684_10015809 | |||
| 1144 | Ga0207684_10213547 | |||
| 1145 | Ga0207684_10310661 | |||
| 1146 | Ga0207684_10863730 | |||
| 1147 | Ga0207654_10018194 | |||
| 1148 | Ga0207707_10000089 | |||
| 1149 | Ga0207707_10054688 | |||
| 1150 | Ga0207695_10061148 | |||
| 1151 | Ga0207671_10164128 | |||
| 1152 | Ga0207693_10019042 | |||
| 1153 | Ga0207693_10150444 | |||
| 1154 | Ga0207693_10206818 | |||
| 1155 | Ga0207693_10473026 | |||
| 1156 | Ga0207663_10073799 | |||
| 1157 | Ga0207663_10075252 | |||
| 1158 | Ga0207660_10001907 | |||
| 1159 | Ga0207660_10002528 | |||
| 1160 | Ga0207660_10267695 | |||
| 1161 | Ga0207662_10122244 | |||
| 1162 | Ga0207657_10017121 | |||
| 1163 | Ga0207649_10007713 | |||
| 1164 | Ga0207652_10000015 | |||
| 1165 | Ga0207652_10015476 | |||
| 1166 | Ga0207646_10000731 | |||
| 1167 | Ga0207646_10009013 | |||
| 1168 | Ga0207646_10048380 | |||
| 1169 | Ga0207646_10116996 | |||
| 1170 | Ga0207646_10403354 | |||
| 1171 | Ga0207646_11218803 | |||
| 1172 | Ga0207681_10136888 | |||
| 1173 | Ga0207694_10025217 | |||
| 1174 | Ga0207694_10110096 | |||
| 1175 | Ga0207650_10001380 | |||
| 1176 | Ga0207659_10008047 | |||
| 1177 | Ga0207659_10252210 | |||
| 1178 | Ga0207687_10004511 | |||
| 1179 | Ga0207687_10250138 | |||
| 1180 | Ga0207700_10035538 | |||
| 1181 | Ga0207700_10154973 | |||
| 1182 | Ga0207700_10196572 | |||
| 1183 | Ga0207700_10402338 | |||
| 1184 | Ga0207700_10688340 | |||
| 1185 | Ga0207664_10009298 | |||
| 1186 | Ga0207664_10023058 | |||
| 1187 | Ga0207664_10049093 | |||
| 1188 | Ga0207664_10049924 | |||
| 1189 | Ga0207664_10049971 | |||
| 1190 | Ga0207644_10000647 | |||
| 1191 | Ga0207644_10019645 | |||
| 1192 | Ga0207690_10018313 | |||
| 1193 | Ga0207690_10384941 | |||
| 1194 | Ga0207706_10061473 | |||
| 1195 | Ga0207706_10200245 | |||
| 1196 | Ga0207709_10281390 | |||
| 1197 | Ga0207670_10176633 | |||
| 1198 | Ga0207669_10075981 | |||
| 1199 | Ga0207704_10066480 | |||
| 1200 | Ga0207665_10029654 | |||
| 1201 | Ga0207691_10025726 | |||
| 1202 | Ga0207711_10827028 | |||
| 1203 | Ga0207689_10003676 | |||
| 1204 | Ga0207689_10099783 | |||
| 1205 | Ga0207661_10041234 | |||
| 1206 | Ga0207661_10098684 | |||
| 1207 | Ga0207661_10126896 | |||
| 1208 | Ga0207661_10146991 | |||
| 1209 | Ga0207661_10233247 | |||
| 1210 | Ga0207661_10591621 | |||
| 1211 | Ga0207679_10001781 | |||
| 1212 | Ga0207679_10140684 | |||
| 1213 | Ga0207667_10029004 | |||
| 1214 | Ga0207667_10117863 | |||
| 1215 | Ga0207651_10022933 | |||
| 1216 | Ga0207668_10022464 | |||
| 1217 | Ga0207668_10108700 | |||
| 1218 | Ga0207668_10199949 | |||
| 1219 | Ga0207640_10078681 | |||
| 1220 | Ga0207658_10002268 | |||
| 1221 | Ga0207658_10060272 | |||
| 1222 | Ga0207677_10044300 | |||
| 1223 | Ga0207677_10074779 | |||
| 1224 | Ga0207703_10035233 | |||
| 1225 | Ga0207703_10035764 | |||
| 1226 | Ga0207639_10926897 | |||
| 1227 | Ga0207678_10000120 | |||
| 1228 | Ga0207678_10000346 | |||
| 1229 | Ga0207678_10054836 | |||
| 1230 | Ga0207708_10372890 | |||
| 1231 | Ga0207702_10001514 | |||
| 1232 | Ga0207702_10041795 | |||
| 1233 | Ga0207702_10073412 | |||
| 1234 | Ga0207702_10085630 | |||
| 1235 | Ga0207702_10147451 | |||
| 1236 | Ga0207702_10459294 | |||
| 1237 | Ga0207641_10003465 | |||
| 1238 | Ga0207641_10005835 | |||
| 1239 | Ga0207641_10020496 | |||
| 1240 | Ga0207641_10081134 | |||
| 1241 | Ga0207641_10082921 | |||
| 1242 | Ga0207641_10380490 | |||
| 1243 | Ga0207676_10000914 | |||
| 1244 | Ga0207676_10407544 | |||
| 1245 | Ga0207676_10642923 | |||
| 1246 | Ga0207676_10743268 | |||
| 1247 | Ga0207674_10020943 | |||
| 1248 | Ga0207674_10090197 | |||
| 1249 | Ga0207674_10346953 | |||
| 1250 | Ga0207675_100020646 | |||
| 1251 | Ga0207683_10001990 | |||
| 1252 | Ga0207683_10335841 | |||
| 1253 | Ga0207698_10003656 | |||
| 1254 | Ga0207698_10236724 | |||
| 1255 | Ga0207428_10001605 | |||
| 1256 | Ga0268266_10004303 | |||
| 1257 | Ga0268266_10015983 | |||
| 1258 | Ga0268266_10057047 | |||
| 1259 | Ga0268266_10083185 | |||
| 1260 | Ga0268264_10000114 | |||
| 1261 | Ga0268264_10044861 | |||
| 1262 | Ga0307515_10142969 | |||
| 1263 | Ga0307515_10238616 | |||
| 1264 | Ga0307511_10001747 | |||
| 1265 | Ga0307512_10079030 | |||
| 1266 | Ga0314311_1200767 | |||
| 1267 | Ga0316180_1017775 | |||
| 1268 | Ga0307513_10034844 | |||
| 1269 | Ga0307509_10056168 | |||
| 1270 | Ga0307509_10261811 | |||
| 1271 | Ga0307408_100132511 | |||
| 1272 | Ga0307508_10011315 | |||
| 1273 | Ga0316575_10037052 | |||
| 1274 | Ga0307405_10042305 | |||
| 1275 | Ga0307405_10986081 | |||
| 1276 | Ga0307413_10049467 | |||
| 1277 | Ga0307518_10000517 | |||
| 1278 | Ga0307410_10057630 | |||
| 1279 | Ga0307410_10870975 | |||
| 1280 | Ga0307406_10027269 | |||
| 1281 | Ga0307406_10365759 | |||
| 1282 | Ga0307407_10012377 | |||
| 1283 | Ga0307412_10059506 | |||
| 1284 | Ga0307412_10586734 | |||
| 1285 | Ga0307409_100000307 | |||
| 1286 | Ga0307409_100069674 | |||
| 1287 | Ga0307409_100095284 | |||
| 1288 | Ga0307416_100001292 | |||
| 1289 | Ga0307416_100242948 | |||
| 1290 | Ga0307416_100515423 | |||
| 1291 | Ga0307416_102139783 | |||
| 1292 | Ga0307411_10140942 | |||
| 1293 | Ga0307411_10150169 | |||
| 1294 | Ga0307415_100000008 | |||
| 1295 | Ga0307415_100027555 | |||
| 1296 | Ga0307415_100028203 | |||
| 1297 | Ga0316585_10084182 | |||
| 1298 | Ga0373930_0007860 | |||
| 1299 | Ga0373958_0063072 | |||
| 1300 | Ga0373959_0047484 | |||
| 1301 | Ga0373938_0046063 | |||
| 1302 | Ga0373928_0037626 | |||
| 1303 | Ga0373934_0000049 | |||
| 1304 | Ga0373934_0006516 | |||
| 1305 | Ga0373944_0046946 | |||
| 1306 | Ga0373949_0040472 | |||
| 1307 | Ga0373951_0010768 | |||
| 1308 | Ga0373923_0010142 | |||
| 1309 | Ga0373923_0032238 | |||
| 1310 | Ga0373936_0119956 | |||
| 1311 | Ga0373939_0007613 | |||
| 1312 | Ga0373941_0041616 | |||
| 1313 | Ga0373945_0043214 | |||
| 1314 | Ga0373953_0000077 | |||
| 1315 | Ga0373954_0016600 | |||
| 1316 | Ga0373954_0088020 | |||
| 1317 | Ga0373954_0130781 | |||
| 1318 | Ga0373956_0000086 | |||
| 1319 | Ga0373956_0026508 | |||
| 1320 | Ga0373956_0053578 | |||
| 1321 | Ga0373956_0065695 | |||
| 1322 | Ga0373957_0000167 | |||
| 1323 | Ga0373957_0014145 | |||
| 1324 | Ga0373960_0113817 | |||
| 1325 | Ga0373943_0072646 | |||
| 1326 | Ga0373943_0213120 | |||
| 1327 | Ga0373946_0130329 | |||
| 1328 | Ga0373955_0000252 | |||
| 1329 | Ga0373955_0005539 | |||
| 1330 | Ga0373955_0018911 | |||
| 1331 | Ga0373942_0066185 | |||
| 1332 | Ga0373962_0006236 | |||
| 1333 | Ga0373924_0002022 | |||
| 1334 | Ga0373924_0063603 | |||
| 1335 | Ga0373931_0105780 | |||
| 1336 | Ga0373931_0125620 | |||
| 1337 | Ga0373927_0477916 | |||
| 1338 | Ga0373933_0000051 | |||
| 1339 | Ga0373933_0007530 | |||
| 1340 | Ga0373933_0013021 | |||
| 1341 | Ga0373933_0039454 | |||
| 1342 | Ga0373947_0017493 | |||
| 1343 | Ga0373947_0669888 | |||
| 1344 | Ga0373937_0000289 | |||
| 1345 | Ga0373937_0040374 | |||
| 1346 | Ga0373937_0065355 | |||
| 1347 | Ga0373937_0252813 | |||
| 1348 | Ga0373925_1039755 | |||
| 1349 | Ga0395899_0006426 | |||
| 1350 | Ga0395900_0091467 | |||
| 1351 | Ga0395900_0098140 | |||
| 1352 | Ga0395898_0226597 | |||
| 1353 | Ga0395898_0973423 | |||
| 1354 | Ga0436364_0580980 | |||
| 1355 | Ga0436364_1139642 | |||
| 1356 | Ga0395901_0205522 | |||
| 1357 | Ga0395901_0260051 | |||
| 1358 | Ga0395901_1424094 | |||
| 1359 | Ga0436365_1884406 | |||
| 1360 | Ga0436362_1009491 | |||
| 1361 | Ga0439465_0003486 | |||
| 1362 | Ga0451795_0390901 | |||
| 1363 | Ga0451833_1468397 | |||
| 1364 | Ga0451853_0401476 | |||
| 1365 | Ga0439448_0033838 | |||
| 1366 | Ga0439449_0131494 | |||
| 1367 | Ga0439449_0189735 | |||
| 1368 | Ga0439463_002459 | |||
| 1369 | Ga0450900_024085 | |||
| 1370 | Ga0450902_036331 | |||
| 1371 | Ga0439458_0003635 | |||
| 1372 | Ga0439459_0003127 | |||
| 1373 | Ga0466969_0004684 | |||
| 1374 | Ga0466972_0009347 | |||
| 1375 | Ga0466972_0009858 | |||
| 1376 | Ga0466972_0030426 | |||
| 1377 | Ga0466972_0265932 | |||
| 1378 | Ga0466965_0000884 | |||
| 1379 | Ga0466965_0001772 | |||
| 1380 | Ga0466965_0052304 | |||
| 1381 | Ga0466965_0366892 | |||
| 1382 | Ga0466966_0001055 | |||
| 1383 | Ga0466966_0141958 | |||
| 1384 | Ga0466966_0148139 | |||
| 1385 | Ga0466966_0154428 | |||
| 1386 | Ga0466966_0221615 | |||
| 1387 | Ga0466961_0013186 | |||
| 1388 | Ga0466961_0018939 | |||
| 1389 | Ga0466961_0024716 | |||
| 1390 | Ga0466961_0042768 | |||
| 1391 | Ga0466961_0046415 | |||
| 1392 | Ga0466961_0057207 | |||
| 1393 | Ga0466961_0182478 | |||
| 1394 | Ga0466963_0003782 | |||
| 1395 | Ga0466963_0009176 | |||
| 1396 | Ga0466963_0128484 | |||
| 1397 | Ga0466963_0149388 | |||
| 1398 | Ga0466963_0240440 | |||
| 1399 | Ga0466963_0272816 | |||
| 1400 | Ga0466964_0312671 | |||
| 1401 | Ga0466964_0323366 | |||
| 1402 | Ga0466971_0003749 | |||
| 1403 | Ga0466971_0044272 | |||
| 1404 | Ga0466971_0078749 | |||
| 1405 | Ga0466971_0153913 | |||
| 1406 | Ga0466968_0073794 | |||
| 1407 | Ga0466968_0086864 | |||
| 1408 | Ga0466968_0156784 | |||
| 1409 | Ga0466970_0001375 | |||
| 1410 | Ga0466970_0006135 | |||
| 1411 | Ga0466970_0049465 | |||
| 1412 | Ga0466970_0097043 | |||
| 1413 | Ga0466970_0170974 | |||
| 1414 | Ga0466970_0181219 | |||
| 1415 | Ga0466970_0212236 | |||
| 1416 | Ga0466970_0251857 | |||
| 1417 | Ga0466957_0012389 | |||
| 1418 | Ga0466957_0025827 | |||
| 1419 | Ga0466957_0036271 | |||
| 1420 | Ga0466957_0070187 | |||
| 1421 | Ga0466957_0129670 | |||
| 1422 | Ga0466957_0257477 | |||
| 1423 | Ga0466960_0005629 | |||
| 1424 | Ga0466960_0007203 | |||
| 1425 | Ga0466960_0023038 | |||
| 1426 | Ga0466960_0042396 | |||
| 1427 | Ga0466960_0058805 | |||
| 1428 | Ga0466960_0073691 | |||
| 1429 | Ga0466960_0229956 | |||
| 1430 | Ga0466959_0038275 | |||
| 1431 | Ga0466959_0073752 | |||
| 1432 | Ga0466959_0088762 | |||
| 1433 | Ga0466959_0188439 | |||
| 1434 | Ga0466959_0281505 | |||
| 1435 | Ga0466958_0014164 | |||
| 1436 | Ga0466958_0015139 | |||
| 1437 | Ga0466958_0024266 | |||
| 1438 | Ga0466958_0175807 | |||
| 1439 | Ga0466958_0249031 | |||
| 1440 | Ga0466967_0008682 | |||
| 1441 | Ga0466967_0009725 | |||
| 1442 | Ga0466967_0020980 | |||
| 1443 | Ga0466967_0051580 | |||
| 1444 | Ga0466967_0090564 | |||
| 1445 | Ga0466967_0124968 | |||
| 1446 | Ga0466967_0126909 | |||
| 1447 | Ga0466967_0294427 | |||
| 1448 | Ga0466967_1926534 | |||
| 1449 | Ga0495592_0000111 | |||
| 1450 | Ga0495592_0144718 | |||
| 1451 | Ga0495592_0351801 | |||
| 1452 | Ga0495603_0365842 | |||
| 1453 | Ga0495629_0009858 | |||
| 1454 | Ga0495629_0011492 | |||
| 1455 | Ga0495629_0461698 | |||
| 1456 | Ga0495641_0036119 | |||
| 1457 | Ga0495641_0343409 | |||
| 1458 | Ga0495651_0000068 | |||
| 1459 | Ga0495651_0008120 | |||
| 1460 | Ga0495651_0028073 | |||
| 1461 | Ga0495651_0056235 | |||
| 1462 | Ga0495653_0006022 | |||
| 1463 | Ga0495653_0259887 | |||
| 1464 | Ga0495653_0682139 | |||
| 1465 | Ga0495580_0490807 | |||
| 1466 | Ga0495582_0125596 | |||
| 1467 | Ga0495639_0363735 | |||
| 1468 | Ga0495662_0178557 | |||
| 1469 | Ga0495662_0244597 | |||
| 1470 | Ga0495664_0006291 | |||
| 1471 | Ga0495664_0036186 | |||
| 1472 | Ga0495664_0378524 | |||
| 1473 | Ga0495594_0317364 | |||
| 1474 | Ga0495608_0000160 | |||
| 1475 | Ga0495608_0005659 | |||
| 1476 | Ga0495608_0014575 | |||
| 1477 | Ga0495608_0037195 | |||
| 1478 | Ga0495608_0076266 | |||
| 1479 | Ga0495618_0035874 | |||
| 1480 | Ga0495618_0109181 | |||
| 1481 | Ga0495628_0001952 | |||
| 1482 | Ga0495628_0051285 | |||
| 1483 | Ga0495628_0119344 | |||
| 1484 | Ga0495628_0224652 | |||
| 1485 | Ga0495628_0546007 | |||
| 1486 | Ga0495630_0073467 | |||
| 1487 | Ga0495630_0271984 | |||
| 1488 | Ga0495630_0336367 | |||
| 1489 | Ga0495666_0043595 | |||
| 1490 | Ga0495666_0315880 | |||
| 1491 | Ga0495652_0000440 | |||
| 1492 | Ga0495652_0006040 | |||
| 1493 | Ga0495652_0007093 | |||
| 1494 | Ga0495652_0119915 | |||
| 1495 | Ga0495652_0305175 | |||
| 1496 | Ga0495665_0011687 | |||
| 1497 | Ga0495640_0025998 | |||
| 1498 | Ga0495640_0074262 | |||
| 1499 | Ga0495640_0188589 | |||
| 1500 | Ga0495587_0000056 | |||
| 1501 | Ga0495587_0020297 | |||
| 1502 | Ga0495587_0028292 | |||
| 1503 | Ga0495587_0041551 | |||
| 1504 | Ga0495645_0043469 | |||
| 1505 | Ga0495645_0108658 | |||
| 1506 | Ga0495667_0000078 | |||
| 1507 | Ga0495667_0008381 | |||
| 1508 | Ga0495667_0016093 | |||
| 1509 | Ga0495667_0057070 | |||
| 1510 | Ga0495667_0060306 | |||
| 1511 | Ga0495625_0481392 | |||
| 1512 | Ga0495635_0037440 | |||
| 1513 | Ga0495635_0040265 | |||
| 1514 | Ga0495635_0091804 | |||
| 1515 | Ga0495635_0364193 | |||
| 1516 | Ga0495657_0000444 | |||
| 1517 | Ga0495657_0016199 | |||
| 1518 | Ga0495657_0018538 | |||
| 1519 | Ga0495599_0000625 | |||
| 1520 | Ga0495599_0016217 | |||
| 1521 | Ga0495599_0041303 | |||
| 1522 | Ga0495623_0000209 | |||
| 1523 | Ga0495623_0055275 | |||
| 1524 | Ga0495646_0015181 | |||
| 1525 | Ga0495646_0066101 | |||
| 1526 | Ga0495646_0091405 | |||
| 1527 | Ga0495646_0118110 | |||
| 1528 | Ga0495658_0027682 | |||
| 1529 | Ga0495613_0140514 | |||
| 1530 | Ga0495624_0031289 | |||
| 1531 | Ga0495600_0171064 | |||
| 1532 | Ga0495581_0010214 | |||
| 1533 | Ga0495604_0000105 | |||
| 1534 | Ga0495604_0015336 | |||
| 1535 | Ga0495604_0024226 | |||
| 1536 | Ga0495604_0077661 | |||
| 1537 | Ga0495604_1013031 | |||
| 1538 | Ga0495674_0069525 | |||
| 1539 | Ga0495674_0080143 | |||
| 1540 | Ga0495674_0121775 | |||
| 1541 | Ga0495680_0000115 | |||
| 1542 | Ga0495680_0007061 | |||
| 1543 | Ga0495680_0017293 | |||
| 1544 | Ga0495680_0215801 | |||
| 1545 | Ga0495680_0248673 | |||
| 1546 | Ga0495675_0000962 | |||
| 1547 | Ga0495675_0009775 | |||
| 1548 | Ga0495675_0032186 | |||
| 1549 | Ga0495684_0037245 | |||
| 1550 | Ga0495684_0201596 | |||
| 1551 | Ga0495593_0040335 | |||
| 1552 | Ga0495593_0083721 | |||
| 1553 | Ga0495593_0145291 | |||
| 1554 | Ga0495602_0000114 | |||
| 1555 | Ga0495602_0023251 | |||
| 1556 | Ga0496100_0050680 | |||
| 1557 | Ga0496100_0636961 | |||
| 1558 | Ga0496101_0035974 | |||
| 1559 | Ga0496101_0178834 | |||
| 1560 | Ga0496101_1148206 | |||
| 1561 | Ga0496102_0000144 | |||
| 1562 | Ga0496102_0019635 | |||
| 1563 | Ga0496102_0070174 | |||
| 1564 | Ga0496102_0149607 | |||
| 1565 | Ga0496103_0000109 | |||
| 1566 | Ga0496104_0000401 | |||
| 1567 | Ga0496104_0021286 | |||
| 1568 | Ga0496104_0124449 | |||
| 1569 | Ga0496104_0277620 | |||
| 1570 | Ga0496104_0414646 | |||
| 1571 | Ga0496104_0758718 | |||
| 1572 | Ga0496105_0040230 | |||
| 1573 | Ga0496105_0043102 | |||
| 1574 | Ga0496105_0211368 | |||
| 1575 | Ga0496106_0041444 | |||
| 1576 | Ga0496106_0082843 | |||
| 1577 | Ga0496106_0637560 | |||
| 1578 | Ga0496107_0111512 | |||
| 1579 | Ga0496108_0004478 | |||
| 1580 | Ga0496108_0011840 | |||
| 1581 | Ga0496108_0313451 | |||
| 1582 | Ga0496110_0008191 | |||
| 1583 | Ga0496110_0186184 | |||
| 1584 | Ga0496111_0001523 | |||
| 1585 | Ga0496111_0085172 | |||
| 1586 | Ga0496111_0830020 | |||
| 1587 | Ga0496112_0006557 | |||
| 1588 | Ga0496112_0023068 | |||
| 1589 | Ga0496112_0035669 | |||
| 1590 | Ga0496112_0076015 | |||
| 1591 | Ga0496112_0119358 | |||
| 1592 | Ga0496112_0164085 | |||
| 1593 | Ga0496112_0514026 | |||
| 1594 | Ga0496113_0003731 | |||
| 1595 | Ga0496113_0035198 | |||
| 1596 | Ga0496113_0124132 | |||
| 1597 | Ga0496113_0141023 | |||
| 1598 | Ga0496113_0291762 | |||
| 1599 | Ga0496113_0497512 | |||
| 1600 | Ga0496113_0662143 | |||
| 1601 | Ga0496114_0024846 | |||
| 1602 | Ga0496114_0094110 | |||
| 1603 | Ga0496114_0149572 | |||
| 1604 | Ga0496114_0369150 | |||
| 1605 | Ga0496114_1540627 | |||
| 1606 | Ga0496115_0051555 | |||
| 1607 | Ga0496115_0124166 | |||
| 1608 | Ga0496115_0134687 | |||
| 1609 | Ga0496115_0155943 | |||
| 1610 | Ga0496115_0174837 | |||
| 1611 | Ga0496116_0000128 | |||
| 1612 | Ga0496117_0000034 | |||
| 1613 | Ga0496117_0000356 | |||
| 1614 | Ga0496117_0006770 | |||
| 1615 | Ga0496118_0000631 | |||
| 1616 | Ga0496119_0007264 | |||
| 1617 | Ga0496120_0002945 | |||
| 1618 | Ga0496122_0076243 | |||
| 1619 | Ga0496123_0088431 | |||
| 1620 | Ga0496124_0049763 | |||
| 1621 | Ga0496125_0023870 | |||
| 1622 | Ga0496126_0000379 | |||
| 1623 | Ga0496126_0000772 | |||
| 1624 | Ga0501310_000323 | |||
| 1625 | Ga0501034_0611195 | |||
| 1626 | Ga0501040_0167717 | |||
| 1627 | Ga0501042_0047380 | |||
| 1628 | Ga0501074_0202457 | |||
| 1629 | Ga0501075_0592049 | |||
| 1630 | Ga0501077_0286336 | |||
| 1631 | Ga0501079_0532430 | |||
| 1632 | Ga0501081_0074720 | |||
| 1633 | Ga0501044_0579362 | |||
| 1634 | nmdc:mga03683_250625_c1 | |||
| 1635 | nmdc:mga00v17_254089_c1 | |||
| 1636 | nmdc:mga0yw44_231449_c1 | |||
| 1637 | nmdc:mga06z11_20923_c1 | |||
| 1638 | nmdc:mga07m45_163378_c1 | |||
| 1639 | nmdc:mga05p37_146143_c1 | |||
| 1640 | nmdc:mga05p37_330264_c1 | |||
| 1641 | nmdc:mga05p37_421744_c1 | |||
| 1642 | nmdc:mga05p37_612356_c1 | |||
| 1643 | nmdc:mga05p37_61_c1 | |||
| 1644 | nmdc:mga05p37_945076_c1 | |||
| 1645 | nmdc:mga09592_173256_c1 | |||
| 1646 | nmdc:mga09592_17_c1 | |||
| 1647 | nmdc:mga09592_193090_c1 | |||
| 1648 | nmdc:mga09592_202018_c1 | |||
| 1649 | nmdc:mga0qj67_251_c1 | |||
| 1650 | nmdc:mga0qj67_32_c1 | |||
| 1651 | nmdc:mga06r32_26_c1 | |||
| 1652 | nmdc:mga06r32_309247_c1 | |||
| 1653 | nmdc:mga06r32_357223_c1 | |||
| 1654 | nmdc:mga06r32_36371_c1 | |||
| 1655 | nmdc:mga08y16_11871_c1 | |||
| 1656 | nmdc:mga08y16_599300_c1 | |||
| 1657 | nmdc:mga08y16_938130_c1 | |||
| 1658 | nmdc:mga0n895_119064_c1 | |||
| 1659 | nmdc:mga0n895_482230_c1 | |||
| 1660 | nmdc:mga0n895_5449_c1 | |||
| 1661 | nmdc:mga0rr50_101408_c1 | |||
| 1662 | nmdc:mga0rr50_121734_c1 | |||
| 1663 | nmdc:mga0rr50_4411_c1 | |||
| 1664 | nmdc:mga08x19_127119_c1 | |||
| 1665 | nmdc:mga08x19_14540_c1 | |||
| 1666 | nmdc:mga08x19_26800_c1 | |||
| 1667 | nmdc:mga0a205_104928_c1 | |||
| 1668 | nmdc:mga0a205_18307_c1 | |||
| 1669 | nmdc:mga0sz30_422088_c1 | |||
| 1670 | Ga0495601_0202590 | |||
| 1671 | Ga0495595_0000926 | |||
| 1672 | Ga0495595_0055755 | |||
| 1673 | Ga0495595_0150537 | |||
| 1674 | Ga0495619_0023221 | |||
| 1675 | Ga0495619_0169957 | |||
| 1676 | Ga0500559_0002209 | |||
| 1677 | Ga0500559_0013186 | |||
| 1678 | Ga0500577_0001516 | |||
| 1679 | Ga0500616_0000269 | |||
| 1680 | Ga0500637_0212150 | |||
| 1681 | Ga0500645_003326 | |||
| 1682 | Ga0501084_0255272 | |||
| 1683 | Ga0466962_0006353 | |||
| 1684 | Ga0466962_0013272 | |||
| 1685 | Ga0466962_0177033 | |||
| 1686 | 2795781257 | |||
| 1687 | 2559428537 | |||
| 1688 | 2583148814 | |||
| 1689 | 2586064763 | |||
| 1690 | 2643996672 | |||
| 1691 | 2676475006 | |||
| 1692 | 2753069749 | |||
| 1693 | 2776377725 | |||
| 1694 | 2791913881 | |||
| 1695 | 2795791853 | |||
| 1696 | 2809586002 | |||
| 1697 | 2821271037 | |||
| 1698 | 2827630825 | |||
| 1699 | 2832005296 | |||
| 1700 | 2833712056 | |||
| 1701 | 2844842158 | |||
| 1702 | 2862509783 | |||
| 1703 | 2863070140 | |||
| 1704 | 2866068977 | |||
| 1705 | 2866555750 | |||
| 1706 | 2866617309 | |||
| 1707 | 2867318933 | |||
| 1708 | 2867323917 | |||
| 1709 | 2870727738 | |||
| 1710 | 2891331679 | |||
| 1711 | 2899361202 | |||
| 1712 | 2899373690 | |||
| 1713 | 2915359419 | |||
| 1714 | 2915773095 | |||
| 1715 | 2917745358 | |||
| 1716 | 2919057804 | |||
| 1717 | 2919524205 | |||
| 1718 | 2928156185 | |||
| 1719 | 3006394603 | |||
| 1720 | 8003320899 | |||
| 1721 | 8003860141 | |||
| 1722 | 8047718493 | |||
| 1723 | 8054475565 | |||
| 1724 | 8056211027 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wdv-assembly2.cif.gz_B | crystal structure of hypothetical protein ape2540 | 0.8967 | 24 | 180 |
| 1wdv-assembly2.cif.gz_B | crystal structure of hypothetical protein ape2540 | 0.8857 | 24 | 180 |
| 1dbx-assembly2.cif.gz_B | crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) | 0.8591 | 24 | 181 |
| 3ri0-assembly2.cif.gz_B | epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins | 0.8526 | 22 | 182 |
| 1dbx-assembly2.cif.gz_B | crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) | 0.8489 | 24 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8833 | 24 | 180 | 3.90.960.10 |
| 1wdvB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8724 | 24 | 180 | 3.90.960.10 |
| af_Q2G0A0_1_158_3.90.960.10 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8585 | 22 | 176 | 3.90.960.10 |
| 1dbxB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8508 | 24 | 181 | 3.90.960.10 |
| 1dbxB00 | Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain | 0.8407 | 24 | 181 | 3.90.960.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LED0-F1-model_v4 | YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein | 0.9931 | 1 | 184 |
GO:0002161
|
| AF-A0A7Z0D435-F1-model_v4 | Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) | 0.9908 | 4 | 180 |
GO:0002161
|
| AF-A0A6P1FBU5-F1-model_v4 | Uncharacterized protein | 0.9885 | 4 | 182 |
GO:0002161
GO:0016020 GO:0030416 |
| AF-A0A3A1TZV6-F1-model_v4 | YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein | 0.9878 | 1 | 180 |
GO:0002161
|
| AF-A0A538LED0-F1-model_v4 | YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein | 0.9878 | 1 | 184 |
GO:0002161
|