F483846

General Info

Members Datasets Scaffolds Average Seq Length
861 388 845 147

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_11112255|Ga0207691_111122551
Length 171
Sequence MSVVAFERKQNGGEWSEKELSTLVAALCATPGSGREWETGMTERGDAQFYLLGPLPDQACEVCVSRIGGRYILEDGSGRLLFEHRNLEFVALHAKAAVPSTSWLMVRAITLWCAIRNTLHEKVQPLLVEGEELFVQFVPQLAAFAWSTAPRTSGASHQAPSPTSHDRTRPG

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2791355199
5 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
6 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
7 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
8 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
9 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
10 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
11 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
12 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
13 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
213 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
337 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
340 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
341 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
342 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
350 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
351 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
352 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
359 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
360 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
361 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
362 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
368 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
369 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
377 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
380 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
381 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
382 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
383 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
384 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
387 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
388 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.14
Metatranscriptomes 0.12
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.65
Nodule 0.93
Rhizoplane 6.62
Rhizosphere 68.52
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10050278 3300001979 Bacteria 1200
2 JGI24744J21845_10006024 3300002077 Bacteria 2514
3 JGI25406J46586_10088073 3300003203 Bacteria 941
4 JGI25153J46596_10008126 3300003215 Bacteria 5057
5 JGI25404J52841_10004963 3300003659 Bacteria 2731
6 JGI25404J52841_10022179 3300003659 Bacteria 1373
7 JGI25404J52841_10034975 3300003659 Bacteria 1070
8 JGI25404J52841_10127105 3300003659 Bacteria 538
9 Ga0058860_11735244 3300004801 Bacteria 913
10 Ga0070658_10275339 3300005327 Bacteria 1432
11 Ga0070676_10027638 3300005328 Bacteria 3219
12 Ga0070676_10038958 3300005328 Bacteria 2746
13 Ga0070683_100670434 3300005329 Bacteria 993
14 Ga0070690_100025683 3300005330 Bacteria 3627
15 Ga0070670_100376393 3300005331 Bacteria 1250
16 Ga0070670_100676477 3300005331 Bacteria 927
17 Ga0068869_100045470 3300005334 Bacteria 3161
18 Ga0068869_100047276 3300005334 Bacteria 3107
19 Ga0068869_100073070 3300005334 Bacteria 2543
20 Ga0068869_100075640 3300005334 Bacteria 2502
21 Ga0070682_100112780 3300005337 Bacteria 1815
22 Ga0068868_100124385 3300005338 Bacteria 2106
23 Ga0068868_100190391 3300005338 Bacteria 1706
24 Ga0070689_100061523 3300005340 Bacteria 2920
25 Ga0070691_10312393 3300005341 Bacteria 862
26 Ga0070687_101328605 3300005343 Bacteria 535
27 Ga0070661_100054292 3300005344 Bacteria 2934
28 Ga0070661_100133003 3300005344 Bacteria 1869
29 Ga0070661_100339723 3300005344 Bacteria 1176
30 Ga0070668_100031383 3300005347 Bacteria 4042
31 Ga0070668_100037566 3300005347 Bacteria 3698
32 Ga0070668_100075725 3300005347 Bacteria 2628
33 Ga0070668_100120847 3300005347 Bacteria 2093
34 Ga0070668_100430157 3300005347 Bacteria 1131
35 Ga0070668_100882624 3300005347 Bacteria 798
36 Ga0070669_100123379 3300005353 Bacteria 1979
37 Ga0070669_100217204 3300005353 Bacteria 1511
38 Ga0070675_100132272 3300005354 Bacteria 2127
39 Ga0070675_100753638 3300005354 Bacteria 888
40 Ga0070671_100190666 3300005355 Bacteria 1737
41 Ga0070671_100752084 3300005355 Bacteria 847
42 Ga0070674_100084725 3300005356 Bacteria 2273
43 Ga0070674_100159655 3300005356 Bacteria 1709
44 Ga0070674_100450125 3300005356 Bacteria 1063
45 Ga0070674_101143058 3300005356 Bacteria 689
46 Ga0070673_100208162 3300005364 Bacteria 1688
47 Ga0070673_100382712 3300005364 Bacteria 1255
48 Ga0070673_100396559 3300005364 Bacteria 1233
49 Ga0070688_100623186 3300005365 Bacteria 828
50 Ga0070659_100117021 3300005366 Bacteria 2155
51 Ga0070659_100751301 3300005366 Bacteria 846
52 Ga0070659_101611929 3300005366 Bacteria 579
53 Ga0070667_100173516 3300005367 Bacteria 1904
54 Ga0070667_100429823 3300005367 Bacteria 1205
55 Ga0070667_100678186 3300005367 Bacteria 953
56 Ga0070714_100366282 3300005435 Bacteria 1356
57 Ga0070701_10071178 3300005438 Bacteria 1860
58 Ga0070700_100194457 3300005441 Bacteria 1421
59 Ga0070700_100585442 3300005441 Bacteria 872
60 Ga0070694_100563023 3300005444 Bacteria 914
61 Ga0070663_100003353 3300005455 Bacteria 9243
62 Ga0070663_100030539 3300005455 Bacteria 3694
63 Ga0070663_100031087 3300005455 Bacteria 3666
64 Ga0070663_100072147 3300005455 Bacteria 2514
65 Ga0070663_100079989 3300005455 Bacteria 2399
66 Ga0070663_100211565 3300005455 Bacteria 1518
67 Ga0070663_101167035 3300005455 Bacteria 675
68 Ga0070678_100002662 3300005456 Bacteria 9839
69 Ga0070678_100019954 3300005456 Bacteria 4386
70 Ga0070678_100063923 3300005456 Bacteria 2725
71 Ga0070678_100812282 3300005456 Bacteria 850
72 Ga0070678_100883660 3300005456 Bacteria 816
73 Ga0070662_100506194 3300005457 Bacteria 1008
74 Ga0070662_101796513 3300005457 Bacteria 530
75 Ga0068867_100099433 3300005459 Bacteria 2219
76 Ga0068867_100278532 3300005459 Bacteria 1371
77 Ga0070685_10278594 3300005466 Bacteria 1119
78 Ga0070706_100139022 3300005467 Bacteria 2267
79 Ga0070706_100783928 3300005467 Bacteria 883
80 Ga0070699_100252574 3300005518 Bacteria 1576
81 Ga0070697_101443611 3300005536 Bacteria 615
82 Ga0068853_100084299 3300005539 Bacteria 2784
83 Ga0068853_100116417 3300005539 Bacteria 2379
84 Ga0068853_100185189 3300005539 Bacteria 1890
85 Ga0068853_101662964 3300005539 Bacteria 619
86 Ga0070672_100052132 3300005543 Bacteria 3193
87 Ga0070672_100217030 3300005543 Bacteria 1603
88 Ga0070672_100735015 3300005543 Bacteria 865
89 Ga0070686_100262875 3300005544 Bacteria 1266
90 Ga0070686_100303713 3300005544 Bacteria 1184
91 Ga0070695_100982499 3300005545 Bacteria 686
92 Ga0070693_100222809 3300005547 Bacteria 1237
93 Ga0070665_100019653 3300005548 Bacteria 6780
94 Ga0070665_100044982 3300005548 Bacteria 4432
95 Ga0070665_100086641 3300005548 Bacteria 3137
96 Ga0070665_100128711 3300005548 Bacteria 2534
97 Ga0070665_100129397 3300005548 Bacteria 2527
98 Ga0070665_100139127 3300005548 Bacteria 2431
99 Ga0070665_100304679 3300005548 Bacteria 1596
100 Ga0070665_100554975 3300005548 Bacteria 1161
101 Ga0070664_100073611 3300005564 Bacteria 2932
102 Ga0070664_100465490 3300005564 Bacteria 1162
103 Ga0068857_100875200 3300005577 Bacteria 860
104 Ga0068854_100042601 3300005578 Bacteria 3213
105 Ga0068854_100150499 3300005578 Bacteria 1794
106 Ga0068854_100193499 3300005578 Bacteria 1595
107 Ga0068856_100068900 3300005614 Bacteria 3497
108 Ga0070702_100136524 3300005615 Bacteria 1557
109 Ga0070702_100154534 3300005615 Bacteria 1476
110 Ga0068852_101244731 3300005616 Bacteria 766
111 Ga0068859_100100705 3300005617 Bacteria 2945
112 Ga0068859_100178572 3300005617 Bacteria 2205
113 Ga0068859_100414848 3300005617 Bacteria 1442
114 Ga0068864_100058560 3300005618 Bacteria 3330
115 Ga0068864_100069127 3300005618 Bacteria 3070
116 Ga0068864_100546839 3300005618 Bacteria 1119
117 Ga0068864_101221454 3300005618 Bacteria 751
118 Ga0068866_10012487 3300005718 Bacteria 3701
119 Ga0068866_10013354 3300005718 Bacteria 3601
120 Ga0068866_10138234 3300005718 Bacteria 1395
121 Ga0068861_100166031 3300005719 Bacteria 1825
122 Ga0068861_100494325 3300005719 Bacteria 1105
123 Ga0068861_100522610 3300005719 Bacteria 1077
124 Ga0068851_10074088 3300005834 Bacteria 1767
125 Ga0068870_11290518 3300005840 Bacteria 532
126 Ga0068863_100098680 3300005841 Bacteria 2774
127 Ga0068863_100684414 3300005841 Bacteria 1019
128 Ga0068863_101293690 3300005841 Bacteria 736
129 Ga0068858_100060227 3300005842 Bacteria 3509
130 Ga0068858_100178305 3300005842 Bacteria 2005
131 Ga0068860_100719936 3300005843 Bacteria 1008
132 Ga0068860_100892941 3300005843 Bacteria 905
133 Ga0068860_101820661 3300005843 Bacteria 630
134 Ga0068862_100064616 3300005844 Bacteria 3150
135 Ga0068862_100099202 3300005844 Bacteria 2545
136 Ga0068862_100213168 3300005844 Bacteria 1745
137 Ga0068862_100261263 3300005844 Bacteria 1580
138 Ga0068862_100395734 3300005844 Bacteria 1291
139 Ga0068862_100401407 3300005844 Bacteria 1282
140 Ga0068862_100408583 3300005844 Bacteria 1271
141 Ga0068862_100422959 3300005844 Bacteria 1251
142 Ga0068862_100480089 3300005844 Bacteria 1176
143 Ga0068862_100866078 3300005844 Unclassified 886
144 Ga0068862_101950260 3300005844 Bacteria 597
145 Ga0081455_10010859 3300005937 Bacteria 9192
146 Ga0081455_10016359 3300005937 Bacteria 7165
147 Ga0081455_10017850 3300005937 Bacteria 6783
148 Ga0081455_10030202 3300005937 Bacteria 4927
149 Ga0081455_10125630 3300005937 Bacteria 2014
150 Ga0081455_10177248 3300005937 Bacteria 1617
151 Ga0081538_10015837 3300005981 Bacteria 5814
152 Ga0081540_1002860 3300005983 Bacteria 13966
153 Ga0081540_1004874 3300005983 Bacteria 10108
154 Ga0081540_1007330 3300005983 Bacteria 7889
155 Ga0081540_1009322 3300005983 Bacteria 6771
156 Ga0081540_1015061 3300005983 Bacteria 4908
157 Ga0081540_1027967 3300005983 Bacteria 3180
158 Ga0081540_1041856 3300005983 Bacteria 2370
159 Ga0081540_1042714 3300005983 Bacteria 2335
160 Ga0081540_1067351 3300005983 Bacteria 1674
161 Ga0081539_10029635 3300005985 Bacteria 3414
162 Ga0081539_10151141 3300005985 Bacteria 1117
163 Ga0075365_10026315 3300006038 Bacteria 3692
164 Ga0075365_10040262 3300006038 Bacteria 3047
165 Ga0075365_10088394 3300006038 Bacteria 2108
166 Ga0075365_10117480 3300006038 Bacteria 1832
167 Ga0075365_10150714 3300006038 Bacteria 1618
168 Ga0075365_10435751 3300006038 Bacteria 925
169 Ga0075365_10597478 3300006038 Bacteria 780
170 Ga0075365_10971962 3300006038 Bacteria 598
171 Ga0075365_11234895 3300006038 Bacteria 525
172 Ga0075368_10025986 3300006042 Bacteria 2250
173 Ga0075368_10047547 3300006042 Bacteria 1699
174 Ga0075363_100000569 3300006048 Bacteria 12095
175 Ga0075363_100075676 3300006048 Bacteria 1834
176 Ga0075364_10019872 3300006051 Bacteria 4222
177 Ga0075364_10025564 3300006051 Bacteria 3759
178 Ga0075364_10026435 3300006051 Bacteria 3703
179 Ga0075364_10831794 3300006051 Bacteria 629
180 Ga0075432_10015387 3300006058 Bacteria 2609
181 Ga0070715_10367997 3300006163 Bacteria 790
182 Ga0070716_100077422 3300006173 Bacteria 1974
183 Ga0070712_100433226 3300006175 Bacteria 1092
184 Ga0075362_10147716 3300006177 Bacteria 1126
185 Ga0075367_10011572 3300006178 Bacteria 4675
186 Ga0075367_10018357 3300006178 Bacteria 3858
187 Ga0075367_10061707 3300006178 Bacteria 2238
188 Ga0075367_10155032 3300006178 Bacteria 1423
189 Ga0075367_10339442 3300006178 Bacteria 947
190 Ga0075367_10714339 3300006178 Bacteria 638
191 Ga0075367_10817903 3300006178 Bacteria 593
192 Ga0075369_10005129 3300006186 Bacteria 4879
193 Ga0075369_10015343 3300006186 Bacteria 3073
194 Ga0075369_10100009 3300006186 Bacteria 1300
195 Ga0075369_10245524 3300006186 Bacteria 831
196 Ga0075366_10086258 3300006195 Bacteria 1878
197 Ga0075366_10091682 3300006195 Bacteria 1820
198 Ga0075366_10107576 3300006195 Bacteria 1677
199 Ga0075366_10201797 3300006195 Bacteria 1210
200 Ga0075366_10297503 3300006195 Bacteria 987
201 Ga0075366_10943511 3300006195 Bacteria 538
202 Ga0097621_100034098 3300006237 Bacteria 4057
203 Ga0097621_100036520 3300006237 Bacteria 3932
204 Ga0075370_10014094 3300006353 Bacteria 4258
205 Ga0075370_10072040 3300006353 Bacteria 1978
206 Ga0075370_10103015 3300006353 Bacteria 1653
207 Ga0075370_10338658 3300006353 Bacteria 897
208 Ga0075370_10384595 3300006353 Bacteria 841
209 Ga0068871_100160352 3300006358 Bacteria 1923
210 Ga0068871_100344932 3300006358 Bacteria 1316
211 Ga0075428_100067240 3300006844 Bacteria 3923
212 Ga0075428_100068913 3300006844 Bacteria 3869
213 Ga0075428_101205413 3300006844 Bacteria 798
214 Ga0075434_100300927 3300006871 Bacteria 1624
215 Ga0068865_100040769 3300006881 Bacteria 3157
216 Ga0068865_100045409 3300006881 Bacteria 3012
217 Ga0068865_100237154 3300006881 Bacteria 1434
218 Ga0068865_100427191 3300006881 Bacteria 1091
219 Ga0075436_100393060 3300006914 Bacteria 1004
220 Ga0097620_100100701 3300006931 Bacteria 2945
221 Ga0097620_100178567 3300006931 Bacteria 2205
222 Ga0097620_100414844 3300006931 Bacteria 1442
223 Ga0099795_10034510 3300007788 Bacteria 1763
224 Ga0099795_10049039 3300007788 Bacteria 1531
225 Ga0105251_10406927 3300009011 Bacteria 626
226 Ga0105244_10220204 3300009036 Bacteria 890
227 Ga0105250_10091443 3300009092 Bacteria 1238
228 Ga0105250_10270421 3300009092 Bacteria 730
229 Ga0105240_10479386 3300009093 Bacteria 1387
230 Ga0111539_10089828 3300009094 Bacteria 3610
231 Ga0105245_10164541 3300009098 Bacteria 2107
232 Ga0105245_10263865 3300009098 Bacteria 1677
233 Ga0105245_11510448 3300009098 Bacteria 723
234 Ga0105247_10073371 3300009101 Bacteria 2144
235 Ga0105247_10218098 3300009101 Bacteria 1290
236 Ga0105247_10254390 3300009101 Bacteria 1202
237 Ga0105247_10285067 3300009101 Bacteria 1141
238 Ga0114129_10133780 3300009147 Bacteria 3404
239 Ga0105243_10085482 3300009148 Bacteria 2586
240 Ga0105243_10346774 3300009148 Bacteria 1362
241 Ga0105243_10358800 3300009148 Bacteria 1341
242 Ga0105243_10552705 3300009148 Bacteria 1100
243 Ga0105243_10873475 3300009148 Bacteria 892
244 Ga0105241_10030199 3300009174 Bacteria 4048
245 Ga0105241_10459259 3300009174 Bacteria 1128
246 Ga0105241_10640778 3300009174 Bacteria 964
247 Ga0105242_10091348 3300009176 Bacteria 2563
248 Ga0105242_10440069 3300009176 Bacteria 1226
249 Ga0105242_10841423 3300009176 Bacteria 912
250 Ga0105242_11089932 3300009176 Bacteria 812
251 Ga0105248_10054241 3300009177 Bacteria 4495
252 Ga0105237_10137991 3300009545 Bacteria 2433
253 Ga0105237_10318174 3300009545 Bacteria 1559
254 Ga0105238_10080497 3300009551 Bacteria 3247
255 Ga0105238_10274010 3300009551 Bacteria 1668
256 Ga0105238_10505109 3300009551 Bacteria 1210
257 Ga0105249_10113290 3300009553 Bacteria 2566
258 Ga0105249_10589187 3300009553 Bacteria 1166
259 Ga0105249_10756811 3300009553 Bacteria 1034
260 Ga0105249_11000305 3300009553 Bacteria 905
261 Ga0105249_11140318 3300009553 Bacteria 850
262 Ga0105239_10098298 3300010375 Bacteria 3235
263 Ga0105239_10217198 3300010375 Bacteria 2144
264 Ga0105239_10541832 3300010375 Bacteria 1325
265 Ga0105239_11184508 3300010375 Bacteria 880
266 Ga0105239_12922054 3300010375 Bacteria 557
267 Ga0105246_10110980 3300011119 Bacteria 2015
268 Ga0105246_10185559 3300011119 Bacteria 1605
269 Ga0105246_10228853 3300011119 Bacteria 1463
270 Ga0105246_10852430 3300011119 Bacteria 813
271 Ga0157374_10273006 3300013296 Bacteria 1668
272 Ga0157374_10622123 3300013296 Bacteria 1090
273 Ga0157378_10020790 3300013297 Bacteria 5771
274 Ga0157378_10263661 3300013297 Bacteria 1654
275 Ga0163162_10055949 3300013306 Bacteria 3973
276 Ga0163162_11494298 3300013306 Bacteria 769
277 Ga0157372_11664474 3300013307 Bacteria 734
278 Ga0157375_10018295 3300013308 Bacteria 6352
279 Ga0157375_10079517 3300013308 Bacteria 3315
280 Ga0157375_10106423 3300013308 Bacteria 2897
281 Ga0157375_10539501 3300013308 Bacteria 1329
282 Ga0157375_10654551 3300013308 Bacteria 1207
283 Ga0157375_11373185 3300013308 Bacteria 832
284 Ga0157375_13543623 3300013308 Bacteria 519
285 Ga0163163_10199277 3300014325 Bacteria 2050
286 Ga0163163_10310305 3300014325 Bacteria 1630
287 Ga0163163_10401910 3300014325 Bacteria 1428
288 Ga0163163_11172445 3300014325 Bacteria 831
289 Ga0157380_10056556 3300014326 Bacteria 3121
290 Ga0157380_10130927 3300014326 Bacteria 2140
291 Ga0157380_10220770 3300014326 Bacteria 1696
292 Ga0157380_10292094 3300014326 Bacteria 1497
293 Ga0157380_11079080 3300014326 Bacteria 841
294 Ga0157377_10054673 3300014745 Bacteria 2261
295 Ga0157379_10131370 3300014968 Bacteria 2254
296 Ga0157379_10147094 3300014968 Bacteria 2125
297 Ga0157376_10043154 3300014969 Bacteria 3700
298 Ga0157376_10054887 3300014969 Bacteria 3323
299 Ga0157376_10349468 3300014969 Bacteria 1415
300 Ga0157376_10353987 3300014969 Bacteria 1406
301 Ga0163161_10068479 3300017792 Bacteria 2593
302 Ga0209564_1023084 3300025295 Bacteria 2174
303 Ga0209758_1001444 3300025297 Bacteria 28002
304 Ga0209758_1043368 3300025297 Bacteria 1658
305 Ga0207697_10168408 3300025315 Bacteria 958
306 Ga0207697_10192915 3300025315 Bacteria 895
307 Ga0207656_10055273 3300025321 Bacteria 1727
308 Ga0207653_10078223 3300025885 Bacteria 1141
309 Ga0207642_10014744 3300025899 Bacteria 2893
310 Ga0207710_10050314 3300025900 Bacteria 1869
311 Ga0207710_10105582 3300025900 Bacteria 1333
312 Ga0207710_10365603 3300025900 Bacteria 737
313 Ga0207688_10061342 3300025901 Bacteria 2119
314 Ga0207688_10083544 3300025901 Bacteria 1826
315 Ga0207647_10235056 3300025904 Bacteria 1054
316 Ga0207645_10041042 3300025907 Bacteria 2963
317 Ga0207645_10080213 3300025907 Bacteria 2092
318 Ga0207645_10116590 3300025907 Bacteria 1732
319 Ga0207643_10131227 3300025908 Bacteria 1491
320 Ga0207643_10260678 3300025908 Bacteria 1070
321 Ga0207643_10761069 3300025908 Bacteria 627
322 Ga0207654_10012529 3300025911 Bacteria 4346
323 Ga0207695_10279751 3300025913 Bacteria 1562
324 Ga0207671_10078672 3300025914 Bacteria 2470
325 Ga0207693_10043247 3300025915 Bacteria 3545
326 Ga0207662_11170361 3300025918 Bacteria 547
327 Ga0207657_10453659 3300025919 Bacteria 1006
328 Ga0207649_10049714 3300025920 Bacteria 2591
329 Ga0207681_10134255 3300025923 Bacteria 1834
330 Ga0207681_10737867 3300025923 Bacteria 820
331 Ga0207681_10892005 3300025923 Bacteria 744
332 Ga0207694_10058626 3300025924 Bacteria 2995
333 Ga0207694_11356097 3300025924 Bacteria 601
334 Ga0207659_10238825 3300025926 Bacteria 1469
335 Ga0207659_10554114 3300025926 Bacteria 977
336 Ga0207687_10052625 3300025927 Bacteria 2842
337 Ga0207664_10786941 3300025929 Bacteria 856
338 Ga0207644_10093660 3300025931 Bacteria 2243
339 Ga0207644_11408977 3300025931 Bacteria 585
340 Ga0207690_10223908 3300025932 Bacteria 1441
341 Ga0207706_10047923 3300025933 Bacteria 3780
342 Ga0207706_10371555 3300025933 Bacteria 1242
343 Ga0207706_11145341 3300025933 Bacteria 648
344 Ga0207706_11209933 3300025933 Bacteria 627
345 Ga0207686_10417495 3300025934 Bacteria 1025
346 Ga0207709_10031459 3300025935 Bacteria 3100
347 Ga0207709_10664060 3300025935 Bacteria 831
348 Ga0207709_10892815 3300025935 Unclassified 722
349 Ga0207670_10076308 3300025936 Bacteria 2332
350 Ga0207669_10060620 3300025937 Bacteria 2320
351 Ga0207669_10693778 3300025937 Bacteria 836
352 Ga0207704_10076741 3300025938 Bacteria 2142
353 Ga0207704_10159868 3300025938 Bacteria 1601
354 Ga0207704_10296409 3300025938 Bacteria 1237
355 Ga0207704_10825391 3300025938 Bacteria 776
356 Ga0207665_10064556 3300025939 Bacteria 2488
357 Ga0207665_10121161 3300025939 Bacteria 1848
358 Ga0207691_10117880 3300025940 Bacteria 2355
359 Ga0207691_10686813 3300025940 Bacteria 864
360 Ga0207691_10900702 3300025940 Bacteria 740
361 Ga0207691_11112255 3300025940 Bacteria 657
362 Ga0207711_10020555 3300025941 Bacteria 5507
363 Ga0207689_10034293 3300025942 Bacteria 4216
364 Ga0207689_10061642 3300025942 Bacteria 3085
365 Ga0207689_10118992 3300025942 Bacteria 2173
366 Ga0207679_10056113 3300025945 Bacteria 2907
367 Ga0207679_10070881 3300025945 Bacteria 2627
368 Ga0207667_10046871 3300025949 Bacteria 4577
369 Ga0207651_10199343 3300025960 Bacteria 1603
370 Ga0207651_10365751 3300025960 Bacteria 1219
371 Ga0207651_10581446 3300025960 Bacteria 977
372 Ga0207712_10942140 3300025961 Bacteria 765
373 Ga0207668_10147450 3300025972 Bacteria 1817
374 Ga0207668_10192277 3300025972 Bacteria 1618
375 Ga0207668_10255695 3300025972 Bacteria 1425
376 Ga0207668_10275556 3300025972 Bacteria 1377
377 Ga0207668_10465081 3300025972 Bacteria 1082
378 Ga0207668_11625945 3300025972 Bacteria 583
379 Ga0207640_10113931 3300025981 Bacteria 1923
380 Ga0207640_10207698 3300025981 Bacteria 1489
381 Ga0207640_10236652 3300025981 Bacteria 1408
382 Ga0207640_11533458 3300025981 Bacteria 599
383 Ga0207658_10050950 3300025986 Bacteria 3049
384 Ga0207658_10453054 3300025986 Bacteria 1136
385 Ga0207658_11493405 3300025986 Bacteria 618
386 Ga0207677_10014116 3300026023 Bacteria 4653
387 Ga0207677_10640946 3300026023 Bacteria 937
388 Ga0207703_10079384 3300026035 Bacteria 2730
389 Ga0207639_10429373 3300026041 Bacteria 1196
390 Ga0207639_10753875 3300026041 Bacteria 905
391 Ga0207639_11674812 3300026041 Bacteria 596
392 Ga0207678_10005268 3300026067 Bacteria 11582
393 Ga0207678_10032402 3300026067 Bacteria 4554
394 Ga0207678_10038621 3300026067 Bacteria 4147
395 Ga0207678_10048058 3300026067 Bacteria 3689
396 Ga0207678_10060852 3300026067 Bacteria 3248
397 Ga0207678_10076918 3300026067 Bacteria 2858
398 Ga0207678_10121178 3300026067 Bacteria 2232
399 Ga0207678_10203925 3300026067 Bacteria 1691
400 Ga0207678_11232563 3300026067 Bacteria 662
401 Ga0207708_10053224 3300026075 Bacteria 3084
402 Ga0207708_10332602 3300026075 Bacteria 1242
403 Ga0207702_10069003 3300026078 Bacteria 3038
404 Ga0207702_11565889 3300026078 Bacteria 652
405 Ga0207641_10112831 3300026088 Bacteria 2412
406 Ga0207648_10042048 3300026089 Bacteria 4013
407 Ga0207648_10118129 3300026089 Bacteria 2330
408 Ga0207676_10116997 3300026095 Bacteria 2241
409 Ga0207676_10122781 3300026095 Bacteria 2193
410 Ga0207676_10379198 3300026095 Bacteria 1316
411 Ga0207676_10963167 3300026095 Bacteria 839
412 Ga0207674_10040950 3300026116 Bacteria 4794
413 Ga0207674_11477855 3300026116 Bacteria 649
414 Ga0207675_100095640 3300026118 Bacteria 2795
415 Ga0207675_100202556 3300026118 Bacteria 1906
416 Ga0207675_100222513 3300026118 Bacteria 1819
417 Ga0207675_100381419 3300026118 Bacteria 1386
418 Ga0207675_100394151 3300026118 Bacteria 1363
419 Ga0207675_100560201 3300026118 Bacteria 1143
420 Ga0207683_10053503 3300026121 Bacteria 3540
421 Ga0207683_10082114 3300026121 Bacteria 2862
422 Ga0207683_10095110 3300026121 Bacteria 2656
423 Ga0207683_10234955 3300026121 Bacteria 1672
424 Ga0207683_10273371 3300026121 Bacteria 1544
425 Ga0207683_10469697 3300026121 Bacteria 1160
426 Ga0207698_10080447 3300026142 Bacteria 2625
427 Ga0207698_10725526 3300026142 Bacteria 991
428 Ga0207698_10752051 3300026142 Bacteria 974
429 Ga0209813_10012688 3300027866 Bacteria 2234
430 Ga0209813_10202553 3300027866 Bacteria 735
431 Ga0207428_10156085 3300027907 Bacteria 1736
432 Ga0268266_10001439 3300028379 Bacteria 28336
433 Ga0268266_10004759 3300028379 Bacteria 12905
434 Ga0268266_10021895 3300028379 Bacteria 5446
435 Ga0268266_10048061 3300028379 Bacteria 3656
436 Ga0268266_10099983 3300028379 Bacteria 2554
437 Ga0268266_10153310 3300028379 Bacteria 2079
438 Ga0268266_10242848 3300028379 Bacteria 1663
439 Ga0268266_10394307 3300028379 Bacteria 1308
440 Ga0268266_10412639 3300028379 Bacteria 1278
441 Ga0268266_10650097 3300028379 Bacteria 1015
442 Ga0268265_10056338 3300028380 Bacteria 2990
443 Ga0268265_10125571 3300028380 Bacteria 2122
444 Ga0268265_10226578 3300028380 Bacteria 1639
445 Ga0268265_10292344 3300028380 Bacteria 1463
446 Ga0268265_10315453 3300028380 Bacteria 1413
447 Ga0268265_10362348 3300028380 Bacteria 1327
448 Ga0268265_10482092 3300028380 Bacteria 1165
449 Ga0268265_11180455 3300028380 Bacteria 762
450 Ga0268265_11615061 3300028380 Bacteria 653
451 Ga0268265_11971414 3300028380 Bacteria 591
452 Ga0268264_10056791 3300028381 Bacteria 3273
453 Ga0307517_10126584 3300028786 Bacteria 1861
454 Ga0307517_10180147 3300028786 Bacteria 1366
455 Ga0307517_10237341 3300028786 Bacteria 1086
456 Ga0307515_10254822 3300028794 Bacteria 1501
457 Ga0307515_10471896 3300028794 Bacteria 868
458 Ga0307511_10128517 3300030521 Bacteria 1536
459 Ga0307513_10126681 3300031456 Bacteria 2508
460 Ga0307509_10198703 3300031507 Bacteria 1845
461 Ga0307408_101122507 3300031548 Bacteria 730
462 Ga0307408_101687807 3300031548 Bacteria 603
463 Ga0307508_10436927 3300031616 Bacteria 901
464 Ga0307516_10120108 3300031730 Bacteria 2420
465 Ga0307516_10280387 3300031730 Bacteria 1349
466 Ga0307405_10152841 3300031731 Bacteria 1625
467 Ga0307405_10385865 3300031731 Bacteria 1092
468 Ga0307413_10146496 3300031824 Bacteria 1640
469 Ga0307413_10205283 3300031824 Bacteria 1426
470 Ga0307413_10747627 3300031824 Bacteria 817
471 Ga0307406_10368236 3300031901 Bacteria 1129
472 Ga0307406_10909904 3300031901 Bacteria 750
473 Ga0307412_10028635 3300031911 Bacteria 3488
474 Ga0307412_10288119 3300031911 Bacteria 1292
475 Ga0307412_10676827 3300031911 Bacteria 883
476 Ga0307412_11927524 3300031911 Bacteria 546
477 Ga0307412_11938691 3300031911 Unclassified 544
478 Ga0307409_100504840 3300031995 Bacteria 1178
479 Ga0307409_102530113 3300031995 Bacteria 542
480 Ga0307416_100124842 3300032002 Bacteria 2303
481 Ga0307416_100621101 3300032002 Bacteria 1163
482 Ga0307416_100941318 3300032002 Bacteria 965
483 Ga0307416_100949353 3300032002 Bacteria 962
484 Ga0307416_101100863 3300032002 Bacteria 899
485 Ga0307416_101256695 3300032002 Bacteria 846
486 Ga0307416_101375007 3300032002 Bacteria 812
487 Ga0307411_10038307 3300032005 Bacteria 3023
488 Ga0307411_10285462 3300032005 Bacteria 1316
489 Ga0307411_11131720 3300032005 Bacteria 707
490 Ga0307415_100017971 3300032126 Bacteria 4256
491 Ga0307415_100182077 3300032126 Bacteria 1650
492 Ga0307415_100259039 3300032126 Bacteria 1418
493 Ga0307510_10071137 3300033180 Bacteria 3467
494 Ga0373943_0014145 3300035170 Bacteria 3609
495 Ga0373931_0625332 3300035691 Bacteria 706
496 Ga0373927_0019266 3300035695 Bacteria 4475
497 Ga0373947_0008612 3300035725 Bacteria 5872
498 Ga0373925_0081544 3300037068 Bacteria 2460
499 Ga0395905_0446101 3300037471 Bacteria 1192
500 Ga0439465_0012592 3300041413 Bacteria 2645
501 Ga0451793_0458310 3300041452 Bacteria 842
502 Ga0451797_0020094 3300041453 Bacteria 686
503 Ga0451800_0637662 3300041459 Bacteria 1208
504 Ga0451802_1184584 3300041460 Bacteria 1179
505 Ga0451802_1997251 3300041460 Bacteria 560
506 Ga0451802_2127802 3300041460 Bacteria 519
507 Ga0451807_0833332 3300041486 Bacteria 1241
508 Ga0451841_1432989 3300041498 Bacteria 688
509 Ga0451853_1513700 3300041512 Bacteria 1701
510 Ga0439445_0078004 3300042004 Bacteria 923
511 Ga0451576_1134266 3300045051 Bacteria 818
512 Ga0495617_114056 3300046452 Bacteria 873
513 Ga0495617_160604 3300046452 Bacteria 712
514 Ga0495603_0011405 3300046455 Bacteria 5380
515 Ga0495603_0079703 3300046455 Bacteria 1919
516 Ga0495603_0138290 3300046455 Bacteria 1417
517 Ga0495590_0438002 3300046457 Bacteria 504
518 Ga0495629_0866461 3300046459 Bacteria 593
519 Ga0495638_0107015 3300046460 Bacteria 1665
520 Ga0495638_0147794 3300046460 Bacteria 1365
521 Ga0495641_0392743 3300046461 Unclassified 629
522 Ga0495650_0132802 3300046471 Bacteria 907
523 Ga0495580_0211891 3300046472 Bacteria 1333
524 Ga0495605_0116782 3300046474 Bacteria 1213
525 Ga0495662_0337457 3300046476 Bacteria 741
526 Ga0495584_0057240 3300046491 Bacteria 1961
527 Ga0495584_0128354 3300046491 Bacteria 1286
528 Ga0495584_0269295 3300046491 Bacteria 866
529 Ga0495584_0317976 3300046491 Bacteria 790
530 Ga0495585_0017852 3300046492 Bacteria 4095
531 Ga0495585_0033839 3300046492 Bacteria 2891
532 Ga0495585_0241584 3300046492 Bacteria 904
533 Ga0495594_0080093 3300046499 Bacteria 1823
534 Ga0495596_0053833 3300046500 Bacteria 1574
535 Ga0495596_0099065 3300046500 Bacteria 1131
536 Ga0495607_0055266 3300046501 Bacteria 2284
537 Ga0495607_0142486 3300046501 Bacteria 1235
538 Ga0495583_0033447 3300046506 Bacteria 2473
539 Ga0495583_0055586 3300046506 Bacteria 1788
540 Ga0495583_0261356 3300046506 Bacteria 692
541 Ga0495606_0135727 3300046507 Bacteria 1457
542 Ga0495606_0165192 3300046507 Bacteria 1288
543 Ga0495610_0025158 3300046512 Bacteria 3201
544 Ga0495610_0248654 3300046512 Bacteria 705
545 Ga0495616_0021245 3300046513 Bacteria 3517
546 Ga0495616_0091337 3300046513 Bacteria 1441
547 Ga0495616_0142007 3300046513 Bacteria 1092
548 Ga0495616_0424363 3300046513 Bacteria 543
549 Ga0495620_0012556 3300046515 Bacteria 4367
550 Ga0495620_0268957 3300046515 Bacteria 649
551 Ga0495630_0133723 3300046517 Bacteria 1884
552 Ga0495631_0019017 3300046518 Bacteria 3226
553 Ga0495631_0082536 3300046518 Bacteria 1385
554 Ga0495632_0118079 3300046519 Bacteria 1241
555 Ga0495632_0146198 3300046519 Bacteria 1094
556 Ga0495632_0170461 3300046519 Bacteria 1000
557 Ga0495637_0106273 3300046520 Bacteria 1092
558 Ga0495643_0083768 3300046522 Bacteria 1655
559 Ga0495643_0220586 3300046522 Bacteria 899
560 Ga0495644_0032891 3300046523 Bacteria 1960
561 Ga0495644_0034709 3300046523 Bacteria 1904
562 Ga0495644_0287849 3300046523 Bacteria 642
563 Ga0495644_0352431 3300046523 Bacteria 580
564 Ga0495648_0003972 3300046524 Bacteria 12795
565 Ga0495648_0062800 3300046524 Bacteria 2197
566 Ga0495648_0274312 3300046524 Bacteria 802
567 Ga0495648_0301955 3300046524 Bacteria 750
568 Ga0495663_0036767 3300046525 Bacteria 1475
569 Ga0495663_0229618 3300046525 Bacteria 654
570 Ga0495642_0221046 3300046528 Bacteria 827
571 Ga0495654_0081580 3300046530 Bacteria 1515
572 Ga0495598_0026714 3300046537 Bacteria 1585
573 Ga0495609_0054926 3300046538 Bacteria 1767
574 Ga0495609_0167607 3300046538 Bacteria 929
575 Ga0495597_0043930 3300046542 Bacteria 1988
576 Ga0495597_0321323 3300046542 Bacteria 598
577 Ga0495622_0019041 3300046557 Bacteria 3198
578 Ga0495622_0110135 3300046557 Bacteria 1261
579 Ga0495622_0130339 3300046557 Bacteria 1146
580 Ga0495656_0016291 3300046615 Bacteria 2819
581 Ga0495656_0085971 3300046615 Bacteria 1429
582 Ga0495656_0115215 3300046615 Bacteria 1262
583 Ga0495656_0404391 3300046615 Bacteria 714
584 Ga0495656_0641787 3300046615 Bacteria 570
585 Ga0495668_0077805 3300046616 Bacteria 1821
586 Ga0495611_0027557 3300046648 Bacteria 2484
587 Ga0495611_0073397 3300046648 Bacteria 1566
588 Ga0495611_0184702 3300046648 Bacteria 974
589 Ga0495611_0593020 3300046648 Bacteria 501
590 Ga0495625_0183592 3300046660 Bacteria 1389
591 Ga0495625_0186023 3300046660 Bacteria 1378
592 Ga0495635_0409530 3300046663 Bacteria 900
593 Ga0495659_0004408 3300046664 Bacteria 4433
594 Ga0495659_0006029 3300046664 Bacteria 3831
595 Ga0495661_0055606 3300046665 Bacteria 2371
596 Ga0495661_0182535 3300046665 Bacteria 1111
597 Ga0495588_0005668 3300046674 Bacteria 5567
598 Ga0495588_0063262 3300046674 Bacteria 1918
599 Ga0495669_0005775 3300046684 Bacteria 5160
600 Ga0495669_0064087 3300046684 Bacteria 1667
601 Ga0495669_0086391 3300046684 Bacteria 1444
602 Ga0495669_0166884 3300046684 Bacteria 1046
603 Ga0495669_0550258 3300046684 Bacteria 561
604 Ga0495624_0105506 3300046690 Bacteria 1734
605 Ga0495670_0041394 3300046691 Bacteria 2298
606 Ga0495670_0410719 3300046691 Bacteria 732
607 Ga0495671_0016018 3300046692 Bacteria 4010
608 Ga0495671_0230377 3300046692 Bacteria 896
609 Ga0495649_0094598 3300046694 Bacteria 1590
610 Ga0495649_0316004 3300046694 Bacteria 793
611 Ga0495589_0386501 3300046794 Bacteria 643
612 Ga0495660_0028579 3300046810 Bacteria 3149
613 Ga0495581_0431231 3300047315 Bacteria 768
614 Ga0495636_0313305 3300047318 Bacteria 736
615 Ga0495636_0442684 3300047318 Bacteria 623
616 Ga0495672_0084529 3300047320 Bacteria 1760
617 Ga0495672_0231428 3300047320 Bacteria 907
618 Ga0495672_0232039 3300047320 Bacteria 905
619 Ga0495672_0340494 3300047320 Bacteria 699
620 Ga0495676_0038104 3300047321 Bacteria 3996
621 Ga0495676_0091373 3300047321 Bacteria 2276
622 Ga0495676_0486011 3300047321 Bacteria 812
623 Ga0495683_0141427 3300047323 Bacteria 1127
624 Ga0495683_0212261 3300047323 Bacteria 867
625 Ga0495677_0012469 3300047445 Bacteria 3100
626 Ga0495677_0262739 3300047445 Bacteria 676
627 Ga0495673_0119325 3300047469 Bacteria 1046
628 Ga0495673_0335321 3300047469 Bacteria 536
629 Ga0495681_0107394 3300047470 Bacteria 1213
630 Ga0495686_0134109 3300047472 Bacteria 1466
631 Ga0495686_0162470 3300047472 Bacteria 1304
632 Ga0495593_0051110 3300047673 Bacteria 2188
633 Ga0495602_0415451 3300048088 Bacteria 956
634 Ga0495615_0096012 3300048090 Bacteria 832
635 Ga0495626_0083104 3300048091 Bacteria 1419
636 Ga0496100_0244255 3300048903 Bacteria 1326
637 Ga0496100_0400348 3300048903 Bacteria 1045
638 Ga0496100_0490392 3300048903 Bacteria 946
639 Ga0496101_0251839 3300048904 Bacteria 1376
640 Ga0496101_0279729 3300048904 Bacteria 1304
641 Ga0496102_0040343 3300048905 Bacteria 4222
642 Ga0496102_0236607 3300048905 Bacteria 1722
643 Ga0496102_0328645 3300048905 Bacteria 1440
644 Ga0496102_0475381 3300048905 Bacteria 1171
645 Ga0496102_0532199 3300048905 Bacteria 1098
646 Ga0496102_0548722 3300048905 Bacteria 1079
647 Ga0496102_0804442 3300048905 Bacteria 862
648 Ga0496103_0515679 3300048906 Bacteria 764
649 Ga0496104_0179386 3300048907 Bacteria 2028
650 Ga0496104_0802006 3300048907 Bacteria 848
651 Ga0496104_1054754 3300048907 Bacteria 716
652 Ga0496105_0022258 3300048908 Bacteria 5133
653 Ga0496105_0261668 3300048908 Bacteria 1399
654 Ga0496105_1226346 3300048908 Bacteria 551
655 Ga0496106_0132428 3300048909 Bacteria 1956
656 Ga0496106_0159983 3300048909 Bacteria 1781
657 Ga0496106_0172367 3300048909 Bacteria 1715
658 Ga0496106_0516883 3300048909 Bacteria 959
659 Ga0496106_1031002 3300048909 Bacteria 646
660 Ga0496107_0050553 3300048910 Bacteria 2996
661 Ga0496107_0185277 3300048910 Bacteria 1546
662 Ga0496108_0041652 3300048911 Bacteria 3834
663 Ga0496108_0069035 3300048911 Bacteria 2982
664 Ga0496108_0127359 3300048911 Bacteria 2187
665 Ga0496109_0002712 3300048912 Bacteria 14835
666 Ga0496109_0268167 3300048912 Bacteria 1608
667 Ga0496109_0846522 3300048912 Bacteria 852
668 Ga0496109_1161348 3300048912 Bacteria 709
669 Ga0496110_0047989 3300048913 Bacteria 3741
670 Ga0496110_0296914 3300048913 Bacteria 1472
671 Ga0496110_0652449 3300048913 Bacteria 952
672 Ga0496111_0369912 3300048914 Bacteria 1060
673 Ga0496111_0660527 3300048914 Bacteria 762
674 Ga0496111_0888610 3300048914 Bacteria 642
675 Ga0496112_0385209 3300048915 Bacteria 1343
676 Ga0496112_0503882 3300048915 Bacteria 1146
677 Ga0496113_0042931 3300048916 Bacteria 3343
678 Ga0496113_0156425 3300048916 Bacteria 1800
679 Ga0496113_1062269 3300048916 Bacteria 636
680 Ga0496114_0017279 3300048917 Bacteria 5821
681 Ga0496115_0000662 3300048918 Bacteria 25511
682 Ga0496115_0016859 3300048918 Bacteria 5571
683 Ga0496115_0350908 3300048918 Bacteria 1203
684 Ga0496115_0474670 3300048918 Bacteria 1008
685 Ga0496116_0004324 3300048919 Bacteria 13589
686 Ga0496116_0136526 3300048919 Bacteria 1388
687 Ga0496116_0156431 3300048919 Bacteria 1257
688 Ga0496117_0217647 3300048920 Bacteria 1065
689 Ga0496118_0340515 3300048921 Bacteria 804
690 Ga0496118_0506131 3300048921 Bacteria 599
691 Ga0496119_0065422 3300048922 Bacteria 2153
692 Ga0496120_0037891 3300048923 Bacteria 2857
693 Ga0496120_0286356 3300048923 Bacteria 760
694 Ga0496121_0009292 3300048924 Bacteria 11341
695 Ga0496121_0014683 3300048924 Bacteria 8280
696 Ga0496121_0068498 3300048924 Bacteria 2870
697 Ga0496121_0070812 3300048924 Bacteria 2807
698 Ga0496121_0077018 3300048924 Bacteria 2657
699 Ga0496121_0173020 3300048924 Bacteria 1566
700 Ga0496122_0236731 3300048925 Bacteria 1033
701 Ga0496124_0038084 3300048927 Bacteria 4177
702 Ga0496124_0136750 3300048927 Bacteria 1939
703 Ga0496124_0322025 3300048927 Bacteria 1106
704 Ga0496125_0000576 3300048928 Bacteria 62844
705 Ga0496125_0003062 3300048928 Bacteria 20888
706 Ga0496125_0019247 3300048928 Bacteria 6447
707 Ga0496125_0024760 3300048928 Bacteria 5512
708 Ga0496125_0162397 3300048928 Bacteria 1515
709 Ga0496126_0010315 3300048929 Bacteria 9808
710 Ga0496126_0251532 3300048929 Bacteria 1472
711 Ga0496126_0252521 3300048929 Bacteria 1469
712 Ga0496126_0268499 3300048929 Bacteria 1416
713 Ga0496126_0637230 3300048929 Bacteria 835
714 Ga0496126_0811190 3300048929 Bacteria 717
715 Ga0496126_0838694 3300048929 Bacteria 702
716 Ga0496126_0960773 3300048929 Bacteria 644
717 Ga0495678_053345 3300049459 Bacteria 1553
718 Ga0495678_150195 3300049459 Bacteria 753
719 Ga0501033_0281497 3300049570 Bacteria 1174
720 Ga0501036_0032225 3300049572 Bacteria 4428
721 Ga0501039_0359995 3300049575 Bacteria 1143
722 Ga0501040_0421166 3300049576 Bacteria 960
723 Ga0501042_0207474 3300049578 Bacteria 1413
724 Ga0501042_0416929 3300049578 Bacteria 973
725 Ga0501067_0097450 3300049583 Bacteria 1633
726 Ga0501067_0229794 3300049583 Bacteria 1033
727 Ga0501067_0793314 3300049583 Bacteria 533
728 Ga0501068_0709982 3300049584 Bacteria 658
729 Ga0501069_0266049 3300049585 Bacteria 1002
730 Ga0501075_0904345 3300049591 Bacteria 671
731 Ga0501076_0081846 3300049592 Bacteria 2592
732 Ga0501079_0509766 3300049741 Bacteria 946
733 nmdc:mga03683_216634_c1 3300050489 Bacteria 882
734 nmdc:mga03683_30311_c1 3300050489 Bacteria 2164
735 nmdc:mga03683_60875_c1 3300050489 Bacteria 1595
736 nmdc:mga03n38_218285_c1 3300050490 Bacteria 994
737 nmdc:mga03n38_4900_c1 3300050490 Bacteria 4490
738 nmdc:mga03n38_509678_c1 3300050490 Bacteria 676
739 nmdc:mga03n38_87872_c1 3300050490 Bacteria 1474
740 nmdc:mga00v17_25959_c1 3300050491 Bacteria 3408
741 nmdc:mga00v17_275865_c1 3300050491 Bacteria 1091
742 nmdc:mga00v17_33232_c1 3300050491 Bacteria 3055
743 nmdc:mga00v17_493727_c1 3300050491 Bacteria 794
744 nmdc:mga00v17_67499_c1 3300050491 Bacteria 2210
745 nmdc:mga0yw44_110728_c1 3300050492 Bacteria 1759
746 nmdc:mga0yw44_53352_c1 3300050492 Bacteria 2455
747 nmdc:mga0yw44_534557_c1 3300050492 Bacteria 796
748 nmdc:mga0yw44_67134_c1 3300050492 Bacteria 2216
749 nmdc:mga0k408_172468_c1 3300050493 Bacteria 1289
750 nmdc:mga0k408_17739_c1 3300050493 Bacteria 3967
751 nmdc:mga0k408_364905_c1 3300050493 Bacteria 861
752 nmdc:mga0k408_48985_c1 3300050493 Bacteria 2446
753 nmdc:mga06z11_46391_c1 3300050494 Bacteria 2202
754 nmdc:mga06z11_86090_c1 3300050494 Bacteria 1697
755 nmdc:mga06z11_95459_c1 3300050494 Bacteria 1622
756 nmdc:mga04h51_271546_c1 3300050495 Bacteria 685
757 nmdc:mga04h51_4863_c1 3300050495 Bacteria 3379
758 nmdc:mga07m45_1133_c1 3300050496 Bacteria 11961
759 nmdc:mga07m45_127438_c1 3300050496 Bacteria 1472
760 nmdc:mga07m45_63401_c1 3300050496 Bacteria 2096
761 nmdc:mga07m45_8538_c1 3300050496 Bacteria 5270
762 nmdc:mga05p37_98773_c2 3300050507 Bacteria 2993
763 nmdc:mga0qj67_852783_c1 3300050509 Bacteria 719
764 nmdc:mga08y16_167333_c1 3300050511 Bacteria 2284
765 nmdc:mga0n895_749391_c1 3300050512 Bacteria 970
766 nmdc:mga0rr50_87656_c1 3300050513 Bacteria 2416
767 nmdc:mga0sz30_127066_c1 3300050516 Bacteria 1122
768 nmdc:mga0sz30_33621_c1 3300050516 Bacteria 2132
769 nmdc:mga0sz30_5727_c1 3300050516 Bacteria 4573
770 Ga0495601_0775270 3300053077 Bacteria 609
771 Ga0500610_0372451 3300053079 Bacteria 594
772 Ga0500578_0086215 3300053086 Bacteria 1995
773 Ga0500643_015303 3300053087 Bacteria 2634
774 Ga0500644_0038537 3300053088 Bacteria 1569
775 Ga0500581_095248 3300053089 Bacteria 1469
776 Ga0500646_0005472 3300053090 Bacteria 3211
777 Ga0500583_0094821 3300053092 Bacteria 1455
778 Ga0500651_0083111 3300053093 Bacteria 1981
779 Ga0500651_0200773 3300053093 Bacteria 1176
780 Ga0500566_0001694 3300053094 Bacteria 12936
781 Ga0500641_0012293 3300053096 Bacteria 3125
782 Ga0500641_0080652 3300053096 Bacteria 1380
783 Ga0500650_0026706 3300053098 Bacteria 2592
784 Ga0500555_058223 3300053103 Bacteria 1044
785 Ga0500556_0000045 3300053104 Bacteria 130653
786 Ga0500556_0055793 3300053104 Bacteria 1442
787 Ga0500557_020503 3300053105 Bacteria 1882
788 Ga0500562_040758 3300053108 Bacteria 1234
789 Ga0500562_064114 3300053108 Bacteria 988
790 Ga0500569_002140 3300053109 Bacteria 3844
791 Ga0500569_118019 3300053109 Bacteria 881
792 Ga0500592_001228 3300053116 Bacteria 4180
793 Ga0500594_0016895 3300053118 Bacteria 1779
794 Ga0500594_0027480 3300053118 Bacteria 1474
795 Ga0500594_0045206 3300053118 Bacteria 1221
796 Ga0500595_001792 3300053119 Bacteria 11171
797 Ga0500595_036921 3300053119 Bacteria 1597
798 Ga0500607_118597 3300053121 Bacteria 1284
799 Ga0500608_000258 3300053122 Bacteria 20723
800 Ga0500618_003686 3300053125 Bacteria 5169
801 Ga0500621_043972 3300053126 Bacteria 1806
802 Ga0500628_106102 3300053129 Bacteria 749
803 Ga0500642_0000024 3300053130 Bacteria 134373
804 Ga0500642_0186978 3300053130 Bacteria 967
805 Ga0500642_0196556 3300053130 Bacteria 940
806 Ga0500652_000243 3300053131 Bacteria 20537
807 Ga0500655_086095 3300053133 Bacteria 650
808 Ga0500658_0063954 3300053134 Bacteria 1537
809 Ga0500658_0399763 3300053134 Bacteria 629
810 Ga0500559_0000051 3300053136 Bacteria 91468
811 Ga0500568_0004461 3300053139 Bacteria 7475
812 Ga0500568_0007981 3300053139 Bacteria 5139
813 Ga0500577_0000206 3300053142 Bacteria 15624
814 Ga0500577_0201678 3300053142 Bacteria 858
815 Ga0500586_001434 3300053145 Bacteria 5025
816 Ga0500588_0058542 3300053146 Bacteria 1227
817 Ga0500588_0064459 3300053146 Bacteria 1184
818 Ga0500589_222608 3300053147 Bacteria 710
819 Ga0500604_0039514 3300053151 Bacteria 1419
820 Ga0500616_0000054 3300053153 Bacteria 290186
821 Ga0500616_0174836 3300053153 Bacteria 972
822 Ga0500622_0011897 3300053156 Bacteria 4730
823 Ga0500624_051840 3300053157 Bacteria 765
824 Ga0500627_0073841 3300053158 Bacteria 1513
825 Ga0500627_0106682 3300053158 Bacteria 1259
826 Ga0500633_0086631 3300053160 Bacteria 1139
827 Ga0500633_0142048 3300053160 Bacteria 899
828 Ga0500633_0198603 3300053160 Bacteria 751
829 Ga0500634_0017025 3300053161 Bacteria 3887
830 Ga0500634_0061817 3300053161 Bacteria 1985
831 Ga0500634_0185350 3300053161 Bacteria 931
832 Ga0500638_101381 3300053162 Bacteria 1342
833 Ga0500636_0000249 3300053177 Bacteria 29583
834 Ga0500637_0205050 3300053178 Bacteria 1121
835 Ga0500637_0240308 3300053178 Bacteria 1015
836 Ga0500570_056815 3300053724 Bacteria 1924
837 Ga0500611_003674 3300053727 Bacteria 1993
838 Ga0500611_008796 3300053727 Bacteria 1576
839 Ga0500645_017731 3300053730 Bacteria 2227
840 Ga0500645_021151 3300053730 Bacteria 2009
841 Ga0500645_049014 3300053730 Bacteria 1236
842 Ga0500645_133957 3300053730 Bacteria 687
843 Ga0500609_033089 3300053731 Bacteria 712
844 Ga0500596_006873 3300053735 Bacteria 1892
845 Ga0501084_0400018 3300054114 Bacteria 1161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2602042107 2603860532 139
2 iso_pu_bacteria 2857524615 2857525487 139
3 iso_pu_bacteria 2893066018 2893070864 139
4 iso_pu_bacteria 2919073203 2919074703 139
5 3300048929 Ga0496126_0960773 Ga0496126_0960773_45_476 141
6 3300053121 Ga0500607_118597 Ga0500607_118597_380_826 141
7 3300053142 Ga0500577_0000206 Ga0500577_0000206_6143_6571 141
8 iso_pu_bacteria 2922361189 2922363462 141
9 iso_pu_bacteria 2922386360 2922389578 141
10 3300031911 Ga0307412_10288119 Ga0307412_102881192 142
11 3300048925 Ga0496122_0236731 Ga0496122_0236731_592_1023 142
12 3300048928 Ga0496125_0000576 Ga0496125_0000576_60474_60905 142
13 3300048928 Ga0496125_0003062 Ga0496125_0003062_8832_9263 142
14 3300005435 Ga0070714_100366282 Ga0070714_1003662822 143
15 3300005455 Ga0070663_100031087 Ga0070663_1000310875 143
16 3300005548 Ga0070665_100554975 Ga0070665_1005549752 143
17 3300006038 Ga0075365_10597478 Ga0075365_105974781 143
18 3300006038 Ga0075365_10971962 Ga0075365_109719622 143
19 3300006048 Ga0075363_100075676 Ga0075363_1000756762 143
20 3300006051 Ga0075364_10019872 Ga0075364_100198725 143
21 3300006186 Ga0075369_10015343 Ga0075369_100153433 143
22 3300006353 Ga0075370_10103015 Ga0075370_101030152 143
23 3300025295 Ga0209564_1023084 Ga0209564_10230843 143
24 3300025929 Ga0207664_10786941 Ga0207664_107869412 143
25 3300026067 Ga0207678_10005268 Ga0207678_100052687 143
26 3300028794 Ga0307515_10254822 Ga0307515_102548222 143
27 3300041452 Ga0451793_0458310 Ga0451793_0458310_32_469 143
28 3300041460 Ga0451802_2127802 Ga0451802_2127802_26_463 143
29 3300046460 Ga0495638_0147794 Ga0495638_0147794_725_1162 143
30 3300046500 Ga0495596_0053833 Ga0495596_0053833_1049_1486 143
31 3300046501 Ga0495607_0055266 Ga0495607_0055266_1417_1854 143
32 3300046506 Ga0495583_0055586 Ga0495583_0055586_1329_1766 143
33 3300046507 Ga0495606_0165192 Ga0495606_0165192_478_915 143
34 3300046512 Ga0495610_0025158 Ga0495610_0025158_1209_1646 143
35 3300046513 Ga0495616_0021245 Ga0495616_0021245_1168_1605 143
36 3300046515 Ga0495620_0012556 Ga0495620_0012556_1147_1584 143
37 3300046518 Ga0495631_0082536 Ga0495631_0082536_890_1327 143
38 3300046519 Ga0495632_0146198 Ga0495632_0146198_411_848 143
39 3300046520 Ga0495637_0106273 Ga0495637_0106273_343_780 143
40 3300046522 Ga0495643_0220586 Ga0495643_0220586_94_531 143
41 3300046524 Ga0495648_0003972 Ga0495648_0003972_4854_5291 143
42 3300046524 Ga0495648_0062800 Ga0495648_0062800_272_709 143
43 3300046530 Ga0495654_0081580 Ga0495654_0081580_687_1124 143
44 3300046542 Ga0495597_0043930 Ga0495597_0043930_909_1346 143
45 3300046557 Ga0495622_0019041 Ga0495622_0019041_2595_3032 143
46 3300046616 Ga0495668_0077805 Ga0495668_0077805_927_1364 143
47 3300046648 Ga0495611_0073397 Ga0495611_0073397_325_756 143
48 3300046660 Ga0495625_0186023 Ga0495625_0186023_729_1166 143
49 3300046665 Ga0495661_0055606 Ga0495661_0055606_1488_1925 143
50 3300046674 Ga0495588_0063262 Ga0495588_0063262_630_1067 143
51 3300046691 Ga0495670_0041394 Ga0495670_0041394_1605_2042 143
52 3300046692 Ga0495671_0016018 Ga0495671_0016018_2579_3016 143
53 3300046810 Ga0495660_0028579 Ga0495660_0028579_1463_1900 143
54 3300047320 Ga0495672_0084529 Ga0495672_0084529_1082_1519 143
55 3300047323 Ga0495683_0212261 Ga0495683_0212261_213_650 143
56 3300047469 Ga0495673_0119325 Ga0495673_0119325_380_817 143
57 3300047470 Ga0495681_0107394 Ga0495681_0107394_758_1195 143
58 3300048088 Ga0495602_0415451 Ga0495602_0415451_461_898 143
59 3300048091 Ga0495626_0083104 Ga0495626_0083104_660_1097 143
60 3300048903 Ga0496100_0244255 Ga0496100_0244255_540_977 143
61 3300048905 Ga0496102_0236607 Ga0496102_0236607_364_801 143
62 3300048909 Ga0496106_0132428 Ga0496106_0132428_468_905 143
63 3300048919 Ga0496116_0004324 Ga0496116_0004324_12800_13237 143
64 3300048919 Ga0496116_0156431 Ga0496116_0156431_273_710 143
65 3300048920 Ga0496117_0217647 Ga0496117_0217647_28_465 143
66 3300048922 Ga0496119_0065422 Ga0496119_0065422_80_517 143
67 3300048923 Ga0496120_0037891 Ga0496120_0037891_1760_2197 143
68 3300048924 Ga0496121_0009292 Ga0496121_0009292_4998_5435 143
69 3300048924 Ga0496121_0014683 Ga0496121_0014683_3559_3996 143
70 3300048927 Ga0496124_0322025 Ga0496124_0322025_573_1010 143
71 3300048928 Ga0496125_0019247 Ga0496125_0019247_73_510 143
72 3300048928 Ga0496125_0024760 Ga0496125_0024760_73_510 143
73 3300049459 Ga0495678_053345 Ga0495678_053345_73_510 143
74 3300050492 nmdc:mga0yw44_53352_c1 nmdc:mga0yw44_53352_c1_212_649 143
75 3300050492 nmdc:mga0yw44_67134_c1 nmdc:mga0yw44_67134_c1_852_1289 143
76 3300050496 nmdc:mga07m45_127438_c1 nmdc:mga07m45_127438_c1_719_1156 143
77 3300050516 nmdc:mga0sz30_5727_c1 nmdc:mga0sz30_5727_c1_2054_2491 143
78 3300053086 Ga0500578_0086215 Ga0500578_0086215_1355_1792 143
79 3300053087 Ga0500643_015303 Ga0500643_015303_1629_2066 143
80 3300053088 Ga0500644_0038537 Ga0500644_0038537_445_882 143
81 3300053089 Ga0500581_095248 Ga0500581_095248_437_874 143
82 3300053090 Ga0500646_0005472 Ga0500646_0005472_2031_2468 143
83 3300053093 Ga0500651_0083111 Ga0500651_0083111_204_641 143
84 3300053093 Ga0500651_0200773 Ga0500651_0200773_497_934 143
85 3300053094 Ga0500566_0001694 Ga0500566_0001694_5625_6062 143
86 3300053096 Ga0500641_0012293 Ga0500641_0012293_1874_2311 143
87 3300053098 Ga0500650_0026706 Ga0500650_0026706_1261_1698 143
88 3300053104 Ga0500556_0000045 Ga0500556_0000045_97077_97514 143
89 3300053105 Ga0500557_020503 Ga0500557_020503_265_702 143
90 3300053108 Ga0500562_040758 Ga0500562_040758_189_626 143
91 3300053109 Ga0500569_002140 Ga0500569_002140_447_884 143
92 3300053116 Ga0500592_001228 Ga0500592_001228_1661_2098 143
93 3300053118 Ga0500594_0016895 Ga0500594_0016895_978_1415 143
94 3300053122 Ga0500608_000258 Ga0500608_000258_11774_12211 143
95 3300053125 Ga0500618_003686 Ga0500618_003686_1631_2068 143
96 3300053126 Ga0500621_043972 Ga0500621_043972_494_931 143
97 3300053130 Ga0500642_0000024 Ga0500642_0000024_100983_101420 143
98 3300053131 Ga0500652_000243 Ga0500652_000243_10119_10556 143
99 3300053133 Ga0500655_086095 Ga0500655_086095_119_556 143
100 3300053134 Ga0500658_0063954 Ga0500658_0063954_535_972 143
101 3300053136 Ga0500559_0000051 Ga0500559_0000051_16489_16926 143
102 3300053139 Ga0500568_0007981 Ga0500568_0007981_3192_3629 143
103 3300053142 Ga0500577_0201678 Ga0500577_0201678_189_626 143
104 3300053145 Ga0500586_001434 Ga0500586_001434_1950_2402 143
105 3300053146 Ga0500588_0064459 Ga0500588_0064459_189_626 143
106 3300053153 Ga0500616_0000054 Ga0500616_0000054_99995_100432 143
107 3300053156 Ga0500622_0011897 Ga0500622_0011897_4246_4683 143
108 3300053157 Ga0500624_051840 Ga0500624_051840_85_522 143
109 3300053158 Ga0500627_0106682 Ga0500627_0106682_559_996 143
110 3300053160 Ga0500633_0086631 Ga0500633_0086631_173_610 143
111 3300053161 Ga0500634_0017025 Ga0500634_0017025_1355_1792 143
112 3300053177 Ga0500636_0000249 Ga0500636_0000249_7274_7711 143
113 3300053178 Ga0500637_0240308 Ga0500637_0240308_296_733 143
114 3300053724 Ga0500570_056815 Ga0500570_056815_1282_1719 143
115 3300053727 Ga0500611_008796 Ga0500611_008796_39_476 143
116 3300053730 Ga0500645_017731 Ga0500645_017731_1570_2007 143
117 3300053730 Ga0500645_049014 Ga0500645_049014_424_861 143
118 3300053735 Ga0500596_006873 Ga0500596_006873_1070_1507 143
119 iso_pu_bacteria 2513237101 2513698539 143
120 iso_pu_bacteria 2721755755 2723848799 143
121 iso_pu_bacteria 2791355199 2793078803 143
122 iso_pu_bacteria 2874604998 2874606079 143
123 iso_pu_bacteria 2876808645 2876809151 143
124 iso_pu_bacteria 2879110137 2879116758 143
125 iso_pu_bacteria 2889033259 2889034421 143
126 iso_pu_bacteria 8006984368 8006986276 143
127 iso_pu_bacteria 8006994254 8006998951 143
128 iso_pu_bacteria 8056673599 8056675413 143
129 3300005343 Ga0070687_101328605 Ga0070687_1013286051 144
130 3300005356 Ga0070674_100159655 Ga0070674_1001596552 144
131 3300005456 Ga0070678_100019954 Ga0070678_1000199545 144
132 3300005543 Ga0070672_100735015 Ga0070672_1007350151 144
133 3300005544 Ga0070686_100303713 Ga0070686_1003037133 144
134 3300005615 Ga0070702_100136524 Ga0070702_1001365242 144
135 3300005718 Ga0068866_10138234 Ga0068866_101382342 144
136 3300006237 Ga0097621_100036520 Ga0097621_1000365205 144
137 3300006358 Ga0068871_100344932 Ga0068871_1003449323 144
138 3300006881 Ga0068865_100045409 Ga0068865_1000454092 144
139 3300009176 Ga0105242_11089932 Ga0105242_110899321 144
140 3300013297 Ga0157378_10263661 Ga0157378_102636612 144
141 3300013308 Ga0157375_10079517 Ga0157375_100795172 144
142 3300014326 Ga0157380_10130927 Ga0157380_101309272 144
143 3300014969 Ga0157376_10043154 Ga0157376_100431542 144
144 3300025918 Ga0207662_11170361 Ga0207662_111703612 144
145 3300025935 Ga0207709_10892815 Ga0207709_108928151 144
146 3300025938 Ga0207704_10159868 Ga0207704_101598683 144
147 3300025940 Ga0207691_10686813 Ga0207691_106868131 144
148 3300026121 Ga0207683_10053503 Ga0207683_100535032 144
149 3300046515 Ga0495620_0268957 Ga0495620_0268957_95_535 144
150 3300048904 Ga0496101_0279729 Ga0496101_0279729_826_1266 144
151 3300005334 Ga0068869_100045470 Ga0068869_1000454702 145
152 3300005338 Ga0068868_100190391 Ga0068868_1001903913 145
153 3300005353 Ga0070669_100217204 Ga0070669_1002172042 145
154 3300005356 Ga0070674_100450125 Ga0070674_1004501251 145
155 3300005456 Ga0070678_100063923 Ga0070678_1000639232 145
156 3300005457 Ga0070662_100506194 Ga0070662_1005061942 145
157 3300005543 Ga0070672_100217030 Ga0070672_1002170303 145
158 3300005617 Ga0068859_100100705 Ga0068859_1001007052 145
159 3300005618 Ga0068864_100546839 Ga0068864_1005468392 145
160 3300005844 Ga0068862_100395734 Ga0068862_1003957342 145
161 3300005844 Ga0068862_100401407 Ga0068862_1004014072 145
162 3300005983 Ga0081540_1007330 Ga0081540_10073306 145
163 3300006038 Ga0075365_10435751 Ga0075365_104357513 145
164 3300006178 Ga0075367_10155032 Ga0075367_101550322 145
165 3300006178 Ga0075367_10714339 Ga0075367_107143391 145
166 3300006195 Ga0075366_10107576 Ga0075366_101075764 145
167 3300006195 Ga0075366_10943511 Ga0075366_109435111 145
168 3300006353 Ga0075370_10014094 Ga0075370_100140944 145
169 3300006844 Ga0075428_101205413 Ga0075428_1012054131 145
170 3300006881 Ga0068865_100427191 Ga0068865_1004271911 145
171 3300006931 Ga0097620_100100701 Ga0097620_1001007015 145
172 3300009092 Ga0105250_10270421 Ga0105250_102704212 145
173 3300009101 Ga0105247_10218098 Ga0105247_102180982 145
174 3300009148 Ga0105243_10346774 Ga0105243_103467742 145
175 3300011119 Ga0105246_10185559 Ga0105246_101855592 145
176 3300013308 Ga0157375_10654551 Ga0157375_106545512 145
177 3300014325 Ga0163163_11172445 Ga0163163_111724452 145
178 3300014326 Ga0157380_10220770 Ga0157380_102207702 145
179 3300025907 Ga0207645_10080213 Ga0207645_100802132 145
180 3300025923 Ga0207681_10892005 Ga0207681_108920052 145
181 3300025933 Ga0207706_11145341 Ga0207706_111453411 145
182 3300025937 Ga0207669_10693778 Ga0207669_106937782 145
183 3300025938 Ga0207704_10825391 Ga0207704_108253911 145
184 3300025940 Ga0207691_11112255 Ga0207691_111122551 145
185 3300025942 Ga0207689_10061642 Ga0207689_100616425 145
186 3300025960 Ga0207651_10581446 Ga0207651_105814461 145
187 3300025972 Ga0207668_10147450 Ga0207668_101474503 145
188 3300026095 Ga0207676_10379198 Ga0207676_103791982 145
189 3300026118 Ga0207675_100222513 Ga0207675_1002225134 145
190 3300026121 Ga0207683_10095110 Ga0207683_100951102 145
191 3300028380 Ga0268265_10226578 Ga0268265_102265783 145
192 3300028380 Ga0268265_10362348 Ga0268265_103623482 145
193 3300028381 Ga0268264_10056791 Ga0268264_100567914 145
194 3300028794 Ga0307515_10471896 Ga0307515_104718962 145
195 3300031730 Ga0307516_10120108 Ga0307516_101201082 145
196 3300031901 Ga0307406_10909904 Ga0307406_109099042 145
197 3300031911 Ga0307412_11927524 Ga0307412_119275241 145
198 3300032002 Ga0307416_100949353 Ga0307416_1009493532 145
199 3300032005 Ga0307411_11131720 Ga0307411_111317202 145
200 3300037471 Ga0395905_0446101 Ga0395905_0446101_275_712 145
201 3300041460 Ga0451802_1184584 Ga0451802_1184584_315_752 145
202 3300045051 Ga0451576_1134266 Ga0451576_1134266_310_747 145
203 3300046476 Ga0495662_0337457 Ga0495662_0337457_81_524 145
204 3300046491 Ga0495584_0128354 Ga0495584_0128354_415_852 145
205 3300046491 Ga0495584_0269295 Ga0495584_0269295_196_633 145
206 3300046492 Ga0495585_0033839 Ga0495585_0033839_2252_2689 145
207 3300046492 Ga0495585_0241584 Ga0495585_0241584_409_846 145
208 3300046499 Ga0495594_0080093 Ga0495594_0080093_882_1319 145
209 3300046501 Ga0495607_0142486 Ga0495607_0142486_472_909 145
210 3300046506 Ga0495583_0261356 Ga0495583_0261356_70_507 145
211 3300046513 Ga0495616_0424363 Ga0495616_0424363_41_478 145
212 3300046523 Ga0495644_0032891 Ga0495644_0032891_1043_1480 145
213 3300046523 Ga0495644_0034709 Ga0495644_0034709_1311_1748 145
214 3300046524 Ga0495648_0301955 Ga0495648_0301955_296_733 145
215 3300046537 Ga0495598_0026714 Ga0495598_0026714_164_601 145
216 3300046538 Ga0495609_0167607 Ga0495609_0167607_376_813 145
217 3300046615 Ga0495656_0016291 Ga0495656_0016291_888_1325 145
218 3300046615 Ga0495656_0085971 Ga0495656_0085971_313_750 145
219 3300046664 Ga0495659_0004408 Ga0495659_0004408_3607_4044 145
220 3300046664 Ga0495659_0006029 Ga0495659_0006029_2934_3371 145
221 3300046674 Ga0495588_0005668 Ga0495588_0005668_3361_3798 145
222 3300046684 Ga0495669_0086391 Ga0495669_0086391_39_476 145
223 3300046684 Ga0495669_0550258 Ga0495669_0550258_82_519 145
224 3300047321 Ga0495676_0038104 Ga0495676_0038104_400_837 145
225 3300047445 Ga0495677_0262739 Ga0495677_0262739_31_468 145
226 3300048913 Ga0496110_0652449 Ga0496110_0652449_419_856 145
227 3300048924 Ga0496121_0068498 Ga0496121_0068498_811_1248 145
228 3300048927 Ga0496124_0038084 Ga0496124_0038084_312_749 145
229 3300048927 Ga0496124_0136750 Ga0496124_0136750_822_1259 145
230 3300048928 Ga0496125_0162397 Ga0496125_0162397_419_856 145
231 3300048929 Ga0496126_0251532 Ga0496126_0251532_617_1054 145
232 3300049583 Ga0501067_0793314 Ga0501067_0793314_68_505 145
233 3300050494 nmdc:mga06z11_95459_c1 nmdc:mga06z11_95459_c1_688_1125 145
234 3300050496 nmdc:mga07m45_8538_c1 nmdc:mga07m45_8538_c1_768_1205 145
235 3300053077 Ga0495601_0775270 Ga0495601_0775270_20_463 145
236 3300005344 Ga0070661_100054292 Ga0070661_1000542925 146
237 3300005539 Ga0068853_100116417 Ga0068853_1001164174 146
238 3300007788 Ga0099795_10034510 Ga0099795_100345103 146
239 3300009551 Ga0105238_10274010 Ga0105238_102740103 146
240 3300010375 Ga0105239_10217198 Ga0105239_102171982 146
241 3300025920 Ga0207649_10049714 Ga0207649_100497142 146
242 3300026041 Ga0207639_10753875 Ga0207639_107538752 146
243 3300026067 Ga0207678_10060852 Ga0207678_100608525 146
244 3300026142 Ga0207698_10725526 Ga0207698_107255262 146
245 3300031548 Ga0307408_101122507 Ga0307408_1011225071 146
246 3300031731 Ga0307405_10152841 Ga0307405_101528412 146
247 3300031731 Ga0307405_10385865 Ga0307405_103858652 146
248 3300031911 Ga0307412_10676827 Ga0307412_106768272 146
249 3300032002 Ga0307416_100124842 Ga0307416_1001248422 146
250 3300032002 Ga0307416_100941318 Ga0307416_1009413182 146
251 3300032126 Ga0307415_100017971 Ga0307415_1000179715 146
252 3300032126 Ga0307415_100182077 Ga0307415_1001820771 146
253 3300041453 Ga0451797_0020094 Ga0451797_0020094_91_531 146
254 3300041459 Ga0451800_0637662 Ga0451800_0637662_623_1063 146
255 3300001979 JGI24740J21852_10050278 JGI24740J21852_100502782 147
256 3300002077 JGI24744J21845_10006024 JGI24744J21845_100060242 147
257 3300003203 JGI25406J46586_10088073 JGI25406J46586_100880731 147
258 3300003215 JGI25153J46596_10008126 JGI25153J46596_100081261 147
259 3300003659 JGI25404J52841_10004963 JGI25404J52841_100049633 147
260 3300003659 JGI25404J52841_10022179 JGI25404J52841_100221793 147
261 3300003659 JGI25404J52841_10034975 JGI25404J52841_100349752 147
262 3300003659 JGI25404J52841_10127105 JGI25404J52841_101271051 147
263 3300004801 Ga0058860_11735244 Ga0058860_117352442 147
264 3300005327 Ga0070658_10275339 Ga0070658_102753392 147
265 3300005328 Ga0070676_10027638 Ga0070676_100276385 147
266 3300005328 Ga0070676_10038958 Ga0070676_100389582 147
267 3300005329 Ga0070683_100670434 Ga0070683_1006704342 147
268 3300005330 Ga0070690_100025683 Ga0070690_1000256835 147
269 3300005331 Ga0070670_100376393 Ga0070670_1003763932 147
270 3300005331 Ga0070670_100676477 Ga0070670_1006764771 147
271 3300005334 Ga0068869_100047276 Ga0068869_1000472763 147
272 3300005334 Ga0068869_100073070 Ga0068869_1000730702 147
273 3300005334 Ga0068869_100075640 Ga0068869_1000756401 147
274 3300005337 Ga0070682_100112780 Ga0070682_1001127801 147
275 3300005338 Ga0068868_100124385 Ga0068868_1001243852 147
276 3300005340 Ga0070689_100061523 Ga0070689_1000615232 147
277 3300005341 Ga0070691_10312393 Ga0070691_103123932 147
278 3300005344 Ga0070661_100133003 Ga0070661_1001330031 147
279 3300005344 Ga0070661_100339723 Ga0070661_1003397232 147
280 3300005347 Ga0070668_100031383 Ga0070668_1000313835 147
281 3300005347 Ga0070668_100037566 Ga0070668_1000375663 147
282 3300005347 Ga0070668_100075725 Ga0070668_1000757255 147
283 3300005347 Ga0070668_100120847 Ga0070668_1001208472 147
284 3300005347 Ga0070668_100430157 Ga0070668_1004301572 147
285 3300005347 Ga0070668_100882624 Ga0070668_1008826242 147
286 3300005353 Ga0070669_100123379 Ga0070669_1001233792 147
287 3300005354 Ga0070675_100132272 Ga0070675_1001322722 147
288 3300005354 Ga0070675_100753638 Ga0070675_1007536382 147
289 3300005355 Ga0070671_100190666 Ga0070671_1001906662 147
290 3300005355 Ga0070671_100752084 Ga0070671_1007520842 147
291 3300005356 Ga0070674_100084725 Ga0070674_1000847251 147
292 3300005356 Ga0070674_101143058 Ga0070674_1011430582 147
293 3300005364 Ga0070673_100208162 Ga0070673_1002081622 147
294 3300005364 Ga0070673_100382712 Ga0070673_1003827122 147
295 3300005364 Ga0070673_100396559 Ga0070673_1003965592 147
296 3300005365 Ga0070688_100623186 Ga0070688_1006231862 147
297 3300005366 Ga0070659_100117021 Ga0070659_1001170211 147
298 3300005366 Ga0070659_100751301 Ga0070659_1007513012 147
299 3300005366 Ga0070659_101611929 Ga0070659_1016119291 147
300 3300005367 Ga0070667_100173516 Ga0070667_1001735163 147
301 3300005367 Ga0070667_100429823 Ga0070667_1004298232 147
302 3300005367 Ga0070667_100678186 Ga0070667_1006781862 147
303 3300005438 Ga0070701_10071178 Ga0070701_100711783 147
304 3300005441 Ga0070700_100194457 Ga0070700_1001944573 147
305 3300005441 Ga0070700_100585442 Ga0070700_1005854422 147
306 3300005444 Ga0070694_100563023 Ga0070694_1005630232 147
307 3300005455 Ga0070663_100003353 Ga0070663_1000033537 147
308 3300005455 Ga0070663_100030539 Ga0070663_1000305392 147
309 3300005455 Ga0070663_100072147 Ga0070663_1000721472 147
310 3300005455 Ga0070663_100079989 Ga0070663_1000799892 147
311 3300005455 Ga0070663_100211565 Ga0070663_1002115652 147
312 3300005455 Ga0070663_101167035 Ga0070663_1011670351 147
313 3300005456 Ga0070678_100002662 Ga0070678_1000026626 147
314 3300005456 Ga0070678_100812282 Ga0070678_1008122822 147
315 3300005456 Ga0070678_100883660 Ga0070678_1008836602 147
316 3300005457 Ga0070662_101796513 Ga0070662_1017965131 147
317 3300005459 Ga0068867_100099433 Ga0068867_1000994332 147
318 3300005459 Ga0068867_100278532 Ga0068867_1002785322 147
319 3300005466 Ga0070685_10278594 Ga0070685_102785942 147
320 3300005467 Ga0070706_100139022 Ga0070706_1001390222 147
321 3300005467 Ga0070706_100783928 Ga0070706_1007839281 147
322 3300005518 Ga0070699_100252574 Ga0070699_1002525742 147
323 3300005536 Ga0070697_101443611 Ga0070697_1014436111 147
324 3300005539 Ga0068853_100084299 Ga0068853_1000842993 147
325 3300005539 Ga0068853_100185189 Ga0068853_1001851893 147
326 3300005539 Ga0068853_101662964 Ga0068853_1016629641 147
327 3300005543 Ga0070672_100052132 Ga0070672_1000521322 147
328 3300005544 Ga0070686_100262875 Ga0070686_1002628751 147
329 3300005545 Ga0070695_100982499 Ga0070695_1009824991 147
330 3300005547 Ga0070693_100222809 Ga0070693_1002228092 147
331 3300005548 Ga0070665_100019653 Ga0070665_1000196537 147
332 3300005548 Ga0070665_100044982 Ga0070665_1000449822 147
333 3300005548 Ga0070665_100086641 Ga0070665_1000866412 147
334 3300005548 Ga0070665_100128711 Ga0070665_1001287112 147
335 3300005548 Ga0070665_100129397 Ga0070665_1001293975 147
336 3300005548 Ga0070665_100139127 Ga0070665_1001391272 147
337 3300005548 Ga0070665_100304679 Ga0070665_1003046792 147
338 3300005564 Ga0070664_100073611 Ga0070664_1000736112 147
339 3300005564 Ga0070664_100465490 Ga0070664_1004654902 147
340 3300005577 Ga0068857_100875200 Ga0068857_1008752002 147
341 3300005578 Ga0068854_100042601 Ga0068854_1000426012 147
342 3300005578 Ga0068854_100150499 Ga0068854_1001504992 147
343 3300005578 Ga0068854_100193499 Ga0068854_1001934991 147
344 3300005614 Ga0068856_100068900 Ga0068856_1000689002 147
345 3300005615 Ga0070702_100154534 Ga0070702_1001545342 147
346 3300005616 Ga0068852_101244731 Ga0068852_1012447311 147
347 3300005617 Ga0068859_100178572 Ga0068859_1001785722 147
348 3300005617 Ga0068859_100414848 Ga0068859_1004148483 147
349 3300005618 Ga0068864_100058560 Ga0068864_1000585602 147
350 3300005618 Ga0068864_100069127 Ga0068864_1000691272 147
351 3300005618 Ga0068864_101221454 Ga0068864_1012214541 147
352 3300005718 Ga0068866_10012487 Ga0068866_100124872 147
353 3300005718 Ga0068866_10013354 Ga0068866_100133545 147
354 3300005719 Ga0068861_100166031 Ga0068861_1001660313 147
355 3300005719 Ga0068861_100494325 Ga0068861_1004943253 147
356 3300005719 Ga0068861_100522610 Ga0068861_1005226101 147
357 3300005834 Ga0068851_10074088 Ga0068851_100740883 147
358 3300005840 Ga0068870_11290518 Ga0068870_112905181 147
359 3300005841 Ga0068863_100098680 Ga0068863_1000986805 147
360 3300005841 Ga0068863_100684414 Ga0068863_1006844142 147
361 3300005841 Ga0068863_101293690 Ga0068863_1012936901 147
362 3300005842 Ga0068858_100060227 Ga0068858_1000602275 147
363 3300005842 Ga0068858_100178305 Ga0068858_1001783051 147
364 3300005843 Ga0068860_100719936 Ga0068860_1007199362 147
365 3300005843 Ga0068860_100892941 Ga0068860_1008929412 147
366 3300005843 Ga0068860_101820661 Ga0068860_1018206611 147
367 3300005844 Ga0068862_100064616 Ga0068862_1000646161 147
368 3300005844 Ga0068862_100099202 Ga0068862_1000992025 147
369 3300005844 Ga0068862_100213168 Ga0068862_1002131684 147
370 3300005844 Ga0068862_100261263 Ga0068862_1002612633 147
371 3300005844 Ga0068862_100408583 Ga0068862_1004085832 147
372 3300005844 Ga0068862_100422959 Ga0068862_1004229593 147
373 3300005844 Ga0068862_100480089 Ga0068862_1004800891 147
374 3300005844 Ga0068862_100866078 Ga0068862_1008660782 147
375 3300005844 Ga0068862_101950260 Ga0068862_1019502601 147
376 3300005937 Ga0081455_10010859 Ga0081455_100108599 147
377 3300005937 Ga0081455_10016359 Ga0081455_100163596 147
378 3300005937 Ga0081455_10017850 Ga0081455_100178508 147
379 3300005937 Ga0081455_10030202 Ga0081455_100302023 147
380 3300005937 Ga0081455_10125630 Ga0081455_101256302 147
381 3300005937 Ga0081455_10177248 Ga0081455_101772483 147
382 3300005981 Ga0081538_10015837 Ga0081538_100158376 147
383 3300005983 Ga0081540_1002860 Ga0081540_10028605 147
384 3300005983 Ga0081540_1004874 Ga0081540_10048747 147
385 3300005983 Ga0081540_1009322 Ga0081540_10093222 147
386 3300005983 Ga0081540_1015061 Ga0081540_10150613 147
387 3300005983 Ga0081540_1027967 Ga0081540_10279674 147
388 3300005983 Ga0081540_1041856 Ga0081540_10418562 147
389 3300005983 Ga0081540_1042714 Ga0081540_10427145 147
390 3300005983 Ga0081540_1067351 Ga0081540_10673512 147
391 3300005985 Ga0081539_10029635 Ga0081539_100296353 147
392 3300005985 Ga0081539_10151141 Ga0081539_101511412 147
393 3300006038 Ga0075365_10026315 Ga0075365_100263152 147
394 3300006038 Ga0075365_10040262 Ga0075365_100402625 147
395 3300006038 Ga0075365_10088394 Ga0075365_100883942 147
396 3300006038 Ga0075365_10117480 Ga0075365_101174802 147
397 3300006038 Ga0075365_10150714 Ga0075365_101507142 147
398 3300006038 Ga0075365_11234895 Ga0075365_112348951 147
399 3300006042 Ga0075368_10025986 Ga0075368_100259864 147
400 3300006042 Ga0075368_10047547 Ga0075368_100475472 147
401 3300006048 Ga0075363_100000569 Ga0075363_1000005697 147
402 3300006051 Ga0075364_10025564 Ga0075364_100255644 147
403 3300006051 Ga0075364_10026435 Ga0075364_100264352 147
404 3300006051 Ga0075364_10831794 Ga0075364_108317941 147
405 3300006058 Ga0075432_10015387 Ga0075432_100153874 147
406 3300006163 Ga0070715_10367997 Ga0070715_103679972 147
407 3300006173 Ga0070716_100077422 Ga0070716_1000774224 147
408 3300006175 Ga0070712_100433226 Ga0070712_1004332261 147
409 3300006177 Ga0075362_10147716 Ga0075362_101477162 147
410 3300006178 Ga0075367_10011572 Ga0075367_100115723 147
411 3300006178 Ga0075367_10018357 Ga0075367_100183575 147
412 3300006178 Ga0075367_10061707 Ga0075367_100617074 147
413 3300006178 Ga0075367_10339442 Ga0075367_103394422 147
414 3300006178 Ga0075367_10817903 Ga0075367_108179031 147
415 3300006186 Ga0075369_10005129 Ga0075369_100051295 147
416 3300006186 Ga0075369_10100009 Ga0075369_101000093 147
417 3300006186 Ga0075369_10245524 Ga0075369_102455242 147
418 3300006195 Ga0075366_10086258 Ga0075366_100862582 147
419 3300006195 Ga0075366_10091682 Ga0075366_100916823 147
420 3300006195 Ga0075366_10201797 Ga0075366_102017972 147
421 3300006195 Ga0075366_10297503 Ga0075366_102975032 147
422 3300006237 Ga0097621_100034098 Ga0097621_1000340983 147
423 3300006353 Ga0075370_10072040 Ga0075370_100720404 147
424 3300006353 Ga0075370_10338658 Ga0075370_103386581 147
425 3300006353 Ga0075370_10384595 Ga0075370_103845951 147
426 3300006358 Ga0068871_100160352 Ga0068871_1001603522 147
427 3300006844 Ga0075428_100067240 Ga0075428_1000672405 147
428 3300006844 Ga0075428_100068913 Ga0075428_1000689133 147
429 3300006871 Ga0075434_100300927 Ga0075434_1003009272 147
430 3300006881 Ga0068865_100040769 Ga0068865_1000407694 147
431 3300006881 Ga0068865_100237154 Ga0068865_1002371542 147
432 3300006914 Ga0075436_100393060 Ga0075436_1003930602 147
433 3300006931 Ga0097620_100178567 Ga0097620_1001785672 147
434 3300006931 Ga0097620_100414844 Ga0097620_1004148443 147
435 3300007788 Ga0099795_10049039 Ga0099795_100490392 147
436 3300009011 Ga0105251_10406927 Ga0105251_104069272 147
437 3300009036 Ga0105244_10220204 Ga0105244_102202041 147
438 3300009092 Ga0105250_10091443 Ga0105250_100914432 147
439 3300009093 Ga0105240_10479386 Ga0105240_104793862 147
440 3300009094 Ga0111539_10089828 Ga0111539_100898282 147
441 3300009098 Ga0105245_10164541 Ga0105245_101645413 147
442 3300009098 Ga0105245_10263865 Ga0105245_102638654 147
443 3300009098 Ga0105245_11510448 Ga0105245_115104482 147
444 3300009101 Ga0105247_10073371 Ga0105247_100733712 147
445 3300009101 Ga0105247_10254390 Ga0105247_102543902 147
446 3300009101 Ga0105247_10285067 Ga0105247_102850672 147
447 3300009147 Ga0114129_10133780 Ga0114129_101337802 147
448 3300009148 Ga0105243_10085482 Ga0105243_100854823 147
449 3300009148 Ga0105243_10358800 Ga0105243_103588002 147
450 3300009148 Ga0105243_10552705 Ga0105243_105527052 147
451 3300009148 Ga0105243_10873475 Ga0105243_108734752 147
452 3300009174 Ga0105241_10030199 Ga0105241_100301992 147
453 3300009174 Ga0105241_10459259 Ga0105241_104592593 147
454 3300009174 Ga0105241_10640778 Ga0105241_106407782 147
455 3300009176 Ga0105242_10091348 Ga0105242_100913484 147
456 3300009176 Ga0105242_10440069 Ga0105242_104400692 147
457 3300009176 Ga0105242_10841423 Ga0105242_108414232 147
458 3300009177 Ga0105248_10054241 Ga0105248_100542415 147
459 3300009545 Ga0105237_10137991 Ga0105237_101379914 147
460 3300009545 Ga0105237_10318174 Ga0105237_103181744 147
461 3300009551 Ga0105238_10080497 Ga0105238_100804975 147
462 3300009551 Ga0105238_10505109 Ga0105238_105051092 147
463 3300009553 Ga0105249_10113290 Ga0105249_101132903 147
464 3300009553 Ga0105249_10589187 Ga0105249_105891872 147
465 3300009553 Ga0105249_10756811 Ga0105249_107568112 147
466 3300009553 Ga0105249_11000305 Ga0105249_110003052 147
467 3300009553 Ga0105249_11140318 Ga0105249_111403182 147
468 3300010375 Ga0105239_10098298 Ga0105239_100982985 147
469 3300010375 Ga0105239_10541832 Ga0105239_105418321 147
470 3300010375 Ga0105239_11184508 Ga0105239_111845082 147
471 3300010375 Ga0105239_12922054 Ga0105239_129220541 147
472 3300011119 Ga0105246_10110980 Ga0105246_101109804 147
473 3300011119 Ga0105246_10228853 Ga0105246_102288532 147
474 3300011119 Ga0105246_10852430 Ga0105246_108524302 147
475 3300013296 Ga0157374_10273006 Ga0157374_102730062 147
476 3300013296 Ga0157374_10622123 Ga0157374_106221232 147
477 3300013297 Ga0157378_10020790 Ga0157378_100207904 147
478 3300013306 Ga0163162_10055949 Ga0163162_100559495 147
479 3300013306 Ga0163162_11494298 Ga0163162_114942982 147
480 3300013307 Ga0157372_11664474 Ga0157372_116644741 147
481 3300013308 Ga0157375_10018295 Ga0157375_100182957 147
482 3300013308 Ga0157375_10106423 Ga0157375_101064232 147
483 3300013308 Ga0157375_10539501 Ga0157375_105395012 147
484 3300013308 Ga0157375_11373185 Ga0157375_113731852 147
485 3300013308 Ga0157375_13543623 Ga0157375_135436231 147
486 3300014325 Ga0163163_10199277 Ga0163163_101992773 147
487 3300014325 Ga0163163_10310305 Ga0163163_103103053 147
488 3300014325 Ga0163163_10401910 Ga0163163_104019101 147
489 3300014326 Ga0157380_10056556 Ga0157380_100565564 147
490 3300014326 Ga0157380_10292094 Ga0157380_102920941 147
491 3300014326 Ga0157380_11079080 Ga0157380_110790802 147
492 3300014745 Ga0157377_10054673 Ga0157377_100546732 147
493 3300014968 Ga0157379_10131370 Ga0157379_101313702 147
494 3300014968 Ga0157379_10147094 Ga0157379_101470942 147
495 3300014969 Ga0157376_10054887 Ga0157376_100548873 147
496 3300014969 Ga0157376_10349468 Ga0157376_103494681 147
497 3300014969 Ga0157376_10353987 Ga0157376_103539872 147
498 3300017792 Ga0163161_10068479 Ga0163161_100684794 147
499 3300025297 Ga0209758_1001444 Ga0209758_100144421 147
500 3300025297 Ga0209758_1043368 Ga0209758_10433684 147
501 3300025315 Ga0207697_10168408 Ga0207697_101684082 147
502 3300025315 Ga0207697_10192915 Ga0207697_101929152 147
503 3300025321 Ga0207656_10055273 Ga0207656_100552731 147
504 3300025885 Ga0207653_10078223 Ga0207653_100782232 147
505 3300025899 Ga0207642_10014744 Ga0207642_100147442 147
506 3300025900 Ga0207710_10050314 Ga0207710_100503144 147
507 3300025900 Ga0207710_10105582 Ga0207710_101055822 147
508 3300025900 Ga0207710_10365603 Ga0207710_103656032 147
509 3300025901 Ga0207688_10061342 Ga0207688_100613423 147
510 3300025901 Ga0207688_10083544 Ga0207688_100835443 147
511 3300025904 Ga0207647_10235056 Ga0207647_102350562 147
512 3300025907 Ga0207645_10041042 Ga0207645_100410424 147
513 3300025907 Ga0207645_10116590 Ga0207645_101165902 147
514 3300025908 Ga0207643_10131227 Ga0207643_101312272 147
515 3300025908 Ga0207643_10260678 Ga0207643_102606782 147
516 3300025908 Ga0207643_10761069 Ga0207643_107610691 147
517 3300025911 Ga0207654_10012529 Ga0207654_100125292 147
518 3300025913 Ga0207695_10279751 Ga0207695_102797513 147
519 3300025914 Ga0207671_10078672 Ga0207671_100786722 147
520 3300025915 Ga0207693_10043247 Ga0207693_100432472 147
521 3300025919 Ga0207657_10453659 Ga0207657_104536591 147
522 3300025923 Ga0207681_10134255 Ga0207681_101342554 147
523 3300025923 Ga0207681_10737867 Ga0207681_107378672 147
524 3300025924 Ga0207694_10058626 Ga0207694_100586265 147
525 3300025924 Ga0207694_11356097 Ga0207694_113560971 147
526 3300025926 Ga0207659_10238825 Ga0207659_102388253 147
527 3300025926 Ga0207659_10554114 Ga0207659_105541142 147
528 3300025927 Ga0207687_10052625 Ga0207687_100526252 147
529 3300025931 Ga0207644_10093660 Ga0207644_100936602 147
530 3300025931 Ga0207644_11408977 Ga0207644_114089771 147
531 3300025932 Ga0207690_10223908 Ga0207690_102239082 147
532 3300025933 Ga0207706_10047923 Ga0207706_100479234 147
533 3300025933 Ga0207706_10371555 Ga0207706_103715552 147
534 3300025933 Ga0207706_11209933 Ga0207706_112099331 147
535 3300025934 Ga0207686_10417495 Ga0207686_104174953 147
536 3300025935 Ga0207709_10031459 Ga0207709_100314592 147
537 3300025935 Ga0207709_10664060 Ga0207709_106640601 147
538 3300025936 Ga0207670_10076308 Ga0207670_100763082 147
539 3300025937 Ga0207669_10060620 Ga0207669_100606204 147
540 3300025938 Ga0207704_10076741 Ga0207704_100767413 147
541 3300025938 Ga0207704_10296409 Ga0207704_102964092 147
542 3300025939 Ga0207665_10064556 Ga0207665_100645562 147
543 3300025939 Ga0207665_10121161 Ga0207665_101211611 147
544 3300025940 Ga0207691_10117880 Ga0207691_101178802 147
545 3300025940 Ga0207691_10900702 Ga0207691_109007022 147
546 3300025941 Ga0207711_10020555 Ga0207711_100205556 147
547 3300025942 Ga0207689_10034293 Ga0207689_100342932 147
548 3300025942 Ga0207689_10118992 Ga0207689_101189922 147
549 3300025945 Ga0207679_10056113 Ga0207679_100561133 147
550 3300025945 Ga0207679_10070881 Ga0207679_100708812 147
551 3300025949 Ga0207667_10046871 Ga0207667_100468712 147
552 3300025960 Ga0207651_10199343 Ga0207651_101993434 147
553 3300025960 Ga0207651_10365751 Ga0207651_103657512 147
554 3300025961 Ga0207712_10942140 Ga0207712_109421402 147
555 3300025972 Ga0207668_10192277 Ga0207668_101922773 147
556 3300025972 Ga0207668_10255695 Ga0207668_102556952 147
557 3300025972 Ga0207668_10275556 Ga0207668_102755562 147
558 3300025972 Ga0207668_10465081 Ga0207668_104650812 147
559 3300025972 Ga0207668_11625945 Ga0207668_116259452 147
560 3300025981 Ga0207640_10113931 Ga0207640_101139312 147
561 3300025981 Ga0207640_10207698 Ga0207640_102076983 147
562 3300025981 Ga0207640_10236652 Ga0207640_102366522 147
563 3300025981 Ga0207640_11533458 Ga0207640_115334582 147
564 3300025986 Ga0207658_10050950 Ga0207658_100509502 147
565 3300025986 Ga0207658_10453054 Ga0207658_104530542 147
566 3300025986 Ga0207658_11493405 Ga0207658_114934052 147
567 3300026023 Ga0207677_10014116 Ga0207677_100141163 147
568 3300026023 Ga0207677_10640946 Ga0207677_106409462 147
569 3300026035 Ga0207703_10079384 Ga0207703_100793842 147
570 3300026041 Ga0207639_10429373 Ga0207639_104293731 147
571 3300026041 Ga0207639_11674812 Ga0207639_116748121 147
572 3300026067 Ga0207678_10032402 Ga0207678_100324025 147
573 3300026067 Ga0207678_10038621 Ga0207678_100386215 147
574 3300026067 Ga0207678_10048058 Ga0207678_100480585 147
575 3300026067 Ga0207678_10076918 Ga0207678_100769183 147
576 3300026067 Ga0207678_10121178 Ga0207678_101211783 147
577 3300026067 Ga0207678_10203925 Ga0207678_102039253 147
578 3300026067 Ga0207678_11232563 Ga0207678_112325632 147
579 3300026075 Ga0207708_10053224 Ga0207708_100532242 147
580 3300026075 Ga0207708_10332602 Ga0207708_103326022 147
581 3300026078 Ga0207702_10069003 Ga0207702_100690032 147
582 3300026078 Ga0207702_11565889 Ga0207702_115658891 147
583 3300026088 Ga0207641_10112831 Ga0207641_101128315 147
584 3300026089 Ga0207648_10042048 Ga0207648_100420483 147
585 3300026089 Ga0207648_10118129 Ga0207648_101181294 147
586 3300026095 Ga0207676_10116997 Ga0207676_101169972 147
587 3300026095 Ga0207676_10122781 Ga0207676_101227812 147
588 3300026095 Ga0207676_10963167 Ga0207676_109631672 147
589 3300026116 Ga0207674_10040950 Ga0207674_100409502 147
590 3300026116 Ga0207674_11477855 Ga0207674_114778551 147
591 3300026118 Ga0207675_100095640 Ga0207675_1000956402 147
592 3300026118 Ga0207675_100202556 Ga0207675_1002025561 147
593 3300026118 Ga0207675_100381419 Ga0207675_1003814193 147
594 3300026118 Ga0207675_100394151 Ga0207675_1003941513 147
595 3300026118 Ga0207675_100560201 Ga0207675_1005602012 147
596 3300026121 Ga0207683_10082114 Ga0207683_100821145 147
597 3300026121 Ga0207683_10234955 Ga0207683_102349552 147
598 3300026121 Ga0207683_10273371 Ga0207683_102733712 147
599 3300026121 Ga0207683_10469697 Ga0207683_104696972 147
600 3300026142 Ga0207698_10080447 Ga0207698_100804474 147
601 3300026142 Ga0207698_10752051 Ga0207698_107520512 147
602 3300027866 Ga0209813_10012688 Ga0209813_100126882 147
603 3300027866 Ga0209813_10202553 Ga0209813_102025532 147
604 3300027907 Ga0207428_10156085 Ga0207428_101560852 147
605 3300028379 Ga0268266_10001439 Ga0268266_1000143920 147
606 3300028379 Ga0268266_10004759 Ga0268266_100047599 147
607 3300028379 Ga0268266_10021895 Ga0268266_100218956 147
608 3300028379 Ga0268266_10048061 Ga0268266_100480615 147
609 3300028379 Ga0268266_10099983 Ga0268266_100999833 147
610 3300028379 Ga0268266_10153310 Ga0268266_101533102 147
611 3300028379 Ga0268266_10242848 Ga0268266_102428483 147
612 3300028379 Ga0268266_10394307 Ga0268266_103943072 147
613 3300028379 Ga0268266_10412639 Ga0268266_104126393 147
614 3300028379 Ga0268266_10650097 Ga0268266_106500972 147
615 3300028380 Ga0268265_10056338 Ga0268265_100563382 147
616 3300028380 Ga0268265_10125571 Ga0268265_101255714 147
617 3300028380 Ga0268265_10292344 Ga0268265_102923443 147
618 3300028380 Ga0268265_10315453 Ga0268265_103154533 147
619 3300028380 Ga0268265_10482092 Ga0268265_104820923 147
620 3300028380 Ga0268265_11180455 Ga0268265_111804551 147
621 3300028380 Ga0268265_11615061 Ga0268265_116150612 147
622 3300028380 Ga0268265_11971414 Ga0268265_119714141 147
623 3300028786 Ga0307517_10126584 Ga0307517_101265842 147
624 3300028786 Ga0307517_10180147 Ga0307517_101801472 147
625 3300028786 Ga0307517_10237341 Ga0307517_102373412 147
626 3300030521 Ga0307511_10128517 Ga0307511_101285172 147
627 3300031456 Ga0307513_10126681 Ga0307513_101266814 147
628 3300031507 Ga0307509_10198703 Ga0307509_101987032 147
629 3300031548 Ga0307408_101687807 Ga0307408_1016878071 147
630 3300031616 Ga0307508_10436927 Ga0307508_104369272 147
631 3300031730 Ga0307516_10280387 Ga0307516_102803871 147
632 3300031824 Ga0307413_10146496 Ga0307413_101464962 147
633 3300031824 Ga0307413_10205283 Ga0307413_102052833 147
634 3300031824 Ga0307413_10747627 Ga0307413_107476271 147
635 3300031901 Ga0307406_10368236 Ga0307406_103682363 147
636 3300031911 Ga0307412_10028635 Ga0307412_100286351 147
637 3300031911 Ga0307412_11938691 Ga0307412_119386911 147
638 3300031995 Ga0307409_100504840 Ga0307409_1005048403 147
639 3300031995 Ga0307409_102530113 Ga0307409_1025301131 147
640 3300032002 Ga0307416_100621101 Ga0307416_1006211011 147
641 3300032002 Ga0307416_101100863 Ga0307416_1011008632 147
642 3300032002 Ga0307416_101256695 Ga0307416_1012566952 147
643 3300032002 Ga0307416_101375007 Ga0307416_1013750072 147
644 3300032005 Ga0307411_10038307 Ga0307411_100383071 147
645 3300032005 Ga0307411_10285462 Ga0307411_102854621 147
646 3300032126 Ga0307415_100259039 Ga0307415_1002590392 147
647 3300033180 Ga0307510_10071137 Ga0307510_100711374 147
648 3300035170 Ga0373943_0014145 Ga0373943_0014145_3068_3514 147
649 3300035691 Ga0373931_0625332 Ga0373931_0625332_136_579 147
650 3300035695 Ga0373927_0019266 Ga0373927_0019266_1512_1958 147
651 3300035725 Ga0373947_0008612 Ga0373947_0008612_5200_5646 147
652 3300037068 Ga0373925_0081544 Ga0373925_0081544_490_936 147
653 3300041413 Ga0439465_0012592 Ga0439465_0012592_1344_1787 147
654 3300041460 Ga0451802_1997251 Ga0451802_1997251_43_486 147
655 3300041486 Ga0451807_0833332 Ga0451807_0833332_373_816 147
656 3300041498 Ga0451841_1432989 Ga0451841_1432989_92_538 147
657 3300041512 Ga0451853_1513700 Ga0451853_1513700_1231_1677 147
658 3300042004 Ga0439445_0078004 Ga0439445_0078004_73_516 147
659 3300046452 Ga0495617_114056 Ga0495617_114056_120_563 147
660 3300046452 Ga0495617_160604 Ga0495617_160604_43_486 147
661 3300046455 Ga0495603_0011405 Ga0495603_0011405_1339_1785 147
662 3300046455 Ga0495603_0079703 Ga0495603_0079703_1372_1815 147
663 3300046455 Ga0495603_0138290 Ga0495603_0138290_166_609 147
664 3300046457 Ga0495590_0438002 Ga0495590_0438002_47_490 147
665 3300046459 Ga0495629_0866461 Ga0495629_0866461_76_519 147
666 3300046460 Ga0495638_0107015 Ga0495638_0107015_492_935 147
667 3300046461 Ga0495641_0392743 Ga0495641_0392743_168_614 147
668 3300046471 Ga0495650_0132802 Ga0495650_0132802_68_511 147
669 3300046472 Ga0495580_0211891 Ga0495580_0211891_223_669 147
670 3300046474 Ga0495605_0116782 Ga0495605_0116782_659_1102 147
671 3300046491 Ga0495584_0057240 Ga0495584_0057240_356_799 147
672 3300046491 Ga0495584_0317976 Ga0495584_0317976_301_744 147
673 3300046492 Ga0495585_0017852 Ga0495585_0017852_1688_2131 147
674 3300046500 Ga0495596_0099065 Ga0495596_0099065_107_550 147
675 3300046506 Ga0495583_0033447 Ga0495583_0033447_1396_1839 147
676 3300046507 Ga0495606_0135727 Ga0495606_0135727_991_1434 147
677 3300046512 Ga0495610_0248654 Ga0495610_0248654_131_574 147
678 3300046513 Ga0495616_0091337 Ga0495616_0091337_841_1284 147
679 3300046513 Ga0495616_0142007 Ga0495616_0142007_245_688 147
680 3300046517 Ga0495630_0133723 Ga0495630_0133723_864_1310 147
681 3300046518 Ga0495631_0019017 Ga0495631_0019017_1631_2074 147
682 3300046519 Ga0495632_0118079 Ga0495632_0118079_523_966 147
683 3300046519 Ga0495632_0170461 Ga0495632_0170461_70_513 147
684 3300046522 Ga0495643_0083768 Ga0495643_0083768_849_1292 147
685 3300046523 Ga0495644_0287849 Ga0495644_0287849_61_504 147
686 3300046523 Ga0495644_0352431 Ga0495644_0352431_91_534 147
687 3300046524 Ga0495648_0274312 Ga0495648_0274312_65_508 147
688 3300046525 Ga0495663_0036767 Ga0495663_0036767_856_1299 147
689 3300046525 Ga0495663_0229618 Ga0495663_0229618_115_558 147
690 3300046528 Ga0495642_0221046 Ga0495642_0221046_223_666 147
691 3300046538 Ga0495609_0054926 Ga0495609_0054926_541_984 147
692 3300046542 Ga0495597_0321323 Ga0495597_0321323_47_490 147
693 3300046557 Ga0495622_0110135 Ga0495622_0110135_431_874 147
694 3300046557 Ga0495622_0130339 Ga0495622_0130339_602_1045 147
695 3300046615 Ga0495656_0115215 Ga0495656_0115215_752_1195 147
696 3300046615 Ga0495656_0404391 Ga0495656_0404391_174_617 147
697 3300046615 Ga0495656_0641787 Ga0495656_0641787_65_508 147
698 3300046648 Ga0495611_0027557 Ga0495611_0027557_1040_1483 147
699 3300046648 Ga0495611_0184702 Ga0495611_0184702_439_882 147
700 3300046648 Ga0495611_0593020 Ga0495611_0593020_22_465 147
701 3300046660 Ga0495625_0183592 Ga0495625_0183592_193_636 147
702 3300046663 Ga0495635_0409530 Ga0495635_0409530_185_628 147
703 3300046665 Ga0495661_0182535 Ga0495661_0182535_429_872 147
704 3300046684 Ga0495669_0005775 Ga0495669_0005775_3131_3574 147
705 3300046684 Ga0495669_0064087 Ga0495669_0064087_844_1287 147
706 3300046684 Ga0495669_0166884 Ga0495669_0166884_273_716 147
707 3300046690 Ga0495624_0105506 Ga0495624_0105506_557_1003 147
708 3300046691 Ga0495670_0410719 Ga0495670_0410719_15_458 147
709 3300046692 Ga0495671_0230377 Ga0495671_0230377_323_766 147
710 3300046694 Ga0495649_0094598 Ga0495649_0094598_848_1291 147
711 3300046694 Ga0495649_0316004 Ga0495649_0316004_146_589 147
712 3300046794 Ga0495589_0386501 Ga0495589_0386501_113_556 147
713 3300047315 Ga0495581_0431231 Ga0495581_0431231_214_657 147
714 3300047318 Ga0495636_0313305 Ga0495636_0313305_144_587 147
715 3300047318 Ga0495636_0442684 Ga0495636_0442684_70_513 147
716 3300047320 Ga0495672_0231428 Ga0495672_0231428_443_889 147
717 3300047320 Ga0495672_0232039 Ga0495672_0232039_328_774 147
718 3300047320 Ga0495672_0340494 Ga0495672_0340494_192_635 147
719 3300047321 Ga0495676_0091373 Ga0495676_0091373_286_732 147
720 3300047321 Ga0495676_0486011 Ga0495676_0486011_310_756 147
721 3300047323 Ga0495683_0141427 Ga0495683_0141427_403_846 147
722 3300047445 Ga0495677_0012469 Ga0495677_0012469_644_1087 147
723 3300047469 Ga0495673_0335321 Ga0495673_0335321_77_520 147
724 3300047472 Ga0495686_0134109 Ga0495686_0134109_655_1098 147
725 3300047472 Ga0495686_0162470 Ga0495686_0162470_232_678 147
726 3300047673 Ga0495593_0051110 Ga0495593_0051110_594_1037 147
727 3300048090 Ga0495615_0096012 Ga0495615_0096012_150_593 147
728 3300048903 Ga0496100_0400348 Ga0496100_0400348_327_773 147
729 3300048903 Ga0496100_0490392 Ga0496100_0490392_118_561 147
730 3300048904 Ga0496101_0251839 Ga0496101_0251839_176_619 147
731 3300048905 Ga0496102_0040343 Ga0496102_0040343_311_757 147
732 3300048905 Ga0496102_0328645 Ga0496102_0328645_887_1330 147
733 3300048905 Ga0496102_0475381 Ga0496102_0475381_621_1064 147
734 3300048905 Ga0496102_0532199 Ga0496102_0532199_202_645 147
735 3300048905 Ga0496102_0548722 Ga0496102_0548722_321_764 147
736 3300048905 Ga0496102_0804442 Ga0496102_0804442_20_463 147
737 3300048906 Ga0496103_0515679 Ga0496103_0515679_186_629 147
738 3300048907 Ga0496104_0179386 Ga0496104_0179386_1190_1633 147
739 3300048907 Ga0496104_0802006 Ga0496104_0802006_29_472 147
740 3300048907 Ga0496104_1054754 Ga0496104_1054754_63_509 147
741 3300048908 Ga0496105_0022258 Ga0496105_0022258_4085_4531 147
742 3300048908 Ga0496105_0261668 Ga0496105_0261668_88_534 147
743 3300048908 Ga0496105_1226346 Ga0496105_1226346_75_518 147
744 3300048909 Ga0496106_0159983 Ga0496106_0159983_1145_1588 147
745 3300048909 Ga0496106_0172367 Ga0496106_0172367_758_1201 147
746 3300048909 Ga0496106_0516883 Ga0496106_0516883_24_467 147
747 3300048909 Ga0496106_1031002 Ga0496106_1031002_170_616 147
748 3300048910 Ga0496107_0050553 Ga0496107_0050553_145_591 147
749 3300048910 Ga0496107_0185277 Ga0496107_0185277_37_480 147
750 3300048911 Ga0496108_0041652 Ga0496108_0041652_1563_2009 147
751 3300048911 Ga0496108_0069035 Ga0496108_0069035_254_697 147
752 3300048911 Ga0496108_0127359 Ga0496108_0127359_1311_1754 147
753 3300048912 Ga0496109_0002712 Ga0496109_0002712_4181_4627 147
754 3300048912 Ga0496109_0268167 Ga0496109_0268167_315_758 147
755 3300048912 Ga0496109_0846522 Ga0496109_0846522_58_501 147
756 3300048912 Ga0496109_1161348 Ga0496109_1161348_238_681 147
757 3300048913 Ga0496110_0047989 Ga0496110_0047989_1826_2272 147
758 3300048913 Ga0496110_0296914 Ga0496110_0296914_422_865 147
759 3300048914 Ga0496111_0369912 Ga0496111_0369912_163_609 147
760 3300048914 Ga0496111_0660527 Ga0496111_0660527_29_472 147
761 3300048914 Ga0496111_0888610 Ga0496111_0888610_115_558 147
762 3300048915 Ga0496112_0385209 Ga0496112_0385209_112_555 147
763 3300048915 Ga0496112_0503882 Ga0496112_0503882_583_1026 147
764 3300048916 Ga0496113_0042931 Ga0496113_0042931_1189_1635 147
765 3300048916 Ga0496113_0156425 Ga0496113_0156425_1329_1775 147
766 3300048916 Ga0496113_1062269 Ga0496113_1062269_124_567 147
767 3300048917 Ga0496114_0017279 Ga0496114_0017279_3228_3674 147
768 3300048918 Ga0496115_0000662 Ga0496115_0000662_20981_21427 147
769 3300048918 Ga0496115_0016859 Ga0496115_0016859_3483_3929 147
770 3300048918 Ga0496115_0350908 Ga0496115_0350908_175_618 147
771 3300048918 Ga0496115_0474670 Ga0496115_0474670_506_949 147
772 3300048919 Ga0496116_0136526 Ga0496116_0136526_476_919 147
773 3300048921 Ga0496118_0340515 Ga0496118_0340515_322_765 147
774 3300048921 Ga0496118_0506131 Ga0496118_0506131_103_546 147
775 3300048923 Ga0496120_0286356 Ga0496120_0286356_94_537 147
776 3300048924 Ga0496121_0070812 Ga0496121_0070812_1344_1787 147
777 3300048924 Ga0496121_0077018 Ga0496121_0077018_2156_2599 147
778 3300048924 Ga0496121_0173020 Ga0496121_0173020_1026_1469 147
779 3300048929 Ga0496126_0010315 Ga0496126_0010315_6772_7215 147
780 3300048929 Ga0496126_0252521 Ga0496126_0252521_590_1033 147
781 3300048929 Ga0496126_0268499 Ga0496126_0268499_785_1228 147
782 3300048929 Ga0496126_0637230 Ga0496126_0637230_244_687 147
783 3300048929 Ga0496126_0811190 Ga0496126_0811190_229_672 147
784 3300048929 Ga0496126_0838694 Ga0496126_0838694_142_585 147
785 3300049459 Ga0495678_150195 Ga0495678_150195_106_549 147
786 3300049570 Ga0501033_0281497 Ga0501033_0281497_376_819 147
787 3300049572 Ga0501036_0032225 Ga0501036_0032225_3817_4260 147
788 3300049575 Ga0501039_0359995 Ga0501039_0359995_370_813 147
789 3300049576 Ga0501040_0421166 Ga0501040_0421166_204_647 147
790 3300049578 Ga0501042_0207474 Ga0501042_0207474_459_902 147
791 3300049578 Ga0501042_0416929 Ga0501042_0416929_187_630 147
792 3300049583 Ga0501067_0097450 Ga0501067_0097450_129_572 147
793 3300049583 Ga0501067_0229794 Ga0501067_0229794_526_969 147
794 3300049584 Ga0501068_0709982 Ga0501068_0709982_42_485 147
795 3300049585 Ga0501069_0266049 Ga0501069_0266049_441_884 147
796 3300049591 Ga0501075_0904345 Ga0501075_0904345_186_629 147
797 3300049592 Ga0501076_0081846 Ga0501076_0081846_654_1097 147
798 3300049741 Ga0501079_0509766 Ga0501079_0509766_116_559 147
799 3300050489 nmdc:mga03683_216634_c1 nmdc:mga03683_216634_c1_277_720 147
800 3300050489 nmdc:mga03683_30311_c1 nmdc:mga03683_30311_c1_1240_1683 147
801 3300050489 nmdc:mga03683_60875_c1 nmdc:mga03683_60875_c1_1133_1576 147
802 3300050490 nmdc:mga03n38_218285_c1 nmdc:mga03n38_218285_c1_290_733 147
803 3300050490 nmdc:mga03n38_4900_c1 nmdc:mga03n38_4900_c1_205_648 147
804 3300050490 nmdc:mga03n38_509678_c1 nmdc:mga03n38_509678_c1_183_626 147
805 3300050490 nmdc:mga03n38_87872_c1 nmdc:mga03n38_87872_c1_106_549 147
806 3300050491 nmdc:mga00v17_25959_c1 nmdc:mga00v17_25959_c1_1746_2195 147
807 3300050491 nmdc:mga00v17_275865_c1 nmdc:mga00v17_275865_c1_247_690 147
808 3300050491 nmdc:mga00v17_33232_c1 nmdc:mga00v17_33232_c1_1262_1705 147
809 3300050491 nmdc:mga00v17_493727_c1 nmdc:mga00v17_493727_c1_241_684 147
810 3300050491 nmdc:mga00v17_67499_c1 nmdc:mga00v17_67499_c1_950_1393 147
811 3300050492 nmdc:mga0yw44_110728_c1 nmdc:mga0yw44_110728_c1_272_718 147
812 3300050492 nmdc:mga0yw44_534557_c1 nmdc:mga0yw44_534557_c1_65_508 147
813 3300050493 nmdc:mga0k408_172468_c1 nmdc:mga0k408_172468_c1_193_636 147
814 3300050493 nmdc:mga0k408_17739_c1 nmdc:mga0k408_17739_c1_640_1083 147
815 3300050493 nmdc:mga0k408_364905_c1 nmdc:mga0k408_364905_c1_301_744 147
816 3300050493 nmdc:mga0k408_48985_c1 nmdc:mga0k408_48985_c1_1885_2328 147
817 3300050494 nmdc:mga06z11_46391_c1 nmdc:mga06z11_46391_c1_1083_1526 147
818 3300050494 nmdc:mga06z11_86090_c1 nmdc:mga06z11_86090_c1_1232_1675 147
819 3300050495 nmdc:mga04h51_271546_c1 nmdc:mga04h51_271546_c1_95_538 147
820 3300050495 nmdc:mga04h51_4863_c1 nmdc:mga04h51_4863_c1_314_757 147
821 3300050496 nmdc:mga07m45_1133_c1 nmdc:mga07m45_1133_c1_7133_7576 147
822 3300050496 nmdc:mga07m45_63401_c1 nmdc:mga07m45_63401_c1_766_1209 147
823 3300050507 nmdc:mga05p37_98773_c2 nmdc:mga05p37_98773_c2_472_915 147
824 3300050509 nmdc:mga0qj67_852783_c1 nmdc:mga0qj67_852783_c1_227_670 147
825 3300050511 nmdc:mga08y16_167333_c1 nmdc:mga08y16_167333_c1_1048_1491 147
826 3300050512 nmdc:mga0n895_749391_c1 nmdc:mga0n895_749391_c1_44_487 147
827 3300050513 nmdc:mga0rr50_87656_c1 nmdc:mga0rr50_87656_c1_862_1305 147
828 3300050516 nmdc:mga0sz30_127066_c1 nmdc:mga0sz30_127066_c1_101_544 147
829 3300050516 nmdc:mga0sz30_33621_c1 nmdc:mga0sz30_33621_c1_107_550 147
830 3300053079 Ga0500610_0372451 Ga0500610_0372451_57_500 147
831 3300053092 Ga0500583_0094821 Ga0500583_0094821_209_652 147
832 3300053096 Ga0500641_0080652 Ga0500641_0080652_736_1179 147
833 3300053103 Ga0500555_058223 Ga0500555_058223_32_475 147
834 3300053104 Ga0500556_0055793 Ga0500556_0055793_337_783 147
835 3300053108 Ga0500562_064114 Ga0500562_064114_22_465 147
836 3300053109 Ga0500569_118019 Ga0500569_118019_286_729 147
837 3300053118 Ga0500594_0027480 Ga0500594_0027480_68_511 147
838 3300053118 Ga0500594_0045206 Ga0500594_0045206_352_795 147
839 3300053119 Ga0500595_001792 Ga0500595_001792_398_844 147
840 3300053119 Ga0500595_036921 Ga0500595_036921_586_1029 147
841 3300053129 Ga0500628_106102 Ga0500628_106102_181_624 147
842 3300053130 Ga0500642_0186978 Ga0500642_0186978_354_797 147
843 3300053130 Ga0500642_0196556 Ga0500642_0196556_253_696 147
844 3300053134 Ga0500658_0399763 Ga0500658_0399763_136_579 147
845 3300053139 Ga0500568_0004461 Ga0500568_0004461_5659_6105 147
846 3300053146 Ga0500588_0058542 Ga0500588_0058542_68_511 147
847 3300053147 Ga0500589_222608 Ga0500589_222608_44_487 147
848 3300053151 Ga0500604_0039514 Ga0500604_0039514_673_1116 147
849 3300053153 Ga0500616_0174836 Ga0500616_0174836_169_612 147
850 3300053158 Ga0500627_0073841 Ga0500627_0073841_730_1173 147
851 3300053160 Ga0500633_0142048 Ga0500633_0142048_222_665 147
852 3300053160 Ga0500633_0198603 Ga0500633_0198603_86_529 147
853 3300053161 Ga0500634_0061817 Ga0500634_0061817_283_726 147
854 3300053161 Ga0500634_0185350 Ga0500634_0185350_302_745 147
855 3300053162 Ga0500638_101381 Ga0500638_101381_639_1082 147
856 3300053178 Ga0500637_0205050 Ga0500637_0205050_311_754 147
857 3300053727 Ga0500611_003674 Ga0500611_003674_1284_1727 147
858 3300053730 Ga0500645_021151 Ga0500645_021151_1411_1854 147
859 3300053730 Ga0500645_133957 Ga0500645_133957_113_556 147
860 3300053731 Ga0500609_033089 Ga0500609_033089_113_556 147
861 3300054114 Ga0501084_0400018 Ga0501084_0400018_475_918 147

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d42-assembly1.cif.gz_B human mitochondrial dna polymerase gamma ternary complex with gt basepair in editing conformer (composite) 0.7639 31 69
7fjj-assembly1.cif.gz_B human pol iii pre-termination complex 0.7436 38 77
6iu0-assembly1.cif.gz_A peroxiredoxin from thermococcus kodakaraensis (0cys mutant) 0.7094 72 98
6itz-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7026 72 98
2lrn-assembly1.cif.gz_A solution structure of a thiol:disulfide interchange protein from bacteroides sp. 0.6695 72 98
ID Description Score Start End Superfamily
af_Q9V4M2_585_816_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.886 63 86 2.120.10.30
af_F1QXI6_172_401_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8196 63 86 2.130.10.10
af_A4I4C4_81_338_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8163 63 85 2.130.10.10
af_F1QCX8_281_476_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7787 63 88 2.110.10.10
af_Q9BKZ9_480_615_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7754 64 87 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A398D9J9-F1-model_v4 Uncharacterized protein 0.8684 41 86 GO:0016020
AF-A0A1B1U9T3-F1-model_v4 Uncharacterized protein 0.8644 1 147
AF-A0A398DA14-F1-model_v4 Uncharacterized protein 0.8506 41 86
AF-A0A7C0X258-F1-model_v4 Lipoprotein 0.844 49 86
AF-X7YLP1-F1-model_v4 Uncharacterized protein 0.8252 49 85

Feature Viewer

pLDDT pTM Quality
79.69 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map