F483846
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 861 | 388 | 845 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_11112255|Ga0207691_111122551 |
| Length | 171 |
| Sequence | MSVVAFERKQNGGEWSEKELSTLVAALCATPGSGREWETGMTERGDAQFYLLGPLPDQACEVCVSRIGGRYILEDGSGRLLFEHRNLEFVALHAKAAVPSTSWLMVRAITLWCAIRNTLHEKVQPLLVEGEELFVQFVPQLAAFAWSTAPRTSGASHQAPSPTSHDRTRPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2791355199 | |||
| 5 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 6 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 7 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 8 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 9 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 10 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 11 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 12 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 13 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 342 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 347 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 350 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 351 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 352 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 359 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 360 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 361 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 362 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 368 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 369 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 370 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 380 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 381 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 382 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 384 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 387 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 388 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.14 |
| Metatranscriptomes | 0.12 |
| Isolates | 1.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.65 |
| Nodule | 0.93 |
| Rhizoplane | 6.62 |
| Rhizosphere | 68.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10050278 | 3300001979 | Bacteria | 1200 |
| 2 | JGI24744J21845_10006024 | 3300002077 | Bacteria | 2514 |
| 3 | JGI25406J46586_10088073 | 3300003203 | Bacteria | 941 |
| 4 | JGI25153J46596_10008126 | 3300003215 | Bacteria | 5057 |
| 5 | JGI25404J52841_10004963 | 3300003659 | Bacteria | 2731 |
| 6 | JGI25404J52841_10022179 | 3300003659 | Bacteria | 1373 |
| 7 | JGI25404J52841_10034975 | 3300003659 | Bacteria | 1070 |
| 8 | JGI25404J52841_10127105 | 3300003659 | Bacteria | 538 |
| 9 | Ga0058860_11735244 | 3300004801 | Bacteria | 913 |
| 10 | Ga0070658_10275339 | 3300005327 | Bacteria | 1432 |
| 11 | Ga0070676_10027638 | 3300005328 | Bacteria | 3219 |
| 12 | Ga0070676_10038958 | 3300005328 | Bacteria | 2746 |
| 13 | Ga0070683_100670434 | 3300005329 | Bacteria | 993 |
| 14 | Ga0070690_100025683 | 3300005330 | Bacteria | 3627 |
| 15 | Ga0070670_100376393 | 3300005331 | Bacteria | 1250 |
| 16 | Ga0070670_100676477 | 3300005331 | Bacteria | 927 |
| 17 | Ga0068869_100045470 | 3300005334 | Bacteria | 3161 |
| 18 | Ga0068869_100047276 | 3300005334 | Bacteria | 3107 |
| 19 | Ga0068869_100073070 | 3300005334 | Bacteria | 2543 |
| 20 | Ga0068869_100075640 | 3300005334 | Bacteria | 2502 |
| 21 | Ga0070682_100112780 | 3300005337 | Bacteria | 1815 |
| 22 | Ga0068868_100124385 | 3300005338 | Bacteria | 2106 |
| 23 | Ga0068868_100190391 | 3300005338 | Bacteria | 1706 |
| 24 | Ga0070689_100061523 | 3300005340 | Bacteria | 2920 |
| 25 | Ga0070691_10312393 | 3300005341 | Bacteria | 862 |
| 26 | Ga0070687_101328605 | 3300005343 | Bacteria | 535 |
| 27 | Ga0070661_100054292 | 3300005344 | Bacteria | 2934 |
| 28 | Ga0070661_100133003 | 3300005344 | Bacteria | 1869 |
| 29 | Ga0070661_100339723 | 3300005344 | Bacteria | 1176 |
| 30 | Ga0070668_100031383 | 3300005347 | Bacteria | 4042 |
| 31 | Ga0070668_100037566 | 3300005347 | Bacteria | 3698 |
| 32 | Ga0070668_100075725 | 3300005347 | Bacteria | 2628 |
| 33 | Ga0070668_100120847 | 3300005347 | Bacteria | 2093 |
| 34 | Ga0070668_100430157 | 3300005347 | Bacteria | 1131 |
| 35 | Ga0070668_100882624 | 3300005347 | Bacteria | 798 |
| 36 | Ga0070669_100123379 | 3300005353 | Bacteria | 1979 |
| 37 | Ga0070669_100217204 | 3300005353 | Bacteria | 1511 |
| 38 | Ga0070675_100132272 | 3300005354 | Bacteria | 2127 |
| 39 | Ga0070675_100753638 | 3300005354 | Bacteria | 888 |
| 40 | Ga0070671_100190666 | 3300005355 | Bacteria | 1737 |
| 41 | Ga0070671_100752084 | 3300005355 | Bacteria | 847 |
| 42 | Ga0070674_100084725 | 3300005356 | Bacteria | 2273 |
| 43 | Ga0070674_100159655 | 3300005356 | Bacteria | 1709 |
| 44 | Ga0070674_100450125 | 3300005356 | Bacteria | 1063 |
| 45 | Ga0070674_101143058 | 3300005356 | Bacteria | 689 |
| 46 | Ga0070673_100208162 | 3300005364 | Bacteria | 1688 |
| 47 | Ga0070673_100382712 | 3300005364 | Bacteria | 1255 |
| 48 | Ga0070673_100396559 | 3300005364 | Bacteria | 1233 |
| 49 | Ga0070688_100623186 | 3300005365 | Bacteria | 828 |
| 50 | Ga0070659_100117021 | 3300005366 | Bacteria | 2155 |
| 51 | Ga0070659_100751301 | 3300005366 | Bacteria | 846 |
| 52 | Ga0070659_101611929 | 3300005366 | Bacteria | 579 |
| 53 | Ga0070667_100173516 | 3300005367 | Bacteria | 1904 |
| 54 | Ga0070667_100429823 | 3300005367 | Bacteria | 1205 |
| 55 | Ga0070667_100678186 | 3300005367 | Bacteria | 953 |
| 56 | Ga0070714_100366282 | 3300005435 | Bacteria | 1356 |
| 57 | Ga0070701_10071178 | 3300005438 | Bacteria | 1860 |
| 58 | Ga0070700_100194457 | 3300005441 | Bacteria | 1421 |
| 59 | Ga0070700_100585442 | 3300005441 | Bacteria | 872 |
| 60 | Ga0070694_100563023 | 3300005444 | Bacteria | 914 |
| 61 | Ga0070663_100003353 | 3300005455 | Bacteria | 9243 |
| 62 | Ga0070663_100030539 | 3300005455 | Bacteria | 3694 |
| 63 | Ga0070663_100031087 | 3300005455 | Bacteria | 3666 |
| 64 | Ga0070663_100072147 | 3300005455 | Bacteria | 2514 |
| 65 | Ga0070663_100079989 | 3300005455 | Bacteria | 2399 |
| 66 | Ga0070663_100211565 | 3300005455 | Bacteria | 1518 |
| 67 | Ga0070663_101167035 | 3300005455 | Bacteria | 675 |
| 68 | Ga0070678_100002662 | 3300005456 | Bacteria | 9839 |
| 69 | Ga0070678_100019954 | 3300005456 | Bacteria | 4386 |
| 70 | Ga0070678_100063923 | 3300005456 | Bacteria | 2725 |
| 71 | Ga0070678_100812282 | 3300005456 | Bacteria | 850 |
| 72 | Ga0070678_100883660 | 3300005456 | Bacteria | 816 |
| 73 | Ga0070662_100506194 | 3300005457 | Bacteria | 1008 |
| 74 | Ga0070662_101796513 | 3300005457 | Bacteria | 530 |
| 75 | Ga0068867_100099433 | 3300005459 | Bacteria | 2219 |
| 76 | Ga0068867_100278532 | 3300005459 | Bacteria | 1371 |
| 77 | Ga0070685_10278594 | 3300005466 | Bacteria | 1119 |
| 78 | Ga0070706_100139022 | 3300005467 | Bacteria | 2267 |
| 79 | Ga0070706_100783928 | 3300005467 | Bacteria | 883 |
| 80 | Ga0070699_100252574 | 3300005518 | Bacteria | 1576 |
| 81 | Ga0070697_101443611 | 3300005536 | Bacteria | 615 |
| 82 | Ga0068853_100084299 | 3300005539 | Bacteria | 2784 |
| 83 | Ga0068853_100116417 | 3300005539 | Bacteria | 2379 |
| 84 | Ga0068853_100185189 | 3300005539 | Bacteria | 1890 |
| 85 | Ga0068853_101662964 | 3300005539 | Bacteria | 619 |
| 86 | Ga0070672_100052132 | 3300005543 | Bacteria | 3193 |
| 87 | Ga0070672_100217030 | 3300005543 | Bacteria | 1603 |
| 88 | Ga0070672_100735015 | 3300005543 | Bacteria | 865 |
| 89 | Ga0070686_100262875 | 3300005544 | Bacteria | 1266 |
| 90 | Ga0070686_100303713 | 3300005544 | Bacteria | 1184 |
| 91 | Ga0070695_100982499 | 3300005545 | Bacteria | 686 |
| 92 | Ga0070693_100222809 | 3300005547 | Bacteria | 1237 |
| 93 | Ga0070665_100019653 | 3300005548 | Bacteria | 6780 |
| 94 | Ga0070665_100044982 | 3300005548 | Bacteria | 4432 |
| 95 | Ga0070665_100086641 | 3300005548 | Bacteria | 3137 |
| 96 | Ga0070665_100128711 | 3300005548 | Bacteria | 2534 |
| 97 | Ga0070665_100129397 | 3300005548 | Bacteria | 2527 |
| 98 | Ga0070665_100139127 | 3300005548 | Bacteria | 2431 |
| 99 | Ga0070665_100304679 | 3300005548 | Bacteria | 1596 |
| 100 | Ga0070665_100554975 | 3300005548 | Bacteria | 1161 |
| 101 | Ga0070664_100073611 | 3300005564 | Bacteria | 2932 |
| 102 | Ga0070664_100465490 | 3300005564 | Bacteria | 1162 |
| 103 | Ga0068857_100875200 | 3300005577 | Bacteria | 860 |
| 104 | Ga0068854_100042601 | 3300005578 | Bacteria | 3213 |
| 105 | Ga0068854_100150499 | 3300005578 | Bacteria | 1794 |
| 106 | Ga0068854_100193499 | 3300005578 | Bacteria | 1595 |
| 107 | Ga0068856_100068900 | 3300005614 | Bacteria | 3497 |
| 108 | Ga0070702_100136524 | 3300005615 | Bacteria | 1557 |
| 109 | Ga0070702_100154534 | 3300005615 | Bacteria | 1476 |
| 110 | Ga0068852_101244731 | 3300005616 | Bacteria | 766 |
| 111 | Ga0068859_100100705 | 3300005617 | Bacteria | 2945 |
| 112 | Ga0068859_100178572 | 3300005617 | Bacteria | 2205 |
| 113 | Ga0068859_100414848 | 3300005617 | Bacteria | 1442 |
| 114 | Ga0068864_100058560 | 3300005618 | Bacteria | 3330 |
| 115 | Ga0068864_100069127 | 3300005618 | Bacteria | 3070 |
| 116 | Ga0068864_100546839 | 3300005618 | Bacteria | 1119 |
| 117 | Ga0068864_101221454 | 3300005618 | Bacteria | 751 |
| 118 | Ga0068866_10012487 | 3300005718 | Bacteria | 3701 |
| 119 | Ga0068866_10013354 | 3300005718 | Bacteria | 3601 |
| 120 | Ga0068866_10138234 | 3300005718 | Bacteria | 1395 |
| 121 | Ga0068861_100166031 | 3300005719 | Bacteria | 1825 |
| 122 | Ga0068861_100494325 | 3300005719 | Bacteria | 1105 |
| 123 | Ga0068861_100522610 | 3300005719 | Bacteria | 1077 |
| 124 | Ga0068851_10074088 | 3300005834 | Bacteria | 1767 |
| 125 | Ga0068870_11290518 | 3300005840 | Bacteria | 532 |
| 126 | Ga0068863_100098680 | 3300005841 | Bacteria | 2774 |
| 127 | Ga0068863_100684414 | 3300005841 | Bacteria | 1019 |
| 128 | Ga0068863_101293690 | 3300005841 | Bacteria | 736 |
| 129 | Ga0068858_100060227 | 3300005842 | Bacteria | 3509 |
| 130 | Ga0068858_100178305 | 3300005842 | Bacteria | 2005 |
| 131 | Ga0068860_100719936 | 3300005843 | Bacteria | 1008 |
| 132 | Ga0068860_100892941 | 3300005843 | Bacteria | 905 |
| 133 | Ga0068860_101820661 | 3300005843 | Bacteria | 630 |
| 134 | Ga0068862_100064616 | 3300005844 | Bacteria | 3150 |
| 135 | Ga0068862_100099202 | 3300005844 | Bacteria | 2545 |
| 136 | Ga0068862_100213168 | 3300005844 | Bacteria | 1745 |
| 137 | Ga0068862_100261263 | 3300005844 | Bacteria | 1580 |
| 138 | Ga0068862_100395734 | 3300005844 | Bacteria | 1291 |
| 139 | Ga0068862_100401407 | 3300005844 | Bacteria | 1282 |
| 140 | Ga0068862_100408583 | 3300005844 | Bacteria | 1271 |
| 141 | Ga0068862_100422959 | 3300005844 | Bacteria | 1251 |
| 142 | Ga0068862_100480089 | 3300005844 | Bacteria | 1176 |
| 143 | Ga0068862_100866078 | 3300005844 | Unclassified | 886 |
| 144 | Ga0068862_101950260 | 3300005844 | Bacteria | 597 |
| 145 | Ga0081455_10010859 | 3300005937 | Bacteria | 9192 |
| 146 | Ga0081455_10016359 | 3300005937 | Bacteria | 7165 |
| 147 | Ga0081455_10017850 | 3300005937 | Bacteria | 6783 |
| 148 | Ga0081455_10030202 | 3300005937 | Bacteria | 4927 |
| 149 | Ga0081455_10125630 | 3300005937 | Bacteria | 2014 |
| 150 | Ga0081455_10177248 | 3300005937 | Bacteria | 1617 |
| 151 | Ga0081538_10015837 | 3300005981 | Bacteria | 5814 |
| 152 | Ga0081540_1002860 | 3300005983 | Bacteria | 13966 |
| 153 | Ga0081540_1004874 | 3300005983 | Bacteria | 10108 |
| 154 | Ga0081540_1007330 | 3300005983 | Bacteria | 7889 |
| 155 | Ga0081540_1009322 | 3300005983 | Bacteria | 6771 |
| 156 | Ga0081540_1015061 | 3300005983 | Bacteria | 4908 |
| 157 | Ga0081540_1027967 | 3300005983 | Bacteria | 3180 |
| 158 | Ga0081540_1041856 | 3300005983 | Bacteria | 2370 |
| 159 | Ga0081540_1042714 | 3300005983 | Bacteria | 2335 |
| 160 | Ga0081540_1067351 | 3300005983 | Bacteria | 1674 |
| 161 | Ga0081539_10029635 | 3300005985 | Bacteria | 3414 |
| 162 | Ga0081539_10151141 | 3300005985 | Bacteria | 1117 |
| 163 | Ga0075365_10026315 | 3300006038 | Bacteria | 3692 |
| 164 | Ga0075365_10040262 | 3300006038 | Bacteria | 3047 |
| 165 | Ga0075365_10088394 | 3300006038 | Bacteria | 2108 |
| 166 | Ga0075365_10117480 | 3300006038 | Bacteria | 1832 |
| 167 | Ga0075365_10150714 | 3300006038 | Bacteria | 1618 |
| 168 | Ga0075365_10435751 | 3300006038 | Bacteria | 925 |
| 169 | Ga0075365_10597478 | 3300006038 | Bacteria | 780 |
| 170 | Ga0075365_10971962 | 3300006038 | Bacteria | 598 |
| 171 | Ga0075365_11234895 | 3300006038 | Bacteria | 525 |
| 172 | Ga0075368_10025986 | 3300006042 | Bacteria | 2250 |
| 173 | Ga0075368_10047547 | 3300006042 | Bacteria | 1699 |
| 174 | Ga0075363_100000569 | 3300006048 | Bacteria | 12095 |
| 175 | Ga0075363_100075676 | 3300006048 | Bacteria | 1834 |
| 176 | Ga0075364_10019872 | 3300006051 | Bacteria | 4222 |
| 177 | Ga0075364_10025564 | 3300006051 | Bacteria | 3759 |
| 178 | Ga0075364_10026435 | 3300006051 | Bacteria | 3703 |
| 179 | Ga0075364_10831794 | 3300006051 | Bacteria | 629 |
| 180 | Ga0075432_10015387 | 3300006058 | Bacteria | 2609 |
| 181 | Ga0070715_10367997 | 3300006163 | Bacteria | 790 |
| 182 | Ga0070716_100077422 | 3300006173 | Bacteria | 1974 |
| 183 | Ga0070712_100433226 | 3300006175 | Bacteria | 1092 |
| 184 | Ga0075362_10147716 | 3300006177 | Bacteria | 1126 |
| 185 | Ga0075367_10011572 | 3300006178 | Bacteria | 4675 |
| 186 | Ga0075367_10018357 | 3300006178 | Bacteria | 3858 |
| 187 | Ga0075367_10061707 | 3300006178 | Bacteria | 2238 |
| 188 | Ga0075367_10155032 | 3300006178 | Bacteria | 1423 |
| 189 | Ga0075367_10339442 | 3300006178 | Bacteria | 947 |
| 190 | Ga0075367_10714339 | 3300006178 | Bacteria | 638 |
| 191 | Ga0075367_10817903 | 3300006178 | Bacteria | 593 |
| 192 | Ga0075369_10005129 | 3300006186 | Bacteria | 4879 |
| 193 | Ga0075369_10015343 | 3300006186 | Bacteria | 3073 |
| 194 | Ga0075369_10100009 | 3300006186 | Bacteria | 1300 |
| 195 | Ga0075369_10245524 | 3300006186 | Bacteria | 831 |
| 196 | Ga0075366_10086258 | 3300006195 | Bacteria | 1878 |
| 197 | Ga0075366_10091682 | 3300006195 | Bacteria | 1820 |
| 198 | Ga0075366_10107576 | 3300006195 | Bacteria | 1677 |
| 199 | Ga0075366_10201797 | 3300006195 | Bacteria | 1210 |
| 200 | Ga0075366_10297503 | 3300006195 | Bacteria | 987 |
| 201 | Ga0075366_10943511 | 3300006195 | Bacteria | 538 |
| 202 | Ga0097621_100034098 | 3300006237 | Bacteria | 4057 |
| 203 | Ga0097621_100036520 | 3300006237 | Bacteria | 3932 |
| 204 | Ga0075370_10014094 | 3300006353 | Bacteria | 4258 |
| 205 | Ga0075370_10072040 | 3300006353 | Bacteria | 1978 |
| 206 | Ga0075370_10103015 | 3300006353 | Bacteria | 1653 |
| 207 | Ga0075370_10338658 | 3300006353 | Bacteria | 897 |
| 208 | Ga0075370_10384595 | 3300006353 | Bacteria | 841 |
| 209 | Ga0068871_100160352 | 3300006358 | Bacteria | 1923 |
| 210 | Ga0068871_100344932 | 3300006358 | Bacteria | 1316 |
| 211 | Ga0075428_100067240 | 3300006844 | Bacteria | 3923 |
| 212 | Ga0075428_100068913 | 3300006844 | Bacteria | 3869 |
| 213 | Ga0075428_101205413 | 3300006844 | Bacteria | 798 |
| 214 | Ga0075434_100300927 | 3300006871 | Bacteria | 1624 |
| 215 | Ga0068865_100040769 | 3300006881 | Bacteria | 3157 |
| 216 | Ga0068865_100045409 | 3300006881 | Bacteria | 3012 |
| 217 | Ga0068865_100237154 | 3300006881 | Bacteria | 1434 |
| 218 | Ga0068865_100427191 | 3300006881 | Bacteria | 1091 |
| 219 | Ga0075436_100393060 | 3300006914 | Bacteria | 1004 |
| 220 | Ga0097620_100100701 | 3300006931 | Bacteria | 2945 |
| 221 | Ga0097620_100178567 | 3300006931 | Bacteria | 2205 |
| 222 | Ga0097620_100414844 | 3300006931 | Bacteria | 1442 |
| 223 | Ga0099795_10034510 | 3300007788 | Bacteria | 1763 |
| 224 | Ga0099795_10049039 | 3300007788 | Bacteria | 1531 |
| 225 | Ga0105251_10406927 | 3300009011 | Bacteria | 626 |
| 226 | Ga0105244_10220204 | 3300009036 | Bacteria | 890 |
| 227 | Ga0105250_10091443 | 3300009092 | Bacteria | 1238 |
| 228 | Ga0105250_10270421 | 3300009092 | Bacteria | 730 |
| 229 | Ga0105240_10479386 | 3300009093 | Bacteria | 1387 |
| 230 | Ga0111539_10089828 | 3300009094 | Bacteria | 3610 |
| 231 | Ga0105245_10164541 | 3300009098 | Bacteria | 2107 |
| 232 | Ga0105245_10263865 | 3300009098 | Bacteria | 1677 |
| 233 | Ga0105245_11510448 | 3300009098 | Bacteria | 723 |
| 234 | Ga0105247_10073371 | 3300009101 | Bacteria | 2144 |
| 235 | Ga0105247_10218098 | 3300009101 | Bacteria | 1290 |
| 236 | Ga0105247_10254390 | 3300009101 | Bacteria | 1202 |
| 237 | Ga0105247_10285067 | 3300009101 | Bacteria | 1141 |
| 238 | Ga0114129_10133780 | 3300009147 | Bacteria | 3404 |
| 239 | Ga0105243_10085482 | 3300009148 | Bacteria | 2586 |
| 240 | Ga0105243_10346774 | 3300009148 | Bacteria | 1362 |
| 241 | Ga0105243_10358800 | 3300009148 | Bacteria | 1341 |
| 242 | Ga0105243_10552705 | 3300009148 | Bacteria | 1100 |
| 243 | Ga0105243_10873475 | 3300009148 | Bacteria | 892 |
| 244 | Ga0105241_10030199 | 3300009174 | Bacteria | 4048 |
| 245 | Ga0105241_10459259 | 3300009174 | Bacteria | 1128 |
| 246 | Ga0105241_10640778 | 3300009174 | Bacteria | 964 |
| 247 | Ga0105242_10091348 | 3300009176 | Bacteria | 2563 |
| 248 | Ga0105242_10440069 | 3300009176 | Bacteria | 1226 |
| 249 | Ga0105242_10841423 | 3300009176 | Bacteria | 912 |
| 250 | Ga0105242_11089932 | 3300009176 | Bacteria | 812 |
| 251 | Ga0105248_10054241 | 3300009177 | Bacteria | 4495 |
| 252 | Ga0105237_10137991 | 3300009545 | Bacteria | 2433 |
| 253 | Ga0105237_10318174 | 3300009545 | Bacteria | 1559 |
| 254 | Ga0105238_10080497 | 3300009551 | Bacteria | 3247 |
| 255 | Ga0105238_10274010 | 3300009551 | Bacteria | 1668 |
| 256 | Ga0105238_10505109 | 3300009551 | Bacteria | 1210 |
| 257 | Ga0105249_10113290 | 3300009553 | Bacteria | 2566 |
| 258 | Ga0105249_10589187 | 3300009553 | Bacteria | 1166 |
| 259 | Ga0105249_10756811 | 3300009553 | Bacteria | 1034 |
| 260 | Ga0105249_11000305 | 3300009553 | Bacteria | 905 |
| 261 | Ga0105249_11140318 | 3300009553 | Bacteria | 850 |
| 262 | Ga0105239_10098298 | 3300010375 | Bacteria | 3235 |
| 263 | Ga0105239_10217198 | 3300010375 | Bacteria | 2144 |
| 264 | Ga0105239_10541832 | 3300010375 | Bacteria | 1325 |
| 265 | Ga0105239_11184508 | 3300010375 | Bacteria | 880 |
| 266 | Ga0105239_12922054 | 3300010375 | Bacteria | 557 |
| 267 | Ga0105246_10110980 | 3300011119 | Bacteria | 2015 |
| 268 | Ga0105246_10185559 | 3300011119 | Bacteria | 1605 |
| 269 | Ga0105246_10228853 | 3300011119 | Bacteria | 1463 |
| 270 | Ga0105246_10852430 | 3300011119 | Bacteria | 813 |
| 271 | Ga0157374_10273006 | 3300013296 | Bacteria | 1668 |
| 272 | Ga0157374_10622123 | 3300013296 | Bacteria | 1090 |
| 273 | Ga0157378_10020790 | 3300013297 | Bacteria | 5771 |
| 274 | Ga0157378_10263661 | 3300013297 | Bacteria | 1654 |
| 275 | Ga0163162_10055949 | 3300013306 | Bacteria | 3973 |
| 276 | Ga0163162_11494298 | 3300013306 | Bacteria | 769 |
| 277 | Ga0157372_11664474 | 3300013307 | Bacteria | 734 |
| 278 | Ga0157375_10018295 | 3300013308 | Bacteria | 6352 |
| 279 | Ga0157375_10079517 | 3300013308 | Bacteria | 3315 |
| 280 | Ga0157375_10106423 | 3300013308 | Bacteria | 2897 |
| 281 | Ga0157375_10539501 | 3300013308 | Bacteria | 1329 |
| 282 | Ga0157375_10654551 | 3300013308 | Bacteria | 1207 |
| 283 | Ga0157375_11373185 | 3300013308 | Bacteria | 832 |
| 284 | Ga0157375_13543623 | 3300013308 | Bacteria | 519 |
| 285 | Ga0163163_10199277 | 3300014325 | Bacteria | 2050 |
| 286 | Ga0163163_10310305 | 3300014325 | Bacteria | 1630 |
| 287 | Ga0163163_10401910 | 3300014325 | Bacteria | 1428 |
| 288 | Ga0163163_11172445 | 3300014325 | Bacteria | 831 |
| 289 | Ga0157380_10056556 | 3300014326 | Bacteria | 3121 |
| 290 | Ga0157380_10130927 | 3300014326 | Bacteria | 2140 |
| 291 | Ga0157380_10220770 | 3300014326 | Bacteria | 1696 |
| 292 | Ga0157380_10292094 | 3300014326 | Bacteria | 1497 |
| 293 | Ga0157380_11079080 | 3300014326 | Bacteria | 841 |
| 294 | Ga0157377_10054673 | 3300014745 | Bacteria | 2261 |
| 295 | Ga0157379_10131370 | 3300014968 | Bacteria | 2254 |
| 296 | Ga0157379_10147094 | 3300014968 | Bacteria | 2125 |
| 297 | Ga0157376_10043154 | 3300014969 | Bacteria | 3700 |
| 298 | Ga0157376_10054887 | 3300014969 | Bacteria | 3323 |
| 299 | Ga0157376_10349468 | 3300014969 | Bacteria | 1415 |
| 300 | Ga0157376_10353987 | 3300014969 | Bacteria | 1406 |
| 301 | Ga0163161_10068479 | 3300017792 | Bacteria | 2593 |
| 302 | Ga0209564_1023084 | 3300025295 | Bacteria | 2174 |
| 303 | Ga0209758_1001444 | 3300025297 | Bacteria | 28002 |
| 304 | Ga0209758_1043368 | 3300025297 | Bacteria | 1658 |
| 305 | Ga0207697_10168408 | 3300025315 | Bacteria | 958 |
| 306 | Ga0207697_10192915 | 3300025315 | Bacteria | 895 |
| 307 | Ga0207656_10055273 | 3300025321 | Bacteria | 1727 |
| 308 | Ga0207653_10078223 | 3300025885 | Bacteria | 1141 |
| 309 | Ga0207642_10014744 | 3300025899 | Bacteria | 2893 |
| 310 | Ga0207710_10050314 | 3300025900 | Bacteria | 1869 |
| 311 | Ga0207710_10105582 | 3300025900 | Bacteria | 1333 |
| 312 | Ga0207710_10365603 | 3300025900 | Bacteria | 737 |
| 313 | Ga0207688_10061342 | 3300025901 | Bacteria | 2119 |
| 314 | Ga0207688_10083544 | 3300025901 | Bacteria | 1826 |
| 315 | Ga0207647_10235056 | 3300025904 | Bacteria | 1054 |
| 316 | Ga0207645_10041042 | 3300025907 | Bacteria | 2963 |
| 317 | Ga0207645_10080213 | 3300025907 | Bacteria | 2092 |
| 318 | Ga0207645_10116590 | 3300025907 | Bacteria | 1732 |
| 319 | Ga0207643_10131227 | 3300025908 | Bacteria | 1491 |
| 320 | Ga0207643_10260678 | 3300025908 | Bacteria | 1070 |
| 321 | Ga0207643_10761069 | 3300025908 | Bacteria | 627 |
| 322 | Ga0207654_10012529 | 3300025911 | Bacteria | 4346 |
| 323 | Ga0207695_10279751 | 3300025913 | Bacteria | 1562 |
| 324 | Ga0207671_10078672 | 3300025914 | Bacteria | 2470 |
| 325 | Ga0207693_10043247 | 3300025915 | Bacteria | 3545 |
| 326 | Ga0207662_11170361 | 3300025918 | Bacteria | 547 |
| 327 | Ga0207657_10453659 | 3300025919 | Bacteria | 1006 |
| 328 | Ga0207649_10049714 | 3300025920 | Bacteria | 2591 |
| 329 | Ga0207681_10134255 | 3300025923 | Bacteria | 1834 |
| 330 | Ga0207681_10737867 | 3300025923 | Bacteria | 820 |
| 331 | Ga0207681_10892005 | 3300025923 | Bacteria | 744 |
| 332 | Ga0207694_10058626 | 3300025924 | Bacteria | 2995 |
| 333 | Ga0207694_11356097 | 3300025924 | Bacteria | 601 |
| 334 | Ga0207659_10238825 | 3300025926 | Bacteria | 1469 |
| 335 | Ga0207659_10554114 | 3300025926 | Bacteria | 977 |
| 336 | Ga0207687_10052625 | 3300025927 | Bacteria | 2842 |
| 337 | Ga0207664_10786941 | 3300025929 | Bacteria | 856 |
| 338 | Ga0207644_10093660 | 3300025931 | Bacteria | 2243 |
| 339 | Ga0207644_11408977 | 3300025931 | Bacteria | 585 |
| 340 | Ga0207690_10223908 | 3300025932 | Bacteria | 1441 |
| 341 | Ga0207706_10047923 | 3300025933 | Bacteria | 3780 |
| 342 | Ga0207706_10371555 | 3300025933 | Bacteria | 1242 |
| 343 | Ga0207706_11145341 | 3300025933 | Bacteria | 648 |
| 344 | Ga0207706_11209933 | 3300025933 | Bacteria | 627 |
| 345 | Ga0207686_10417495 | 3300025934 | Bacteria | 1025 |
| 346 | Ga0207709_10031459 | 3300025935 | Bacteria | 3100 |
| 347 | Ga0207709_10664060 | 3300025935 | Bacteria | 831 |
| 348 | Ga0207709_10892815 | 3300025935 | Unclassified | 722 |
| 349 | Ga0207670_10076308 | 3300025936 | Bacteria | 2332 |
| 350 | Ga0207669_10060620 | 3300025937 | Bacteria | 2320 |
| 351 | Ga0207669_10693778 | 3300025937 | Bacteria | 836 |
| 352 | Ga0207704_10076741 | 3300025938 | Bacteria | 2142 |
| 353 | Ga0207704_10159868 | 3300025938 | Bacteria | 1601 |
| 354 | Ga0207704_10296409 | 3300025938 | Bacteria | 1237 |
| 355 | Ga0207704_10825391 | 3300025938 | Bacteria | 776 |
| 356 | Ga0207665_10064556 | 3300025939 | Bacteria | 2488 |
| 357 | Ga0207665_10121161 | 3300025939 | Bacteria | 1848 |
| 358 | Ga0207691_10117880 | 3300025940 | Bacteria | 2355 |
| 359 | Ga0207691_10686813 | 3300025940 | Bacteria | 864 |
| 360 | Ga0207691_10900702 | 3300025940 | Bacteria | 740 |
| 361 | Ga0207691_11112255 | 3300025940 | Bacteria | 657 |
| 362 | Ga0207711_10020555 | 3300025941 | Bacteria | 5507 |
| 363 | Ga0207689_10034293 | 3300025942 | Bacteria | 4216 |
| 364 | Ga0207689_10061642 | 3300025942 | Bacteria | 3085 |
| 365 | Ga0207689_10118992 | 3300025942 | Bacteria | 2173 |
| 366 | Ga0207679_10056113 | 3300025945 | Bacteria | 2907 |
| 367 | Ga0207679_10070881 | 3300025945 | Bacteria | 2627 |
| 368 | Ga0207667_10046871 | 3300025949 | Bacteria | 4577 |
| 369 | Ga0207651_10199343 | 3300025960 | Bacteria | 1603 |
| 370 | Ga0207651_10365751 | 3300025960 | Bacteria | 1219 |
| 371 | Ga0207651_10581446 | 3300025960 | Bacteria | 977 |
| 372 | Ga0207712_10942140 | 3300025961 | Bacteria | 765 |
| 373 | Ga0207668_10147450 | 3300025972 | Bacteria | 1817 |
| 374 | Ga0207668_10192277 | 3300025972 | Bacteria | 1618 |
| 375 | Ga0207668_10255695 | 3300025972 | Bacteria | 1425 |
| 376 | Ga0207668_10275556 | 3300025972 | Bacteria | 1377 |
| 377 | Ga0207668_10465081 | 3300025972 | Bacteria | 1082 |
| 378 | Ga0207668_11625945 | 3300025972 | Bacteria | 583 |
| 379 | Ga0207640_10113931 | 3300025981 | Bacteria | 1923 |
| 380 | Ga0207640_10207698 | 3300025981 | Bacteria | 1489 |
| 381 | Ga0207640_10236652 | 3300025981 | Bacteria | 1408 |
| 382 | Ga0207640_11533458 | 3300025981 | Bacteria | 599 |
| 383 | Ga0207658_10050950 | 3300025986 | Bacteria | 3049 |
| 384 | Ga0207658_10453054 | 3300025986 | Bacteria | 1136 |
| 385 | Ga0207658_11493405 | 3300025986 | Bacteria | 618 |
| 386 | Ga0207677_10014116 | 3300026023 | Bacteria | 4653 |
| 387 | Ga0207677_10640946 | 3300026023 | Bacteria | 937 |
| 388 | Ga0207703_10079384 | 3300026035 | Bacteria | 2730 |
| 389 | Ga0207639_10429373 | 3300026041 | Bacteria | 1196 |
| 390 | Ga0207639_10753875 | 3300026041 | Bacteria | 905 |
| 391 | Ga0207639_11674812 | 3300026041 | Bacteria | 596 |
| 392 | Ga0207678_10005268 | 3300026067 | Bacteria | 11582 |
| 393 | Ga0207678_10032402 | 3300026067 | Bacteria | 4554 |
| 394 | Ga0207678_10038621 | 3300026067 | Bacteria | 4147 |
| 395 | Ga0207678_10048058 | 3300026067 | Bacteria | 3689 |
| 396 | Ga0207678_10060852 | 3300026067 | Bacteria | 3248 |
| 397 | Ga0207678_10076918 | 3300026067 | Bacteria | 2858 |
| 398 | Ga0207678_10121178 | 3300026067 | Bacteria | 2232 |
| 399 | Ga0207678_10203925 | 3300026067 | Bacteria | 1691 |
| 400 | Ga0207678_11232563 | 3300026067 | Bacteria | 662 |
| 401 | Ga0207708_10053224 | 3300026075 | Bacteria | 3084 |
| 402 | Ga0207708_10332602 | 3300026075 | Bacteria | 1242 |
| 403 | Ga0207702_10069003 | 3300026078 | Bacteria | 3038 |
| 404 | Ga0207702_11565889 | 3300026078 | Bacteria | 652 |
| 405 | Ga0207641_10112831 | 3300026088 | Bacteria | 2412 |
| 406 | Ga0207648_10042048 | 3300026089 | Bacteria | 4013 |
| 407 | Ga0207648_10118129 | 3300026089 | Bacteria | 2330 |
| 408 | Ga0207676_10116997 | 3300026095 | Bacteria | 2241 |
| 409 | Ga0207676_10122781 | 3300026095 | Bacteria | 2193 |
| 410 | Ga0207676_10379198 | 3300026095 | Bacteria | 1316 |
| 411 | Ga0207676_10963167 | 3300026095 | Bacteria | 839 |
| 412 | Ga0207674_10040950 | 3300026116 | Bacteria | 4794 |
| 413 | Ga0207674_11477855 | 3300026116 | Bacteria | 649 |
| 414 | Ga0207675_100095640 | 3300026118 | Bacteria | 2795 |
| 415 | Ga0207675_100202556 | 3300026118 | Bacteria | 1906 |
| 416 | Ga0207675_100222513 | 3300026118 | Bacteria | 1819 |
| 417 | Ga0207675_100381419 | 3300026118 | Bacteria | 1386 |
| 418 | Ga0207675_100394151 | 3300026118 | Bacteria | 1363 |
| 419 | Ga0207675_100560201 | 3300026118 | Bacteria | 1143 |
| 420 | Ga0207683_10053503 | 3300026121 | Bacteria | 3540 |
| 421 | Ga0207683_10082114 | 3300026121 | Bacteria | 2862 |
| 422 | Ga0207683_10095110 | 3300026121 | Bacteria | 2656 |
| 423 | Ga0207683_10234955 | 3300026121 | Bacteria | 1672 |
| 424 | Ga0207683_10273371 | 3300026121 | Bacteria | 1544 |
| 425 | Ga0207683_10469697 | 3300026121 | Bacteria | 1160 |
| 426 | Ga0207698_10080447 | 3300026142 | Bacteria | 2625 |
| 427 | Ga0207698_10725526 | 3300026142 | Bacteria | 991 |
| 428 | Ga0207698_10752051 | 3300026142 | Bacteria | 974 |
| 429 | Ga0209813_10012688 | 3300027866 | Bacteria | 2234 |
| 430 | Ga0209813_10202553 | 3300027866 | Bacteria | 735 |
| 431 | Ga0207428_10156085 | 3300027907 | Bacteria | 1736 |
| 432 | Ga0268266_10001439 | 3300028379 | Bacteria | 28336 |
| 433 | Ga0268266_10004759 | 3300028379 | Bacteria | 12905 |
| 434 | Ga0268266_10021895 | 3300028379 | Bacteria | 5446 |
| 435 | Ga0268266_10048061 | 3300028379 | Bacteria | 3656 |
| 436 | Ga0268266_10099983 | 3300028379 | Bacteria | 2554 |
| 437 | Ga0268266_10153310 | 3300028379 | Bacteria | 2079 |
| 438 | Ga0268266_10242848 | 3300028379 | Bacteria | 1663 |
| 439 | Ga0268266_10394307 | 3300028379 | Bacteria | 1308 |
| 440 | Ga0268266_10412639 | 3300028379 | Bacteria | 1278 |
| 441 | Ga0268266_10650097 | 3300028379 | Bacteria | 1015 |
| 442 | Ga0268265_10056338 | 3300028380 | Bacteria | 2990 |
| 443 | Ga0268265_10125571 | 3300028380 | Bacteria | 2122 |
| 444 | Ga0268265_10226578 | 3300028380 | Bacteria | 1639 |
| 445 | Ga0268265_10292344 | 3300028380 | Bacteria | 1463 |
| 446 | Ga0268265_10315453 | 3300028380 | Bacteria | 1413 |
| 447 | Ga0268265_10362348 | 3300028380 | Bacteria | 1327 |
| 448 | Ga0268265_10482092 | 3300028380 | Bacteria | 1165 |
| 449 | Ga0268265_11180455 | 3300028380 | Bacteria | 762 |
| 450 | Ga0268265_11615061 | 3300028380 | Bacteria | 653 |
| 451 | Ga0268265_11971414 | 3300028380 | Bacteria | 591 |
| 452 | Ga0268264_10056791 | 3300028381 | Bacteria | 3273 |
| 453 | Ga0307517_10126584 | 3300028786 | Bacteria | 1861 |
| 454 | Ga0307517_10180147 | 3300028786 | Bacteria | 1366 |
| 455 | Ga0307517_10237341 | 3300028786 | Bacteria | 1086 |
| 456 | Ga0307515_10254822 | 3300028794 | Bacteria | 1501 |
| 457 | Ga0307515_10471896 | 3300028794 | Bacteria | 868 |
| 458 | Ga0307511_10128517 | 3300030521 | Bacteria | 1536 |
| 459 | Ga0307513_10126681 | 3300031456 | Bacteria | 2508 |
| 460 | Ga0307509_10198703 | 3300031507 | Bacteria | 1845 |
| 461 | Ga0307408_101122507 | 3300031548 | Bacteria | 730 |
| 462 | Ga0307408_101687807 | 3300031548 | Bacteria | 603 |
| 463 | Ga0307508_10436927 | 3300031616 | Bacteria | 901 |
| 464 | Ga0307516_10120108 | 3300031730 | Bacteria | 2420 |
| 465 | Ga0307516_10280387 | 3300031730 | Bacteria | 1349 |
| 466 | Ga0307405_10152841 | 3300031731 | Bacteria | 1625 |
| 467 | Ga0307405_10385865 | 3300031731 | Bacteria | 1092 |
| 468 | Ga0307413_10146496 | 3300031824 | Bacteria | 1640 |
| 469 | Ga0307413_10205283 | 3300031824 | Bacteria | 1426 |
| 470 | Ga0307413_10747627 | 3300031824 | Bacteria | 817 |
| 471 | Ga0307406_10368236 | 3300031901 | Bacteria | 1129 |
| 472 | Ga0307406_10909904 | 3300031901 | Bacteria | 750 |
| 473 | Ga0307412_10028635 | 3300031911 | Bacteria | 3488 |
| 474 | Ga0307412_10288119 | 3300031911 | Bacteria | 1292 |
| 475 | Ga0307412_10676827 | 3300031911 | Bacteria | 883 |
| 476 | Ga0307412_11927524 | 3300031911 | Bacteria | 546 |
| 477 | Ga0307412_11938691 | 3300031911 | Unclassified | 544 |
| 478 | Ga0307409_100504840 | 3300031995 | Bacteria | 1178 |
| 479 | Ga0307409_102530113 | 3300031995 | Bacteria | 542 |
| 480 | Ga0307416_100124842 | 3300032002 | Bacteria | 2303 |
| 481 | Ga0307416_100621101 | 3300032002 | Bacteria | 1163 |
| 482 | Ga0307416_100941318 | 3300032002 | Bacteria | 965 |
| 483 | Ga0307416_100949353 | 3300032002 | Bacteria | 962 |
| 484 | Ga0307416_101100863 | 3300032002 | Bacteria | 899 |
| 485 | Ga0307416_101256695 | 3300032002 | Bacteria | 846 |
| 486 | Ga0307416_101375007 | 3300032002 | Bacteria | 812 |
| 487 | Ga0307411_10038307 | 3300032005 | Bacteria | 3023 |
| 488 | Ga0307411_10285462 | 3300032005 | Bacteria | 1316 |
| 489 | Ga0307411_11131720 | 3300032005 | Bacteria | 707 |
| 490 | Ga0307415_100017971 | 3300032126 | Bacteria | 4256 |
| 491 | Ga0307415_100182077 | 3300032126 | Bacteria | 1650 |
| 492 | Ga0307415_100259039 | 3300032126 | Bacteria | 1418 |
| 493 | Ga0307510_10071137 | 3300033180 | Bacteria | 3467 |
| 494 | Ga0373943_0014145 | 3300035170 | Bacteria | 3609 |
| 495 | Ga0373931_0625332 | 3300035691 | Bacteria | 706 |
| 496 | Ga0373927_0019266 | 3300035695 | Bacteria | 4475 |
| 497 | Ga0373947_0008612 | 3300035725 | Bacteria | 5872 |
| 498 | Ga0373925_0081544 | 3300037068 | Bacteria | 2460 |
| 499 | Ga0395905_0446101 | 3300037471 | Bacteria | 1192 |
| 500 | Ga0439465_0012592 | 3300041413 | Bacteria | 2645 |
| 501 | Ga0451793_0458310 | 3300041452 | Bacteria | 842 |
| 502 | Ga0451797_0020094 | 3300041453 | Bacteria | 686 |
| 503 | Ga0451800_0637662 | 3300041459 | Bacteria | 1208 |
| 504 | Ga0451802_1184584 | 3300041460 | Bacteria | 1179 |
| 505 | Ga0451802_1997251 | 3300041460 | Bacteria | 560 |
| 506 | Ga0451802_2127802 | 3300041460 | Bacteria | 519 |
| 507 | Ga0451807_0833332 | 3300041486 | Bacteria | 1241 |
| 508 | Ga0451841_1432989 | 3300041498 | Bacteria | 688 |
| 509 | Ga0451853_1513700 | 3300041512 | Bacteria | 1701 |
| 510 | Ga0439445_0078004 | 3300042004 | Bacteria | 923 |
| 511 | Ga0451576_1134266 | 3300045051 | Bacteria | 818 |
| 512 | Ga0495617_114056 | 3300046452 | Bacteria | 873 |
| 513 | Ga0495617_160604 | 3300046452 | Bacteria | 712 |
| 514 | Ga0495603_0011405 | 3300046455 | Bacteria | 5380 |
| 515 | Ga0495603_0079703 | 3300046455 | Bacteria | 1919 |
| 516 | Ga0495603_0138290 | 3300046455 | Bacteria | 1417 |
| 517 | Ga0495590_0438002 | 3300046457 | Bacteria | 504 |
| 518 | Ga0495629_0866461 | 3300046459 | Bacteria | 593 |
| 519 | Ga0495638_0107015 | 3300046460 | Bacteria | 1665 |
| 520 | Ga0495638_0147794 | 3300046460 | Bacteria | 1365 |
| 521 | Ga0495641_0392743 | 3300046461 | Unclassified | 629 |
| 522 | Ga0495650_0132802 | 3300046471 | Bacteria | 907 |
| 523 | Ga0495580_0211891 | 3300046472 | Bacteria | 1333 |
| 524 | Ga0495605_0116782 | 3300046474 | Bacteria | 1213 |
| 525 | Ga0495662_0337457 | 3300046476 | Bacteria | 741 |
| 526 | Ga0495584_0057240 | 3300046491 | Bacteria | 1961 |
| 527 | Ga0495584_0128354 | 3300046491 | Bacteria | 1286 |
| 528 | Ga0495584_0269295 | 3300046491 | Bacteria | 866 |
| 529 | Ga0495584_0317976 | 3300046491 | Bacteria | 790 |
| 530 | Ga0495585_0017852 | 3300046492 | Bacteria | 4095 |
| 531 | Ga0495585_0033839 | 3300046492 | Bacteria | 2891 |
| 532 | Ga0495585_0241584 | 3300046492 | Bacteria | 904 |
| 533 | Ga0495594_0080093 | 3300046499 | Bacteria | 1823 |
| 534 | Ga0495596_0053833 | 3300046500 | Bacteria | 1574 |
| 535 | Ga0495596_0099065 | 3300046500 | Bacteria | 1131 |
| 536 | Ga0495607_0055266 | 3300046501 | Bacteria | 2284 |
| 537 | Ga0495607_0142486 | 3300046501 | Bacteria | 1235 |
| 538 | Ga0495583_0033447 | 3300046506 | Bacteria | 2473 |
| 539 | Ga0495583_0055586 | 3300046506 | Bacteria | 1788 |
| 540 | Ga0495583_0261356 | 3300046506 | Bacteria | 692 |
| 541 | Ga0495606_0135727 | 3300046507 | Bacteria | 1457 |
| 542 | Ga0495606_0165192 | 3300046507 | Bacteria | 1288 |
| 543 | Ga0495610_0025158 | 3300046512 | Bacteria | 3201 |
| 544 | Ga0495610_0248654 | 3300046512 | Bacteria | 705 |
| 545 | Ga0495616_0021245 | 3300046513 | Bacteria | 3517 |
| 546 | Ga0495616_0091337 | 3300046513 | Bacteria | 1441 |
| 547 | Ga0495616_0142007 | 3300046513 | Bacteria | 1092 |
| 548 | Ga0495616_0424363 | 3300046513 | Bacteria | 543 |
| 549 | Ga0495620_0012556 | 3300046515 | Bacteria | 4367 |
| 550 | Ga0495620_0268957 | 3300046515 | Bacteria | 649 |
| 551 | Ga0495630_0133723 | 3300046517 | Bacteria | 1884 |
| 552 | Ga0495631_0019017 | 3300046518 | Bacteria | 3226 |
| 553 | Ga0495631_0082536 | 3300046518 | Bacteria | 1385 |
| 554 | Ga0495632_0118079 | 3300046519 | Bacteria | 1241 |
| 555 | Ga0495632_0146198 | 3300046519 | Bacteria | 1094 |
| 556 | Ga0495632_0170461 | 3300046519 | Bacteria | 1000 |
| 557 | Ga0495637_0106273 | 3300046520 | Bacteria | 1092 |
| 558 | Ga0495643_0083768 | 3300046522 | Bacteria | 1655 |
| 559 | Ga0495643_0220586 | 3300046522 | Bacteria | 899 |
| 560 | Ga0495644_0032891 | 3300046523 | Bacteria | 1960 |
| 561 | Ga0495644_0034709 | 3300046523 | Bacteria | 1904 |
| 562 | Ga0495644_0287849 | 3300046523 | Bacteria | 642 |
| 563 | Ga0495644_0352431 | 3300046523 | Bacteria | 580 |
| 564 | Ga0495648_0003972 | 3300046524 | Bacteria | 12795 |
| 565 | Ga0495648_0062800 | 3300046524 | Bacteria | 2197 |
| 566 | Ga0495648_0274312 | 3300046524 | Bacteria | 802 |
| 567 | Ga0495648_0301955 | 3300046524 | Bacteria | 750 |
| 568 | Ga0495663_0036767 | 3300046525 | Bacteria | 1475 |
| 569 | Ga0495663_0229618 | 3300046525 | Bacteria | 654 |
| 570 | Ga0495642_0221046 | 3300046528 | Bacteria | 827 |
| 571 | Ga0495654_0081580 | 3300046530 | Bacteria | 1515 |
| 572 | Ga0495598_0026714 | 3300046537 | Bacteria | 1585 |
| 573 | Ga0495609_0054926 | 3300046538 | Bacteria | 1767 |
| 574 | Ga0495609_0167607 | 3300046538 | Bacteria | 929 |
| 575 | Ga0495597_0043930 | 3300046542 | Bacteria | 1988 |
| 576 | Ga0495597_0321323 | 3300046542 | Bacteria | 598 |
| 577 | Ga0495622_0019041 | 3300046557 | Bacteria | 3198 |
| 578 | Ga0495622_0110135 | 3300046557 | Bacteria | 1261 |
| 579 | Ga0495622_0130339 | 3300046557 | Bacteria | 1146 |
| 580 | Ga0495656_0016291 | 3300046615 | Bacteria | 2819 |
| 581 | Ga0495656_0085971 | 3300046615 | Bacteria | 1429 |
| 582 | Ga0495656_0115215 | 3300046615 | Bacteria | 1262 |
| 583 | Ga0495656_0404391 | 3300046615 | Bacteria | 714 |
| 584 | Ga0495656_0641787 | 3300046615 | Bacteria | 570 |
| 585 | Ga0495668_0077805 | 3300046616 | Bacteria | 1821 |
| 586 | Ga0495611_0027557 | 3300046648 | Bacteria | 2484 |
| 587 | Ga0495611_0073397 | 3300046648 | Bacteria | 1566 |
| 588 | Ga0495611_0184702 | 3300046648 | Bacteria | 974 |
| 589 | Ga0495611_0593020 | 3300046648 | Bacteria | 501 |
| 590 | Ga0495625_0183592 | 3300046660 | Bacteria | 1389 |
| 591 | Ga0495625_0186023 | 3300046660 | Bacteria | 1378 |
| 592 | Ga0495635_0409530 | 3300046663 | Bacteria | 900 |
| 593 | Ga0495659_0004408 | 3300046664 | Bacteria | 4433 |
| 594 | Ga0495659_0006029 | 3300046664 | Bacteria | 3831 |
| 595 | Ga0495661_0055606 | 3300046665 | Bacteria | 2371 |
| 596 | Ga0495661_0182535 | 3300046665 | Bacteria | 1111 |
| 597 | Ga0495588_0005668 | 3300046674 | Bacteria | 5567 |
| 598 | Ga0495588_0063262 | 3300046674 | Bacteria | 1918 |
| 599 | Ga0495669_0005775 | 3300046684 | Bacteria | 5160 |
| 600 | Ga0495669_0064087 | 3300046684 | Bacteria | 1667 |
| 601 | Ga0495669_0086391 | 3300046684 | Bacteria | 1444 |
| 602 | Ga0495669_0166884 | 3300046684 | Bacteria | 1046 |
| 603 | Ga0495669_0550258 | 3300046684 | Bacteria | 561 |
| 604 | Ga0495624_0105506 | 3300046690 | Bacteria | 1734 |
| 605 | Ga0495670_0041394 | 3300046691 | Bacteria | 2298 |
| 606 | Ga0495670_0410719 | 3300046691 | Bacteria | 732 |
| 607 | Ga0495671_0016018 | 3300046692 | Bacteria | 4010 |
| 608 | Ga0495671_0230377 | 3300046692 | Bacteria | 896 |
| 609 | Ga0495649_0094598 | 3300046694 | Bacteria | 1590 |
| 610 | Ga0495649_0316004 | 3300046694 | Bacteria | 793 |
| 611 | Ga0495589_0386501 | 3300046794 | Bacteria | 643 |
| 612 | Ga0495660_0028579 | 3300046810 | Bacteria | 3149 |
| 613 | Ga0495581_0431231 | 3300047315 | Bacteria | 768 |
| 614 | Ga0495636_0313305 | 3300047318 | Bacteria | 736 |
| 615 | Ga0495636_0442684 | 3300047318 | Bacteria | 623 |
| 616 | Ga0495672_0084529 | 3300047320 | Bacteria | 1760 |
| 617 | Ga0495672_0231428 | 3300047320 | Bacteria | 907 |
| 618 | Ga0495672_0232039 | 3300047320 | Bacteria | 905 |
| 619 | Ga0495672_0340494 | 3300047320 | Bacteria | 699 |
| 620 | Ga0495676_0038104 | 3300047321 | Bacteria | 3996 |
| 621 | Ga0495676_0091373 | 3300047321 | Bacteria | 2276 |
| 622 | Ga0495676_0486011 | 3300047321 | Bacteria | 812 |
| 623 | Ga0495683_0141427 | 3300047323 | Bacteria | 1127 |
| 624 | Ga0495683_0212261 | 3300047323 | Bacteria | 867 |
| 625 | Ga0495677_0012469 | 3300047445 | Bacteria | 3100 |
| 626 | Ga0495677_0262739 | 3300047445 | Bacteria | 676 |
| 627 | Ga0495673_0119325 | 3300047469 | Bacteria | 1046 |
| 628 | Ga0495673_0335321 | 3300047469 | Bacteria | 536 |
| 629 | Ga0495681_0107394 | 3300047470 | Bacteria | 1213 |
| 630 | Ga0495686_0134109 | 3300047472 | Bacteria | 1466 |
| 631 | Ga0495686_0162470 | 3300047472 | Bacteria | 1304 |
| 632 | Ga0495593_0051110 | 3300047673 | Bacteria | 2188 |
| 633 | Ga0495602_0415451 | 3300048088 | Bacteria | 956 |
| 634 | Ga0495615_0096012 | 3300048090 | Bacteria | 832 |
| 635 | Ga0495626_0083104 | 3300048091 | Bacteria | 1419 |
| 636 | Ga0496100_0244255 | 3300048903 | Bacteria | 1326 |
| 637 | Ga0496100_0400348 | 3300048903 | Bacteria | 1045 |
| 638 | Ga0496100_0490392 | 3300048903 | Bacteria | 946 |
| 639 | Ga0496101_0251839 | 3300048904 | Bacteria | 1376 |
| 640 | Ga0496101_0279729 | 3300048904 | Bacteria | 1304 |
| 641 | Ga0496102_0040343 | 3300048905 | Bacteria | 4222 |
| 642 | Ga0496102_0236607 | 3300048905 | Bacteria | 1722 |
| 643 | Ga0496102_0328645 | 3300048905 | Bacteria | 1440 |
| 644 | Ga0496102_0475381 | 3300048905 | Bacteria | 1171 |
| 645 | Ga0496102_0532199 | 3300048905 | Bacteria | 1098 |
| 646 | Ga0496102_0548722 | 3300048905 | Bacteria | 1079 |
| 647 | Ga0496102_0804442 | 3300048905 | Bacteria | 862 |
| 648 | Ga0496103_0515679 | 3300048906 | Bacteria | 764 |
| 649 | Ga0496104_0179386 | 3300048907 | Bacteria | 2028 |
| 650 | Ga0496104_0802006 | 3300048907 | Bacteria | 848 |
| 651 | Ga0496104_1054754 | 3300048907 | Bacteria | 716 |
| 652 | Ga0496105_0022258 | 3300048908 | Bacteria | 5133 |
| 653 | Ga0496105_0261668 | 3300048908 | Bacteria | 1399 |
| 654 | Ga0496105_1226346 | 3300048908 | Bacteria | 551 |
| 655 | Ga0496106_0132428 | 3300048909 | Bacteria | 1956 |
| 656 | Ga0496106_0159983 | 3300048909 | Bacteria | 1781 |
| 657 | Ga0496106_0172367 | 3300048909 | Bacteria | 1715 |
| 658 | Ga0496106_0516883 | 3300048909 | Bacteria | 959 |
| 659 | Ga0496106_1031002 | 3300048909 | Bacteria | 646 |
| 660 | Ga0496107_0050553 | 3300048910 | Bacteria | 2996 |
| 661 | Ga0496107_0185277 | 3300048910 | Bacteria | 1546 |
| 662 | Ga0496108_0041652 | 3300048911 | Bacteria | 3834 |
| 663 | Ga0496108_0069035 | 3300048911 | Bacteria | 2982 |
| 664 | Ga0496108_0127359 | 3300048911 | Bacteria | 2187 |
| 665 | Ga0496109_0002712 | 3300048912 | Bacteria | 14835 |
| 666 | Ga0496109_0268167 | 3300048912 | Bacteria | 1608 |
| 667 | Ga0496109_0846522 | 3300048912 | Bacteria | 852 |
| 668 | Ga0496109_1161348 | 3300048912 | Bacteria | 709 |
| 669 | Ga0496110_0047989 | 3300048913 | Bacteria | 3741 |
| 670 | Ga0496110_0296914 | 3300048913 | Bacteria | 1472 |
| 671 | Ga0496110_0652449 | 3300048913 | Bacteria | 952 |
| 672 | Ga0496111_0369912 | 3300048914 | Bacteria | 1060 |
| 673 | Ga0496111_0660527 | 3300048914 | Bacteria | 762 |
| 674 | Ga0496111_0888610 | 3300048914 | Bacteria | 642 |
| 675 | Ga0496112_0385209 | 3300048915 | Bacteria | 1343 |
| 676 | Ga0496112_0503882 | 3300048915 | Bacteria | 1146 |
| 677 | Ga0496113_0042931 | 3300048916 | Bacteria | 3343 |
| 678 | Ga0496113_0156425 | 3300048916 | Bacteria | 1800 |
| 679 | Ga0496113_1062269 | 3300048916 | Bacteria | 636 |
| 680 | Ga0496114_0017279 | 3300048917 | Bacteria | 5821 |
| 681 | Ga0496115_0000662 | 3300048918 | Bacteria | 25511 |
| 682 | Ga0496115_0016859 | 3300048918 | Bacteria | 5571 |
| 683 | Ga0496115_0350908 | 3300048918 | Bacteria | 1203 |
| 684 | Ga0496115_0474670 | 3300048918 | Bacteria | 1008 |
| 685 | Ga0496116_0004324 | 3300048919 | Bacteria | 13589 |
| 686 | Ga0496116_0136526 | 3300048919 | Bacteria | 1388 |
| 687 | Ga0496116_0156431 | 3300048919 | Bacteria | 1257 |
| 688 | Ga0496117_0217647 | 3300048920 | Bacteria | 1065 |
| 689 | Ga0496118_0340515 | 3300048921 | Bacteria | 804 |
| 690 | Ga0496118_0506131 | 3300048921 | Bacteria | 599 |
| 691 | Ga0496119_0065422 | 3300048922 | Bacteria | 2153 |
| 692 | Ga0496120_0037891 | 3300048923 | Bacteria | 2857 |
| 693 | Ga0496120_0286356 | 3300048923 | Bacteria | 760 |
| 694 | Ga0496121_0009292 | 3300048924 | Bacteria | 11341 |
| 695 | Ga0496121_0014683 | 3300048924 | Bacteria | 8280 |
| 696 | Ga0496121_0068498 | 3300048924 | Bacteria | 2870 |
| 697 | Ga0496121_0070812 | 3300048924 | Bacteria | 2807 |
| 698 | Ga0496121_0077018 | 3300048924 | Bacteria | 2657 |
| 699 | Ga0496121_0173020 | 3300048924 | Bacteria | 1566 |
| 700 | Ga0496122_0236731 | 3300048925 | Bacteria | 1033 |
| 701 | Ga0496124_0038084 | 3300048927 | Bacteria | 4177 |
| 702 | Ga0496124_0136750 | 3300048927 | Bacteria | 1939 |
| 703 | Ga0496124_0322025 | 3300048927 | Bacteria | 1106 |
| 704 | Ga0496125_0000576 | 3300048928 | Bacteria | 62844 |
| 705 | Ga0496125_0003062 | 3300048928 | Bacteria | 20888 |
| 706 | Ga0496125_0019247 | 3300048928 | Bacteria | 6447 |
| 707 | Ga0496125_0024760 | 3300048928 | Bacteria | 5512 |
| 708 | Ga0496125_0162397 | 3300048928 | Bacteria | 1515 |
| 709 | Ga0496126_0010315 | 3300048929 | Bacteria | 9808 |
| 710 | Ga0496126_0251532 | 3300048929 | Bacteria | 1472 |
| 711 | Ga0496126_0252521 | 3300048929 | Bacteria | 1469 |
| 712 | Ga0496126_0268499 | 3300048929 | Bacteria | 1416 |
| 713 | Ga0496126_0637230 | 3300048929 | Bacteria | 835 |
| 714 | Ga0496126_0811190 | 3300048929 | Bacteria | 717 |
| 715 | Ga0496126_0838694 | 3300048929 | Bacteria | 702 |
| 716 | Ga0496126_0960773 | 3300048929 | Bacteria | 644 |
| 717 | Ga0495678_053345 | 3300049459 | Bacteria | 1553 |
| 718 | Ga0495678_150195 | 3300049459 | Bacteria | 753 |
| 719 | Ga0501033_0281497 | 3300049570 | Bacteria | 1174 |
| 720 | Ga0501036_0032225 | 3300049572 | Bacteria | 4428 |
| 721 | Ga0501039_0359995 | 3300049575 | Bacteria | 1143 |
| 722 | Ga0501040_0421166 | 3300049576 | Bacteria | 960 |
| 723 | Ga0501042_0207474 | 3300049578 | Bacteria | 1413 |
| 724 | Ga0501042_0416929 | 3300049578 | Bacteria | 973 |
| 725 | Ga0501067_0097450 | 3300049583 | Bacteria | 1633 |
| 726 | Ga0501067_0229794 | 3300049583 | Bacteria | 1033 |
| 727 | Ga0501067_0793314 | 3300049583 | Bacteria | 533 |
| 728 | Ga0501068_0709982 | 3300049584 | Bacteria | 658 |
| 729 | Ga0501069_0266049 | 3300049585 | Bacteria | 1002 |
| 730 | Ga0501075_0904345 | 3300049591 | Bacteria | 671 |
| 731 | Ga0501076_0081846 | 3300049592 | Bacteria | 2592 |
| 732 | Ga0501079_0509766 | 3300049741 | Bacteria | 946 |
| 733 | nmdc:mga03683_216634_c1 | 3300050489 | Bacteria | 882 |
| 734 | nmdc:mga03683_30311_c1 | 3300050489 | Bacteria | 2164 |
| 735 | nmdc:mga03683_60875_c1 | 3300050489 | Bacteria | 1595 |
| 736 | nmdc:mga03n38_218285_c1 | 3300050490 | Bacteria | 994 |
| 737 | nmdc:mga03n38_4900_c1 | 3300050490 | Bacteria | 4490 |
| 738 | nmdc:mga03n38_509678_c1 | 3300050490 | Bacteria | 676 |
| 739 | nmdc:mga03n38_87872_c1 | 3300050490 | Bacteria | 1474 |
| 740 | nmdc:mga00v17_25959_c1 | 3300050491 | Bacteria | 3408 |
| 741 | nmdc:mga00v17_275865_c1 | 3300050491 | Bacteria | 1091 |
| 742 | nmdc:mga00v17_33232_c1 | 3300050491 | Bacteria | 3055 |
| 743 | nmdc:mga00v17_493727_c1 | 3300050491 | Bacteria | 794 |
| 744 | nmdc:mga00v17_67499_c1 | 3300050491 | Bacteria | 2210 |
| 745 | nmdc:mga0yw44_110728_c1 | 3300050492 | Bacteria | 1759 |
| 746 | nmdc:mga0yw44_53352_c1 | 3300050492 | Bacteria | 2455 |
| 747 | nmdc:mga0yw44_534557_c1 | 3300050492 | Bacteria | 796 |
| 748 | nmdc:mga0yw44_67134_c1 | 3300050492 | Bacteria | 2216 |
| 749 | nmdc:mga0k408_172468_c1 | 3300050493 | Bacteria | 1289 |
| 750 | nmdc:mga0k408_17739_c1 | 3300050493 | Bacteria | 3967 |
| 751 | nmdc:mga0k408_364905_c1 | 3300050493 | Bacteria | 861 |
| 752 | nmdc:mga0k408_48985_c1 | 3300050493 | Bacteria | 2446 |
| 753 | nmdc:mga06z11_46391_c1 | 3300050494 | Bacteria | 2202 |
| 754 | nmdc:mga06z11_86090_c1 | 3300050494 | Bacteria | 1697 |
| 755 | nmdc:mga06z11_95459_c1 | 3300050494 | Bacteria | 1622 |
| 756 | nmdc:mga04h51_271546_c1 | 3300050495 | Bacteria | 685 |
| 757 | nmdc:mga04h51_4863_c1 | 3300050495 | Bacteria | 3379 |
| 758 | nmdc:mga07m45_1133_c1 | 3300050496 | Bacteria | 11961 |
| 759 | nmdc:mga07m45_127438_c1 | 3300050496 | Bacteria | 1472 |
| 760 | nmdc:mga07m45_63401_c1 | 3300050496 | Bacteria | 2096 |
| 761 | nmdc:mga07m45_8538_c1 | 3300050496 | Bacteria | 5270 |
| 762 | nmdc:mga05p37_98773_c2 | 3300050507 | Bacteria | 2993 |
| 763 | nmdc:mga0qj67_852783_c1 | 3300050509 | Bacteria | 719 |
| 764 | nmdc:mga08y16_167333_c1 | 3300050511 | Bacteria | 2284 |
| 765 | nmdc:mga0n895_749391_c1 | 3300050512 | Bacteria | 970 |
| 766 | nmdc:mga0rr50_87656_c1 | 3300050513 | Bacteria | 2416 |
| 767 | nmdc:mga0sz30_127066_c1 | 3300050516 | Bacteria | 1122 |
| 768 | nmdc:mga0sz30_33621_c1 | 3300050516 | Bacteria | 2132 |
| 769 | nmdc:mga0sz30_5727_c1 | 3300050516 | Bacteria | 4573 |
| 770 | Ga0495601_0775270 | 3300053077 | Bacteria | 609 |
| 771 | Ga0500610_0372451 | 3300053079 | Bacteria | 594 |
| 772 | Ga0500578_0086215 | 3300053086 | Bacteria | 1995 |
| 773 | Ga0500643_015303 | 3300053087 | Bacteria | 2634 |
| 774 | Ga0500644_0038537 | 3300053088 | Bacteria | 1569 |
| 775 | Ga0500581_095248 | 3300053089 | Bacteria | 1469 |
| 776 | Ga0500646_0005472 | 3300053090 | Bacteria | 3211 |
| 777 | Ga0500583_0094821 | 3300053092 | Bacteria | 1455 |
| 778 | Ga0500651_0083111 | 3300053093 | Bacteria | 1981 |
| 779 | Ga0500651_0200773 | 3300053093 | Bacteria | 1176 |
| 780 | Ga0500566_0001694 | 3300053094 | Bacteria | 12936 |
| 781 | Ga0500641_0012293 | 3300053096 | Bacteria | 3125 |
| 782 | Ga0500641_0080652 | 3300053096 | Bacteria | 1380 |
| 783 | Ga0500650_0026706 | 3300053098 | Bacteria | 2592 |
| 784 | Ga0500555_058223 | 3300053103 | Bacteria | 1044 |
| 785 | Ga0500556_0000045 | 3300053104 | Bacteria | 130653 |
| 786 | Ga0500556_0055793 | 3300053104 | Bacteria | 1442 |
| 787 | Ga0500557_020503 | 3300053105 | Bacteria | 1882 |
| 788 | Ga0500562_040758 | 3300053108 | Bacteria | 1234 |
| 789 | Ga0500562_064114 | 3300053108 | Bacteria | 988 |
| 790 | Ga0500569_002140 | 3300053109 | Bacteria | 3844 |
| 791 | Ga0500569_118019 | 3300053109 | Bacteria | 881 |
| 792 | Ga0500592_001228 | 3300053116 | Bacteria | 4180 |
| 793 | Ga0500594_0016895 | 3300053118 | Bacteria | 1779 |
| 794 | Ga0500594_0027480 | 3300053118 | Bacteria | 1474 |
| 795 | Ga0500594_0045206 | 3300053118 | Bacteria | 1221 |
| 796 | Ga0500595_001792 | 3300053119 | Bacteria | 11171 |
| 797 | Ga0500595_036921 | 3300053119 | Bacteria | 1597 |
| 798 | Ga0500607_118597 | 3300053121 | Bacteria | 1284 |
| 799 | Ga0500608_000258 | 3300053122 | Bacteria | 20723 |
| 800 | Ga0500618_003686 | 3300053125 | Bacteria | 5169 |
| 801 | Ga0500621_043972 | 3300053126 | Bacteria | 1806 |
| 802 | Ga0500628_106102 | 3300053129 | Bacteria | 749 |
| 803 | Ga0500642_0000024 | 3300053130 | Bacteria | 134373 |
| 804 | Ga0500642_0186978 | 3300053130 | Bacteria | 967 |
| 805 | Ga0500642_0196556 | 3300053130 | Bacteria | 940 |
| 806 | Ga0500652_000243 | 3300053131 | Bacteria | 20537 |
| 807 | Ga0500655_086095 | 3300053133 | Bacteria | 650 |
| 808 | Ga0500658_0063954 | 3300053134 | Bacteria | 1537 |
| 809 | Ga0500658_0399763 | 3300053134 | Bacteria | 629 |
| 810 | Ga0500559_0000051 | 3300053136 | Bacteria | 91468 |
| 811 | Ga0500568_0004461 | 3300053139 | Bacteria | 7475 |
| 812 | Ga0500568_0007981 | 3300053139 | Bacteria | 5139 |
| 813 | Ga0500577_0000206 | 3300053142 | Bacteria | 15624 |
| 814 | Ga0500577_0201678 | 3300053142 | Bacteria | 858 |
| 815 | Ga0500586_001434 | 3300053145 | Bacteria | 5025 |
| 816 | Ga0500588_0058542 | 3300053146 | Bacteria | 1227 |
| 817 | Ga0500588_0064459 | 3300053146 | Bacteria | 1184 |
| 818 | Ga0500589_222608 | 3300053147 | Bacteria | 710 |
| 819 | Ga0500604_0039514 | 3300053151 | Bacteria | 1419 |
| 820 | Ga0500616_0000054 | 3300053153 | Bacteria | 290186 |
| 821 | Ga0500616_0174836 | 3300053153 | Bacteria | 972 |
| 822 | Ga0500622_0011897 | 3300053156 | Bacteria | 4730 |
| 823 | Ga0500624_051840 | 3300053157 | Bacteria | 765 |
| 824 | Ga0500627_0073841 | 3300053158 | Bacteria | 1513 |
| 825 | Ga0500627_0106682 | 3300053158 | Bacteria | 1259 |
| 826 | Ga0500633_0086631 | 3300053160 | Bacteria | 1139 |
| 827 | Ga0500633_0142048 | 3300053160 | Bacteria | 899 |
| 828 | Ga0500633_0198603 | 3300053160 | Bacteria | 751 |
| 829 | Ga0500634_0017025 | 3300053161 | Bacteria | 3887 |
| 830 | Ga0500634_0061817 | 3300053161 | Bacteria | 1985 |
| 831 | Ga0500634_0185350 | 3300053161 | Bacteria | 931 |
| 832 | Ga0500638_101381 | 3300053162 | Bacteria | 1342 |
| 833 | Ga0500636_0000249 | 3300053177 | Bacteria | 29583 |
| 834 | Ga0500637_0205050 | 3300053178 | Bacteria | 1121 |
| 835 | Ga0500637_0240308 | 3300053178 | Bacteria | 1015 |
| 836 | Ga0500570_056815 | 3300053724 | Bacteria | 1924 |
| 837 | Ga0500611_003674 | 3300053727 | Bacteria | 1993 |
| 838 | Ga0500611_008796 | 3300053727 | Bacteria | 1576 |
| 839 | Ga0500645_017731 | 3300053730 | Bacteria | 2227 |
| 840 | Ga0500645_021151 | 3300053730 | Bacteria | 2009 |
| 841 | Ga0500645_049014 | 3300053730 | Bacteria | 1236 |
| 842 | Ga0500645_133957 | 3300053730 | Bacteria | 687 |
| 843 | Ga0500609_033089 | 3300053731 | Bacteria | 712 |
| 844 | Ga0500596_006873 | 3300053735 | Bacteria | 1892 |
| 845 | Ga0501084_0400018 | 3300054114 | Bacteria | 1161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2602042107 | 2603860532 | 139 |
| 2 | iso_pu_bacteria | 2857524615 | 2857525487 | 139 |
| 3 | iso_pu_bacteria | 2893066018 | 2893070864 | 139 |
| 4 | iso_pu_bacteria | 2919073203 | 2919074703 | 139 |
| 5 | 3300048929 | Ga0496126_0960773 | Ga0496126_0960773_45_476 | 141 |
| 6 | 3300053121 | Ga0500607_118597 | Ga0500607_118597_380_826 | 141 |
| 7 | 3300053142 | Ga0500577_0000206 | Ga0500577_0000206_6143_6571 | 141 |
| 8 | iso_pu_bacteria | 2922361189 | 2922363462 | 141 |
| 9 | iso_pu_bacteria | 2922386360 | 2922389578 | 141 |
| 10 | 3300031911 | Ga0307412_10288119 | Ga0307412_102881192 | 142 |
| 11 | 3300048925 | Ga0496122_0236731 | Ga0496122_0236731_592_1023 | 142 |
| 12 | 3300048928 | Ga0496125_0000576 | Ga0496125_0000576_60474_60905 | 142 |
| 13 | 3300048928 | Ga0496125_0003062 | Ga0496125_0003062_8832_9263 | 142 |
| 14 | 3300005435 | Ga0070714_100366282 | Ga0070714_1003662822 | 143 |
| 15 | 3300005455 | Ga0070663_100031087 | Ga0070663_1000310875 | 143 |
| 16 | 3300005548 | Ga0070665_100554975 | Ga0070665_1005549752 | 143 |
| 17 | 3300006038 | Ga0075365_10597478 | Ga0075365_105974781 | 143 |
| 18 | 3300006038 | Ga0075365_10971962 | Ga0075365_109719622 | 143 |
| 19 | 3300006048 | Ga0075363_100075676 | Ga0075363_1000756762 | 143 |
| 20 | 3300006051 | Ga0075364_10019872 | Ga0075364_100198725 | 143 |
| 21 | 3300006186 | Ga0075369_10015343 | Ga0075369_100153433 | 143 |
| 22 | 3300006353 | Ga0075370_10103015 | Ga0075370_101030152 | 143 |
| 23 | 3300025295 | Ga0209564_1023084 | Ga0209564_10230843 | 143 |
| 24 | 3300025929 | Ga0207664_10786941 | Ga0207664_107869412 | 143 |
| 25 | 3300026067 | Ga0207678_10005268 | Ga0207678_100052687 | 143 |
| 26 | 3300028794 | Ga0307515_10254822 | Ga0307515_102548222 | 143 |
| 27 | 3300041452 | Ga0451793_0458310 | Ga0451793_0458310_32_469 | 143 |
| 28 | 3300041460 | Ga0451802_2127802 | Ga0451802_2127802_26_463 | 143 |
| 29 | 3300046460 | Ga0495638_0147794 | Ga0495638_0147794_725_1162 | 143 |
| 30 | 3300046500 | Ga0495596_0053833 | Ga0495596_0053833_1049_1486 | 143 |
| 31 | 3300046501 | Ga0495607_0055266 | Ga0495607_0055266_1417_1854 | 143 |
| 32 | 3300046506 | Ga0495583_0055586 | Ga0495583_0055586_1329_1766 | 143 |
| 33 | 3300046507 | Ga0495606_0165192 | Ga0495606_0165192_478_915 | 143 |
| 34 | 3300046512 | Ga0495610_0025158 | Ga0495610_0025158_1209_1646 | 143 |
| 35 | 3300046513 | Ga0495616_0021245 | Ga0495616_0021245_1168_1605 | 143 |
| 36 | 3300046515 | Ga0495620_0012556 | Ga0495620_0012556_1147_1584 | 143 |
| 37 | 3300046518 | Ga0495631_0082536 | Ga0495631_0082536_890_1327 | 143 |
| 38 | 3300046519 | Ga0495632_0146198 | Ga0495632_0146198_411_848 | 143 |
| 39 | 3300046520 | Ga0495637_0106273 | Ga0495637_0106273_343_780 | 143 |
| 40 | 3300046522 | Ga0495643_0220586 | Ga0495643_0220586_94_531 | 143 |
| 41 | 3300046524 | Ga0495648_0003972 | Ga0495648_0003972_4854_5291 | 143 |
| 42 | 3300046524 | Ga0495648_0062800 | Ga0495648_0062800_272_709 | 143 |
| 43 | 3300046530 | Ga0495654_0081580 | Ga0495654_0081580_687_1124 | 143 |
| 44 | 3300046542 | Ga0495597_0043930 | Ga0495597_0043930_909_1346 | 143 |
| 45 | 3300046557 | Ga0495622_0019041 | Ga0495622_0019041_2595_3032 | 143 |
| 46 | 3300046616 | Ga0495668_0077805 | Ga0495668_0077805_927_1364 | 143 |
| 47 | 3300046648 | Ga0495611_0073397 | Ga0495611_0073397_325_756 | 143 |
| 48 | 3300046660 | Ga0495625_0186023 | Ga0495625_0186023_729_1166 | 143 |
| 49 | 3300046665 | Ga0495661_0055606 | Ga0495661_0055606_1488_1925 | 143 |
| 50 | 3300046674 | Ga0495588_0063262 | Ga0495588_0063262_630_1067 | 143 |
| 51 | 3300046691 | Ga0495670_0041394 | Ga0495670_0041394_1605_2042 | 143 |
| 52 | 3300046692 | Ga0495671_0016018 | Ga0495671_0016018_2579_3016 | 143 |
| 53 | 3300046810 | Ga0495660_0028579 | Ga0495660_0028579_1463_1900 | 143 |
| 54 | 3300047320 | Ga0495672_0084529 | Ga0495672_0084529_1082_1519 | 143 |
| 55 | 3300047323 | Ga0495683_0212261 | Ga0495683_0212261_213_650 | 143 |
| 56 | 3300047469 | Ga0495673_0119325 | Ga0495673_0119325_380_817 | 143 |
| 57 | 3300047470 | Ga0495681_0107394 | Ga0495681_0107394_758_1195 | 143 |
| 58 | 3300048088 | Ga0495602_0415451 | Ga0495602_0415451_461_898 | 143 |
| 59 | 3300048091 | Ga0495626_0083104 | Ga0495626_0083104_660_1097 | 143 |
| 60 | 3300048903 | Ga0496100_0244255 | Ga0496100_0244255_540_977 | 143 |
| 61 | 3300048905 | Ga0496102_0236607 | Ga0496102_0236607_364_801 | 143 |
| 62 | 3300048909 | Ga0496106_0132428 | Ga0496106_0132428_468_905 | 143 |
| 63 | 3300048919 | Ga0496116_0004324 | Ga0496116_0004324_12800_13237 | 143 |
| 64 | 3300048919 | Ga0496116_0156431 | Ga0496116_0156431_273_710 | 143 |
| 65 | 3300048920 | Ga0496117_0217647 | Ga0496117_0217647_28_465 | 143 |
| 66 | 3300048922 | Ga0496119_0065422 | Ga0496119_0065422_80_517 | 143 |
| 67 | 3300048923 | Ga0496120_0037891 | Ga0496120_0037891_1760_2197 | 143 |
| 68 | 3300048924 | Ga0496121_0009292 | Ga0496121_0009292_4998_5435 | 143 |
| 69 | 3300048924 | Ga0496121_0014683 | Ga0496121_0014683_3559_3996 | 143 |
| 70 | 3300048927 | Ga0496124_0322025 | Ga0496124_0322025_573_1010 | 143 |
| 71 | 3300048928 | Ga0496125_0019247 | Ga0496125_0019247_73_510 | 143 |
| 72 | 3300048928 | Ga0496125_0024760 | Ga0496125_0024760_73_510 | 143 |
| 73 | 3300049459 | Ga0495678_053345 | Ga0495678_053345_73_510 | 143 |
| 74 | 3300050492 | nmdc:mga0yw44_53352_c1 | nmdc:mga0yw44_53352_c1_212_649 | 143 |
| 75 | 3300050492 | nmdc:mga0yw44_67134_c1 | nmdc:mga0yw44_67134_c1_852_1289 | 143 |
| 76 | 3300050496 | nmdc:mga07m45_127438_c1 | nmdc:mga07m45_127438_c1_719_1156 | 143 |
| 77 | 3300050516 | nmdc:mga0sz30_5727_c1 | nmdc:mga0sz30_5727_c1_2054_2491 | 143 |
| 78 | 3300053086 | Ga0500578_0086215 | Ga0500578_0086215_1355_1792 | 143 |
| 79 | 3300053087 | Ga0500643_015303 | Ga0500643_015303_1629_2066 | 143 |
| 80 | 3300053088 | Ga0500644_0038537 | Ga0500644_0038537_445_882 | 143 |
| 81 | 3300053089 | Ga0500581_095248 | Ga0500581_095248_437_874 | 143 |
| 82 | 3300053090 | Ga0500646_0005472 | Ga0500646_0005472_2031_2468 | 143 |
| 83 | 3300053093 | Ga0500651_0083111 | Ga0500651_0083111_204_641 | 143 |
| 84 | 3300053093 | Ga0500651_0200773 | Ga0500651_0200773_497_934 | 143 |
| 85 | 3300053094 | Ga0500566_0001694 | Ga0500566_0001694_5625_6062 | 143 |
| 86 | 3300053096 | Ga0500641_0012293 | Ga0500641_0012293_1874_2311 | 143 |
| 87 | 3300053098 | Ga0500650_0026706 | Ga0500650_0026706_1261_1698 | 143 |
| 88 | 3300053104 | Ga0500556_0000045 | Ga0500556_0000045_97077_97514 | 143 |
| 89 | 3300053105 | Ga0500557_020503 | Ga0500557_020503_265_702 | 143 |
| 90 | 3300053108 | Ga0500562_040758 | Ga0500562_040758_189_626 | 143 |
| 91 | 3300053109 | Ga0500569_002140 | Ga0500569_002140_447_884 | 143 |
| 92 | 3300053116 | Ga0500592_001228 | Ga0500592_001228_1661_2098 | 143 |
| 93 | 3300053118 | Ga0500594_0016895 | Ga0500594_0016895_978_1415 | 143 |
| 94 | 3300053122 | Ga0500608_000258 | Ga0500608_000258_11774_12211 | 143 |
| 95 | 3300053125 | Ga0500618_003686 | Ga0500618_003686_1631_2068 | 143 |
| 96 | 3300053126 | Ga0500621_043972 | Ga0500621_043972_494_931 | 143 |
| 97 | 3300053130 | Ga0500642_0000024 | Ga0500642_0000024_100983_101420 | 143 |
| 98 | 3300053131 | Ga0500652_000243 | Ga0500652_000243_10119_10556 | 143 |
| 99 | 3300053133 | Ga0500655_086095 | Ga0500655_086095_119_556 | 143 |
| 100 | 3300053134 | Ga0500658_0063954 | Ga0500658_0063954_535_972 | 143 |
| 101 | 3300053136 | Ga0500559_0000051 | Ga0500559_0000051_16489_16926 | 143 |
| 102 | 3300053139 | Ga0500568_0007981 | Ga0500568_0007981_3192_3629 | 143 |
| 103 | 3300053142 | Ga0500577_0201678 | Ga0500577_0201678_189_626 | 143 |
| 104 | 3300053145 | Ga0500586_001434 | Ga0500586_001434_1950_2402 | 143 |
| 105 | 3300053146 | Ga0500588_0064459 | Ga0500588_0064459_189_626 | 143 |
| 106 | 3300053153 | Ga0500616_0000054 | Ga0500616_0000054_99995_100432 | 143 |
| 107 | 3300053156 | Ga0500622_0011897 | Ga0500622_0011897_4246_4683 | 143 |
| 108 | 3300053157 | Ga0500624_051840 | Ga0500624_051840_85_522 | 143 |
| 109 | 3300053158 | Ga0500627_0106682 | Ga0500627_0106682_559_996 | 143 |
| 110 | 3300053160 | Ga0500633_0086631 | Ga0500633_0086631_173_610 | 143 |
| 111 | 3300053161 | Ga0500634_0017025 | Ga0500634_0017025_1355_1792 | 143 |
| 112 | 3300053177 | Ga0500636_0000249 | Ga0500636_0000249_7274_7711 | 143 |
| 113 | 3300053178 | Ga0500637_0240308 | Ga0500637_0240308_296_733 | 143 |
| 114 | 3300053724 | Ga0500570_056815 | Ga0500570_056815_1282_1719 | 143 |
| 115 | 3300053727 | Ga0500611_008796 | Ga0500611_008796_39_476 | 143 |
| 116 | 3300053730 | Ga0500645_017731 | Ga0500645_017731_1570_2007 | 143 |
| 117 | 3300053730 | Ga0500645_049014 | Ga0500645_049014_424_861 | 143 |
| 118 | 3300053735 | Ga0500596_006873 | Ga0500596_006873_1070_1507 | 143 |
| 119 | iso_pu_bacteria | 2513237101 | 2513698539 | 143 |
| 120 | iso_pu_bacteria | 2721755755 | 2723848799 | 143 |
| 121 | iso_pu_bacteria | 2791355199 | 2793078803 | 143 |
| 122 | iso_pu_bacteria | 2874604998 | 2874606079 | 143 |
| 123 | iso_pu_bacteria | 2876808645 | 2876809151 | 143 |
| 124 | iso_pu_bacteria | 2879110137 | 2879116758 | 143 |
| 125 | iso_pu_bacteria | 2889033259 | 2889034421 | 143 |
| 126 | iso_pu_bacteria | 8006984368 | 8006986276 | 143 |
| 127 | iso_pu_bacteria | 8006994254 | 8006998951 | 143 |
| 128 | iso_pu_bacteria | 8056673599 | 8056675413 | 143 |
| 129 | 3300005343 | Ga0070687_101328605 | Ga0070687_1013286051 | 144 |
| 130 | 3300005356 | Ga0070674_100159655 | Ga0070674_1001596552 | 144 |
| 131 | 3300005456 | Ga0070678_100019954 | Ga0070678_1000199545 | 144 |
| 132 | 3300005543 | Ga0070672_100735015 | Ga0070672_1007350151 | 144 |
| 133 | 3300005544 | Ga0070686_100303713 | Ga0070686_1003037133 | 144 |
| 134 | 3300005615 | Ga0070702_100136524 | Ga0070702_1001365242 | 144 |
| 135 | 3300005718 | Ga0068866_10138234 | Ga0068866_101382342 | 144 |
| 136 | 3300006237 | Ga0097621_100036520 | Ga0097621_1000365205 | 144 |
| 137 | 3300006358 | Ga0068871_100344932 | Ga0068871_1003449323 | 144 |
| 138 | 3300006881 | Ga0068865_100045409 | Ga0068865_1000454092 | 144 |
| 139 | 3300009176 | Ga0105242_11089932 | Ga0105242_110899321 | 144 |
| 140 | 3300013297 | Ga0157378_10263661 | Ga0157378_102636612 | 144 |
| 141 | 3300013308 | Ga0157375_10079517 | Ga0157375_100795172 | 144 |
| 142 | 3300014326 | Ga0157380_10130927 | Ga0157380_101309272 | 144 |
| 143 | 3300014969 | Ga0157376_10043154 | Ga0157376_100431542 | 144 |
| 144 | 3300025918 | Ga0207662_11170361 | Ga0207662_111703612 | 144 |
| 145 | 3300025935 | Ga0207709_10892815 | Ga0207709_108928151 | 144 |
| 146 | 3300025938 | Ga0207704_10159868 | Ga0207704_101598683 | 144 |
| 147 | 3300025940 | Ga0207691_10686813 | Ga0207691_106868131 | 144 |
| 148 | 3300026121 | Ga0207683_10053503 | Ga0207683_100535032 | 144 |
| 149 | 3300046515 | Ga0495620_0268957 | Ga0495620_0268957_95_535 | 144 |
| 150 | 3300048904 | Ga0496101_0279729 | Ga0496101_0279729_826_1266 | 144 |
| 151 | 3300005334 | Ga0068869_100045470 | Ga0068869_1000454702 | 145 |
| 152 | 3300005338 | Ga0068868_100190391 | Ga0068868_1001903913 | 145 |
| 153 | 3300005353 | Ga0070669_100217204 | Ga0070669_1002172042 | 145 |
| 154 | 3300005356 | Ga0070674_100450125 | Ga0070674_1004501251 | 145 |
| 155 | 3300005456 | Ga0070678_100063923 | Ga0070678_1000639232 | 145 |
| 156 | 3300005457 | Ga0070662_100506194 | Ga0070662_1005061942 | 145 |
| 157 | 3300005543 | Ga0070672_100217030 | Ga0070672_1002170303 | 145 |
| 158 | 3300005617 | Ga0068859_100100705 | Ga0068859_1001007052 | 145 |
| 159 | 3300005618 | Ga0068864_100546839 | Ga0068864_1005468392 | 145 |
| 160 | 3300005844 | Ga0068862_100395734 | Ga0068862_1003957342 | 145 |
| 161 | 3300005844 | Ga0068862_100401407 | Ga0068862_1004014072 | 145 |
| 162 | 3300005983 | Ga0081540_1007330 | Ga0081540_10073306 | 145 |
| 163 | 3300006038 | Ga0075365_10435751 | Ga0075365_104357513 | 145 |
| 164 | 3300006178 | Ga0075367_10155032 | Ga0075367_101550322 | 145 |
| 165 | 3300006178 | Ga0075367_10714339 | Ga0075367_107143391 | 145 |
| 166 | 3300006195 | Ga0075366_10107576 | Ga0075366_101075764 | 145 |
| 167 | 3300006195 | Ga0075366_10943511 | Ga0075366_109435111 | 145 |
| 168 | 3300006353 | Ga0075370_10014094 | Ga0075370_100140944 | 145 |
| 169 | 3300006844 | Ga0075428_101205413 | Ga0075428_1012054131 | 145 |
| 170 | 3300006881 | Ga0068865_100427191 | Ga0068865_1004271911 | 145 |
| 171 | 3300006931 | Ga0097620_100100701 | Ga0097620_1001007015 | 145 |
| 172 | 3300009092 | Ga0105250_10270421 | Ga0105250_102704212 | 145 |
| 173 | 3300009101 | Ga0105247_10218098 | Ga0105247_102180982 | 145 |
| 174 | 3300009148 | Ga0105243_10346774 | Ga0105243_103467742 | 145 |
| 175 | 3300011119 | Ga0105246_10185559 | Ga0105246_101855592 | 145 |
| 176 | 3300013308 | Ga0157375_10654551 | Ga0157375_106545512 | 145 |
| 177 | 3300014325 | Ga0163163_11172445 | Ga0163163_111724452 | 145 |
| 178 | 3300014326 | Ga0157380_10220770 | Ga0157380_102207702 | 145 |
| 179 | 3300025907 | Ga0207645_10080213 | Ga0207645_100802132 | 145 |
| 180 | 3300025923 | Ga0207681_10892005 | Ga0207681_108920052 | 145 |
| 181 | 3300025933 | Ga0207706_11145341 | Ga0207706_111453411 | 145 |
| 182 | 3300025937 | Ga0207669_10693778 | Ga0207669_106937782 | 145 |
| 183 | 3300025938 | Ga0207704_10825391 | Ga0207704_108253911 | 145 |
| 184 | 3300025940 | Ga0207691_11112255 | Ga0207691_111122551 | 145 |
| 185 | 3300025942 | Ga0207689_10061642 | Ga0207689_100616425 | 145 |
| 186 | 3300025960 | Ga0207651_10581446 | Ga0207651_105814461 | 145 |
| 187 | 3300025972 | Ga0207668_10147450 | Ga0207668_101474503 | 145 |
| 188 | 3300026095 | Ga0207676_10379198 | Ga0207676_103791982 | 145 |
| 189 | 3300026118 | Ga0207675_100222513 | Ga0207675_1002225134 | 145 |
| 190 | 3300026121 | Ga0207683_10095110 | Ga0207683_100951102 | 145 |
| 191 | 3300028380 | Ga0268265_10226578 | Ga0268265_102265783 | 145 |
| 192 | 3300028380 | Ga0268265_10362348 | Ga0268265_103623482 | 145 |
| 193 | 3300028381 | Ga0268264_10056791 | Ga0268264_100567914 | 145 |
| 194 | 3300028794 | Ga0307515_10471896 | Ga0307515_104718962 | 145 |
| 195 | 3300031730 | Ga0307516_10120108 | Ga0307516_101201082 | 145 |
| 196 | 3300031901 | Ga0307406_10909904 | Ga0307406_109099042 | 145 |
| 197 | 3300031911 | Ga0307412_11927524 | Ga0307412_119275241 | 145 |
| 198 | 3300032002 | Ga0307416_100949353 | Ga0307416_1009493532 | 145 |
| 199 | 3300032005 | Ga0307411_11131720 | Ga0307411_111317202 | 145 |
| 200 | 3300037471 | Ga0395905_0446101 | Ga0395905_0446101_275_712 | 145 |
| 201 | 3300041460 | Ga0451802_1184584 | Ga0451802_1184584_315_752 | 145 |
| 202 | 3300045051 | Ga0451576_1134266 | Ga0451576_1134266_310_747 | 145 |
| 203 | 3300046476 | Ga0495662_0337457 | Ga0495662_0337457_81_524 | 145 |
| 204 | 3300046491 | Ga0495584_0128354 | Ga0495584_0128354_415_852 | 145 |
| 205 | 3300046491 | Ga0495584_0269295 | Ga0495584_0269295_196_633 | 145 |
| 206 | 3300046492 | Ga0495585_0033839 | Ga0495585_0033839_2252_2689 | 145 |
| 207 | 3300046492 | Ga0495585_0241584 | Ga0495585_0241584_409_846 | 145 |
| 208 | 3300046499 | Ga0495594_0080093 | Ga0495594_0080093_882_1319 | 145 |
| 209 | 3300046501 | Ga0495607_0142486 | Ga0495607_0142486_472_909 | 145 |
| 210 | 3300046506 | Ga0495583_0261356 | Ga0495583_0261356_70_507 | 145 |
| 211 | 3300046513 | Ga0495616_0424363 | Ga0495616_0424363_41_478 | 145 |
| 212 | 3300046523 | Ga0495644_0032891 | Ga0495644_0032891_1043_1480 | 145 |
| 213 | 3300046523 | Ga0495644_0034709 | Ga0495644_0034709_1311_1748 | 145 |
| 214 | 3300046524 | Ga0495648_0301955 | Ga0495648_0301955_296_733 | 145 |
| 215 | 3300046537 | Ga0495598_0026714 | Ga0495598_0026714_164_601 | 145 |
| 216 | 3300046538 | Ga0495609_0167607 | Ga0495609_0167607_376_813 | 145 |
| 217 | 3300046615 | Ga0495656_0016291 | Ga0495656_0016291_888_1325 | 145 |
| 218 | 3300046615 | Ga0495656_0085971 | Ga0495656_0085971_313_750 | 145 |
| 219 | 3300046664 | Ga0495659_0004408 | Ga0495659_0004408_3607_4044 | 145 |
| 220 | 3300046664 | Ga0495659_0006029 | Ga0495659_0006029_2934_3371 | 145 |
| 221 | 3300046674 | Ga0495588_0005668 | Ga0495588_0005668_3361_3798 | 145 |
| 222 | 3300046684 | Ga0495669_0086391 | Ga0495669_0086391_39_476 | 145 |
| 223 | 3300046684 | Ga0495669_0550258 | Ga0495669_0550258_82_519 | 145 |
| 224 | 3300047321 | Ga0495676_0038104 | Ga0495676_0038104_400_837 | 145 |
| 225 | 3300047445 | Ga0495677_0262739 | Ga0495677_0262739_31_468 | 145 |
| 226 | 3300048913 | Ga0496110_0652449 | Ga0496110_0652449_419_856 | 145 |
| 227 | 3300048924 | Ga0496121_0068498 | Ga0496121_0068498_811_1248 | 145 |
| 228 | 3300048927 | Ga0496124_0038084 | Ga0496124_0038084_312_749 | 145 |
| 229 | 3300048927 | Ga0496124_0136750 | Ga0496124_0136750_822_1259 | 145 |
| 230 | 3300048928 | Ga0496125_0162397 | Ga0496125_0162397_419_856 | 145 |
| 231 | 3300048929 | Ga0496126_0251532 | Ga0496126_0251532_617_1054 | 145 |
| 232 | 3300049583 | Ga0501067_0793314 | Ga0501067_0793314_68_505 | 145 |
| 233 | 3300050494 | nmdc:mga06z11_95459_c1 | nmdc:mga06z11_95459_c1_688_1125 | 145 |
| 234 | 3300050496 | nmdc:mga07m45_8538_c1 | nmdc:mga07m45_8538_c1_768_1205 | 145 |
| 235 | 3300053077 | Ga0495601_0775270 | Ga0495601_0775270_20_463 | 145 |
| 236 | 3300005344 | Ga0070661_100054292 | Ga0070661_1000542925 | 146 |
| 237 | 3300005539 | Ga0068853_100116417 | Ga0068853_1001164174 | 146 |
| 238 | 3300007788 | Ga0099795_10034510 | Ga0099795_100345103 | 146 |
| 239 | 3300009551 | Ga0105238_10274010 | Ga0105238_102740103 | 146 |
| 240 | 3300010375 | Ga0105239_10217198 | Ga0105239_102171982 | 146 |
| 241 | 3300025920 | Ga0207649_10049714 | Ga0207649_100497142 | 146 |
| 242 | 3300026041 | Ga0207639_10753875 | Ga0207639_107538752 | 146 |
| 243 | 3300026067 | Ga0207678_10060852 | Ga0207678_100608525 | 146 |
| 244 | 3300026142 | Ga0207698_10725526 | Ga0207698_107255262 | 146 |
| 245 | 3300031548 | Ga0307408_101122507 | Ga0307408_1011225071 | 146 |
| 246 | 3300031731 | Ga0307405_10152841 | Ga0307405_101528412 | 146 |
| 247 | 3300031731 | Ga0307405_10385865 | Ga0307405_103858652 | 146 |
| 248 | 3300031911 | Ga0307412_10676827 | Ga0307412_106768272 | 146 |
| 249 | 3300032002 | Ga0307416_100124842 | Ga0307416_1001248422 | 146 |
| 250 | 3300032002 | Ga0307416_100941318 | Ga0307416_1009413182 | 146 |
| 251 | 3300032126 | Ga0307415_100017971 | Ga0307415_1000179715 | 146 |
| 252 | 3300032126 | Ga0307415_100182077 | Ga0307415_1001820771 | 146 |
| 253 | 3300041453 | Ga0451797_0020094 | Ga0451797_0020094_91_531 | 146 |
| 254 | 3300041459 | Ga0451800_0637662 | Ga0451800_0637662_623_1063 | 146 |
| 255 | 3300001979 | JGI24740J21852_10050278 | JGI24740J21852_100502782 | 147 |
| 256 | 3300002077 | JGI24744J21845_10006024 | JGI24744J21845_100060242 | 147 |
| 257 | 3300003203 | JGI25406J46586_10088073 | JGI25406J46586_100880731 | 147 |
| 258 | 3300003215 | JGI25153J46596_10008126 | JGI25153J46596_100081261 | 147 |
| 259 | 3300003659 | JGI25404J52841_10004963 | JGI25404J52841_100049633 | 147 |
| 260 | 3300003659 | JGI25404J52841_10022179 | JGI25404J52841_100221793 | 147 |
| 261 | 3300003659 | JGI25404J52841_10034975 | JGI25404J52841_100349752 | 147 |
| 262 | 3300003659 | JGI25404J52841_10127105 | JGI25404J52841_101271051 | 147 |
| 263 | 3300004801 | Ga0058860_11735244 | Ga0058860_117352442 | 147 |
| 264 | 3300005327 | Ga0070658_10275339 | Ga0070658_102753392 | 147 |
| 265 | 3300005328 | Ga0070676_10027638 | Ga0070676_100276385 | 147 |
| 266 | 3300005328 | Ga0070676_10038958 | Ga0070676_100389582 | 147 |
| 267 | 3300005329 | Ga0070683_100670434 | Ga0070683_1006704342 | 147 |
| 268 | 3300005330 | Ga0070690_100025683 | Ga0070690_1000256835 | 147 |
| 269 | 3300005331 | Ga0070670_100376393 | Ga0070670_1003763932 | 147 |
| 270 | 3300005331 | Ga0070670_100676477 | Ga0070670_1006764771 | 147 |
| 271 | 3300005334 | Ga0068869_100047276 | Ga0068869_1000472763 | 147 |
| 272 | 3300005334 | Ga0068869_100073070 | Ga0068869_1000730702 | 147 |
| 273 | 3300005334 | Ga0068869_100075640 | Ga0068869_1000756401 | 147 |
| 274 | 3300005337 | Ga0070682_100112780 | Ga0070682_1001127801 | 147 |
| 275 | 3300005338 | Ga0068868_100124385 | Ga0068868_1001243852 | 147 |
| 276 | 3300005340 | Ga0070689_100061523 | Ga0070689_1000615232 | 147 |
| 277 | 3300005341 | Ga0070691_10312393 | Ga0070691_103123932 | 147 |
| 278 | 3300005344 | Ga0070661_100133003 | Ga0070661_1001330031 | 147 |
| 279 | 3300005344 | Ga0070661_100339723 | Ga0070661_1003397232 | 147 |
| 280 | 3300005347 | Ga0070668_100031383 | Ga0070668_1000313835 | 147 |
| 281 | 3300005347 | Ga0070668_100037566 | Ga0070668_1000375663 | 147 |
| 282 | 3300005347 | Ga0070668_100075725 | Ga0070668_1000757255 | 147 |
| 283 | 3300005347 | Ga0070668_100120847 | Ga0070668_1001208472 | 147 |
| 284 | 3300005347 | Ga0070668_100430157 | Ga0070668_1004301572 | 147 |
| 285 | 3300005347 | Ga0070668_100882624 | Ga0070668_1008826242 | 147 |
| 286 | 3300005353 | Ga0070669_100123379 | Ga0070669_1001233792 | 147 |
| 287 | 3300005354 | Ga0070675_100132272 | Ga0070675_1001322722 | 147 |
| 288 | 3300005354 | Ga0070675_100753638 | Ga0070675_1007536382 | 147 |
| 289 | 3300005355 | Ga0070671_100190666 | Ga0070671_1001906662 | 147 |
| 290 | 3300005355 | Ga0070671_100752084 | Ga0070671_1007520842 | 147 |
| 291 | 3300005356 | Ga0070674_100084725 | Ga0070674_1000847251 | 147 |
| 292 | 3300005356 | Ga0070674_101143058 | Ga0070674_1011430582 | 147 |
| 293 | 3300005364 | Ga0070673_100208162 | Ga0070673_1002081622 | 147 |
| 294 | 3300005364 | Ga0070673_100382712 | Ga0070673_1003827122 | 147 |
| 295 | 3300005364 | Ga0070673_100396559 | Ga0070673_1003965592 | 147 |
| 296 | 3300005365 | Ga0070688_100623186 | Ga0070688_1006231862 | 147 |
| 297 | 3300005366 | Ga0070659_100117021 | Ga0070659_1001170211 | 147 |
| 298 | 3300005366 | Ga0070659_100751301 | Ga0070659_1007513012 | 147 |
| 299 | 3300005366 | Ga0070659_101611929 | Ga0070659_1016119291 | 147 |
| 300 | 3300005367 | Ga0070667_100173516 | Ga0070667_1001735163 | 147 |
| 301 | 3300005367 | Ga0070667_100429823 | Ga0070667_1004298232 | 147 |
| 302 | 3300005367 | Ga0070667_100678186 | Ga0070667_1006781862 | 147 |
| 303 | 3300005438 | Ga0070701_10071178 | Ga0070701_100711783 | 147 |
| 304 | 3300005441 | Ga0070700_100194457 | Ga0070700_1001944573 | 147 |
| 305 | 3300005441 | Ga0070700_100585442 | Ga0070700_1005854422 | 147 |
| 306 | 3300005444 | Ga0070694_100563023 | Ga0070694_1005630232 | 147 |
| 307 | 3300005455 | Ga0070663_100003353 | Ga0070663_1000033537 | 147 |
| 308 | 3300005455 | Ga0070663_100030539 | Ga0070663_1000305392 | 147 |
| 309 | 3300005455 | Ga0070663_100072147 | Ga0070663_1000721472 | 147 |
| 310 | 3300005455 | Ga0070663_100079989 | Ga0070663_1000799892 | 147 |
| 311 | 3300005455 | Ga0070663_100211565 | Ga0070663_1002115652 | 147 |
| 312 | 3300005455 | Ga0070663_101167035 | Ga0070663_1011670351 | 147 |
| 313 | 3300005456 | Ga0070678_100002662 | Ga0070678_1000026626 | 147 |
| 314 | 3300005456 | Ga0070678_100812282 | Ga0070678_1008122822 | 147 |
| 315 | 3300005456 | Ga0070678_100883660 | Ga0070678_1008836602 | 147 |
| 316 | 3300005457 | Ga0070662_101796513 | Ga0070662_1017965131 | 147 |
| 317 | 3300005459 | Ga0068867_100099433 | Ga0068867_1000994332 | 147 |
| 318 | 3300005459 | Ga0068867_100278532 | Ga0068867_1002785322 | 147 |
| 319 | 3300005466 | Ga0070685_10278594 | Ga0070685_102785942 | 147 |
| 320 | 3300005467 | Ga0070706_100139022 | Ga0070706_1001390222 | 147 |
| 321 | 3300005467 | Ga0070706_100783928 | Ga0070706_1007839281 | 147 |
| 322 | 3300005518 | Ga0070699_100252574 | Ga0070699_1002525742 | 147 |
| 323 | 3300005536 | Ga0070697_101443611 | Ga0070697_1014436111 | 147 |
| 324 | 3300005539 | Ga0068853_100084299 | Ga0068853_1000842993 | 147 |
| 325 | 3300005539 | Ga0068853_100185189 | Ga0068853_1001851893 | 147 |
| 326 | 3300005539 | Ga0068853_101662964 | Ga0068853_1016629641 | 147 |
| 327 | 3300005543 | Ga0070672_100052132 | Ga0070672_1000521322 | 147 |
| 328 | 3300005544 | Ga0070686_100262875 | Ga0070686_1002628751 | 147 |
| 329 | 3300005545 | Ga0070695_100982499 | Ga0070695_1009824991 | 147 |
| 330 | 3300005547 | Ga0070693_100222809 | Ga0070693_1002228092 | 147 |
| 331 | 3300005548 | Ga0070665_100019653 | Ga0070665_1000196537 | 147 |
| 332 | 3300005548 | Ga0070665_100044982 | Ga0070665_1000449822 | 147 |
| 333 | 3300005548 | Ga0070665_100086641 | Ga0070665_1000866412 | 147 |
| 334 | 3300005548 | Ga0070665_100128711 | Ga0070665_1001287112 | 147 |
| 335 | 3300005548 | Ga0070665_100129397 | Ga0070665_1001293975 | 147 |
| 336 | 3300005548 | Ga0070665_100139127 | Ga0070665_1001391272 | 147 |
| 337 | 3300005548 | Ga0070665_100304679 | Ga0070665_1003046792 | 147 |
| 338 | 3300005564 | Ga0070664_100073611 | Ga0070664_1000736112 | 147 |
| 339 | 3300005564 | Ga0070664_100465490 | Ga0070664_1004654902 | 147 |
| 340 | 3300005577 | Ga0068857_100875200 | Ga0068857_1008752002 | 147 |
| 341 | 3300005578 | Ga0068854_100042601 | Ga0068854_1000426012 | 147 |
| 342 | 3300005578 | Ga0068854_100150499 | Ga0068854_1001504992 | 147 |
| 343 | 3300005578 | Ga0068854_100193499 | Ga0068854_1001934991 | 147 |
| 344 | 3300005614 | Ga0068856_100068900 | Ga0068856_1000689002 | 147 |
| 345 | 3300005615 | Ga0070702_100154534 | Ga0070702_1001545342 | 147 |
| 346 | 3300005616 | Ga0068852_101244731 | Ga0068852_1012447311 | 147 |
| 347 | 3300005617 | Ga0068859_100178572 | Ga0068859_1001785722 | 147 |
| 348 | 3300005617 | Ga0068859_100414848 | Ga0068859_1004148483 | 147 |
| 349 | 3300005618 | Ga0068864_100058560 | Ga0068864_1000585602 | 147 |
| 350 | 3300005618 | Ga0068864_100069127 | Ga0068864_1000691272 | 147 |
| 351 | 3300005618 | Ga0068864_101221454 | Ga0068864_1012214541 | 147 |
| 352 | 3300005718 | Ga0068866_10012487 | Ga0068866_100124872 | 147 |
| 353 | 3300005718 | Ga0068866_10013354 | Ga0068866_100133545 | 147 |
| 354 | 3300005719 | Ga0068861_100166031 | Ga0068861_1001660313 | 147 |
| 355 | 3300005719 | Ga0068861_100494325 | Ga0068861_1004943253 | 147 |
| 356 | 3300005719 | Ga0068861_100522610 | Ga0068861_1005226101 | 147 |
| 357 | 3300005834 | Ga0068851_10074088 | Ga0068851_100740883 | 147 |
| 358 | 3300005840 | Ga0068870_11290518 | Ga0068870_112905181 | 147 |
| 359 | 3300005841 | Ga0068863_100098680 | Ga0068863_1000986805 | 147 |
| 360 | 3300005841 | Ga0068863_100684414 | Ga0068863_1006844142 | 147 |
| 361 | 3300005841 | Ga0068863_101293690 | Ga0068863_1012936901 | 147 |
| 362 | 3300005842 | Ga0068858_100060227 | Ga0068858_1000602275 | 147 |
| 363 | 3300005842 | Ga0068858_100178305 | Ga0068858_1001783051 | 147 |
| 364 | 3300005843 | Ga0068860_100719936 | Ga0068860_1007199362 | 147 |
| 365 | 3300005843 | Ga0068860_100892941 | Ga0068860_1008929412 | 147 |
| 366 | 3300005843 | Ga0068860_101820661 | Ga0068860_1018206611 | 147 |
| 367 | 3300005844 | Ga0068862_100064616 | Ga0068862_1000646161 | 147 |
| 368 | 3300005844 | Ga0068862_100099202 | Ga0068862_1000992025 | 147 |
| 369 | 3300005844 | Ga0068862_100213168 | Ga0068862_1002131684 | 147 |
| 370 | 3300005844 | Ga0068862_100261263 | Ga0068862_1002612633 | 147 |
| 371 | 3300005844 | Ga0068862_100408583 | Ga0068862_1004085832 | 147 |
| 372 | 3300005844 | Ga0068862_100422959 | Ga0068862_1004229593 | 147 |
| 373 | 3300005844 | Ga0068862_100480089 | Ga0068862_1004800891 | 147 |
| 374 | 3300005844 | Ga0068862_100866078 | Ga0068862_1008660782 | 147 |
| 375 | 3300005844 | Ga0068862_101950260 | Ga0068862_1019502601 | 147 |
| 376 | 3300005937 | Ga0081455_10010859 | Ga0081455_100108599 | 147 |
| 377 | 3300005937 | Ga0081455_10016359 | Ga0081455_100163596 | 147 |
| 378 | 3300005937 | Ga0081455_10017850 | Ga0081455_100178508 | 147 |
| 379 | 3300005937 | Ga0081455_10030202 | Ga0081455_100302023 | 147 |
| 380 | 3300005937 | Ga0081455_10125630 | Ga0081455_101256302 | 147 |
| 381 | 3300005937 | Ga0081455_10177248 | Ga0081455_101772483 | 147 |
| 382 | 3300005981 | Ga0081538_10015837 | Ga0081538_100158376 | 147 |
| 383 | 3300005983 | Ga0081540_1002860 | Ga0081540_10028605 | 147 |
| 384 | 3300005983 | Ga0081540_1004874 | Ga0081540_10048747 | 147 |
| 385 | 3300005983 | Ga0081540_1009322 | Ga0081540_10093222 | 147 |
| 386 | 3300005983 | Ga0081540_1015061 | Ga0081540_10150613 | 147 |
| 387 | 3300005983 | Ga0081540_1027967 | Ga0081540_10279674 | 147 |
| 388 | 3300005983 | Ga0081540_1041856 | Ga0081540_10418562 | 147 |
| 389 | 3300005983 | Ga0081540_1042714 | Ga0081540_10427145 | 147 |
| 390 | 3300005983 | Ga0081540_1067351 | Ga0081540_10673512 | 147 |
| 391 | 3300005985 | Ga0081539_10029635 | Ga0081539_100296353 | 147 |
| 392 | 3300005985 | Ga0081539_10151141 | Ga0081539_101511412 | 147 |
| 393 | 3300006038 | Ga0075365_10026315 | Ga0075365_100263152 | 147 |
| 394 | 3300006038 | Ga0075365_10040262 | Ga0075365_100402625 | 147 |
| 395 | 3300006038 | Ga0075365_10088394 | Ga0075365_100883942 | 147 |
| 396 | 3300006038 | Ga0075365_10117480 | Ga0075365_101174802 | 147 |
| 397 | 3300006038 | Ga0075365_10150714 | Ga0075365_101507142 | 147 |
| 398 | 3300006038 | Ga0075365_11234895 | Ga0075365_112348951 | 147 |
| 399 | 3300006042 | Ga0075368_10025986 | Ga0075368_100259864 | 147 |
| 400 | 3300006042 | Ga0075368_10047547 | Ga0075368_100475472 | 147 |
| 401 | 3300006048 | Ga0075363_100000569 | Ga0075363_1000005697 | 147 |
| 402 | 3300006051 | Ga0075364_10025564 | Ga0075364_100255644 | 147 |
| 403 | 3300006051 | Ga0075364_10026435 | Ga0075364_100264352 | 147 |
| 404 | 3300006051 | Ga0075364_10831794 | Ga0075364_108317941 | 147 |
| 405 | 3300006058 | Ga0075432_10015387 | Ga0075432_100153874 | 147 |
| 406 | 3300006163 | Ga0070715_10367997 | Ga0070715_103679972 | 147 |
| 407 | 3300006173 | Ga0070716_100077422 | Ga0070716_1000774224 | 147 |
| 408 | 3300006175 | Ga0070712_100433226 | Ga0070712_1004332261 | 147 |
| 409 | 3300006177 | Ga0075362_10147716 | Ga0075362_101477162 | 147 |
| 410 | 3300006178 | Ga0075367_10011572 | Ga0075367_100115723 | 147 |
| 411 | 3300006178 | Ga0075367_10018357 | Ga0075367_100183575 | 147 |
| 412 | 3300006178 | Ga0075367_10061707 | Ga0075367_100617074 | 147 |
| 413 | 3300006178 | Ga0075367_10339442 | Ga0075367_103394422 | 147 |
| 414 | 3300006178 | Ga0075367_10817903 | Ga0075367_108179031 | 147 |
| 415 | 3300006186 | Ga0075369_10005129 | Ga0075369_100051295 | 147 |
| 416 | 3300006186 | Ga0075369_10100009 | Ga0075369_101000093 | 147 |
| 417 | 3300006186 | Ga0075369_10245524 | Ga0075369_102455242 | 147 |
| 418 | 3300006195 | Ga0075366_10086258 | Ga0075366_100862582 | 147 |
| 419 | 3300006195 | Ga0075366_10091682 | Ga0075366_100916823 | 147 |
| 420 | 3300006195 | Ga0075366_10201797 | Ga0075366_102017972 | 147 |
| 421 | 3300006195 | Ga0075366_10297503 | Ga0075366_102975032 | 147 |
| 422 | 3300006237 | Ga0097621_100034098 | Ga0097621_1000340983 | 147 |
| 423 | 3300006353 | Ga0075370_10072040 | Ga0075370_100720404 | 147 |
| 424 | 3300006353 | Ga0075370_10338658 | Ga0075370_103386581 | 147 |
| 425 | 3300006353 | Ga0075370_10384595 | Ga0075370_103845951 | 147 |
| 426 | 3300006358 | Ga0068871_100160352 | Ga0068871_1001603522 | 147 |
| 427 | 3300006844 | Ga0075428_100067240 | Ga0075428_1000672405 | 147 |
| 428 | 3300006844 | Ga0075428_100068913 | Ga0075428_1000689133 | 147 |
| 429 | 3300006871 | Ga0075434_100300927 | Ga0075434_1003009272 | 147 |
| 430 | 3300006881 | Ga0068865_100040769 | Ga0068865_1000407694 | 147 |
| 431 | 3300006881 | Ga0068865_100237154 | Ga0068865_1002371542 | 147 |
| 432 | 3300006914 | Ga0075436_100393060 | Ga0075436_1003930602 | 147 |
| 433 | 3300006931 | Ga0097620_100178567 | Ga0097620_1001785672 | 147 |
| 434 | 3300006931 | Ga0097620_100414844 | Ga0097620_1004148443 | 147 |
| 435 | 3300007788 | Ga0099795_10049039 | Ga0099795_100490392 | 147 |
| 436 | 3300009011 | Ga0105251_10406927 | Ga0105251_104069272 | 147 |
| 437 | 3300009036 | Ga0105244_10220204 | Ga0105244_102202041 | 147 |
| 438 | 3300009092 | Ga0105250_10091443 | Ga0105250_100914432 | 147 |
| 439 | 3300009093 | Ga0105240_10479386 | Ga0105240_104793862 | 147 |
| 440 | 3300009094 | Ga0111539_10089828 | Ga0111539_100898282 | 147 |
| 441 | 3300009098 | Ga0105245_10164541 | Ga0105245_101645413 | 147 |
| 442 | 3300009098 | Ga0105245_10263865 | Ga0105245_102638654 | 147 |
| 443 | 3300009098 | Ga0105245_11510448 | Ga0105245_115104482 | 147 |
| 444 | 3300009101 | Ga0105247_10073371 | Ga0105247_100733712 | 147 |
| 445 | 3300009101 | Ga0105247_10254390 | Ga0105247_102543902 | 147 |
| 446 | 3300009101 | Ga0105247_10285067 | Ga0105247_102850672 | 147 |
| 447 | 3300009147 | Ga0114129_10133780 | Ga0114129_101337802 | 147 |
| 448 | 3300009148 | Ga0105243_10085482 | Ga0105243_100854823 | 147 |
| 449 | 3300009148 | Ga0105243_10358800 | Ga0105243_103588002 | 147 |
| 450 | 3300009148 | Ga0105243_10552705 | Ga0105243_105527052 | 147 |
| 451 | 3300009148 | Ga0105243_10873475 | Ga0105243_108734752 | 147 |
| 452 | 3300009174 | Ga0105241_10030199 | Ga0105241_100301992 | 147 |
| 453 | 3300009174 | Ga0105241_10459259 | Ga0105241_104592593 | 147 |
| 454 | 3300009174 | Ga0105241_10640778 | Ga0105241_106407782 | 147 |
| 455 | 3300009176 | Ga0105242_10091348 | Ga0105242_100913484 | 147 |
| 456 | 3300009176 | Ga0105242_10440069 | Ga0105242_104400692 | 147 |
| 457 | 3300009176 | Ga0105242_10841423 | Ga0105242_108414232 | 147 |
| 458 | 3300009177 | Ga0105248_10054241 | Ga0105248_100542415 | 147 |
| 459 | 3300009545 | Ga0105237_10137991 | Ga0105237_101379914 | 147 |
| 460 | 3300009545 | Ga0105237_10318174 | Ga0105237_103181744 | 147 |
| 461 | 3300009551 | Ga0105238_10080497 | Ga0105238_100804975 | 147 |
| 462 | 3300009551 | Ga0105238_10505109 | Ga0105238_105051092 | 147 |
| 463 | 3300009553 | Ga0105249_10113290 | Ga0105249_101132903 | 147 |
| 464 | 3300009553 | Ga0105249_10589187 | Ga0105249_105891872 | 147 |
| 465 | 3300009553 | Ga0105249_10756811 | Ga0105249_107568112 | 147 |
| 466 | 3300009553 | Ga0105249_11000305 | Ga0105249_110003052 | 147 |
| 467 | 3300009553 | Ga0105249_11140318 | Ga0105249_111403182 | 147 |
| 468 | 3300010375 | Ga0105239_10098298 | Ga0105239_100982985 | 147 |
| 469 | 3300010375 | Ga0105239_10541832 | Ga0105239_105418321 | 147 |
| 470 | 3300010375 | Ga0105239_11184508 | Ga0105239_111845082 | 147 |
| 471 | 3300010375 | Ga0105239_12922054 | Ga0105239_129220541 | 147 |
| 472 | 3300011119 | Ga0105246_10110980 | Ga0105246_101109804 | 147 |
| 473 | 3300011119 | Ga0105246_10228853 | Ga0105246_102288532 | 147 |
| 474 | 3300011119 | Ga0105246_10852430 | Ga0105246_108524302 | 147 |
| 475 | 3300013296 | Ga0157374_10273006 | Ga0157374_102730062 | 147 |
| 476 | 3300013296 | Ga0157374_10622123 | Ga0157374_106221232 | 147 |
| 477 | 3300013297 | Ga0157378_10020790 | Ga0157378_100207904 | 147 |
| 478 | 3300013306 | Ga0163162_10055949 | Ga0163162_100559495 | 147 |
| 479 | 3300013306 | Ga0163162_11494298 | Ga0163162_114942982 | 147 |
| 480 | 3300013307 | Ga0157372_11664474 | Ga0157372_116644741 | 147 |
| 481 | 3300013308 | Ga0157375_10018295 | Ga0157375_100182957 | 147 |
| 482 | 3300013308 | Ga0157375_10106423 | Ga0157375_101064232 | 147 |
| 483 | 3300013308 | Ga0157375_10539501 | Ga0157375_105395012 | 147 |
| 484 | 3300013308 | Ga0157375_11373185 | Ga0157375_113731852 | 147 |
| 485 | 3300013308 | Ga0157375_13543623 | Ga0157375_135436231 | 147 |
| 486 | 3300014325 | Ga0163163_10199277 | Ga0163163_101992773 | 147 |
| 487 | 3300014325 | Ga0163163_10310305 | Ga0163163_103103053 | 147 |
| 488 | 3300014325 | Ga0163163_10401910 | Ga0163163_104019101 | 147 |
| 489 | 3300014326 | Ga0157380_10056556 | Ga0157380_100565564 | 147 |
| 490 | 3300014326 | Ga0157380_10292094 | Ga0157380_102920941 | 147 |
| 491 | 3300014326 | Ga0157380_11079080 | Ga0157380_110790802 | 147 |
| 492 | 3300014745 | Ga0157377_10054673 | Ga0157377_100546732 | 147 |
| 493 | 3300014968 | Ga0157379_10131370 | Ga0157379_101313702 | 147 |
| 494 | 3300014968 | Ga0157379_10147094 | Ga0157379_101470942 | 147 |
| 495 | 3300014969 | Ga0157376_10054887 | Ga0157376_100548873 | 147 |
| 496 | 3300014969 | Ga0157376_10349468 | Ga0157376_103494681 | 147 |
| 497 | 3300014969 | Ga0157376_10353987 | Ga0157376_103539872 | 147 |
| 498 | 3300017792 | Ga0163161_10068479 | Ga0163161_100684794 | 147 |
| 499 | 3300025297 | Ga0209758_1001444 | Ga0209758_100144421 | 147 |
| 500 | 3300025297 | Ga0209758_1043368 | Ga0209758_10433684 | 147 |
| 501 | 3300025315 | Ga0207697_10168408 | Ga0207697_101684082 | 147 |
| 502 | 3300025315 | Ga0207697_10192915 | Ga0207697_101929152 | 147 |
| 503 | 3300025321 | Ga0207656_10055273 | Ga0207656_100552731 | 147 |
| 504 | 3300025885 | Ga0207653_10078223 | Ga0207653_100782232 | 147 |
| 505 | 3300025899 | Ga0207642_10014744 | Ga0207642_100147442 | 147 |
| 506 | 3300025900 | Ga0207710_10050314 | Ga0207710_100503144 | 147 |
| 507 | 3300025900 | Ga0207710_10105582 | Ga0207710_101055822 | 147 |
| 508 | 3300025900 | Ga0207710_10365603 | Ga0207710_103656032 | 147 |
| 509 | 3300025901 | Ga0207688_10061342 | Ga0207688_100613423 | 147 |
| 510 | 3300025901 | Ga0207688_10083544 | Ga0207688_100835443 | 147 |
| 511 | 3300025904 | Ga0207647_10235056 | Ga0207647_102350562 | 147 |
| 512 | 3300025907 | Ga0207645_10041042 | Ga0207645_100410424 | 147 |
| 513 | 3300025907 | Ga0207645_10116590 | Ga0207645_101165902 | 147 |
| 514 | 3300025908 | Ga0207643_10131227 | Ga0207643_101312272 | 147 |
| 515 | 3300025908 | Ga0207643_10260678 | Ga0207643_102606782 | 147 |
| 516 | 3300025908 | Ga0207643_10761069 | Ga0207643_107610691 | 147 |
| 517 | 3300025911 | Ga0207654_10012529 | Ga0207654_100125292 | 147 |
| 518 | 3300025913 | Ga0207695_10279751 | Ga0207695_102797513 | 147 |
| 519 | 3300025914 | Ga0207671_10078672 | Ga0207671_100786722 | 147 |
| 520 | 3300025915 | Ga0207693_10043247 | Ga0207693_100432472 | 147 |
| 521 | 3300025919 | Ga0207657_10453659 | Ga0207657_104536591 | 147 |
| 522 | 3300025923 | Ga0207681_10134255 | Ga0207681_101342554 | 147 |
| 523 | 3300025923 | Ga0207681_10737867 | Ga0207681_107378672 | 147 |
| 524 | 3300025924 | Ga0207694_10058626 | Ga0207694_100586265 | 147 |
| 525 | 3300025924 | Ga0207694_11356097 | Ga0207694_113560971 | 147 |
| 526 | 3300025926 | Ga0207659_10238825 | Ga0207659_102388253 | 147 |
| 527 | 3300025926 | Ga0207659_10554114 | Ga0207659_105541142 | 147 |
| 528 | 3300025927 | Ga0207687_10052625 | Ga0207687_100526252 | 147 |
| 529 | 3300025931 | Ga0207644_10093660 | Ga0207644_100936602 | 147 |
| 530 | 3300025931 | Ga0207644_11408977 | Ga0207644_114089771 | 147 |
| 531 | 3300025932 | Ga0207690_10223908 | Ga0207690_102239082 | 147 |
| 532 | 3300025933 | Ga0207706_10047923 | Ga0207706_100479234 | 147 |
| 533 | 3300025933 | Ga0207706_10371555 | Ga0207706_103715552 | 147 |
| 534 | 3300025933 | Ga0207706_11209933 | Ga0207706_112099331 | 147 |
| 535 | 3300025934 | Ga0207686_10417495 | Ga0207686_104174953 | 147 |
| 536 | 3300025935 | Ga0207709_10031459 | Ga0207709_100314592 | 147 |
| 537 | 3300025935 | Ga0207709_10664060 | Ga0207709_106640601 | 147 |
| 538 | 3300025936 | Ga0207670_10076308 | Ga0207670_100763082 | 147 |
| 539 | 3300025937 | Ga0207669_10060620 | Ga0207669_100606204 | 147 |
| 540 | 3300025938 | Ga0207704_10076741 | Ga0207704_100767413 | 147 |
| 541 | 3300025938 | Ga0207704_10296409 | Ga0207704_102964092 | 147 |
| 542 | 3300025939 | Ga0207665_10064556 | Ga0207665_100645562 | 147 |
| 543 | 3300025939 | Ga0207665_10121161 | Ga0207665_101211611 | 147 |
| 544 | 3300025940 | Ga0207691_10117880 | Ga0207691_101178802 | 147 |
| 545 | 3300025940 | Ga0207691_10900702 | Ga0207691_109007022 | 147 |
| 546 | 3300025941 | Ga0207711_10020555 | Ga0207711_100205556 | 147 |
| 547 | 3300025942 | Ga0207689_10034293 | Ga0207689_100342932 | 147 |
| 548 | 3300025942 | Ga0207689_10118992 | Ga0207689_101189922 | 147 |
| 549 | 3300025945 | Ga0207679_10056113 | Ga0207679_100561133 | 147 |
| 550 | 3300025945 | Ga0207679_10070881 | Ga0207679_100708812 | 147 |
| 551 | 3300025949 | Ga0207667_10046871 | Ga0207667_100468712 | 147 |
| 552 | 3300025960 | Ga0207651_10199343 | Ga0207651_101993434 | 147 |
| 553 | 3300025960 | Ga0207651_10365751 | Ga0207651_103657512 | 147 |
| 554 | 3300025961 | Ga0207712_10942140 | Ga0207712_109421402 | 147 |
| 555 | 3300025972 | Ga0207668_10192277 | Ga0207668_101922773 | 147 |
| 556 | 3300025972 | Ga0207668_10255695 | Ga0207668_102556952 | 147 |
| 557 | 3300025972 | Ga0207668_10275556 | Ga0207668_102755562 | 147 |
| 558 | 3300025972 | Ga0207668_10465081 | Ga0207668_104650812 | 147 |
| 559 | 3300025972 | Ga0207668_11625945 | Ga0207668_116259452 | 147 |
| 560 | 3300025981 | Ga0207640_10113931 | Ga0207640_101139312 | 147 |
| 561 | 3300025981 | Ga0207640_10207698 | Ga0207640_102076983 | 147 |
| 562 | 3300025981 | Ga0207640_10236652 | Ga0207640_102366522 | 147 |
| 563 | 3300025981 | Ga0207640_11533458 | Ga0207640_115334582 | 147 |
| 564 | 3300025986 | Ga0207658_10050950 | Ga0207658_100509502 | 147 |
| 565 | 3300025986 | Ga0207658_10453054 | Ga0207658_104530542 | 147 |
| 566 | 3300025986 | Ga0207658_11493405 | Ga0207658_114934052 | 147 |
| 567 | 3300026023 | Ga0207677_10014116 | Ga0207677_100141163 | 147 |
| 568 | 3300026023 | Ga0207677_10640946 | Ga0207677_106409462 | 147 |
| 569 | 3300026035 | Ga0207703_10079384 | Ga0207703_100793842 | 147 |
| 570 | 3300026041 | Ga0207639_10429373 | Ga0207639_104293731 | 147 |
| 571 | 3300026041 | Ga0207639_11674812 | Ga0207639_116748121 | 147 |
| 572 | 3300026067 | Ga0207678_10032402 | Ga0207678_100324025 | 147 |
| 573 | 3300026067 | Ga0207678_10038621 | Ga0207678_100386215 | 147 |
| 574 | 3300026067 | Ga0207678_10048058 | Ga0207678_100480585 | 147 |
| 575 | 3300026067 | Ga0207678_10076918 | Ga0207678_100769183 | 147 |
| 576 | 3300026067 | Ga0207678_10121178 | Ga0207678_101211783 | 147 |
| 577 | 3300026067 | Ga0207678_10203925 | Ga0207678_102039253 | 147 |
| 578 | 3300026067 | Ga0207678_11232563 | Ga0207678_112325632 | 147 |
| 579 | 3300026075 | Ga0207708_10053224 | Ga0207708_100532242 | 147 |
| 580 | 3300026075 | Ga0207708_10332602 | Ga0207708_103326022 | 147 |
| 581 | 3300026078 | Ga0207702_10069003 | Ga0207702_100690032 | 147 |
| 582 | 3300026078 | Ga0207702_11565889 | Ga0207702_115658891 | 147 |
| 583 | 3300026088 | Ga0207641_10112831 | Ga0207641_101128315 | 147 |
| 584 | 3300026089 | Ga0207648_10042048 | Ga0207648_100420483 | 147 |
| 585 | 3300026089 | Ga0207648_10118129 | Ga0207648_101181294 | 147 |
| 586 | 3300026095 | Ga0207676_10116997 | Ga0207676_101169972 | 147 |
| 587 | 3300026095 | Ga0207676_10122781 | Ga0207676_101227812 | 147 |
| 588 | 3300026095 | Ga0207676_10963167 | Ga0207676_109631672 | 147 |
| 589 | 3300026116 | Ga0207674_10040950 | Ga0207674_100409502 | 147 |
| 590 | 3300026116 | Ga0207674_11477855 | Ga0207674_114778551 | 147 |
| 591 | 3300026118 | Ga0207675_100095640 | Ga0207675_1000956402 | 147 |
| 592 | 3300026118 | Ga0207675_100202556 | Ga0207675_1002025561 | 147 |
| 593 | 3300026118 | Ga0207675_100381419 | Ga0207675_1003814193 | 147 |
| 594 | 3300026118 | Ga0207675_100394151 | Ga0207675_1003941513 | 147 |
| 595 | 3300026118 | Ga0207675_100560201 | Ga0207675_1005602012 | 147 |
| 596 | 3300026121 | Ga0207683_10082114 | Ga0207683_100821145 | 147 |
| 597 | 3300026121 | Ga0207683_10234955 | Ga0207683_102349552 | 147 |
| 598 | 3300026121 | Ga0207683_10273371 | Ga0207683_102733712 | 147 |
| 599 | 3300026121 | Ga0207683_10469697 | Ga0207683_104696972 | 147 |
| 600 | 3300026142 | Ga0207698_10080447 | Ga0207698_100804474 | 147 |
| 601 | 3300026142 | Ga0207698_10752051 | Ga0207698_107520512 | 147 |
| 602 | 3300027866 | Ga0209813_10012688 | Ga0209813_100126882 | 147 |
| 603 | 3300027866 | Ga0209813_10202553 | Ga0209813_102025532 | 147 |
| 604 | 3300027907 | Ga0207428_10156085 | Ga0207428_101560852 | 147 |
| 605 | 3300028379 | Ga0268266_10001439 | Ga0268266_1000143920 | 147 |
| 606 | 3300028379 | Ga0268266_10004759 | Ga0268266_100047599 | 147 |
| 607 | 3300028379 | Ga0268266_10021895 | Ga0268266_100218956 | 147 |
| 608 | 3300028379 | Ga0268266_10048061 | Ga0268266_100480615 | 147 |
| 609 | 3300028379 | Ga0268266_10099983 | Ga0268266_100999833 | 147 |
| 610 | 3300028379 | Ga0268266_10153310 | Ga0268266_101533102 | 147 |
| 611 | 3300028379 | Ga0268266_10242848 | Ga0268266_102428483 | 147 |
| 612 | 3300028379 | Ga0268266_10394307 | Ga0268266_103943072 | 147 |
| 613 | 3300028379 | Ga0268266_10412639 | Ga0268266_104126393 | 147 |
| 614 | 3300028379 | Ga0268266_10650097 | Ga0268266_106500972 | 147 |
| 615 | 3300028380 | Ga0268265_10056338 | Ga0268265_100563382 | 147 |
| 616 | 3300028380 | Ga0268265_10125571 | Ga0268265_101255714 | 147 |
| 617 | 3300028380 | Ga0268265_10292344 | Ga0268265_102923443 | 147 |
| 618 | 3300028380 | Ga0268265_10315453 | Ga0268265_103154533 | 147 |
| 619 | 3300028380 | Ga0268265_10482092 | Ga0268265_104820923 | 147 |
| 620 | 3300028380 | Ga0268265_11180455 | Ga0268265_111804551 | 147 |
| 621 | 3300028380 | Ga0268265_11615061 | Ga0268265_116150612 | 147 |
| 622 | 3300028380 | Ga0268265_11971414 | Ga0268265_119714141 | 147 |
| 623 | 3300028786 | Ga0307517_10126584 | Ga0307517_101265842 | 147 |
| 624 | 3300028786 | Ga0307517_10180147 | Ga0307517_101801472 | 147 |
| 625 | 3300028786 | Ga0307517_10237341 | Ga0307517_102373412 | 147 |
| 626 | 3300030521 | Ga0307511_10128517 | Ga0307511_101285172 | 147 |
| 627 | 3300031456 | Ga0307513_10126681 | Ga0307513_101266814 | 147 |
| 628 | 3300031507 | Ga0307509_10198703 | Ga0307509_101987032 | 147 |
| 629 | 3300031548 | Ga0307408_101687807 | Ga0307408_1016878071 | 147 |
| 630 | 3300031616 | Ga0307508_10436927 | Ga0307508_104369272 | 147 |
| 631 | 3300031730 | Ga0307516_10280387 | Ga0307516_102803871 | 147 |
| 632 | 3300031824 | Ga0307413_10146496 | Ga0307413_101464962 | 147 |
| 633 | 3300031824 | Ga0307413_10205283 | Ga0307413_102052833 | 147 |
| 634 | 3300031824 | Ga0307413_10747627 | Ga0307413_107476271 | 147 |
| 635 | 3300031901 | Ga0307406_10368236 | Ga0307406_103682363 | 147 |
| 636 | 3300031911 | Ga0307412_10028635 | Ga0307412_100286351 | 147 |
| 637 | 3300031911 | Ga0307412_11938691 | Ga0307412_119386911 | 147 |
| 638 | 3300031995 | Ga0307409_100504840 | Ga0307409_1005048403 | 147 |
| 639 | 3300031995 | Ga0307409_102530113 | Ga0307409_1025301131 | 147 |
| 640 | 3300032002 | Ga0307416_100621101 | Ga0307416_1006211011 | 147 |
| 641 | 3300032002 | Ga0307416_101100863 | Ga0307416_1011008632 | 147 |
| 642 | 3300032002 | Ga0307416_101256695 | Ga0307416_1012566952 | 147 |
| 643 | 3300032002 | Ga0307416_101375007 | Ga0307416_1013750072 | 147 |
| 644 | 3300032005 | Ga0307411_10038307 | Ga0307411_100383071 | 147 |
| 645 | 3300032005 | Ga0307411_10285462 | Ga0307411_102854621 | 147 |
| 646 | 3300032126 | Ga0307415_100259039 | Ga0307415_1002590392 | 147 |
| 647 | 3300033180 | Ga0307510_10071137 | Ga0307510_100711374 | 147 |
| 648 | 3300035170 | Ga0373943_0014145 | Ga0373943_0014145_3068_3514 | 147 |
| 649 | 3300035691 | Ga0373931_0625332 | Ga0373931_0625332_136_579 | 147 |
| 650 | 3300035695 | Ga0373927_0019266 | Ga0373927_0019266_1512_1958 | 147 |
| 651 | 3300035725 | Ga0373947_0008612 | Ga0373947_0008612_5200_5646 | 147 |
| 652 | 3300037068 | Ga0373925_0081544 | Ga0373925_0081544_490_936 | 147 |
| 653 | 3300041413 | Ga0439465_0012592 | Ga0439465_0012592_1344_1787 | 147 |
| 654 | 3300041460 | Ga0451802_1997251 | Ga0451802_1997251_43_486 | 147 |
| 655 | 3300041486 | Ga0451807_0833332 | Ga0451807_0833332_373_816 | 147 |
| 656 | 3300041498 | Ga0451841_1432989 | Ga0451841_1432989_92_538 | 147 |
| 657 | 3300041512 | Ga0451853_1513700 | Ga0451853_1513700_1231_1677 | 147 |
| 658 | 3300042004 | Ga0439445_0078004 | Ga0439445_0078004_73_516 | 147 |
| 659 | 3300046452 | Ga0495617_114056 | Ga0495617_114056_120_563 | 147 |
| 660 | 3300046452 | Ga0495617_160604 | Ga0495617_160604_43_486 | 147 |
| 661 | 3300046455 | Ga0495603_0011405 | Ga0495603_0011405_1339_1785 | 147 |
| 662 | 3300046455 | Ga0495603_0079703 | Ga0495603_0079703_1372_1815 | 147 |
| 663 | 3300046455 | Ga0495603_0138290 | Ga0495603_0138290_166_609 | 147 |
| 664 | 3300046457 | Ga0495590_0438002 | Ga0495590_0438002_47_490 | 147 |
| 665 | 3300046459 | Ga0495629_0866461 | Ga0495629_0866461_76_519 | 147 |
| 666 | 3300046460 | Ga0495638_0107015 | Ga0495638_0107015_492_935 | 147 |
| 667 | 3300046461 | Ga0495641_0392743 | Ga0495641_0392743_168_614 | 147 |
| 668 | 3300046471 | Ga0495650_0132802 | Ga0495650_0132802_68_511 | 147 |
| 669 | 3300046472 | Ga0495580_0211891 | Ga0495580_0211891_223_669 | 147 |
| 670 | 3300046474 | Ga0495605_0116782 | Ga0495605_0116782_659_1102 | 147 |
| 671 | 3300046491 | Ga0495584_0057240 | Ga0495584_0057240_356_799 | 147 |
| 672 | 3300046491 | Ga0495584_0317976 | Ga0495584_0317976_301_744 | 147 |
| 673 | 3300046492 | Ga0495585_0017852 | Ga0495585_0017852_1688_2131 | 147 |
| 674 | 3300046500 | Ga0495596_0099065 | Ga0495596_0099065_107_550 | 147 |
| 675 | 3300046506 | Ga0495583_0033447 | Ga0495583_0033447_1396_1839 | 147 |
| 676 | 3300046507 | Ga0495606_0135727 | Ga0495606_0135727_991_1434 | 147 |
| 677 | 3300046512 | Ga0495610_0248654 | Ga0495610_0248654_131_574 | 147 |
| 678 | 3300046513 | Ga0495616_0091337 | Ga0495616_0091337_841_1284 | 147 |
| 679 | 3300046513 | Ga0495616_0142007 | Ga0495616_0142007_245_688 | 147 |
| 680 | 3300046517 | Ga0495630_0133723 | Ga0495630_0133723_864_1310 | 147 |
| 681 | 3300046518 | Ga0495631_0019017 | Ga0495631_0019017_1631_2074 | 147 |
| 682 | 3300046519 | Ga0495632_0118079 | Ga0495632_0118079_523_966 | 147 |
| 683 | 3300046519 | Ga0495632_0170461 | Ga0495632_0170461_70_513 | 147 |
| 684 | 3300046522 | Ga0495643_0083768 | Ga0495643_0083768_849_1292 | 147 |
| 685 | 3300046523 | Ga0495644_0287849 | Ga0495644_0287849_61_504 | 147 |
| 686 | 3300046523 | Ga0495644_0352431 | Ga0495644_0352431_91_534 | 147 |
| 687 | 3300046524 | Ga0495648_0274312 | Ga0495648_0274312_65_508 | 147 |
| 688 | 3300046525 | Ga0495663_0036767 | Ga0495663_0036767_856_1299 | 147 |
| 689 | 3300046525 | Ga0495663_0229618 | Ga0495663_0229618_115_558 | 147 |
| 690 | 3300046528 | Ga0495642_0221046 | Ga0495642_0221046_223_666 | 147 |
| 691 | 3300046538 | Ga0495609_0054926 | Ga0495609_0054926_541_984 | 147 |
| 692 | 3300046542 | Ga0495597_0321323 | Ga0495597_0321323_47_490 | 147 |
| 693 | 3300046557 | Ga0495622_0110135 | Ga0495622_0110135_431_874 | 147 |
| 694 | 3300046557 | Ga0495622_0130339 | Ga0495622_0130339_602_1045 | 147 |
| 695 | 3300046615 | Ga0495656_0115215 | Ga0495656_0115215_752_1195 | 147 |
| 696 | 3300046615 | Ga0495656_0404391 | Ga0495656_0404391_174_617 | 147 |
| 697 | 3300046615 | Ga0495656_0641787 | Ga0495656_0641787_65_508 | 147 |
| 698 | 3300046648 | Ga0495611_0027557 | Ga0495611_0027557_1040_1483 | 147 |
| 699 | 3300046648 | Ga0495611_0184702 | Ga0495611_0184702_439_882 | 147 |
| 700 | 3300046648 | Ga0495611_0593020 | Ga0495611_0593020_22_465 | 147 |
| 701 | 3300046660 | Ga0495625_0183592 | Ga0495625_0183592_193_636 | 147 |
| 702 | 3300046663 | Ga0495635_0409530 | Ga0495635_0409530_185_628 | 147 |
| 703 | 3300046665 | Ga0495661_0182535 | Ga0495661_0182535_429_872 | 147 |
| 704 | 3300046684 | Ga0495669_0005775 | Ga0495669_0005775_3131_3574 | 147 |
| 705 | 3300046684 | Ga0495669_0064087 | Ga0495669_0064087_844_1287 | 147 |
| 706 | 3300046684 | Ga0495669_0166884 | Ga0495669_0166884_273_716 | 147 |
| 707 | 3300046690 | Ga0495624_0105506 | Ga0495624_0105506_557_1003 | 147 |
| 708 | 3300046691 | Ga0495670_0410719 | Ga0495670_0410719_15_458 | 147 |
| 709 | 3300046692 | Ga0495671_0230377 | Ga0495671_0230377_323_766 | 147 |
| 710 | 3300046694 | Ga0495649_0094598 | Ga0495649_0094598_848_1291 | 147 |
| 711 | 3300046694 | Ga0495649_0316004 | Ga0495649_0316004_146_589 | 147 |
| 712 | 3300046794 | Ga0495589_0386501 | Ga0495589_0386501_113_556 | 147 |
| 713 | 3300047315 | Ga0495581_0431231 | Ga0495581_0431231_214_657 | 147 |
| 714 | 3300047318 | Ga0495636_0313305 | Ga0495636_0313305_144_587 | 147 |
| 715 | 3300047318 | Ga0495636_0442684 | Ga0495636_0442684_70_513 | 147 |
| 716 | 3300047320 | Ga0495672_0231428 | Ga0495672_0231428_443_889 | 147 |
| 717 | 3300047320 | Ga0495672_0232039 | Ga0495672_0232039_328_774 | 147 |
| 718 | 3300047320 | Ga0495672_0340494 | Ga0495672_0340494_192_635 | 147 |
| 719 | 3300047321 | Ga0495676_0091373 | Ga0495676_0091373_286_732 | 147 |
| 720 | 3300047321 | Ga0495676_0486011 | Ga0495676_0486011_310_756 | 147 |
| 721 | 3300047323 | Ga0495683_0141427 | Ga0495683_0141427_403_846 | 147 |
| 722 | 3300047445 | Ga0495677_0012469 | Ga0495677_0012469_644_1087 | 147 |
| 723 | 3300047469 | Ga0495673_0335321 | Ga0495673_0335321_77_520 | 147 |
| 724 | 3300047472 | Ga0495686_0134109 | Ga0495686_0134109_655_1098 | 147 |
| 725 | 3300047472 | Ga0495686_0162470 | Ga0495686_0162470_232_678 | 147 |
| 726 | 3300047673 | Ga0495593_0051110 | Ga0495593_0051110_594_1037 | 147 |
| 727 | 3300048090 | Ga0495615_0096012 | Ga0495615_0096012_150_593 | 147 |
| 728 | 3300048903 | Ga0496100_0400348 | Ga0496100_0400348_327_773 | 147 |
| 729 | 3300048903 | Ga0496100_0490392 | Ga0496100_0490392_118_561 | 147 |
| 730 | 3300048904 | Ga0496101_0251839 | Ga0496101_0251839_176_619 | 147 |
| 731 | 3300048905 | Ga0496102_0040343 | Ga0496102_0040343_311_757 | 147 |
| 732 | 3300048905 | Ga0496102_0328645 | Ga0496102_0328645_887_1330 | 147 |
| 733 | 3300048905 | Ga0496102_0475381 | Ga0496102_0475381_621_1064 | 147 |
| 734 | 3300048905 | Ga0496102_0532199 | Ga0496102_0532199_202_645 | 147 |
| 735 | 3300048905 | Ga0496102_0548722 | Ga0496102_0548722_321_764 | 147 |
| 736 | 3300048905 | Ga0496102_0804442 | Ga0496102_0804442_20_463 | 147 |
| 737 | 3300048906 | Ga0496103_0515679 | Ga0496103_0515679_186_629 | 147 |
| 738 | 3300048907 | Ga0496104_0179386 | Ga0496104_0179386_1190_1633 | 147 |
| 739 | 3300048907 | Ga0496104_0802006 | Ga0496104_0802006_29_472 | 147 |
| 740 | 3300048907 | Ga0496104_1054754 | Ga0496104_1054754_63_509 | 147 |
| 741 | 3300048908 | Ga0496105_0022258 | Ga0496105_0022258_4085_4531 | 147 |
| 742 | 3300048908 | Ga0496105_0261668 | Ga0496105_0261668_88_534 | 147 |
| 743 | 3300048908 | Ga0496105_1226346 | Ga0496105_1226346_75_518 | 147 |
| 744 | 3300048909 | Ga0496106_0159983 | Ga0496106_0159983_1145_1588 | 147 |
| 745 | 3300048909 | Ga0496106_0172367 | Ga0496106_0172367_758_1201 | 147 |
| 746 | 3300048909 | Ga0496106_0516883 | Ga0496106_0516883_24_467 | 147 |
| 747 | 3300048909 | Ga0496106_1031002 | Ga0496106_1031002_170_616 | 147 |
| 748 | 3300048910 | Ga0496107_0050553 | Ga0496107_0050553_145_591 | 147 |
| 749 | 3300048910 | Ga0496107_0185277 | Ga0496107_0185277_37_480 | 147 |
| 750 | 3300048911 | Ga0496108_0041652 | Ga0496108_0041652_1563_2009 | 147 |
| 751 | 3300048911 | Ga0496108_0069035 | Ga0496108_0069035_254_697 | 147 |
| 752 | 3300048911 | Ga0496108_0127359 | Ga0496108_0127359_1311_1754 | 147 |
| 753 | 3300048912 | Ga0496109_0002712 | Ga0496109_0002712_4181_4627 | 147 |
| 754 | 3300048912 | Ga0496109_0268167 | Ga0496109_0268167_315_758 | 147 |
| 755 | 3300048912 | Ga0496109_0846522 | Ga0496109_0846522_58_501 | 147 |
| 756 | 3300048912 | Ga0496109_1161348 | Ga0496109_1161348_238_681 | 147 |
| 757 | 3300048913 | Ga0496110_0047989 | Ga0496110_0047989_1826_2272 | 147 |
| 758 | 3300048913 | Ga0496110_0296914 | Ga0496110_0296914_422_865 | 147 |
| 759 | 3300048914 | Ga0496111_0369912 | Ga0496111_0369912_163_609 | 147 |
| 760 | 3300048914 | Ga0496111_0660527 | Ga0496111_0660527_29_472 | 147 |
| 761 | 3300048914 | Ga0496111_0888610 | Ga0496111_0888610_115_558 | 147 |
| 762 | 3300048915 | Ga0496112_0385209 | Ga0496112_0385209_112_555 | 147 |
| 763 | 3300048915 | Ga0496112_0503882 | Ga0496112_0503882_583_1026 | 147 |
| 764 | 3300048916 | Ga0496113_0042931 | Ga0496113_0042931_1189_1635 | 147 |
| 765 | 3300048916 | Ga0496113_0156425 | Ga0496113_0156425_1329_1775 | 147 |
| 766 | 3300048916 | Ga0496113_1062269 | Ga0496113_1062269_124_567 | 147 |
| 767 | 3300048917 | Ga0496114_0017279 | Ga0496114_0017279_3228_3674 | 147 |
| 768 | 3300048918 | Ga0496115_0000662 | Ga0496115_0000662_20981_21427 | 147 |
| 769 | 3300048918 | Ga0496115_0016859 | Ga0496115_0016859_3483_3929 | 147 |
| 770 | 3300048918 | Ga0496115_0350908 | Ga0496115_0350908_175_618 | 147 |
| 771 | 3300048918 | Ga0496115_0474670 | Ga0496115_0474670_506_949 | 147 |
| 772 | 3300048919 | Ga0496116_0136526 | Ga0496116_0136526_476_919 | 147 |
| 773 | 3300048921 | Ga0496118_0340515 | Ga0496118_0340515_322_765 | 147 |
| 774 | 3300048921 | Ga0496118_0506131 | Ga0496118_0506131_103_546 | 147 |
| 775 | 3300048923 | Ga0496120_0286356 | Ga0496120_0286356_94_537 | 147 |
| 776 | 3300048924 | Ga0496121_0070812 | Ga0496121_0070812_1344_1787 | 147 |
| 777 | 3300048924 | Ga0496121_0077018 | Ga0496121_0077018_2156_2599 | 147 |
| 778 | 3300048924 | Ga0496121_0173020 | Ga0496121_0173020_1026_1469 | 147 |
| 779 | 3300048929 | Ga0496126_0010315 | Ga0496126_0010315_6772_7215 | 147 |
| 780 | 3300048929 | Ga0496126_0252521 | Ga0496126_0252521_590_1033 | 147 |
| 781 | 3300048929 | Ga0496126_0268499 | Ga0496126_0268499_785_1228 | 147 |
| 782 | 3300048929 | Ga0496126_0637230 | Ga0496126_0637230_244_687 | 147 |
| 783 | 3300048929 | Ga0496126_0811190 | Ga0496126_0811190_229_672 | 147 |
| 784 | 3300048929 | Ga0496126_0838694 | Ga0496126_0838694_142_585 | 147 |
| 785 | 3300049459 | Ga0495678_150195 | Ga0495678_150195_106_549 | 147 |
| 786 | 3300049570 | Ga0501033_0281497 | Ga0501033_0281497_376_819 | 147 |
| 787 | 3300049572 | Ga0501036_0032225 | Ga0501036_0032225_3817_4260 | 147 |
| 788 | 3300049575 | Ga0501039_0359995 | Ga0501039_0359995_370_813 | 147 |
| 789 | 3300049576 | Ga0501040_0421166 | Ga0501040_0421166_204_647 | 147 |
| 790 | 3300049578 | Ga0501042_0207474 | Ga0501042_0207474_459_902 | 147 |
| 791 | 3300049578 | Ga0501042_0416929 | Ga0501042_0416929_187_630 | 147 |
| 792 | 3300049583 | Ga0501067_0097450 | Ga0501067_0097450_129_572 | 147 |
| 793 | 3300049583 | Ga0501067_0229794 | Ga0501067_0229794_526_969 | 147 |
| 794 | 3300049584 | Ga0501068_0709982 | Ga0501068_0709982_42_485 | 147 |
| 795 | 3300049585 | Ga0501069_0266049 | Ga0501069_0266049_441_884 | 147 |
| 796 | 3300049591 | Ga0501075_0904345 | Ga0501075_0904345_186_629 | 147 |
| 797 | 3300049592 | Ga0501076_0081846 | Ga0501076_0081846_654_1097 | 147 |
| 798 | 3300049741 | Ga0501079_0509766 | Ga0501079_0509766_116_559 | 147 |
| 799 | 3300050489 | nmdc:mga03683_216634_c1 | nmdc:mga03683_216634_c1_277_720 | 147 |
| 800 | 3300050489 | nmdc:mga03683_30311_c1 | nmdc:mga03683_30311_c1_1240_1683 | 147 |
| 801 | 3300050489 | nmdc:mga03683_60875_c1 | nmdc:mga03683_60875_c1_1133_1576 | 147 |
| 802 | 3300050490 | nmdc:mga03n38_218285_c1 | nmdc:mga03n38_218285_c1_290_733 | 147 |
| 803 | 3300050490 | nmdc:mga03n38_4900_c1 | nmdc:mga03n38_4900_c1_205_648 | 147 |
| 804 | 3300050490 | nmdc:mga03n38_509678_c1 | nmdc:mga03n38_509678_c1_183_626 | 147 |
| 805 | 3300050490 | nmdc:mga03n38_87872_c1 | nmdc:mga03n38_87872_c1_106_549 | 147 |
| 806 | 3300050491 | nmdc:mga00v17_25959_c1 | nmdc:mga00v17_25959_c1_1746_2195 | 147 |
| 807 | 3300050491 | nmdc:mga00v17_275865_c1 | nmdc:mga00v17_275865_c1_247_690 | 147 |
| 808 | 3300050491 | nmdc:mga00v17_33232_c1 | nmdc:mga00v17_33232_c1_1262_1705 | 147 |
| 809 | 3300050491 | nmdc:mga00v17_493727_c1 | nmdc:mga00v17_493727_c1_241_684 | 147 |
| 810 | 3300050491 | nmdc:mga00v17_67499_c1 | nmdc:mga00v17_67499_c1_950_1393 | 147 |
| 811 | 3300050492 | nmdc:mga0yw44_110728_c1 | nmdc:mga0yw44_110728_c1_272_718 | 147 |
| 812 | 3300050492 | nmdc:mga0yw44_534557_c1 | nmdc:mga0yw44_534557_c1_65_508 | 147 |
| 813 | 3300050493 | nmdc:mga0k408_172468_c1 | nmdc:mga0k408_172468_c1_193_636 | 147 |
| 814 | 3300050493 | nmdc:mga0k408_17739_c1 | nmdc:mga0k408_17739_c1_640_1083 | 147 |
| 815 | 3300050493 | nmdc:mga0k408_364905_c1 | nmdc:mga0k408_364905_c1_301_744 | 147 |
| 816 | 3300050493 | nmdc:mga0k408_48985_c1 | nmdc:mga0k408_48985_c1_1885_2328 | 147 |
| 817 | 3300050494 | nmdc:mga06z11_46391_c1 | nmdc:mga06z11_46391_c1_1083_1526 | 147 |
| 818 | 3300050494 | nmdc:mga06z11_86090_c1 | nmdc:mga06z11_86090_c1_1232_1675 | 147 |
| 819 | 3300050495 | nmdc:mga04h51_271546_c1 | nmdc:mga04h51_271546_c1_95_538 | 147 |
| 820 | 3300050495 | nmdc:mga04h51_4863_c1 | nmdc:mga04h51_4863_c1_314_757 | 147 |
| 821 | 3300050496 | nmdc:mga07m45_1133_c1 | nmdc:mga07m45_1133_c1_7133_7576 | 147 |
| 822 | 3300050496 | nmdc:mga07m45_63401_c1 | nmdc:mga07m45_63401_c1_766_1209 | 147 |
| 823 | 3300050507 | nmdc:mga05p37_98773_c2 | nmdc:mga05p37_98773_c2_472_915 | 147 |
| 824 | 3300050509 | nmdc:mga0qj67_852783_c1 | nmdc:mga0qj67_852783_c1_227_670 | 147 |
| 825 | 3300050511 | nmdc:mga08y16_167333_c1 | nmdc:mga08y16_167333_c1_1048_1491 | 147 |
| 826 | 3300050512 | nmdc:mga0n895_749391_c1 | nmdc:mga0n895_749391_c1_44_487 | 147 |
| 827 | 3300050513 | nmdc:mga0rr50_87656_c1 | nmdc:mga0rr50_87656_c1_862_1305 | 147 |
| 828 | 3300050516 | nmdc:mga0sz30_127066_c1 | nmdc:mga0sz30_127066_c1_101_544 | 147 |
| 829 | 3300050516 | nmdc:mga0sz30_33621_c1 | nmdc:mga0sz30_33621_c1_107_550 | 147 |
| 830 | 3300053079 | Ga0500610_0372451 | Ga0500610_0372451_57_500 | 147 |
| 831 | 3300053092 | Ga0500583_0094821 | Ga0500583_0094821_209_652 | 147 |
| 832 | 3300053096 | Ga0500641_0080652 | Ga0500641_0080652_736_1179 | 147 |
| 833 | 3300053103 | Ga0500555_058223 | Ga0500555_058223_32_475 | 147 |
| 834 | 3300053104 | Ga0500556_0055793 | Ga0500556_0055793_337_783 | 147 |
| 835 | 3300053108 | Ga0500562_064114 | Ga0500562_064114_22_465 | 147 |
| 836 | 3300053109 | Ga0500569_118019 | Ga0500569_118019_286_729 | 147 |
| 837 | 3300053118 | Ga0500594_0027480 | Ga0500594_0027480_68_511 | 147 |
| 838 | 3300053118 | Ga0500594_0045206 | Ga0500594_0045206_352_795 | 147 |
| 839 | 3300053119 | Ga0500595_001792 | Ga0500595_001792_398_844 | 147 |
| 840 | 3300053119 | Ga0500595_036921 | Ga0500595_036921_586_1029 | 147 |
| 841 | 3300053129 | Ga0500628_106102 | Ga0500628_106102_181_624 | 147 |
| 842 | 3300053130 | Ga0500642_0186978 | Ga0500642_0186978_354_797 | 147 |
| 843 | 3300053130 | Ga0500642_0196556 | Ga0500642_0196556_253_696 | 147 |
| 844 | 3300053134 | Ga0500658_0399763 | Ga0500658_0399763_136_579 | 147 |
| 845 | 3300053139 | Ga0500568_0004461 | Ga0500568_0004461_5659_6105 | 147 |
| 846 | 3300053146 | Ga0500588_0058542 | Ga0500588_0058542_68_511 | 147 |
| 847 | 3300053147 | Ga0500589_222608 | Ga0500589_222608_44_487 | 147 |
| 848 | 3300053151 | Ga0500604_0039514 | Ga0500604_0039514_673_1116 | 147 |
| 849 | 3300053153 | Ga0500616_0174836 | Ga0500616_0174836_169_612 | 147 |
| 850 | 3300053158 | Ga0500627_0073841 | Ga0500627_0073841_730_1173 | 147 |
| 851 | 3300053160 | Ga0500633_0142048 | Ga0500633_0142048_222_665 | 147 |
| 852 | 3300053160 | Ga0500633_0198603 | Ga0500633_0198603_86_529 | 147 |
| 853 | 3300053161 | Ga0500634_0061817 | Ga0500634_0061817_283_726 | 147 |
| 854 | 3300053161 | Ga0500634_0185350 | Ga0500634_0185350_302_745 | 147 |
| 855 | 3300053162 | Ga0500638_101381 | Ga0500638_101381_639_1082 | 147 |
| 856 | 3300053178 | Ga0500637_0205050 | Ga0500637_0205050_311_754 | 147 |
| 857 | 3300053727 | Ga0500611_003674 | Ga0500611_003674_1284_1727 | 147 |
| 858 | 3300053730 | Ga0500645_021151 | Ga0500645_021151_1411_1854 | 147 |
| 859 | 3300053730 | Ga0500645_133957 | Ga0500645_133957_113_556 | 147 |
| 860 | 3300053731 | Ga0500609_033089 | Ga0500609_033089_113_556 | 147 |
| 861 | 3300054114 | Ga0501084_0400018 | Ga0501084_0400018_475_918 | 147 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8d42-assembly1.cif.gz_B | human mitochondrial dna polymerase gamma ternary complex with gt basepair in editing conformer (composite) | 0.7639 | 31 | 69 |
| 7fjj-assembly1.cif.gz_B | human pol iii pre-termination complex | 0.7436 | 38 | 77 |
| 6iu0-assembly1.cif.gz_A | peroxiredoxin from thermococcus kodakaraensis (0cys mutant) | 0.7094 | 72 | 98 |
| 6itz-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7026 | 72 | 98 |
| 2lrn-assembly1.cif.gz_A | solution structure of a thiol:disulfide interchange protein from bacteroides sp. | 0.6695 | 72 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9V4M2_585_816_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.886 | 63 | 86 | 2.120.10.30 |
| af_F1QXI6_172_401_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8196 | 63 | 86 | 2.130.10.10 |
| af_A4I4C4_81_338_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8163 | 63 | 85 | 2.130.10.10 |
| af_F1QCX8_281_476_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.7787 | 63 | 88 | 2.110.10.10 |
| af_Q9BKZ9_480_615_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7754 | 64 | 87 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A398D9J9-F1-model_v4 | Uncharacterized protein | 0.8684 | 41 | 86 |
GO:0016020
|
| AF-A0A1B1U9T3-F1-model_v4 | Uncharacterized protein | 0.8644 | 1 | 147 |
|
| AF-A0A398DA14-F1-model_v4 | Uncharacterized protein | 0.8506 | 41 | 86 |
|
| AF-A0A7C0X258-F1-model_v4 | Lipoprotein | 0.844 | 49 | 86 |
|
| AF-X7YLP1-F1-model_v4 | Uncharacterized protein | 0.8252 | 49 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar