F483837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 861 | 277 | 861 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100055423|Ga0068862_1000554232 |
| Length | 323 |
| Sequence | LRDCGTRTQEVHSERVVACVQFKFTLAPALCASHPGCPGPVRARTQLLRSLPPLTQHPFVEPTAAPTDHVLVTRDGAIVTLTFNRPEARNAMTWEMYQRLYDICEEVDADESVRVLVLRGAGGKAFVAGTDISQFTEFNSGEDGLRYERDGDKRSGRIARVKKPVIAQIQGFAVGGGFGIAAGADLRIATPDARFGAPIARTLGNCLSMQAYARYLDLLGPSRLKELIFTARLMPADEALAAGFVHEIVPADTIEARVHELAQTIASHAPITLWVTKEAVRRIQESRALPDGDDLIATTYGSADFREGVRAFIDKRPPRWIGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 211 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 212 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 217 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.97 |
| Rhizosphere | 97.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10017377 | 3300005327 | Bacteria | 5755 |
| 2 | Ga0070676_10019502 | 3300005328 | Bacteria | 3774 |
| 3 | Ga0070676_10035668 | 3300005328 | Bacteria | 2862 |
| 4 | Ga0070676_10036618 | 3300005328 | Bacteria | 2827 |
| 5 | Ga0070676_10124159 | 3300005328 | Bacteria | 1624 |
| 6 | Ga0070676_10165179 | 3300005328 | Bacteria | 1428 |
| 7 | Ga0070683_100040525 | 3300005329 | Bacteria | 4283 |
| 8 | Ga0070683_100271984 | 3300005329 | Bacteria | 1611 |
| 9 | Ga0070690_100139918 | 3300005330 | Bacteria | 1642 |
| 10 | Ga0070690_100320569 | 3300005330 | Bacteria | 1117 |
| 11 | Ga0070690_100404943 | 3300005330 | Bacteria | 1003 |
| 12 | Ga0070670_100012669 | 3300005331 | Bacteria | 7219 |
| 13 | Ga0070670_100106110 | 3300005331 | Bacteria | 2420 |
| 14 | Ga0070670_100197982 | 3300005331 | Bacteria | 1745 |
| 15 | Ga0070677_10001601 | 3300005333 | Bacteria | 7161 |
| 16 | Ga0070677_10022340 | 3300005333 | Bacteria | 2328 |
| 17 | Ga0070677_10057509 | 3300005333 | Bacteria | 1594 |
| 18 | Ga0068869_100002738 | 3300005334 | Bacteria | 10667 |
| 19 | Ga0068869_100009682 | 3300005334 | Bacteria | 6257 |
| 20 | Ga0068869_100031324 | 3300005334 | Bacteria | 3741 |
| 21 | Ga0068869_100063073 | 3300005334 | Bacteria | 2721 |
| 22 | Ga0068869_100137523 | 3300005334 | Bacteria | 1883 |
| 23 | Ga0070666_10051995 | 3300005335 | Bacteria | 2760 |
| 24 | Ga0070666_10081998 | 3300005335 | Bacteria | 2205 |
| 25 | Ga0070680_100017402 | 3300005336 | Bacteria | 5668 |
| 26 | Ga0070680_100020755 | 3300005336 | Bacteria | 5212 |
| 27 | Ga0070680_100186308 | 3300005336 | Bacteria | 1748 |
| 28 | Ga0070682_100006921 | 3300005337 | Bacteria | 6375 |
| 29 | Ga0068868_100011500 | 3300005338 | Bacteria | 6446 |
| 30 | Ga0068868_100021226 | 3300005338 | Bacteria | 4890 |
| 31 | Ga0068868_100041953 | 3300005338 | Bacteria | 3567 |
| 32 | Ga0068868_100198876 | 3300005338 | Bacteria | 1670 |
| 33 | Ga0070660_100521387 | 3300005339 | Bacteria | 990 |
| 34 | Ga0070689_100254267 | 3300005340 | Bacteria | 1450 |
| 35 | Ga0070691_10007474 | 3300005341 | Bacteria | 5011 |
| 36 | Ga0070691_10043311 | 3300005341 | Bacteria | 2132 |
| 37 | Ga0070691_10080104 | 3300005341 | Bacteria | 1597 |
| 38 | Ga0070687_100006985 | 3300005343 | Bacteria | 4671 |
| 39 | Ga0070687_100165095 | 3300005343 | Bacteria | 1313 |
| 40 | Ga0070661_100014385 | 3300005344 | Bacteria | 5575 |
| 41 | Ga0070661_100175352 | 3300005344 | Bacteria | 1629 |
| 42 | Ga0070692_10010738 | 3300005345 | Bacteria | 4182 |
| 43 | Ga0070692_10019330 | 3300005345 | Bacteria | 3286 |
| 44 | Ga0070692_10063082 | 3300005345 | Bacteria | 1957 |
| 45 | Ga0070668_100008548 | 3300005347 | Bacteria | 7603 |
| 46 | Ga0070668_100234735 | 3300005347 | Bacteria | 1517 |
| 47 | Ga0070669_100008226 | 3300005353 | Bacteria | 7450 |
| 48 | Ga0070669_100017213 | 3300005353 | Bacteria | 5157 |
| 49 | Ga0070669_100136963 | 3300005353 | Bacteria | 1884 |
| 50 | Ga0070669_100427719 | 3300005353 | Bacteria | 1088 |
| 51 | Ga0070675_100001473 | 3300005354 | Bacteria | 17347 |
| 52 | Ga0070675_100002028 | 3300005354 | Bacteria | 15019 |
| 53 | Ga0070675_100067768 | 3300005354 | Bacteria | 2953 |
| 54 | Ga0070675_100071907 | 3300005354 | Bacteria | 2870 |
| 55 | Ga0070675_100123743 | 3300005354 | Bacteria | 2199 |
| 56 | Ga0070675_100141154 | 3300005354 | Bacteria | 2059 |
| 57 | Ga0070675_100165162 | 3300005354 | Bacteria | 1906 |
| 58 | Ga0070671_100009036 | 3300005355 | Bacteria | 7995 |
| 59 | Ga0070671_100036288 | 3300005355 | Bacteria | 4087 |
| 60 | Ga0070671_100084085 | 3300005355 | Bacteria | 2661 |
| 61 | Ga0070671_100140401 | 3300005355 | Bacteria | 2039 |
| 62 | Ga0070671_100401901 | 3300005355 | Bacteria | 1172 |
| 63 | Ga0070674_100002004 | 3300005356 | Bacteria | 11146 |
| 64 | Ga0070674_100028613 | 3300005356 | Bacteria | 3661 |
| 65 | Ga0070674_100175157 | 3300005356 | Bacteria | 1638 |
| 66 | Ga0070673_100101863 | 3300005364 | Bacteria | 2366 |
| 67 | Ga0070673_100124185 | 3300005364 | Bacteria | 2157 |
| 68 | Ga0070673_100158064 | 3300005364 | Bacteria | 1925 |
| 69 | Ga0070673_100406408 | 3300005364 | Bacteria | 1218 |
| 70 | Ga0070688_100047448 | 3300005365 | Bacteria | 2665 |
| 71 | Ga0070659_100010360 | 3300005366 | Bacteria | 6855 |
| 72 | Ga0070659_100060037 | 3300005366 | Bacteria | 3003 |
| 73 | Ga0070659_100191593 | 3300005366 | Bacteria | 1681 |
| 74 | Ga0070667_100006537 | 3300005367 | Bacteria | 9688 |
| 75 | Ga0070667_100044986 | 3300005367 | Bacteria | 3710 |
| 76 | Ga0070667_100105902 | 3300005367 | Bacteria | 2434 |
| 77 | Ga0070667_100301233 | 3300005367 | Bacteria | 1443 |
| 78 | Ga0070703_10013028 | 3300005406 | Bacteria | 2358 |
| 79 | Ga0070701_10013724 | 3300005438 | Bacteria | 3693 |
| 80 | Ga0070701_10026441 | 3300005438 | Bacteria | 2830 |
| 81 | Ga0070705_100013330 | 3300005440 | Bacteria | 4200 |
| 82 | Ga0070700_100032115 | 3300005441 | Bacteria | 3153 |
| 83 | Ga0070694_100007631 | 3300005444 | Bacteria | 6605 |
| 84 | Ga0070694_100010632 | 3300005444 | Bacteria | 5684 |
| 85 | Ga0070694_100021213 | 3300005444 | Bacteria | 4147 |
| 86 | Ga0070694_100059069 | 3300005444 | Bacteria | 2610 |
| 87 | Ga0070694_100098524 | 3300005444 | Bacteria | 2064 |
| 88 | Ga0070694_100171856 | 3300005444 | Bacteria | 1597 |
| 89 | Ga0070708_100029627 | 3300005445 | Bacteria | 4721 |
| 90 | Ga0070708_100073242 | 3300005445 | Bacteria | 3087 |
| 91 | Ga0070708_100073742 | 3300005445 | Bacteria | 3077 |
| 92 | Ga0070708_100347983 | 3300005445 | Bacteria | 1396 |
| 93 | Ga0070708_100390521 | 3300005445 | Bacteria | 1312 |
| 94 | Ga0070663_100023705 | 3300005455 | Bacteria | 4117 |
| 95 | Ga0070663_100051958 | 3300005455 | Bacteria | 2922 |
| 96 | Ga0070663_100251018 | 3300005455 | Bacteria | 1400 |
| 97 | Ga0070678_100005290 | 3300005456 | Bacteria | 7437 |
| 98 | Ga0070678_100008881 | 3300005456 | Bacteria | 6048 |
| 99 | Ga0070678_100009981 | 3300005456 | Bacteria | 5777 |
| 100 | Ga0070678_100202337 | 3300005456 | Bacteria | 1640 |
| 101 | Ga0070678_100223072 | 3300005456 | Bacteria | 1567 |
| 102 | Ga0070662_100018150 | 3300005457 | Bacteria | 4755 |
| 103 | Ga0070662_100033808 | 3300005457 | Bacteria | 3602 |
| 104 | Ga0070662_100074293 | 3300005457 | Bacteria | 2514 |
| 105 | Ga0070662_100202242 | 3300005457 | Bacteria | 1577 |
| 106 | Ga0068867_100009158 | 3300005459 | Bacteria | 6987 |
| 107 | Ga0068867_100039396 | 3300005459 | Bacteria | 3445 |
| 108 | Ga0068867_100092052 | 3300005459 | Bacteria | 2302 |
| 109 | Ga0068867_100257763 | 3300005459 | Bacteria | 1421 |
| 110 | Ga0070685_10219435 | 3300005466 | Bacteria | 1245 |
| 111 | Ga0070706_100042313 | 3300005467 | Bacteria | 4208 |
| 112 | Ga0070706_100073656 | 3300005467 | Bacteria | 3161 |
| 113 | Ga0070707_100006533 | 3300005468 | Bacteria | 10828 |
| 114 | Ga0070707_100041813 | 3300005468 | Bacteria | 4387 |
| 115 | Ga0070707_100044956 | 3300005468 | Bacteria | 4227 |
| 116 | Ga0070707_100069854 | 3300005468 | Bacteria | 3382 |
| 117 | Ga0070707_100354277 | 3300005468 | Bacteria | 1425 |
| 118 | Ga0070707_100481496 | 3300005468 | Bacteria | 1202 |
| 119 | Ga0070698_100006586 | 3300005471 | Bacteria | 12593 |
| 120 | Ga0070698_100038527 | 3300005471 | Bacteria | 4925 |
| 121 | Ga0070698_100239084 | 3300005471 | Bacteria | 1749 |
| 122 | Ga0070698_100300525 | 3300005471 | Unclassified | 1536 |
| 123 | Ga0070698_100663025 | 3300005471 | Bacteria | 985 |
| 124 | Ga0070699_100019038 | 3300005518 | Bacteria | 5905 |
| 125 | Ga0070699_100060621 | 3300005518 | Bacteria | 3279 |
| 126 | Ga0070699_100440720 | 3300005518 | Bacteria | 1180 |
| 127 | Ga0070679_100033201 | 3300005530 | Bacteria | 5110 |
| 128 | Ga0070679_100115287 | 3300005530 | Bacteria | 2672 |
| 129 | Ga0070684_100010489 | 3300005535 | Bacteria | 7343 |
| 130 | Ga0070684_100017959 | 3300005535 | Bacteria | 5815 |
| 131 | Ga0070684_100517726 | 3300005535 | Bacteria | 1105 |
| 132 | Ga0070697_100012294 | 3300005536 | Bacteria | 6706 |
| 133 | Ga0070697_100019590 | 3300005536 | Bacteria | 5345 |
| 134 | Ga0070697_100312598 | 3300005536 | Bacteria | 1352 |
| 135 | Ga0070697_100374499 | 3300005536 | Bacteria | 1232 |
| 136 | Ga0070672_100000367 | 3300005543 | Bacteria | 25974 |
| 137 | Ga0070672_100007088 | 3300005543 | Bacteria | 7582 |
| 138 | Ga0070672_100061957 | 3300005543 | Bacteria | 2950 |
| 139 | Ga0070672_100101293 | 3300005543 | Bacteria | 2336 |
| 140 | Ga0070672_100113183 | 3300005543 | Bacteria | 2214 |
| 141 | Ga0070672_100217578 | 3300005543 | Bacteria | 1601 |
| 142 | Ga0070672_100321905 | 3300005543 | Bacteria | 1315 |
| 143 | Ga0070686_100039323 | 3300005544 | Bacteria | 2947 |
| 144 | Ga0070695_100002303 | 3300005545 | Bacteria | 10951 |
| 145 | Ga0070695_100014436 | 3300005545 | Bacteria | 4762 |
| 146 | Ga0070695_100293142 | 3300005545 | Bacteria | 1200 |
| 147 | Ga0070696_100001449 | 3300005546 | Bacteria | 15529 |
| 148 | Ga0070696_100025581 | 3300005546 | Unclassified | 4014 |
| 149 | Ga0070696_100044578 | 3300005546 | Bacteria | 3071 |
| 150 | Ga0070693_100000500 | 3300005547 | Bacteria | 17545 |
| 151 | Ga0070693_100051699 | 3300005547 | Bacteria | 2354 |
| 152 | Ga0070693_100207726 | 3300005547 | Bacteria | 1276 |
| 153 | Ga0070665_100206576 | 3300005548 | Bacteria | 1964 |
| 154 | Ga0070704_100002668 | 3300005549 | Bacteria | 10079 |
| 155 | Ga0070704_100113857 | 3300005549 | Bacteria | 2063 |
| 156 | Ga0070704_100208137 | 3300005549 | Bacteria | 1583 |
| 157 | Ga0068855_100047419 | 3300005563 | Bacteria | 5075 |
| 158 | Ga0068855_100296977 | 3300005563 | Bacteria | 1790 |
| 159 | Ga0070664_100044502 | 3300005564 | Bacteria | 3748 |
| 160 | Ga0070664_100097835 | 3300005564 | Bacteria | 2548 |
| 161 | Ga0070664_100142653 | 3300005564 | Bacteria | 2110 |
| 162 | Ga0070664_100277572 | 3300005564 | Bacteria | 1510 |
| 163 | Ga0070664_100345530 | 3300005564 | Bacteria | 1352 |
| 164 | Ga0068857_100010492 | 3300005577 | Bacteria | 8051 |
| 165 | Ga0068857_100017565 | 3300005577 | Bacteria | 6272 |
| 166 | Ga0068854_100022784 | 3300005578 | Bacteria | 4273 |
| 167 | Ga0068854_100056187 | 3300005578 | Bacteria | 2836 |
| 168 | Ga0068854_100066784 | 3300005578 | Bacteria | 2618 |
| 169 | Ga0068856_100059275 | 3300005614 | Bacteria | 3781 |
| 170 | Ga0068856_100134328 | 3300005614 | Bacteria | 2480 |
| 171 | Ga0068856_100201548 | 3300005614 | Bacteria | 2004 |
| 172 | Ga0070702_100058658 | 3300005615 | Bacteria | 2231 |
| 173 | Ga0068852_100003436 | 3300005616 | Bacteria | 11066 |
| 174 | Ga0068852_100060689 | 3300005616 | Bacteria | 3283 |
| 175 | Ga0068852_100143093 | 3300005616 | Bacteria | 2215 |
| 176 | Ga0068859_100010053 | 3300005617 | Bacteria | 9540 |
| 177 | Ga0068859_100048511 | 3300005617 | Bacteria | 4265 |
| 178 | Ga0068859_100190461 | 3300005617 | Bacteria | 2135 |
| 179 | Ga0068859_100195161 | 3300005617 | Bacteria | 2109 |
| 180 | Ga0068864_100001463 | 3300005618 | Bacteria | 19462 |
| 181 | Ga0068864_100057592 | 3300005618 | Bacteria | 3357 |
| 182 | Ga0068864_100380419 | 3300005618 | Bacteria | 1338 |
| 183 | Ga0068866_10023300 | 3300005718 | Bacteria | 2878 |
| 184 | Ga0068866_10351328 | 3300005718 | Bacteria | 937 |
| 185 | Ga0068861_100021240 | 3300005719 | Bacteria | 4666 |
| 186 | Ga0068861_100046165 | 3300005719 | Bacteria | 3283 |
| 187 | Ga0068861_100057457 | 3300005719 | Bacteria | 2972 |
| 188 | Ga0068861_100243854 | 3300005719 | Bacteria | 1530 |
| 189 | Ga0068861_100325479 | 3300005719 | Bacteria | 1340 |
| 190 | Ga0068861_100670006 | 3300005719 | Bacteria | 960 |
| 191 | Ga0068851_10007610 | 3300005834 | Bacteria | 4980 |
| 192 | Ga0068851_10160699 | 3300005834 | Bacteria | 1234 |
| 193 | Ga0068870_10002795 | 3300005840 | Bacteria | 7343 |
| 194 | Ga0068870_10154212 | 3300005840 | Bacteria | 1356 |
| 195 | Ga0068863_100061813 | 3300005841 | Bacteria | 3541 |
| 196 | Ga0068863_100173374 | 3300005841 | Bacteria | 2069 |
| 197 | Ga0068863_100283544 | 3300005841 | Bacteria | 1605 |
| 198 | Ga0068863_100331919 | 3300005841 | Bacteria | 1478 |
| 199 | Ga0068858_100011584 | 3300005842 | Bacteria | 8317 |
| 200 | Ga0068858_100030957 | 3300005842 | Bacteria | 4969 |
| 201 | Ga0068858_100076480 | 3300005842 | Bacteria | 3109 |
| 202 | Ga0068860_100032817 | 3300005843 | Bacteria | 4987 |
| 203 | Ga0068860_100076166 | 3300005843 | Bacteria | 3191 |
| 204 | Ga0068860_100077735 | 3300005843 | Bacteria | 3156 |
| 205 | Ga0068862_100016038 | 3300005844 | Bacteria | 6231 |
| 206 | Ga0068862_100055423 | 3300005844 | Bacteria | 3396 |
| 207 | Ga0068862_100079266 | 3300005844 | Bacteria | 2847 |
| 208 | Ga0068862_100093982 | 3300005844 | Bacteria | 2615 |
| 209 | Ga0068862_100154945 | 3300005844 | Bacteria | 2042 |
| 210 | Ga0068862_100298665 | 3300005844 | Bacteria | 1481 |
| 211 | Ga0068862_100459674 | 3300005844 | Bacteria | 1201 |
| 212 | Ga0068862_100534187 | 3300005844 | Bacteria | 1118 |
| 213 | Ga0081455_10005497 | 3300005937 | Bacteria | 13890 |
| 214 | Ga0081540_1001963 | 3300005983 | Bacteria | 17161 |
| 215 | Ga0070712_100003912 | 3300006175 | Bacteria | 9172 |
| 216 | Ga0097621_100027168 | 3300006237 | Bacteria | 4498 |
| 217 | Ga0097621_100057405 | 3300006237 | Bacteria | 3183 |
| 218 | Ga0068871_100053922 | 3300006358 | Bacteria | 3261 |
| 219 | Ga0068871_100077544 | 3300006358 | Bacteria | 2746 |
| 220 | Ga0068871_100077658 | 3300006358 | Bacteria | 2744 |
| 221 | Ga0068871_100370051 | 3300006358 | Bacteria | 1271 |
| 222 | Ga0075428_100049288 | 3300006844 | Bacteria | 4621 |
| 223 | Ga0075428_100208263 | 3300006844 | Bacteria | 2113 |
| 224 | Ga0075428_100219056 | 3300006844 | Bacteria | 2055 |
| 225 | Ga0075428_100320061 | 3300006844 | Bacteria | 1667 |
| 226 | Ga0075428_100628764 | 3300006844 | Bacteria | 1146 |
| 227 | Ga0075430_100004554 | 3300006846 | Bacteria | 11672 |
| 228 | Ga0075430_100012821 | 3300006846 | Bacteria | 7142 |
| 229 | Ga0075430_100066435 | 3300006846 | Bacteria | 3028 |
| 230 | Ga0075431_100001553 | 3300006847 | Bacteria | 21303 |
| 231 | Ga0075431_100002850 | 3300006847 | Bacteria | 16729 |
| 232 | Ga0075431_100030281 | 3300006847 | Bacteria | 5574 |
| 233 | Ga0075431_100073471 | 3300006847 | Bacteria | 3528 |
| 234 | Ga0075431_100131330 | 3300006847 | Bacteria | 2583 |
| 235 | Ga0075431_100163293 | 3300006847 | Bacteria | 2290 |
| 236 | Ga0075431_100243790 | 3300006847 | Bacteria | 1827 |
| 237 | Ga0075431_100308463 | 3300006847 | Bacteria | 1598 |
| 238 | Ga0075431_100412554 | 3300006847 | Bacteria | 1350 |
| 239 | Ga0075431_100451208 | 3300006847 | Bacteria | 1282 |
| 240 | Ga0075433_10003788 | 3300006852 | Bacteria | 11715 |
| 241 | Ga0075433_10037773 | 3300006852 | Bacteria | 4167 |
| 242 | Ga0075434_100008812 | 3300006871 | Bacteria | 9390 |
| 243 | Ga0075434_100010825 | 3300006871 | Bacteria | 8572 |
| 244 | Ga0075434_100027528 | 3300006871 | Bacteria | 5583 |
| 245 | Ga0075434_100052065 | 3300006871 | Bacteria | 4068 |
| 246 | Ga0075434_100333616 | 3300006871 | Bacteria | 1537 |
| 247 | Ga0075429_100002484 | 3300006880 | Bacteria | 15519 |
| 248 | Ga0075429_100003767 | 3300006880 | Bacteria | 12927 |
| 249 | Ga0075429_100080569 | 3300006880 | Bacteria | 2838 |
| 250 | Ga0075429_100179331 | 3300006880 | Bacteria | 1856 |
| 251 | Ga0075429_100598244 | 3300006880 | Unclassified | 966 |
| 252 | Ga0068865_100027578 | 3300006881 | Bacteria | 3752 |
| 253 | Ga0068865_100106877 | 3300006881 | Bacteria | 2058 |
| 254 | Ga0068865_100158436 | 3300006881 | Bacteria | 1724 |
| 255 | Ga0097620_100010053 | 3300006931 | Bacteria | 9540 |
| 256 | Ga0097620_100048512 | 3300006931 | Bacteria | 4265 |
| 257 | Ga0097620_100190449 | 3300006931 | Bacteria | 2135 |
| 258 | Ga0097620_100195163 | 3300006931 | Bacteria | 2109 |
| 259 | Ga0075435_100002991 | 3300007076 | Bacteria | 11373 |
| 260 | Ga0075435_100109652 | 3300007076 | Bacteria | 2295 |
| 261 | Ga0075435_100211384 | 3300007076 | Bacteria | 1646 |
| 262 | Ga0105250_10138870 | 3300009092 | Bacteria | 1006 |
| 263 | Ga0105240_10204521 | 3300009093 | Bacteria | 2312 |
| 264 | Ga0111539_10064141 | 3300009094 | Bacteria | 4348 |
| 265 | Ga0111539_10080686 | 3300009094 | Bacteria | 3827 |
| 266 | Ga0111539_10445188 | 3300009094 | Bacteria | 1508 |
| 267 | Ga0111539_10446254 | 3300009094 | Bacteria | 1506 |
| 268 | Ga0111539_10742846 | 3300009094 | Bacteria | 1142 |
| 269 | Ga0105245_10171232 | 3300009098 | Bacteria | 2068 |
| 270 | Ga0105245_10292954 | 3300009098 | Bacteria | 1595 |
| 271 | Ga0114129_10000404 | 3300009147 | Bacteria | 50669 |
| 272 | Ga0114129_10012932 | 3300009147 | Bacteria | 11877 |
| 273 | Ga0114129_10020555 | 3300009147 | Bacteria | 9389 |
| 274 | Ga0114129_10030580 | 3300009147 | Bacteria | 7619 |
| 275 | Ga0114129_10040169 | 3300009147 | Bacteria | 6596 |
| 276 | Ga0114129_10072480 | 3300009147 | Bacteria | 4801 |
| 277 | Ga0114129_10330122 | 3300009147 | Bacteria | 2025 |
| 278 | Ga0105243_10040301 | 3300009148 | Bacteria | 3646 |
| 279 | Ga0105243_10051221 | 3300009148 | Bacteria | 3265 |
| 280 | Ga0105243_10079378 | 3300009148 | Bacteria | 2675 |
| 281 | Ga0105243_10144850 | 3300009148 | Bacteria | 2031 |
| 282 | Ga0105242_10003134 | 3300009176 | Bacteria | 12908 |
| 283 | Ga0105242_10021582 | 3300009176 | Bacteria | 5058 |
| 284 | Ga0105242_10115400 | 3300009176 | Bacteria | 2296 |
| 285 | Ga0105248_10021675 | 3300009177 | Bacteria | 7117 |
| 286 | Ga0105248_10080234 | 3300009177 | Bacteria | 3667 |
| 287 | Ga0105248_10347494 | 3300009177 | Bacteria | 1670 |
| 288 | Ga0105237_10145509 | 3300009545 | Bacteria | 2365 |
| 289 | Ga0105238_10007362 | 3300009551 | Bacteria | 11022 |
| 290 | Ga0105249_10058975 | 3300009553 | Bacteria | 3519 |
| 291 | Ga0105249_10078076 | 3300009553 | Bacteria | 3072 |
| 292 | Ga0105249_10079624 | 3300009553 | Bacteria | 3042 |
| 293 | Ga0105249_10090602 | 3300009553 | Bacteria | 2859 |
| 294 | Ga0105249_10128679 | 3300009553 | Bacteria | 2415 |
| 295 | Ga0105249_10489576 | 3300009553 | Bacteria | 1273 |
| 296 | Ga0105249_10708819 | 3300009553 | Bacteria | 1067 |
| 297 | Ga0105239_10137492 | 3300010375 | Bacteria | 2720 |
| 298 | Ga0105246_10432177 | 3300011119 | Bacteria | 1102 |
| 299 | Ga0157373_10009169 | 3300013100 | Bacteria | 7317 |
| 300 | Ga0157373_10029670 | 3300013100 | Bacteria | 3938 |
| 301 | Ga0157371_10037931 | 3300013102 | Bacteria | 3448 |
| 302 | Ga0157370_10279402 | 3300013104 | Bacteria | 1543 |
| 303 | Ga0157369_10022216 | 3300013105 | Bacteria | 7085 |
| 304 | Ga0157369_10159570 | 3300013105 | Bacteria | 2380 |
| 305 | Ga0157374_10027157 | 3300013296 | Bacteria | 5160 |
| 306 | Ga0157378_10142178 | 3300013297 | Bacteria | 2229 |
| 307 | Ga0163162_10048029 | 3300013306 | Bacteria | 4277 |
| 308 | Ga0163162_10281320 | 3300013306 | Bacteria | 1796 |
| 309 | Ga0157372_10100255 | 3300013307 | Bacteria | 3305 |
| 310 | Ga0157375_10019729 | 3300013308 | Bacteria | 6141 |
| 311 | Ga0157375_10055410 | 3300013308 | Bacteria | 3909 |
| 312 | Ga0157375_10122639 | 3300013308 | Bacteria | 2710 |
| 313 | Ga0157375_10285477 | 3300013308 | Bacteria | 1814 |
| 314 | Ga0157375_10356485 | 3300013308 | Bacteria | 1629 |
| 315 | Ga0163163_10020609 | 3300014325 | Bacteria | 6214 |
| 316 | Ga0163163_10066450 | 3300014325 | Bacteria | 3581 |
| 317 | Ga0163163_10075895 | 3300014325 | Bacteria | 3355 |
| 318 | Ga0163163_10457677 | 3300014325 | Bacteria | 1336 |
| 319 | Ga0157380_10017786 | 3300014326 | Bacteria | 5267 |
| 320 | Ga0157380_10070708 | 3300014326 | Bacteria | 2821 |
| 321 | Ga0157377_10013835 | 3300014745 | Bacteria | 4091 |
| 322 | Ga0157377_10130712 | 3300014745 | Bacteria | 1533 |
| 323 | Ga0157379_10049404 | 3300014968 | Bacteria | 3756 |
| 324 | Ga0157379_10049604 | 3300014968 | Bacteria | 3749 |
| 325 | Ga0157379_10086963 | 3300014968 | Bacteria | 2803 |
| 326 | Ga0157379_10134992 | 3300014968 | Bacteria | 2223 |
| 327 | Ga0157376_10327049 | 3300014969 | Bacteria | 1459 |
| 328 | Ga0157376_10376071 | 3300014969 | Bacteria | 1367 |
| 329 | Ga0163161_10038748 | 3300017792 | Bacteria | 3419 |
| 330 | Ga0163161_10096543 | 3300017792 | Bacteria | 2194 |
| 331 | Ga0163161_10223126 | 3300017792 | Bacteria | 1460 |
| 332 | Ga0207697_10012608 | 3300025315 | Bacteria | 3540 |
| 333 | Ga0207697_10054956 | 3300025315 | Bacteria | 1650 |
| 334 | Ga0207656_10006250 | 3300025321 | Bacteria | 4268 |
| 335 | Ga0207656_10068267 | 3300025321 | Bacteria | 1575 |
| 336 | Ga0207653_10010751 | 3300025885 | Bacteria | 2855 |
| 337 | Ga0207682_10001930 | 3300025893 | Bacteria | 9419 |
| 338 | Ga0207682_10039867 | 3300025893 | Bacteria | 1911 |
| 339 | Ga0207682_10071731 | 3300025893 | Bacteria | 1468 |
| 340 | Ga0207642_10007895 | 3300025899 | Bacteria | 3617 |
| 341 | Ga0207642_10058446 | 3300025899 | Bacteria | 1779 |
| 342 | Ga0207642_10280851 | 3300025899 | Bacteria | 958 |
| 343 | Ga0207688_10017353 | 3300025901 | Bacteria | 3911 |
| 344 | Ga0207688_10044220 | 3300025901 | Bacteria | 2482 |
| 345 | Ga0207688_10087373 | 3300025901 | Bacteria | 1787 |
| 346 | Ga0207680_10042049 | 3300025903 | Bacteria | 2671 |
| 347 | Ga0207680_10196389 | 3300025903 | Bacteria | 1372 |
| 348 | Ga0207645_10000202 | 3300025907 | Bacteria | 48725 |
| 349 | Ga0207645_10019805 | 3300025907 | Bacteria | 4406 |
| 350 | Ga0207645_10027607 | 3300025907 | Bacteria | 3663 |
| 351 | Ga0207645_10030712 | 3300025907 | Bacteria | 3462 |
| 352 | Ga0207645_10033748 | 3300025907 | Bacteria | 3288 |
| 353 | Ga0207645_10042982 | 3300025907 | Bacteria | 2891 |
| 354 | Ga0207645_10250132 | 3300025907 | Bacteria | 1172 |
| 355 | Ga0207643_10001338 | 3300025908 | Bacteria | 14254 |
| 356 | Ga0207643_10019020 | 3300025908 | Bacteria | 3762 |
| 357 | Ga0207643_10029595 | 3300025908 | Bacteria | 3046 |
| 358 | Ga0207684_10000570 | 3300025910 | Bacteria | 44869 |
| 359 | Ga0207684_10091874 | 3300025910 | Bacteria | 2587 |
| 360 | Ga0207684_10113792 | 3300025910 | Bacteria | 2316 |
| 361 | Ga0207707_10001262 | 3300025912 | Bacteria | 23671 |
| 362 | Ga0207693_10017649 | 3300025915 | Bacteria | 5690 |
| 363 | Ga0207660_10004094 | 3300025917 | Bacteria | 9496 |
| 364 | Ga0207660_10018952 | 3300025917 | Bacteria | 4596 |
| 365 | Ga0207662_10021081 | 3300025918 | Bacteria | 3720 |
| 366 | Ga0207662_10042917 | 3300025918 | Bacteria | 2667 |
| 367 | Ga0207657_10028062 | 3300025919 | Bacteria | 5143 |
| 368 | Ga0207657_10100472 | 3300025919 | Bacteria | 2401 |
| 369 | Ga0207657_10213023 | 3300025919 | Bacteria | 1550 |
| 370 | Ga0207649_10068246 | 3300025920 | Bacteria | 2260 |
| 371 | Ga0207652_10082207 | 3300025921 | Bacteria | 2818 |
| 372 | Ga0207646_10000408 | 3300025922 | Bacteria | 57610 |
| 373 | Ga0207646_10009380 | 3300025922 | Bacteria | 9674 |
| 374 | Ga0207646_10268432 | 3300025922 | Bacteria | 1542 |
| 375 | Ga0207646_10290799 | 3300025922 | Bacteria | 1476 |
| 376 | Ga0207646_10665423 | 3300025922 | Bacteria | 932 |
| 377 | Ga0207681_10004718 | 3300025923 | Bacteria | 8386 |
| 378 | Ga0207681_10071611 | 3300025923 | Bacteria | 2418 |
| 379 | Ga0207694_10010481 | 3300025924 | Bacteria | 6990 |
| 380 | Ga0207650_10002288 | 3300025925 | Bacteria | 13348 |
| 381 | Ga0207650_10007617 | 3300025925 | Bacteria | 7378 |
| 382 | Ga0207650_10489180 | 3300025925 | Bacteria | 1027 |
| 383 | Ga0207650_10530028 | 3300025925 | Bacteria | 986 |
| 384 | Ga0207659_10001251 | 3300025926 | Bacteria | 15213 |
| 385 | Ga0207659_10008394 | 3300025926 | Bacteria | 6410 |
| 386 | Ga0207659_10042664 | 3300025926 | Bacteria | 3182 |
| 387 | Ga0207659_10048389 | 3300025926 | Bacteria | 3012 |
| 388 | Ga0207659_10098723 | 3300025926 | Bacteria | 2196 |
| 389 | Ga0207659_10136798 | 3300025926 | Bacteria | 1897 |
| 390 | Ga0207687_10516559 | 3300025927 | Bacteria | 999 |
| 391 | Ga0207644_10004038 | 3300025931 | Bacteria | 9522 |
| 392 | Ga0207644_10007517 | 3300025931 | Bacteria | 7105 |
| 393 | Ga0207644_10055781 | 3300025931 | Bacteria | 2849 |
| 394 | Ga0207644_10151962 | 3300025931 | Bacteria | 1792 |
| 395 | Ga0207644_10326758 | 3300025931 | Bacteria | 1241 |
| 396 | Ga0207690_10037362 | 3300025932 | Bacteria | 3152 |
| 397 | Ga0207706_10001207 | 3300025933 | Bacteria | 26108 |
| 398 | Ga0207706_10043340 | 3300025933 | Bacteria | 3988 |
| 399 | Ga0207706_10047809 | 3300025933 | Bacteria | 3785 |
| 400 | Ga0207706_10122724 | 3300025933 | Bacteria | 2285 |
| 401 | Ga0207706_10133013 | 3300025933 | Bacteria | 2188 |
| 402 | Ga0207706_10154489 | 3300025933 | Bacteria | 2019 |
| 403 | Ga0207686_10017797 | 3300025934 | Bacteria | 4010 |
| 404 | Ga0207686_10085005 | 3300025934 | Bacteria | 2074 |
| 405 | Ga0207709_10005183 | 3300025935 | Bacteria | 7423 |
| 406 | Ga0207709_10142700 | 3300025935 | Bacteria | 1648 |
| 407 | Ga0207709_10248760 | 3300025935 | Bacteria | 1297 |
| 408 | Ga0207670_10003407 | 3300025936 | Bacteria | 8440 |
| 409 | Ga0207669_10006304 | 3300025937 | Bacteria | 5408 |
| 410 | Ga0207669_10016994 | 3300025937 | Bacteria | 3717 |
| 411 | Ga0207669_10120603 | 3300025937 | Bacteria | 1779 |
| 412 | Ga0207669_10312289 | 3300025937 | Bacteria | 1199 |
| 413 | Ga0207704_10037100 | 3300025938 | Bacteria | 2812 |
| 414 | Ga0207704_10108423 | 3300025938 | Bacteria | 1870 |
| 415 | Ga0207704_10120544 | 3300025938 | Bacteria | 1794 |
| 416 | Ga0207704_10446031 | 3300025938 | Bacteria | 1032 |
| 417 | Ga0207665_10033122 | 3300025939 | Bacteria | 3423 |
| 418 | Ga0207691_10001841 | 3300025940 | Bacteria | 20724 |
| 419 | Ga0207691_10006856 | 3300025940 | Bacteria | 10989 |
| 420 | Ga0207691_10031141 | 3300025940 | Bacteria | 4981 |
| 421 | Ga0207691_10057440 | 3300025940 | Bacteria | 3541 |
| 422 | Ga0207691_10082635 | 3300025940 | Bacteria | 2885 |
| 423 | Ga0207691_10091124 | 3300025940 | Bacteria | 2732 |
| 424 | Ga0207691_10259486 | 3300025940 | Bacteria | 1498 |
| 425 | Ga0207711_10006733 | 3300025941 | Bacteria | 9666 |
| 426 | Ga0207711_10128246 | 3300025941 | Bacteria | 2271 |
| 427 | Ga0207689_10000275 | 3300025942 | Bacteria | 46532 |
| 428 | Ga0207689_10003015 | 3300025942 | Bacteria | 15525 |
| 429 | Ga0207689_10009225 | 3300025942 | Bacteria | 8532 |
| 430 | Ga0207689_10019551 | 3300025942 | Bacteria | 5707 |
| 431 | Ga0207689_10027831 | 3300025942 | Bacteria | 4730 |
| 432 | Ga0207689_10081455 | 3300025942 | Bacteria | 2660 |
| 433 | Ga0207689_10088553 | 3300025942 | Bacteria | 2543 |
| 434 | Ga0207661_10063406 | 3300025944 | Bacteria | 2993 |
| 435 | Ga0207679_10031738 | 3300025945 | Bacteria | 3700 |
| 436 | Ga0207679_10101871 | 3300025945 | Bacteria | 2247 |
| 437 | Ga0207679_10311838 | 3300025945 | Bacteria | 1359 |
| 438 | Ga0207667_10001262 | 3300025949 | Bacteria | 31744 |
| 439 | Ga0207667_10066485 | 3300025949 | Bacteria | 3757 |
| 440 | Ga0207667_10120562 | 3300025949 | Bacteria | 2703 |
| 441 | Ga0207651_10009356 | 3300025960 | Bacteria | 5358 |
| 442 | Ga0207651_10058708 | 3300025960 | Bacteria | 2660 |
| 443 | Ga0207651_10130199 | 3300025960 | Bacteria | 1925 |
| 444 | Ga0207651_10254175 | 3300025960 | Bacteria | 1439 |
| 445 | Ga0207712_10077336 | 3300025961 | Bacteria | 2411 |
| 446 | Ga0207712_10104512 | 3300025961 | Bacteria | 2112 |
| 447 | Ga0207712_10122453 | 3300025961 | Bacteria | 1970 |
| 448 | Ga0207712_10410413 | 3300025961 | Bacteria | 1140 |
| 449 | Ga0207712_10432998 | 3300025961 | Bacteria | 1112 |
| 450 | Ga0207668_10125874 | 3300025972 | Bacteria | 1948 |
| 451 | Ga0207668_10162154 | 3300025972 | Bacteria | 1743 |
| 452 | Ga0207640_10058290 | 3300025981 | Bacteria | 2543 |
| 453 | Ga0207640_10178391 | 3300025981 | Bacteria | 1590 |
| 454 | Ga0207640_10295073 | 3300025981 | Bacteria | 1280 |
| 455 | Ga0207658_10020226 | 3300025986 | Bacteria | 4609 |
| 456 | Ga0207658_10038082 | 3300025986 | Bacteria | 3462 |
| 457 | Ga0207658_10052272 | 3300025986 | Bacteria | 3014 |
| 458 | Ga0207677_10010426 | 3300026023 | Bacteria | 5258 |
| 459 | Ga0207677_10017562 | 3300026023 | Bacteria | 4271 |
| 460 | Ga0207677_10179252 | 3300026023 | Bacteria | 1665 |
| 461 | Ga0207703_10004365 | 3300026035 | Bacteria | 11622 |
| 462 | Ga0207703_10072760 | 3300026035 | Bacteria | 2842 |
| 463 | Ga0207703_10188136 | 3300026035 | Bacteria | 1826 |
| 464 | Ga0207703_10713381 | 3300026035 | Bacteria | 954 |
| 465 | Ga0207639_10030572 | 3300026041 | Bacteria | 3950 |
| 466 | Ga0207639_10184678 | 3300026041 | Bacteria | 1777 |
| 467 | Ga0207678_10018359 | 3300026067 | Bacteria | 6143 |
| 468 | Ga0207678_10080961 | 3300026067 | Bacteria | 2779 |
| 469 | Ga0207708_10014113 | 3300026075 | Bacteria | 5971 |
| 470 | Ga0207702_10004046 | 3300026078 | Bacteria | 13163 |
| 471 | Ga0207641_10029872 | 3300026088 | Bacteria | 4508 |
| 472 | Ga0207641_10194187 | 3300026088 | Bacteria | 1867 |
| 473 | Ga0207641_10290888 | 3300026088 | Bacteria | 1540 |
| 474 | Ga0207648_10004610 | 3300026089 | Bacteria | 14130 |
| 475 | Ga0207648_10005184 | 3300026089 | Bacteria | 13193 |
| 476 | Ga0207648_10013731 | 3300026089 | Bacteria | 7519 |
| 477 | Ga0207648_10017318 | 3300026089 | Bacteria | 6562 |
| 478 | Ga0207648_10046855 | 3300026089 | Bacteria | 3790 |
| 479 | Ga0207648_10084566 | 3300026089 | Bacteria | 2767 |
| 480 | Ga0207648_10107263 | 3300026089 | Bacteria | 2451 |
| 481 | Ga0207648_10212826 | 3300026089 | Bacteria | 1716 |
| 482 | Ga0207676_10005188 | 3300026095 | Bacteria | 9216 |
| 483 | Ga0207676_10233920 | 3300026095 | Bacteria | 1644 |
| 484 | Ga0207674_10030783 | 3300026116 | Bacteria | 5641 |
| 485 | Ga0207674_10056283 | 3300026116 | Bacteria | 3995 |
| 486 | Ga0207674_10073163 | 3300026116 | Bacteria | 3441 |
| 487 | Ga0207674_10082456 | 3300026116 | Bacteria | 3217 |
| 488 | Ga0207674_10224399 | 3300026116 | Bacteria | 1827 |
| 489 | Ga0207674_10308002 | 3300026116 | Bacteria | 1533 |
| 490 | Ga0207675_100004260 | 3300026118 | Bacteria | 13842 |
| 491 | Ga0207675_100004346 | 3300026118 | Bacteria | 13695 |
| 492 | Ga0207675_100012377 | 3300026118 | Bacteria | 7969 |
| 493 | Ga0207675_100033418 | 3300026118 | Bacteria | 4793 |
| 494 | Ga0207675_100134300 | 3300026118 | Bacteria | 2347 |
| 495 | Ga0207675_100196474 | 3300026118 | Bacteria | 1936 |
| 496 | Ga0207675_100639557 | 3300026118 | Bacteria | 1069 |
| 497 | Ga0207683_10003366 | 3300026121 | Bacteria | 13938 |
| 498 | Ga0207683_10005954 | 3300026121 | Bacteria | 10447 |
| 499 | Ga0207683_10094734 | 3300026121 | Bacteria | 2661 |
| 500 | Ga0207683_10133862 | 3300026121 | Bacteria | 2230 |
| 501 | Ga0207683_10134607 | 3300026121 | Bacteria | 2224 |
| 502 | Ga0207683_10175710 | 3300026121 | Bacteria | 1941 |
| 503 | Ga0207683_10190770 | 3300026121 | Bacteria | 1861 |
| 504 | Ga0207683_10243090 | 3300026121 | Bacteria | 1642 |
| 505 | Ga0207698_10052265 | 3300026142 | Bacteria | 3129 |
| 506 | Ga0207698_10067046 | 3300026142 | Bacteria | 2829 |
| 507 | Ga0207698_10090778 | 3300026142 | Bacteria | 2499 |
| 508 | Ga0209969_1010615 | 3300027360 | Bacteria | 1319 |
| 509 | Ga0209967_1020007 | 3300027364 | Bacteria | 974 |
| 510 | Ga0209981_1001982 | 3300027378 | Bacteria | 2617 |
| 511 | Ga0209984_1001927 | 3300027424 | Bacteria | 2288 |
| 512 | Ga0210000_1001061 | 3300027462 | Bacteria | 3845 |
| 513 | Ga0209995_1001661 | 3300027471 | Bacteria | 3457 |
| 514 | Ga0209995_1006498 | 3300027471 | Bacteria | 1880 |
| 515 | Ga0209968_1001914 | 3300027526 | Bacteria | 3161 |
| 516 | Ga0209999_1032194 | 3300027543 | Bacteria | 974 |
| 517 | Ga0209970_1001146 | 3300027614 | Bacteria | 4677 |
| 518 | Ga0210002_1003471 | 3300027617 | Bacteria | 2322 |
| 519 | Ga0209983_1002311 | 3300027665 | Bacteria | 4182 |
| 520 | Ga0209983_1041104 | 3300027665 | Bacteria | 1000 |
| 521 | Ga0209588_1003903 | 3300027671 | Bacteria | 4164 |
| 522 | Ga0209971_1000011 | 3300027682 | Bacteria | 74088 |
| 523 | Ga0209971_1017284 | 3300027682 | Bacteria | 1710 |
| 524 | Ga0209966_1003478 | 3300027695 | Bacteria | 2648 |
| 525 | Ga0209966_1007982 | 3300027695 | Bacteria | 1867 |
| 526 | Ga0209966_1036012 | 3300027695 | Bacteria | 1017 |
| 527 | Ga0209998_10000474 | 3300027717 | Bacteria | 11098 |
| 528 | Ga0209998_10020832 | 3300027717 | Bacteria | 1404 |
| 529 | Ga0209974_10007324 | 3300027876 | Bacteria | 3803 |
| 530 | Ga0209974_10052163 | 3300027876 | Bacteria | 1376 |
| 531 | Ga0207428_10000119 | 3300027907 | Bacteria | 106261 |
| 532 | Ga0268265_10064526 | 3300028380 | Bacteria | 2821 |
| 533 | Ga0268265_10071179 | 3300028380 | Bacteria | 2707 |
| 534 | Ga0268265_10108103 | 3300028380 | Bacteria | 2263 |
| 535 | Ga0268265_10177590 | 3300028380 | Bacteria | 1826 |
| 536 | Ga0268265_10558898 | 3300028380 | Bacteria | 1087 |
| 537 | Ga0268264_10060752 | 3300028381 | Bacteria | 3168 |
| 538 | Ga0268264_10547194 | 3300028381 | Bacteria | 1135 |
| 539 | Ga0307408_100062178 | 3300031548 | Bacteria | 2728 |
| 540 | Ga0307408_100089046 | 3300031548 | Bacteria | 2326 |
| 541 | Ga0307408_100362041 | 3300031548 | Bacteria | 1234 |
| 542 | Ga0307408_100452824 | 3300031548 | Bacteria | 1114 |
| 543 | Ga0307405_10009151 | 3300031731 | Bacteria | 5065 |
| 544 | Ga0307413_10008938 | 3300031824 | Bacteria | 4763 |
| 545 | Ga0307413_10440086 | 3300031824 | Bacteria | 1032 |
| 546 | Ga0307410_10006974 | 3300031852 | Bacteria | 6149 |
| 547 | Ga0307410_10328838 | 3300031852 | Bacteria | 1215 |
| 548 | Ga0307406_10005307 | 3300031901 | Bacteria | 7050 |
| 549 | Ga0307406_10010219 | 3300031901 | Bacteria | 5288 |
| 550 | Ga0307406_10269485 | 3300031901 | Bacteria | 1293 |
| 551 | Ga0307406_10597047 | 3300031901 | Bacteria | 910 |
| 552 | Ga0307407_10059107 | 3300031903 | Bacteria | 2231 |
| 553 | Ga0307412_10021971 | 3300031911 | Bacteria | 3904 |
| 554 | Ga0307412_10058416 | 3300031911 | Bacteria | 2580 |
| 555 | Ga0307409_100003845 | 3300031995 | Bacteria | 8290 |
| 556 | Ga0307409_100037551 | 3300031995 | Bacteria | 3572 |
| 557 | Ga0307416_100006103 | 3300032002 | Bacteria | 7504 |
| 558 | Ga0307416_100015064 | 3300032002 | Bacteria | 5325 |
| 559 | Ga0307416_100113922 | 3300032002 | Bacteria | 2391 |
| 560 | Ga0307416_100360128 | 3300032002 | Bacteria | 1476 |
| 561 | Ga0307411_10001686 | 3300032005 | Bacteria | 9255 |
| 562 | Ga0307415_100003156 | 3300032126 | Bacteria | 8348 |
| 563 | Ga0307415_100047172 | 3300032126 | Bacteria | 2899 |
| 564 | Ga0373959_0007156 | 3300034820 | Bacteria | 1872 |
| 565 | Ga0373928_0052373 | 3300035084 | Bacteria | 967 |
| 566 | Ga0373949_0021317 | 3300035090 | Bacteria | 1489 |
| 567 | Ga0373951_0081861 | 3300035091 | Bacteria | 836 |
| 568 | Ga0373961_0062378 | 3300035241 | Bacteria | 1135 |
| 569 | Ga0373933_0095147 | 3300035724 | Bacteria | 1843 |
| 570 | Ga0373947_0181586 | 3300035725 | Bacteria | 1370 |
| 571 | Ga0373937_0137560 | 3300036401 | Bacteria | 2284 |
| 572 | Ga0242420_022072 | 3300038996 | Bacteria | 1143 |
| 573 | Ga0436365_1520353 | 3300039437 | Bacteria | 3141 |
| 574 | Ga0436363_0880215 | 3300039450 | Bacteria | 2540 |
| 575 | Ga0439453_0024817 | 3300041408 | Unclassified | 1103 |
| 576 | Ga0439461_0001739 | 3300041410 | Bacteria | 3402 |
| 577 | Ga0439441_001036 | 3300042001 | Bacteria | 3443 |
| 578 | Ga0439441_008013 | 3300042001 | Bacteria | 1717 |
| 579 | Ga0439443_002298 | 3300042003 | Bacteria | 2268 |
| 580 | Ga0439446_0006283 | 3300042156 | Bacteria | 3093 |
| 581 | Ga0439458_0004746 | 3300042157 | Bacteria | 3091 |
| 582 | Ga0439434_0000566 | 3300042435 | Bacteria | 10672 |
| 583 | Ga0439435_0000236 | 3300042436 | Bacteria | 7940 |
| 584 | Ga0439435_0000524 | 3300042436 | Bacteria | 6133 |
| 585 | Ga0439444_0000850 | 3300042437 | Bacteria | 3702 |
| 586 | Ga0439460_0000310 | 3300042461 | Bacteria | 10225 |
| 587 | Ga0439460_0004249 | 3300042461 | Bacteria | 3488 |
| 588 | Ga0451577_0001635 | 3300042876 | Bacteria | 29060 |
| 589 | Ga0451577_0092249 | 3300042876 | Bacteria | 2704 |
| 590 | Ga0451577_0286305 | 3300042876 | Bacteria | 1493 |
| 591 | Ga0453683_0033006 | 3300044673 | Bacteria | 3264 |
| 592 | Ga0453683_0047014 | 3300044673 | Bacteria | 2705 |
| 593 | Ga0453683_0049783 | 3300044673 | Bacteria | 2626 |
| 594 | Ga0453684_0022118 | 3300044712 | Bacteria | 9455 |
| 595 | Ga0453684_0378835 | 3300044712 | Bacteria | 1589 |
| 596 | Ga0451576_0013359 | 3300045051 | Bacteria | 9189 |
| 597 | Ga0451576_0019593 | 3300045051 | Bacteria | 7384 |
| 598 | Ga0451576_0020850 | 3300045051 | Bacteria | 7132 |
| 599 | Ga0451576_0074686 | 3300045051 | Bacteria | 3527 |
| 600 | Ga0451576_0161126 | 3300045051 | Bacteria | 2341 |
| 601 | Ga0451576_0228419 | 3300045051 | Bacteria | 1943 |
| 602 | Ga0451576_0733477 | 3300045051 | Bacteria | 1038 |
| 603 | Ga0451576_0836521 | 3300045051 | Bacteria | 966 |
| 604 | Ga0451576_0842872 | 3300045051 | Bacteria | 962 |
| 605 | Ga0495603_0351960 | 3300046455 | Bacteria | 845 |
| 606 | Ga0495580_0019936 | 3300046472 | Bacteria | 4971 |
| 607 | Ga0495580_0056906 | 3300046472 | Bacteria | 2753 |
| 608 | Ga0495580_0169160 | 3300046472 | Bacteria | 1511 |
| 609 | Ga0495621_0006110 | 3300046539 | Bacteria | 3499 |
| 610 | Ga0495621_0071254 | 3300046539 | Bacteria | 1281 |
| 611 | Ga0495658_0173618 | 3300046683 | Bacteria | 1335 |
| 612 | Ga0496101_0126385 | 3300048904 | Bacteria | 1938 |
| 613 | Ga0496102_0117883 | 3300048905 | Bacteria | 2478 |
| 614 | Ga0496102_0254605 | 3300048905 | Bacteria | 1655 |
| 615 | Ga0496103_0239181 | 3300048906 | Bacteria | 1168 |
| 616 | Ga0496104_0148482 | 3300048907 | Bacteria | 2251 |
| 617 | Ga0496105_0204856 | 3300048908 | Bacteria | 1609 |
| 618 | Ga0496106_0207056 | 3300048909 | Bacteria | 1562 |
| 619 | Ga0496107_0057725 | 3300048910 | Bacteria | 2806 |
| 620 | Ga0496108_0112494 | 3300048911 | Bacteria | 2329 |
| 621 | Ga0496108_0316490 | 3300048911 | Bacteria | 1360 |
| 622 | Ga0496109_0092083 | 3300048912 | Bacteria | 2804 |
| 623 | Ga0496109_0257590 | 3300048912 | Bacteria | 1643 |
| 624 | Ga0496110_0115029 | 3300048913 | Bacteria | 2421 |
| 625 | Ga0496112_0237799 | 3300048915 | Bacteria | 1775 |
| 626 | Ga0496113_0026700 | 3300048916 | Bacteria | 4132 |
| 627 | Ga0496114_0287885 | 3300048917 | Bacteria | 1449 |
| 628 | Ga0496114_0452875 | 3300048917 | Bacteria | 1136 |
| 629 | Ga0501032_0141009 | 3300049569 | Bacteria | 1587 |
| 630 | Ga0501033_0002516 | 3300049570 | Bacteria | 15525 |
| 631 | Ga0501033_0117913 | 3300049570 | Bacteria | 1928 |
| 632 | Ga0501033_0423512 | 3300049570 | Bacteria | 927 |
| 633 | Ga0501036_0002550 | 3300049572 | Bacteria | 14321 |
| 634 | Ga0501036_0008089 | 3300049572 | Bacteria | 8616 |
| 635 | Ga0501036_0109508 | 3300049572 | Bacteria | 2334 |
| 636 | Ga0501036_0150770 | 3300049572 | Bacteria | 1961 |
| 637 | Ga0501036_0175440 | 3300049572 | Bacteria | 1805 |
| 638 | Ga0501036_0382201 | 3300049572 | Bacteria | 1175 |
| 639 | Ga0501037_0041574 | 3300049573 | Bacteria | 3381 |
| 640 | Ga0501037_0155445 | 3300049573 | Bacteria | 1633 |
| 641 | Ga0501038_0015810 | 3300049574 | Bacteria | 6857 |
| 642 | Ga0501038_0038049 | 3300049574 | Bacteria | 4214 |
| 643 | Ga0501038_0158731 | 3300049574 | Bacteria | 1840 |
| 644 | Ga0501038_0185490 | 3300049574 | Bacteria | 1677 |
| 645 | Ga0501038_0214400 | 3300049574 | Bacteria | 1539 |
| 646 | Ga0501038_0389645 | 3300049574 | Bacteria | 1080 |
| 647 | Ga0501039_0000890 | 3300049575 | Bacteria | 21739 |
| 648 | Ga0501039_0016381 | 3300049575 | Bacteria | 5680 |
| 649 | Ga0501039_0017620 | 3300049575 | Bacteria | 5479 |
| 650 | Ga0501039_0026742 | 3300049575 | Bacteria | 4434 |
| 651 | Ga0501039_0044475 | 3300049575 | Bacteria | 3430 |
| 652 | Ga0501039_0097688 | 3300049575 | Bacteria | 2290 |
| 653 | Ga0501039_0102901 | 3300049575 | Bacteria | 2229 |
| 654 | Ga0501039_0240371 | 3300049575 | Bacteria | 1424 |
| 655 | Ga0501040_0000166 | 3300049576 | Bacteria | 37216 |
| 656 | Ga0501040_0001379 | 3300049576 | Bacteria | 15333 |
| 657 | Ga0501040_0006519 | 3300049576 | Bacteria | 7580 |
| 658 | Ga0501040_0030519 | 3300049576 | Bacteria | 3641 |
| 659 | Ga0501040_0060582 | 3300049576 | Bacteria | 2601 |
| 660 | Ga0501040_0109842 | 3300049576 | Bacteria | 1928 |
| 661 | Ga0501040_0115421 | 3300049576 | Bacteria | 1880 |
| 662 | Ga0501040_0139886 | 3300049576 | Bacteria | 1705 |
| 663 | Ga0501040_0166778 | 3300049576 | Bacteria | 1558 |
| 664 | Ga0501040_0192711 | 3300049576 | Bacteria | 1447 |
| 665 | Ga0501040_0284053 | 3300049576 | Bacteria | 1182 |
| 666 | Ga0501041_0000454 | 3300049577 | Bacteria | 20790 |
| 667 | Ga0501041_0018036 | 3300049577 | Bacteria | 4202 |
| 668 | Ga0501041_0031014 | 3300049577 | Bacteria | 3227 |
| 669 | Ga0501041_0032491 | 3300049577 | Bacteria | 3154 |
| 670 | Ga0501041_0036688 | 3300049577 | Bacteria | 2969 |
| 671 | Ga0501041_0037895 | 3300049577 | Bacteria | 2923 |
| 672 | Ga0501041_0041322 | 3300049577 | Bacteria | 2801 |
| 673 | Ga0501041_0059931 | 3300049577 | Bacteria | 2329 |
| 674 | Ga0501041_0060322 | 3300049577 | Bacteria | 2322 |
| 675 | Ga0501041_0082721 | 3300049577 | Bacteria | 1978 |
| 676 | Ga0501041_0179294 | 3300049577 | Bacteria | 1326 |
| 677 | Ga0501041_0347950 | 3300049577 | Bacteria | 936 |
| 678 | Ga0501042_0000055 | 3300049578 | Bacteria | 39662 |
| 679 | Ga0501042_0009408 | 3300049578 | Bacteria | 6511 |
| 680 | Ga0501042_0023557 | 3300049578 | Bacteria | 4310 |
| 681 | Ga0501042_0040969 | 3300049578 | Bacteria | 3292 |
| 682 | Ga0501042_0162492 | 3300049578 | Bacteria | 1611 |
| 683 | Ga0501042_0177289 | 3300049578 | Bacteria | 1537 |
| 684 | Ga0501042_0261059 | 3300049578 | Bacteria | 1250 |
| 685 | Ga0501042_0275288 | 3300049578 | Bacteria | 1215 |
| 686 | Ga0501042_0386265 | 3300049578 | Bacteria | 1014 |
| 687 | Ga0501043_0022803 | 3300049579 | Bacteria | 4909 |
| 688 | Ga0501043_0301187 | 3300049579 | Bacteria | 1225 |
| 689 | Ga0501043_0474511 | 3300049579 | Bacteria | 937 |
| 690 | Ga0501046_0002718 | 3300049580 | Bacteria | 16467 |
| 691 | Ga0501046_0004575 | 3300049580 | Bacteria | 12508 |
| 692 | Ga0501046_0028752 | 3300049580 | Bacteria | 4525 |
| 693 | Ga0501046_0029661 | 3300049580 | Bacteria | 4446 |
| 694 | Ga0501046_0032087 | 3300049580 | Bacteria | 4255 |
| 695 | Ga0501046_0175575 | 3300049580 | Bacteria | 1605 |
| 696 | Ga0501046_0479502 | 3300049580 | Bacteria | 892 |
| 697 | Ga0501048_0000123 | 3300049582 | Bacteria | 44886 |
| 698 | Ga0501048_0015656 | 3300049582 | Bacteria | 5597 |
| 699 | Ga0501048_0041686 | 3300049582 | Bacteria | 3287 |
| 700 | Ga0501048_0066840 | 3300049582 | Bacteria | 2541 |
| 701 | Ga0501048_0073797 | 3300049582 | Bacteria | 2408 |
| 702 | Ga0501068_0005780 | 3300049584 | Bacteria | 6784 |
| 703 | Ga0501068_0036323 | 3300049584 | Bacteria | 2945 |
| 704 | Ga0501068_0050238 | 3300049584 | Bacteria | 2521 |
| 705 | Ga0501068_0054829 | 3300049584 | Bacteria | 2415 |
| 706 | Ga0501068_0097325 | 3300049584 | Bacteria | 1821 |
| 707 | Ga0501068_0152375 | 3300049584 | Bacteria | 1453 |
| 708 | Ga0501068_0159569 | 3300049584 | Bacteria | 1421 |
| 709 | Ga0501070_0443676 | 3300049586 | Bacteria | 1047 |
| 710 | Ga0501071_0000151 | 3300049587 | Bacteria | 29305 |
| 711 | Ga0501071_0056191 | 3300049587 | Bacteria | 2842 |
| 712 | Ga0501071_0074525 | 3300049587 | Bacteria | 2477 |
| 713 | Ga0501071_0086066 | 3300049587 | Bacteria | 2305 |
| 714 | Ga0501071_0165472 | 3300049587 | Bacteria | 1654 |
| 715 | Ga0501071_0230201 | 3300049587 | Bacteria | 1396 |
| 716 | Ga0501072_0000139 | 3300049588 | Bacteria | 54279 |
| 717 | Ga0501072_0002950 | 3300049588 | Bacteria | 12808 |
| 718 | Ga0501072_0006314 | 3300049588 | Bacteria | 9025 |
| 719 | Ga0501072_0016554 | 3300049588 | Bacteria | 5664 |
| 720 | Ga0501072_0051233 | 3300049588 | Bacteria | 3251 |
| 721 | Ga0501072_0100091 | 3300049588 | Bacteria | 2304 |
| 722 | Ga0501072_0258539 | 3300049588 | Bacteria | 1386 |
| 723 | Ga0501073_0169020 | 3300049589 | Bacteria | 1514 |
| 724 | Ga0501073_0346042 | 3300049589 | Bacteria | 1026 |
| 725 | Ga0501074_0016213 | 3300049590 | Bacteria | 5413 |
| 726 | Ga0501074_0059946 | 3300049590 | Bacteria | 2741 |
| 727 | Ga0501074_0278548 | 3300049590 | Bacteria | 1189 |
| 728 | Ga0501075_0000051 | 3300049591 | Bacteria | 49296 |
| 729 | Ga0501075_0000488 | 3300049591 | Bacteria | 23707 |
| 730 | Ga0501075_0001002 | 3300049591 | Bacteria | 18052 |
| 731 | Ga0501075_0018565 | 3300049591 | Bacteria | 5035 |
| 732 | Ga0501075_0033179 | 3300049591 | Bacteria | 3840 |
| 733 | Ga0501075_0055799 | 3300049591 | Bacteria | 2973 |
| 734 | Ga0501075_0158687 | 3300049591 | Bacteria | 1725 |
| 735 | Ga0501075_0180372 | 3300049591 | Bacteria | 1611 |
| 736 | Ga0501075_0185736 | 3300049591 | Bacteria | 1586 |
| 737 | Ga0501075_0252758 | 3300049591 | Bacteria | 1343 |
| 738 | Ga0501076_0000008 | 3300049592 | Bacteria | 121885 |
| 739 | Ga0501076_0000047 | 3300049592 | Bacteria | 59013 |
| 740 | Ga0501076_0001091 | 3300049592 | Bacteria | 17844 |
| 741 | Ga0501076_0002593 | 3300049592 | Bacteria | 12432 |
| 742 | Ga0501076_0031876 | 3300049592 | Bacteria | 4113 |
| 743 | Ga0501076_0067898 | 3300049592 | Bacteria | 2847 |
| 744 | Ga0501076_0077788 | 3300049592 | Bacteria | 2662 |
| 745 | Ga0501076_0445799 | 3300049592 | Bacteria | 1065 |
| 746 | Ga0501076_0480395 | 3300049592 | Bacteria | 1024 |
| 747 | Ga0501077_0000528 | 3300049593 | Bacteria | 23159 |
| 748 | Ga0501077_0027236 | 3300049593 | Bacteria | 3629 |
| 749 | Ga0501077_0039200 | 3300049593 | Bacteria | 3017 |
| 750 | Ga0501077_0052158 | 3300049593 | Bacteria | 2598 |
| 751 | Ga0501077_0156287 | 3300049593 | Bacteria | 1447 |
| 752 | Ga0501077_0184671 | 3300049593 | Bacteria | 1325 |
| 753 | Ga0501077_0212388 | 3300049593 | Bacteria | 1230 |
| 754 | Ga0501077_0421647 | 3300049593 | Bacteria | 854 |
| 755 | Ga0501079_0000131 | 3300049741 | Bacteria | 40400 |
| 756 | Ga0501079_0000914 | 3300049741 | Bacteria | 20276 |
| 757 | Ga0501079_0006372 | 3300049741 | Bacteria | 8858 |
| 758 | Ga0501079_0007436 | 3300049741 | Bacteria | 8289 |
| 759 | Ga0501079_0023390 | 3300049741 | Bacteria | 4742 |
| 760 | Ga0501079_0077715 | 3300049741 | Bacteria | 2567 |
| 761 | Ga0501079_0120079 | 3300049741 | Bacteria | 2044 |
| 762 | Ga0501079_0216978 | 3300049741 | Bacteria | 1494 |
| 763 | Ga0501079_0450510 | 3300049741 | Bacteria | 1011 |
| 764 | Ga0501080_0000612 | 3300049742 | Bacteria | 28266 |
| 765 | Ga0501080_0011259 | 3300049742 | Bacteria | 8188 |
| 766 | Ga0501080_0025507 | 3300049742 | Bacteria | 5487 |
| 767 | Ga0501080_0293904 | 3300049742 | Bacteria | 1475 |
| 768 | Ga0501080_0336946 | 3300049742 | Bacteria | 1363 |
| 769 | Ga0501081_0000048 | 3300049743 | Bacteria | 44786 |
| 770 | Ga0501081_0001721 | 3300049743 | Bacteria | 13589 |
| 771 | Ga0501081_0001746 | 3300049743 | Bacteria | 13495 |
| 772 | Ga0501081_0015286 | 3300049743 | Bacteria | 5063 |
| 773 | Ga0501081_0017507 | 3300049743 | Bacteria | 4744 |
| 774 | Ga0501081_0020303 | 3300049743 | Bacteria | 4427 |
| 775 | Ga0501081_0053906 | 3300049743 | Bacteria | 2777 |
| 776 | Ga0501081_0066636 | 3300049743 | Bacteria | 2504 |
| 777 | Ga0501081_0243983 | 3300049743 | Bacteria | 1310 |
| 778 | Ga0501081_0279404 | 3300049743 | Bacteria | 1222 |
| 779 | Ga0501083_0024095 | 3300049744 | Bacteria | 4219 |
| 780 | Ga0501083_0090789 | 3300049744 | Bacteria | 2017 |
| 781 | Ga0501035_0002691 | 3300049822 | Bacteria | 17293 |
| 782 | Ga0501035_0268450 | 3300049822 | Bacteria | 1445 |
| 783 | Ga0501045_0000061 | 3300049824 | Bacteria | 50353 |
| 784 | Ga0501045_0031538 | 3300049824 | Bacteria | 3839 |
| 785 | Ga0501045_0042286 | 3300049824 | Bacteria | 3317 |
| 786 | Ga0501045_0064493 | 3300049824 | Bacteria | 2689 |
| 787 | Ga0501045_0076513 | 3300049824 | Bacteria | 2466 |
| 788 | Ga0501045_0129033 | 3300049824 | Bacteria | 1879 |
| 789 | Ga0501045_0195373 | 3300049824 | Bacteria | 1508 |
| 790 | nmdc:mga05p37_108241_c1 | 3300050507 | Bacteria | 3419 |
| 791 | nmdc:mga05p37_116397_c1 | 3300050507 | Bacteria | 3285 |
| 792 | nmdc:mga05p37_18859_c1 | 3300050507 | Bacteria | 5312 |
| 793 | nmdc:mga05p37_2127_c1 | 3300050507 | Bacteria | 23133 |
| 794 | nmdc:mga05p37_265904_c1 | 3300050507 | Bacteria | 2051 |
| 795 | nmdc:mga05p37_78391_c1 | 3300050507 | Bacteria | 4068 |
| 796 | nmdc:mga05p37_80731_c1 | 3300050507 | Bacteria | 4006 |
| 797 | nmdc:mga09592_674_c1 | 3300050508 | Bacteria | 26100 |
| 798 | nmdc:mga09592_68020_c1 | 3300050508 | Bacteria | 3021 |
| 799 | nmdc:mga0qj67_101406_c1 | 3300050509 | Bacteria | 2321 |
| 800 | nmdc:mga0qj67_2207_c1 | 3300050509 | Bacteria | 13837 |
| 801 | nmdc:mga0qj67_259865_c1 | 3300050509 | Bacteria | 1408 |
| 802 | nmdc:mga0qj67_3331_c1 | 3300050509 | Bacteria | 11585 |
| 803 | nmdc:mga0qj67_3567_c1 | 3300050509 | Bacteria | 11232 |
| 804 | nmdc:mga0qj67_83261_c1 | 3300050509 | Bacteria | 2565 |
| 805 | nmdc:mga06r32_152197_c1 | 3300050510 | Bacteria | 2292 |
| 806 | nmdc:mga06r32_153767_c1 | 3300050510 | Bacteria | 2280 |
| 807 | nmdc:mga06r32_295477_c1 | 3300050510 | Bacteria | 1606 |
| 808 | nmdc:mga06r32_30382_c1 | 3300050510 | Bacteria | 5069 |
| 809 | nmdc:mga06r32_383732_c1 | 3300050510 | Bacteria | 1388 |
| 810 | nmdc:mga06r32_543_c1 | 3300050510 | Bacteria | 32734 |
| 811 | nmdc:mga06r32_5622_c1 | 3300050510 | Bacteria | 11275 |
| 812 | nmdc:mga08y16_119992_c1 | 3300050511 | Bacteria | 2737 |
| 813 | nmdc:mga08y16_135113_c1 | 3300050511 | Bacteria | 2563 |
| 814 | nmdc:mga08y16_221892_c1 | 3300050511 | Bacteria | 1957 |
| 815 | nmdc:mga08y16_33274_c1 | 3300050511 | Bacteria | 5414 |
| 816 | nmdc:mga08y16_343821_c1 | 3300050511 | Bacteria | 1533 |
| 817 | nmdc:mga0n895_15712_c1 | 3300050512 | Bacteria | 6918 |
| 818 | nmdc:mga0n895_188271_c1 | 3300050512 | Bacteria | 2095 |
| 819 | nmdc:mga0n895_287750_c1 | 3300050512 | Bacteria | 1666 |
| 820 | nmdc:mga0rr50_942_c1 | 3300050513 | Bacteria | 15732 |
| 821 | nmdc:mga08x19_14009_c1 | 3300050514 | Bacteria | 4860 |
| 822 | nmdc:mga08x19_186760_c1 | 3300050514 | Bacteria | 1417 |
| 823 | nmdc:mga08x19_29982_c1 | 3300050514 | Bacteria | 3415 |
| 824 | nmdc:mga0a205_126371_c1 | 3300050515 | Bacteria | 2457 |
| 825 | nmdc:mga0a205_2435_c1 | 3300050515 | Bacteria | 16411 |
| 826 | nmdc:mga0a205_294543_c1 | 3300050515 | Bacteria | 1496 |
| 827 | nmdc:mga0a205_325115_c1 | 3300050515 | Bacteria | 1408 |
| 828 | nmdc:mga0a205_39243_c1 | 3300050515 | Bacteria | 4558 |
| 829 | nmdc:mga0a205_4195_c1 | 3300050515 | Bacteria | 12923 |
| 830 | Ga0501084_0000174 | 3300054114 | Bacteria | 50134 |
| 831 | Ga0501084_0006749 | 3300054114 | Bacteria | 9436 |
| 832 | Ga0501084_0008479 | 3300054114 | Bacteria | 8501 |
| 833 | Ga0501084_0021396 | 3300054114 | Bacteria | 5390 |
| 834 | Ga0501084_0051510 | 3300054114 | Bacteria | 3445 |
| 835 | Ga0501084_0060883 | 3300054114 | Bacteria | 3161 |
| 836 | Ga0501084_0087975 | 3300054114 | Bacteria | 2608 |
| 837 | Ga0501084_0091977 | 3300054114 | Bacteria | 2547 |
| 838 | Ga0501084_0151796 | 3300054114 | Bacteria | 1953 |
| 839 | Ga0501084_0465752 | 3300054114 | Bacteria | 1068 |
| 840 | Ga0501082_0000601 | 3300060353 | Bacteria | 31739 |
| 841 | Ga0501082_0001345 | 3300060353 | Bacteria | 21591 |
| 842 | Ga0501082_0011002 | 3300060353 | Bacteria | 7780 |
| 843 | Ga0501082_0017580 | 3300060353 | Bacteria | 6159 |
| 844 | Ga0501082_0029210 | 3300060353 | Bacteria | 4749 |
| 845 | Ga0501082_0060561 | 3300060353 | Bacteria | 3259 |
| 846 | Ga0501082_0064316 | 3300060353 | Bacteria | 3159 |
| 847 | Ga0501082_0087674 | 3300060353 | Bacteria | 2685 |
| 848 | Ga0501082_0118018 | 3300060353 | Bacteria | 2298 |
| 849 | Ga0530510_0000011 | 3300061734 | Bacteria | 125603 |
| 850 | Ga0530510_0000120 | 3300061734 | Bacteria | 44746 |
| 851 | Ga0530510_0000904 | 3300061734 | Bacteria | 19576 |
| 852 | Ga0530510_0002221 | 3300061734 | Bacteria | 13335 |
| 853 | Ga0530510_0006444 | 3300061734 | Bacteria | 8174 |
| 854 | Ga0530510_0008621 | 3300061734 | Bacteria | 7122 |
| 855 | Ga0530510_0033419 | 3300061734 | Bacteria | 3703 |
| 856 | Ga0530510_0058471 | 3300061734 | Bacteria | 2787 |
| 857 | Ga0530510_0067050 | 3300061734 | Bacteria | 2603 |
| 858 | Ga0530510_0089052 | 3300061734 | Bacteria | 2250 |
| 859 | Ga0530510_0144720 | 3300061734 | Bacteria | 1753 |
| 860 | Ga0530510_0181427 | 3300061734 | Bacteria | 1561 |
| 861 | Ga0530510_0388102 | 3300061734 | Bacteria | 1051 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0039200 | Ga0501077_0039200_14_676 | 220 |
| 2 | 3300049592 | Ga0501076_0480395 | Ga0501076_0480395_19_795 | 231 |
| 3 | 3300049593 | Ga0501077_0421647 | Ga0501077_0421647_63_839 | 231 |
| 4 | 3300049578 | Ga0501042_0386265 | Ga0501042_0386265_290_988 | 232 |
| 5 | 3300006844 | Ga0075428_100320061 | Ga0075428_1003200612 | 236 |
| 6 | 3300049578 | Ga0501042_0261059 | Ga0501042_0261059_153_956 | 236 |
| 7 | 3300054114 | Ga0501084_0151796 | Ga0501084_0151796_577_1380 | 236 |
| 8 | 3300049580 | Ga0501046_0175575 | Ga0501046_0175575_570_1376 | 237 |
| 9 | 3300049743 | Ga0501081_0243983 | Ga0501081_0243983_171_977 | 237 |
| 10 | 3300009094 | Ga0111539_10080686 | Ga0111539_100806862 | 241 |
| 11 | 3300050511 | nmdc:mga08y16_343821_c1 | nmdc:mga08y16_343821_c1_327_1115 | 241 |
| 12 | 3300005466 | Ga0070685_10219435 | Ga0070685_102194352 | 257 |
| 13 | 3300006844 | Ga0075428_100049288 | Ga0075428_1000492886 | 257 |
| 14 | 3300006847 | Ga0075431_100001553 | Ga0075431_10000155317 | 257 |
| 15 | 3300006880 | Ga0075429_100003767 | Ga0075429_10000376716 | 257 |
| 16 | 3300027695 | Ga0209966_1003478 | Ga0209966_10034783 | 257 |
| 17 | 3300027717 | Ga0209998_10020832 | Ga0209998_100208322 | 257 |
| 18 | 3300050510 | nmdc:mga06r32_383732_c1 | nmdc:mga06r32_383732_c1_573_1355 | 257 |
| 19 | 3300005445 | Ga0070708_100390521 | Ga0070708_1003905212 | 258 |
| 20 | 3300005536 | Ga0070697_100312598 | Ga0070697_1003125981 | 258 |
| 21 | 3300006847 | Ga0075431_100243790 | Ga0075431_1002437902 | 258 |
| 22 | 3300006880 | Ga0075429_100002484 | Ga0075429_10000248416 | 258 |
| 23 | 3300049572 | Ga0501036_0382201 | Ga0501036_0382201_38_814 | 258 |
| 24 | 3300049574 | Ga0501038_0389645 | Ga0501038_0389645_91_867 | 258 |
| 25 | 3300049577 | Ga0501041_0031014 | Ga0501041_0031014_98_874 | 258 |
| 26 | 3300049584 | Ga0501068_0050238 | Ga0501068_0050238_227_1003 | 258 |
| 27 | 3300049592 | Ga0501076_0445799 | Ga0501076_0445799_85_861 | 258 |
| 28 | 3300049593 | Ga0501077_0027236 | Ga0501077_0027236_2071_2847 | 258 |
| 29 | 3300049824 | Ga0501045_0064493 | Ga0501045_0064493_1158_1934 | 258 |
| 30 | 3300050507 | nmdc:mga05p37_18859_c1 | nmdc:mga05p37_18859_c1_290_1066 | 258 |
| 31 | 3300050508 | nmdc:mga09592_674_c1 | nmdc:mga09592_674_c1_268_1044 | 258 |
| 32 | 3300050509 | nmdc:mga0qj67_2207_c1 | nmdc:mga0qj67_2207_c1_12028_12804 | 258 |
| 33 | 3300050509 | nmdc:mga0qj67_83261_c1 | nmdc:mga0qj67_83261_c1_289_1065 | 258 |
| 34 | 3300050510 | nmdc:mga06r32_5622_c1 | nmdc:mga06r32_5622_c1_289_1065 | 258 |
| 35 | 3300060353 | Ga0501082_0011002 | Ga0501082_0011002_2118_2894 | 258 |
| 36 | 3300061734 | Ga0530510_0002221 | Ga0530510_0002221_3402_4178 | 258 |
| 37 | 3300061734 | Ga0530510_0006444 | Ga0530510_0006444_2403_3179 | 258 |
| 38 | 3300005330 | Ga0070690_100320569 | Ga0070690_1003205691 | 259 |
| 39 | 3300005438 | Ga0070701_10013724 | Ga0070701_100137242 | 259 |
| 40 | 3300005468 | Ga0070707_100006533 | Ga0070707_1000065333 | 259 |
| 41 | 3300005468 | Ga0070707_100041813 | Ga0070707_1000418134 | 259 |
| 42 | 3300005471 | Ga0070698_100300525 | Ga0070698_1003005252 | 259 |
| 43 | 3300005471 | Ga0070698_100663025 | Ga0070698_1006630251 | 259 |
| 44 | 3300005549 | Ga0070704_100208137 | Ga0070704_1002081372 | 259 |
| 45 | 3300005617 | Ga0068859_100190461 | Ga0068859_1001904612 | 259 |
| 46 | 3300005719 | Ga0068861_100670006 | Ga0068861_1006700061 | 259 |
| 47 | 3300005843 | Ga0068860_100077735 | Ga0068860_1000777353 | 259 |
| 48 | 3300005844 | Ga0068862_100459674 | Ga0068862_1004596742 | 259 |
| 49 | 3300005937 | Ga0081455_10005497 | Ga0081455_100054979 | 259 |
| 50 | 3300006880 | Ga0075429_100598244 | Ga0075429_1005982441 | 259 |
| 51 | 3300006931 | Ga0097620_100190449 | Ga0097620_1001904492 | 259 |
| 52 | 3300009092 | Ga0105250_10138870 | Ga0105250_101388701 | 259 |
| 53 | 3300009094 | Ga0111539_10064141 | Ga0111539_100641413 | 259 |
| 54 | 3300009147 | Ga0114129_10012932 | Ga0114129_100129323 | 259 |
| 55 | 3300009177 | Ga0105248_10021675 | Ga0105248_100216752 | 259 |
| 56 | 3300014325 | Ga0163163_10457677 | Ga0163163_104576771 | 259 |
| 57 | 3300035725 | Ga0373947_0181586 | Ga0373947_0181586_30_815 | 259 |
| 58 | 3300049576 | Ga0501040_0284053 | Ga0501040_0284053_115_912 | 259 |
| 59 | 3300049577 | Ga0501041_0018036 | Ga0501041_0018036_2824_3621 | 259 |
| 60 | 3300049741 | Ga0501079_0216978 | Ga0501079_0216978_291_1088 | 259 |
| 61 | 3300049824 | Ga0501045_0076513 | Ga0501045_0076513_426_1223 | 259 |
| 62 | 3300050507 | nmdc:mga05p37_80731_c1 | nmdc:mga05p37_80731_c1_206_991 | 259 |
| 63 | 3300050511 | nmdc:mga08y16_33274_c1 | nmdc:mga08y16_33274_c1_2979_3764 | 259 |
| 64 | 3300054114 | Ga0501084_0060883 | Ga0501084_0060883_1389_2186 | 259 |
| 65 | 3300060353 | Ga0501082_0060561 | Ga0501082_0060561_613_1410 | 259 |
| 66 | 3300061734 | Ga0530510_0144720 | Ga0530510_0144720_675_1472 | 259 |
| 67 | 3300005328 | Ga0070676_10036618 | Ga0070676_100366182 | 260 |
| 68 | 3300005331 | Ga0070670_100106110 | Ga0070670_1001061102 | 260 |
| 69 | 3300005334 | Ga0068869_100002738 | Ga0068869_1000027386 | 260 |
| 70 | 3300005334 | Ga0068869_100009682 | Ga0068869_1000096828 | 260 |
| 71 | 3300005336 | Ga0070680_100186308 | Ga0070680_1001863082 | 260 |
| 72 | 3300005337 | Ga0070682_100006921 | Ga0070682_1000069213 | 260 |
| 73 | 3300005338 | Ga0068868_100198876 | Ga0068868_1001988762 | 260 |
| 74 | 3300005341 | Ga0070691_10007474 | Ga0070691_100074746 | 260 |
| 75 | 3300005345 | Ga0070692_10010738 | Ga0070692_100107381 | 260 |
| 76 | 3300005353 | Ga0070669_100136963 | Ga0070669_1001369633 | 260 |
| 77 | 3300005364 | Ga0070673_100124185 | Ga0070673_1001241853 | 260 |
| 78 | 3300005406 | Ga0070703_10013028 | Ga0070703_100130284 | 260 |
| 79 | 3300005444 | Ga0070694_100010632 | Ga0070694_1000106322 | 260 |
| 80 | 3300005444 | Ga0070694_100021213 | Ga0070694_1000212136 | 260 |
| 81 | 3300005444 | Ga0070694_100059069 | Ga0070694_1000590694 | 260 |
| 82 | 3300005455 | Ga0070663_100251018 | Ga0070663_1002510181 | 260 |
| 83 | 3300005457 | Ga0070662_100074293 | Ga0070662_1000742935 | 260 |
| 84 | 3300005467 | Ga0070706_100073656 | Ga0070706_1000736563 | 260 |
| 85 | 3300005468 | Ga0070707_100044956 | Ga0070707_1000449567 | 260 |
| 86 | 3300005468 | Ga0070707_100354277 | Ga0070707_1003542772 | 260 |
| 87 | 3300005468 | Ga0070707_100481496 | Ga0070707_1004814962 | 260 |
| 88 | 3300005471 | Ga0070698_100006586 | Ga0070698_1000065862 | 260 |
| 89 | 3300005471 | Ga0070698_100038527 | Ga0070698_1000385273 | 260 |
| 90 | 3300005530 | Ga0070679_100115287 | Ga0070679_1001152874 | 260 |
| 91 | 3300005535 | Ga0070684_100517726 | Ga0070684_1005177261 | 260 |
| 92 | 3300005536 | Ga0070697_100012294 | Ga0070697_1000122943 | 260 |
| 93 | 3300005543 | Ga0070672_100321905 | Ga0070672_1003219052 | 260 |
| 94 | 3300005545 | Ga0070695_100002303 | Ga0070695_10000230313 | 260 |
| 95 | 3300005545 | Ga0070695_100293142 | Ga0070695_1002931422 | 260 |
| 96 | 3300005546 | Ga0070696_100001449 | Ga0070696_10000144918 | 260 |
| 97 | 3300005547 | Ga0070693_100000500 | Ga0070693_1000005002 | 260 |
| 98 | 3300005564 | Ga0070664_100097835 | Ga0070664_1000978355 | 260 |
| 99 | 3300005578 | Ga0068854_100022784 | Ga0068854_1000227841 | 260 |
| 100 | 3300005614 | Ga0068856_100059275 | Ga0068856_1000592754 | 260 |
| 101 | 3300005617 | Ga0068859_100048511 | Ga0068859_1000485114 | 260 |
| 102 | 3300005618 | Ga0068864_100057592 | Ga0068864_1000575923 | 260 |
| 103 | 3300005719 | Ga0068861_100021240 | Ga0068861_1000212406 | 260 |
| 104 | 3300005840 | Ga0068870_10002795 | Ga0068870_100027956 | 260 |
| 105 | 3300005841 | Ga0068863_100173374 | Ga0068863_1001733742 | 260 |
| 106 | 3300005842 | Ga0068858_100076480 | Ga0068858_1000764805 | 260 |
| 107 | 3300005843 | Ga0068860_100076166 | Ga0068860_1000761662 | 260 |
| 108 | 3300005844 | Ga0068862_100016038 | Ga0068862_1000160382 | 260 |
| 109 | 3300005844 | Ga0068862_100079266 | Ga0068862_1000792662 | 260 |
| 110 | 3300006358 | Ga0068871_100370051 | Ga0068871_1003700512 | 260 |
| 111 | 3300006852 | Ga0075433_10037773 | Ga0075433_100377737 | 260 |
| 112 | 3300006871 | Ga0075434_100008812 | Ga0075434_1000088125 | 260 |
| 113 | 3300006871 | Ga0075434_100010825 | Ga0075434_1000108254 | 260 |
| 114 | 3300006931 | Ga0097620_100048512 | Ga0097620_1000485124 | 260 |
| 115 | 3300007076 | Ga0075435_100109652 | Ga0075435_1001096522 | 260 |
| 116 | 3300009147 | Ga0114129_10020555 | Ga0114129_100205552 | 260 |
| 117 | 3300009147 | Ga0114129_10030580 | Ga0114129_100305804 | 260 |
| 118 | 3300009553 | Ga0105249_10058975 | Ga0105249_100589753 | 260 |
| 119 | 3300011119 | Ga0105246_10432177 | Ga0105246_104321771 | 260 |
| 120 | 3300013100 | Ga0157373_10009169 | Ga0157373_100091698 | 260 |
| 121 | 3300013105 | Ga0157369_10159570 | Ga0157369_101595703 | 260 |
| 122 | 3300013307 | Ga0157372_10100255 | Ga0157372_101002551 | 260 |
| 123 | 3300014325 | Ga0163163_10066450 | Ga0163163_100664505 | 260 |
| 124 | 3300025901 | Ga0207688_10017353 | Ga0207688_100173533 | 260 |
| 125 | 3300025907 | Ga0207645_10000202 | Ga0207645_1000020247 | 260 |
| 126 | 3300025908 | Ga0207643_10001338 | Ga0207643_100013386 | 260 |
| 127 | 3300025910 | Ga0207684_10000570 | Ga0207684_1000057015 | 260 |
| 128 | 3300025910 | Ga0207684_10091874 | Ga0207684_100918741 | 260 |
| 129 | 3300025912 | Ga0207707_10001262 | Ga0207707_1000126225 | 260 |
| 130 | 3300025917 | Ga0207660_10004094 | Ga0207660_100040942 | 260 |
| 131 | 3300025919 | Ga0207657_10028062 | Ga0207657_100280628 | 260 |
| 132 | 3300025922 | Ga0207646_10000408 | Ga0207646_1000040843 | 260 |
| 133 | 3300025922 | Ga0207646_10009380 | Ga0207646_100093804 | 260 |
| 134 | 3300025922 | Ga0207646_10268432 | Ga0207646_102684321 | 260 |
| 135 | 3300025925 | Ga0207650_10530028 | Ga0207650_105300282 | 260 |
| 136 | 3300025933 | Ga0207706_10001207 | Ga0207706_1000120727 | 260 |
| 137 | 3300025935 | Ga0207709_10142700 | Ga0207709_101427002 | 260 |
| 138 | 3300025939 | Ga0207665_10033122 | Ga0207665_100331223 | 260 |
| 139 | 3300025940 | Ga0207691_10259486 | Ga0207691_102594862 | 260 |
| 140 | 3300025942 | Ga0207689_10000275 | Ga0207689_1000027512 | 260 |
| 141 | 3300025942 | Ga0207689_10009225 | Ga0207689_100092259 | 260 |
| 142 | 3300025949 | Ga0207667_10001262 | Ga0207667_1000126234 | 260 |
| 143 | 3300025960 | Ga0207651_10254175 | Ga0207651_102541752 | 260 |
| 144 | 3300025961 | Ga0207712_10077336 | Ga0207712_100773362 | 260 |
| 145 | 3300026035 | Ga0207703_10188136 | Ga0207703_101881362 | 260 |
| 146 | 3300026041 | Ga0207639_10030572 | Ga0207639_100305724 | 260 |
| 147 | 3300026067 | Ga0207678_10018359 | Ga0207678_100183596 | 260 |
| 148 | 3300026078 | Ga0207702_10004046 | Ga0207702_100040464 | 260 |
| 149 | 3300026088 | Ga0207641_10290888 | Ga0207641_102908882 | 260 |
| 150 | 3300026089 | Ga0207648_10005184 | Ga0207648_1000518416 | 260 |
| 151 | 3300026116 | Ga0207674_10056283 | Ga0207674_100562832 | 260 |
| 152 | 3300026118 | Ga0207675_100134300 | Ga0207675_1001343003 | 260 |
| 153 | 3300027360 | Ga0209969_1010615 | Ga0209969_10106151 | 260 |
| 154 | 3300027424 | Ga0209984_1001927 | Ga0209984_10019273 | 260 |
| 155 | 3300027471 | Ga0209995_1001661 | Ga0209995_10016614 | 260 |
| 156 | 3300027526 | Ga0209968_1001914 | Ga0209968_10019142 | 260 |
| 157 | 3300027614 | Ga0209970_1001146 | Ga0209970_10011462 | 260 |
| 158 | 3300027617 | Ga0210002_1003471 | Ga0210002_10034713 | 260 |
| 159 | 3300027665 | Ga0209983_1002311 | Ga0209983_10023114 | 260 |
| 160 | 3300027671 | Ga0209588_1003903 | Ga0209588_10039032 | 260 |
| 161 | 3300027682 | Ga0209971_1000011 | Ga0209971_100001116 | 260 |
| 162 | 3300027695 | Ga0209966_1007982 | Ga0209966_10079822 | 260 |
| 163 | 3300027717 | Ga0209998_10000474 | Ga0209998_100004747 | 260 |
| 164 | 3300027876 | Ga0209974_10007324 | Ga0209974_100073243 | 260 |
| 165 | 3300028380 | Ga0268265_10064526 | Ga0268265_100645262 | 260 |
| 166 | 3300028380 | Ga0268265_10071179 | Ga0268265_100711793 | 260 |
| 167 | 3300034820 | Ga0373959_0007156 | Ga0373959_0007156_489_1292 | 260 |
| 168 | 3300035084 | Ga0373928_0052373 | Ga0373928_0052373_120_923 | 260 |
| 169 | 3300035090 | Ga0373949_0021317 | Ga0373949_0021317_507_1310 | 260 |
| 170 | 3300035091 | Ga0373951_0081861 | Ga0373951_0081861_20_802 | 260 |
| 171 | 3300035241 | Ga0373961_0062378 | Ga0373961_0062378_310_1113 | 260 |
| 172 | 3300042157 | Ga0439458_0004746 | Ga0439458_0004746_949_1752 | 260 |
| 173 | 3300042461 | Ga0439460_0004249 | Ga0439460_0004249_2157_2939 | 260 |
| 174 | 3300042876 | Ga0451577_0092249 | Ga0451577_0092249_1506_2309 | 260 |
| 175 | 3300042876 | Ga0451577_0286305 | Ga0451577_0286305_545_1327 | 260 |
| 176 | 3300044673 | Ga0453683_0033006 | Ga0453683_0033006_364_1197 | 260 |
| 177 | 3300044673 | Ga0453683_0049783 | Ga0453683_0049783_912_1733 | 260 |
| 178 | 3300044712 | Ga0453684_0378835 | Ga0453684_0378835_216_1019 | 260 |
| 179 | 3300045051 | Ga0451576_0013359 | Ga0451576_0013359_4231_5055 | 260 |
| 180 | 3300045051 | Ga0451576_0020850 | Ga0451576_0020850_2415_3239 | 260 |
| 181 | 3300045051 | Ga0451576_0161126 | Ga0451576_0161126_1365_2168 | 260 |
| 182 | 3300045051 | Ga0451576_0228419 | Ga0451576_0228419_19_801 | 260 |
| 183 | 3300046472 | Ga0495580_0056906 | Ga0495580_0056906_1641_2465 | 260 |
| 184 | 3300046472 | Ga0495580_0169160 | Ga0495580_0169160_25_807 | 260 |
| 185 | 3300048906 | Ga0496103_0239181 | Ga0496103_0239181_369_1151 | 260 |
| 186 | 3300048912 | Ga0496109_0092083 | Ga0496109_0092083_980_1783 | 260 |
| 187 | 3300048915 | Ga0496112_0237799 | Ga0496112_0237799_724_1527 | 260 |
| 188 | 3300049572 | Ga0501036_0150770 | Ga0501036_0150770_208_1182 | 260 |
| 189 | 3300049572 | Ga0501036_0175440 | Ga0501036_0175440_217_999 | 260 |
| 190 | 3300049573 | Ga0501037_0155445 | Ga0501037_0155445_79_1053 | 260 |
| 191 | 3300049574 | Ga0501038_0158731 | Ga0501038_0158731_349_1131 | 260 |
| 192 | 3300049574 | Ga0501038_0214400 | Ga0501038_0214400_267_1049 | 260 |
| 193 | 3300049575 | Ga0501039_0017620 | Ga0501039_0017620_2585_3559 | 260 |
| 194 | 3300049576 | Ga0501040_0001379 | Ga0501040_0001379_277_1251 | 260 |
| 195 | 3300049576 | Ga0501040_0030519 | Ga0501040_0030519_683_1465 | 260 |
| 196 | 3300049576 | Ga0501040_0109842 | Ga0501040_0109842_1033_1815 | 260 |
| 197 | 3300049576 | Ga0501040_0139886 | Ga0501040_0139886_384_1166 | 260 |
| 198 | 3300049577 | Ga0501041_0036688 | Ga0501041_0036688_1683_2657 | 260 |
| 199 | 3300049577 | Ga0501041_0037895 | Ga0501041_0037895_553_1335 | 260 |
| 200 | 3300049577 | Ga0501041_0179294 | Ga0501041_0179294_327_1109 | 260 |
| 201 | 3300049577 | Ga0501041_0347950 | Ga0501041_0347950_120_902 | 260 |
| 202 | 3300049578 | Ga0501042_0040969 | Ga0501042_0040969_514_1296 | 260 |
| 203 | 3300049579 | Ga0501043_0301187 | Ga0501043_0301187_204_986 | 260 |
| 204 | 3300049580 | Ga0501046_0004575 | Ga0501046_0004575_3055_4029 | 260 |
| 205 | 3300049582 | Ga0501048_0041686 | Ga0501048_0041686_312_1286 | 260 |
| 206 | 3300049582 | Ga0501048_0073797 | Ga0501048_0073797_56_838 | 260 |
| 207 | 3300049584 | Ga0501068_0036323 | Ga0501068_0036323_658_1440 | 260 |
| 208 | 3300049584 | Ga0501068_0097325 | Ga0501068_0097325_386_1168 | 260 |
| 209 | 3300049584 | Ga0501068_0152375 | Ga0501068_0152375_196_1170 | 260 |
| 210 | 3300049586 | Ga0501070_0443676 | Ga0501070_0443676_153_935 | 260 |
| 211 | 3300049587 | Ga0501071_0074525 | Ga0501071_0074525_1452_2234 | 260 |
| 212 | 3300049587 | Ga0501071_0086066 | Ga0501071_0086066_1289_2263 | 260 |
| 213 | 3300049587 | Ga0501071_0230201 | Ga0501071_0230201_16_798 | 260 |
| 214 | 3300049588 | Ga0501072_0051233 | Ga0501072_0051233_308_1282 | 260 |
| 215 | 3300049588 | Ga0501072_0258539 | Ga0501072_0258539_28_810 | 260 |
| 216 | 3300049589 | Ga0501073_0169020 | Ga0501073_0169020_544_1326 | 260 |
| 217 | 3300049590 | Ga0501074_0059946 | Ga0501074_0059946_1409_2191 | 260 |
| 218 | 3300049590 | Ga0501074_0278548 | Ga0501074_0278548_153_935 | 260 |
| 219 | 3300049591 | Ga0501075_0033179 | Ga0501075_0033179_228_1010 | 260 |
| 220 | 3300049591 | Ga0501075_0180372 | Ga0501075_0180372_405_1187 | 260 |
| 221 | 3300049591 | Ga0501075_0252758 | Ga0501075_0252758_302_1276 | 260 |
| 222 | 3300049592 | Ga0501076_0031876 | Ga0501076_0031876_183_965 | 260 |
| 223 | 3300049592 | Ga0501076_0067898 | Ga0501076_0067898_517_1491 | 260 |
| 224 | 3300049592 | Ga0501076_0077788 | Ga0501076_0077788_1058_1840 | 260 |
| 225 | 3300049593 | Ga0501077_0156287 | Ga0501077_0156287_519_1301 | 260 |
| 226 | 3300049741 | Ga0501079_0000914 | Ga0501079_0000914_8249_9223 | 260 |
| 227 | 3300049741 | Ga0501079_0077715 | Ga0501079_0077715_487_1269 | 260 |
| 228 | 3300049742 | Ga0501080_0011259 | Ga0501080_0011259_447_1229 | 260 |
| 229 | 3300049743 | Ga0501081_0001721 | Ga0501081_0001721_3306_4088 | 260 |
| 230 | 3300049743 | Ga0501081_0020303 | Ga0501081_0020303_572_1546 | 260 |
| 231 | 3300049743 | Ga0501081_0066636 | Ga0501081_0066636_1666_2448 | 260 |
| 232 | 3300049744 | Ga0501083_0090789 | Ga0501083_0090789_503_1477 | 260 |
| 233 | 3300050507 | nmdc:mga05p37_116397_c1 | nmdc:mga05p37_116397_c1_1560_2342 | 260 |
| 234 | 3300050507 | nmdc:mga05p37_78391_c1 | nmdc:mga05p37_78391_c1_2957_3781 | 260 |
| 235 | 3300050512 | nmdc:mga0n895_15712_c1 | nmdc:mga0n895_15712_c1_270_1094 | 260 |
| 236 | 3300050513 | nmdc:mga0rr50_942_c1 | nmdc:mga0rr50_942_c1_10922_11746 | 260 |
| 237 | 3300050514 | nmdc:mga08x19_14009_c1 | nmdc:mga08x19_14009_c1_3144_3968 | 260 |
| 238 | 3300050514 | nmdc:mga08x19_29982_c1 | nmdc:mga08x19_29982_c1_610_1434 | 260 |
| 239 | 3300050515 | nmdc:mga0a205_126371_c1 | nmdc:mga0a205_126371_c1_502_1305 | 260 |
| 240 | 3300050515 | nmdc:mga0a205_39243_c1 | nmdc:mga0a205_39243_c1_1863_2687 | 260 |
| 241 | 3300054114 | Ga0501084_0006749 | Ga0501084_0006749_7487_8461 | 260 |
| 242 | 3300054114 | Ga0501084_0008479 | Ga0501084_0008479_5387_6169 | 260 |
| 243 | 3300054114 | Ga0501084_0465752 | Ga0501084_0465752_82_864 | 260 |
| 244 | 3300060353 | Ga0501082_0000601 | Ga0501082_0000601_3183_4157 | 260 |
| 245 | 3300060353 | Ga0501082_0029210 | Ga0501082_0029210_2181_2963 | 260 |
| 246 | 3300061734 | Ga0530510_0033419 | Ga0530510_0033419_488_1270 | 260 |
| 247 | 3300061734 | Ga0530510_0089052 | Ga0530510_0089052_724_1698 | 260 |
| 248 | 3300061734 | Ga0530510_0181427 | Ga0530510_0181427_734_1516 | 260 |
| 249 | 3300061734 | Ga0530510_0388102 | Ga0530510_0388102_184_966 | 260 |
| 250 | 3300042001 | Ga0439441_001036 | Ga0439441_001036_1638_2426 | 261 |
| 251 | 3300042003 | Ga0439443_002298 | Ga0439443_002298_1302_2090 | 261 |
| 252 | 3300042436 | Ga0439435_0000236 | Ga0439435_0000236_2791_3579 | 261 |
| 253 | 3300042437 | Ga0439444_0000850 | Ga0439444_0000850_2868_3656 | 261 |
| 254 | 3300042461 | Ga0439460_0000310 | Ga0439460_0000310_4457_5245 | 261 |
| 255 | 3300049741 | Ga0501079_0450510 | Ga0501079_0450510_182_970 | 261 |
| 256 | 3300005544 | Ga0070686_100039323 | Ga0070686_1000393232 | 262 |
| 257 | 3300005616 | Ga0068852_100143093 | Ga0068852_1001430932 | 262 |
| 258 | 3300005618 | Ga0068864_100380419 | Ga0068864_1003804192 | 262 |
| 259 | 3300005844 | Ga0068862_100298665 | Ga0068862_1002986652 | 262 |
| 260 | 3300006847 | Ga0075431_100030281 | Ga0075431_1000302816 | 262 |
| 261 | 3300006847 | Ga0075431_100073471 | Ga0075431_1000734712 | 262 |
| 262 | 3300006847 | Ga0075431_100131330 | Ga0075431_1001313302 | 262 |
| 263 | 3300006852 | Ga0075433_10003788 | Ga0075433_100037889 | 262 |
| 264 | 3300009094 | Ga0111539_10742846 | Ga0111539_107428462 | 262 |
| 265 | 3300009147 | Ga0114129_10000404 | Ga0114129_1000040440 | 262 |
| 266 | 3300009147 | Ga0114129_10330122 | Ga0114129_103301222 | 262 |
| 267 | 3300009553 | Ga0105249_10078076 | Ga0105249_100780762 | 262 |
| 268 | 3300009553 | Ga0105249_10489576 | Ga0105249_104895761 | 262 |
| 269 | 3300009553 | Ga0105249_10708819 | Ga0105249_107088191 | 262 |
| 270 | 3300013297 | Ga0157378_10142178 | Ga0157378_101421783 | 262 |
| 271 | 3300014968 | Ga0157379_10134992 | Ga0157379_101349922 | 262 |
| 272 | 3300025961 | Ga0207712_10410413 | Ga0207712_104104131 | 262 |
| 273 | 3300025961 | Ga0207712_10432998 | Ga0207712_104329981 | 262 |
| 274 | 3300031548 | Ga0307408_100062178 | Ga0307408_1000621783 | 262 |
| 275 | 3300031995 | Ga0307409_100037551 | Ga0307409_1000375513 | 262 |
| 276 | 3300032002 | Ga0307416_100113922 | Ga0307416_1001139223 | 262 |
| 277 | 3300041408 | Ga0439453_0024817 | Ga0439453_0024817_74_862 | 262 |
| 278 | 3300045051 | Ga0451576_0733477 | Ga0451576_0733477_27_815 | 262 |
| 279 | 3300048909 | Ga0496106_0207056 | Ga0496106_0207056_240_1028 | 262 |
| 280 | 3300049569 | Ga0501032_0141009 | Ga0501032_0141009_44_832 | 262 |
| 281 | 3300049570 | Ga0501033_0002516 | Ga0501033_0002516_4855_5643 | 262 |
| 282 | 3300049570 | Ga0501033_0117913 | Ga0501033_0117913_212_1000 | 262 |
| 283 | 3300049570 | Ga0501033_0423512 | Ga0501033_0423512_81_887 | 262 |
| 284 | 3300049572 | Ga0501036_0002550 | Ga0501036_0002550_6258_7046 | 262 |
| 285 | 3300049572 | Ga0501036_0008089 | Ga0501036_0008089_7458_8246 | 262 |
| 286 | 3300049573 | Ga0501037_0041574 | Ga0501037_0041574_1147_1935 | 262 |
| 287 | 3300049574 | Ga0501038_0015810 | Ga0501038_0015810_710_1498 | 262 |
| 288 | 3300049574 | Ga0501038_0038049 | Ga0501038_0038049_2404_3192 | 262 |
| 289 | 3300049575 | Ga0501039_0000890 | Ga0501039_0000890_7975_8763 | 262 |
| 290 | 3300049575 | Ga0501039_0026742 | Ga0501039_0026742_192_980 | 262 |
| 291 | 3300049575 | Ga0501039_0044475 | Ga0501039_0044475_727_1515 | 262 |
| 292 | 3300049576 | Ga0501040_0000166 | Ga0501040_0000166_30061_30849 | 262 |
| 293 | 3300049576 | Ga0501040_0006519 | Ga0501040_0006519_486_1274 | 262 |
| 294 | 3300049576 | Ga0501040_0192711 | Ga0501040_0192711_51_839 | 262 |
| 295 | 3300049577 | Ga0501041_0000454 | Ga0501041_0000454_10863_11651 | 262 |
| 296 | 3300049577 | Ga0501041_0032491 | Ga0501041_0032491_1635_2423 | 262 |
| 297 | 3300049577 | Ga0501041_0041322 | Ga0501041_0041322_1639_2427 | 262 |
| 298 | 3300049578 | Ga0501042_0000055 | Ga0501042_0000055_1622_2410 | 262 |
| 299 | 3300049578 | Ga0501042_0009408 | Ga0501042_0009408_2649_3437 | 262 |
| 300 | 3300049578 | Ga0501042_0177289 | Ga0501042_0177289_391_1179 | 262 |
| 301 | 3300049579 | Ga0501043_0022803 | Ga0501043_0022803_3342_4130 | 262 |
| 302 | 3300049579 | Ga0501043_0474511 | Ga0501043_0474511_121_909 | 262 |
| 303 | 3300049580 | Ga0501046_0002718 | Ga0501046_0002718_14691_15479 | 262 |
| 304 | 3300049580 | Ga0501046_0028752 | Ga0501046_0028752_1092_1880 | 262 |
| 305 | 3300049580 | Ga0501046_0032087 | Ga0501046_0032087_2997_3785 | 262 |
| 306 | 3300049582 | Ga0501048_0000123 | Ga0501048_0000123_36947_37735 | 262 |
| 307 | 3300049582 | Ga0501048_0015656 | Ga0501048_0015656_1822_2610 | 262 |
| 308 | 3300049584 | Ga0501068_0005780 | Ga0501068_0005780_4902_5690 | 262 |
| 309 | 3300049584 | Ga0501068_0159569 | Ga0501068_0159569_335_1123 | 262 |
| 310 | 3300049587 | Ga0501071_0000151 | Ga0501071_0000151_7911_8699 | 262 |
| 311 | 3300049587 | Ga0501071_0056191 | Ga0501071_0056191_234_1022 | 262 |
| 312 | 3300049588 | Ga0501072_0000139 | Ga0501072_0000139_15959_16747 | 262 |
| 313 | 3300049588 | Ga0501072_0002950 | Ga0501072_0002950_6145_6933 | 262 |
| 314 | 3300049588 | Ga0501072_0006314 | Ga0501072_0006314_5180_5968 | 262 |
| 315 | 3300049588 | Ga0501072_0100091 | Ga0501072_0100091_474_1262 | 262 |
| 316 | 3300049589 | Ga0501073_0346042 | Ga0501073_0346042_225_1013 | 262 |
| 317 | 3300049590 | Ga0501074_0016213 | Ga0501074_0016213_2501_3289 | 262 |
| 318 | 3300049591 | Ga0501075_0000051 | Ga0501075_0000051_16588_17376 | 262 |
| 319 | 3300049591 | Ga0501075_0000488 | Ga0501075_0000488_10283_11071 | 262 |
| 320 | 3300049591 | Ga0501075_0001002 | Ga0501075_0001002_10420_11208 | 262 |
| 321 | 3300049592 | Ga0501076_0000008 | Ga0501076_0000008_31826_32614 | 262 |
| 322 | 3300049592 | Ga0501076_0000047 | Ga0501076_0000047_43254_44042 | 262 |
| 323 | 3300049592 | Ga0501076_0002593 | Ga0501076_0002593_5503_6291 | 262 |
| 324 | 3300049593 | Ga0501077_0000528 | Ga0501077_0000528_16240_17028 | 262 |
| 325 | 3300049593 | Ga0501077_0212388 | Ga0501077_0212388_392_1180 | 262 |
| 326 | 3300049741 | Ga0501079_0000131 | Ga0501079_0000131_31469_32257 | 262 |
| 327 | 3300049741 | Ga0501079_0007436 | Ga0501079_0007436_1479_2267 | 262 |
| 328 | 3300049741 | Ga0501079_0120079 | Ga0501079_0120079_930_1718 | 262 |
| 329 | 3300049742 | Ga0501080_0000612 | Ga0501080_0000612_12768_13556 | 262 |
| 330 | 3300049742 | Ga0501080_0025507 | Ga0501080_0025507_1655_2443 | 262 |
| 331 | 3300049742 | Ga0501080_0336946 | Ga0501080_0336946_407_1195 | 262 |
| 332 | 3300049743 | Ga0501081_0000048 | Ga0501081_0000048_29444_30232 | 262 |
| 333 | 3300049743 | Ga0501081_0001746 | Ga0501081_0001746_10631_11419 | 262 |
| 334 | 3300049743 | Ga0501081_0015286 | Ga0501081_0015286_471_1259 | 262 |
| 335 | 3300049743 | Ga0501081_0053906 | Ga0501081_0053906_1864_2652 | 262 |
| 336 | 3300049744 | Ga0501083_0024095 | Ga0501083_0024095_2955_3743 | 262 |
| 337 | 3300049822 | Ga0501035_0002691 | Ga0501035_0002691_253_1041 | 262 |
| 338 | 3300049824 | Ga0501045_0000061 | Ga0501045_0000061_33217_34005 | 262 |
| 339 | 3300049824 | Ga0501045_0129033 | Ga0501045_0129033_623_1411 | 262 |
| 340 | 3300049824 | Ga0501045_0195373 | Ga0501045_0195373_227_1015 | 262 |
| 341 | 3300050507 | nmdc:mga05p37_2127_c1 | nmdc:mga05p37_2127_c1_12949_13737 | 262 |
| 342 | 3300050507 | nmdc:mga05p37_265904_c1 | nmdc:mga05p37_265904_c1_399_1193 | 262 |
| 343 | 3300050510 | nmdc:mga06r32_152197_c1 | nmdc:mga06r32_152197_c1_691_1479 | 262 |
| 344 | 3300050512 | nmdc:mga0n895_287750_c1 | nmdc:mga0n895_287750_c1_789_1577 | 262 |
| 345 | 3300050515 | nmdc:mga0a205_2435_c1 | nmdc:mga0a205_2435_c1_3355_4143 | 262 |
| 346 | 3300050515 | nmdc:mga0a205_294543_c1 | nmdc:mga0a205_294543_c1_475_1263 | 262 |
| 347 | 3300054114 | Ga0501084_0000174 | Ga0501084_0000174_14465_15253 | 262 |
| 348 | 3300054114 | Ga0501084_0051510 | Ga0501084_0051510_89_877 | 262 |
| 349 | 3300054114 | Ga0501084_0091977 | Ga0501084_0091977_1178_1966 | 262 |
| 350 | 3300060353 | Ga0501082_0001345 | Ga0501082_0001345_9314_10102 | 262 |
| 351 | 3300060353 | Ga0501082_0017580 | Ga0501082_0017580_1006_1794 | 262 |
| 352 | 3300060353 | Ga0501082_0064316 | Ga0501082_0064316_460_1248 | 262 |
| 353 | 3300061734 | Ga0530510_0000011 | Ga0530510_0000011_16537_17325 | 262 |
| 354 | 3300061734 | Ga0530510_0000120 | Ga0530510_0000120_13932_14720 | 262 |
| 355 | 3300061734 | Ga0530510_0000904 | Ga0530510_0000904_15335_16123 | 262 |
| 356 | 3300061734 | Ga0530510_0008621 | Ga0530510_0008621_4944_5732 | 262 |
| 357 | 3300005333 | Ga0070677_10057509 | Ga0070677_100575092 | 263 |
| 358 | 3300005334 | Ga0068869_100031324 | Ga0068869_1000313242 | 263 |
| 359 | 3300005335 | Ga0070666_10081998 | Ga0070666_100819982 | 263 |
| 360 | 3300005338 | Ga0068868_100041953 | Ga0068868_1000419534 | 263 |
| 361 | 3300005340 | Ga0070689_100254267 | Ga0070689_1002542672 | 263 |
| 362 | 3300005341 | Ga0070691_10080104 | Ga0070691_100801042 | 263 |
| 363 | 3300005345 | Ga0070692_10019330 | Ga0070692_100193302 | 263 |
| 364 | 3300005354 | Ga0070675_100002028 | Ga0070675_1000020282 | 263 |
| 365 | 3300005355 | Ga0070671_100009036 | Ga0070671_1000090364 | 263 |
| 366 | 3300005355 | Ga0070671_100036288 | Ga0070671_1000362884 | 263 |
| 367 | 3300005356 | Ga0070674_100175157 | Ga0070674_1001751572 | 263 |
| 368 | 3300005364 | Ga0070673_100406408 | Ga0070673_1004064082 | 263 |
| 369 | 3300005365 | Ga0070688_100047448 | Ga0070688_1000474482 | 263 |
| 370 | 3300005367 | Ga0070667_100006537 | Ga0070667_1000065379 | 263 |
| 371 | 3300005438 | Ga0070701_10026441 | Ga0070701_100264413 | 263 |
| 372 | 3300005440 | Ga0070705_100013330 | Ga0070705_1000133301 | 263 |
| 373 | 3300005444 | Ga0070694_100098524 | Ga0070694_1000985241 | 263 |
| 374 | 3300005445 | Ga0070708_100029627 | Ga0070708_1000296274 | 263 |
| 375 | 3300005445 | Ga0070708_100347983 | Ga0070708_1003479832 | 263 |
| 376 | 3300005456 | Ga0070678_100008881 | Ga0070678_1000088814 | 263 |
| 377 | 3300005457 | Ga0070662_100018150 | Ga0070662_1000181504 | 263 |
| 378 | 3300005459 | Ga0068867_100039396 | Ga0068867_1000393964 | 263 |
| 379 | 3300005459 | Ga0068867_100092052 | Ga0068867_1000920521 | 263 |
| 380 | 3300005468 | Ga0070707_100069854 | Ga0070707_1000698544 | 263 |
| 381 | 3300005518 | Ga0070699_100019038 | Ga0070699_1000190383 | 263 |
| 382 | 3300005518 | Ga0070699_100440720 | Ga0070699_1004407202 | 263 |
| 383 | 3300005546 | Ga0070696_100044578 | Ga0070696_1000445783 | 263 |
| 384 | 3300005549 | Ga0070704_100113857 | Ga0070704_1001138572 | 263 |
| 385 | 3300005564 | Ga0070664_100277572 | Ga0070664_1002775722 | 263 |
| 386 | 3300005577 | Ga0068857_100010492 | Ga0068857_1000104922 | 263 |
| 387 | 3300005578 | Ga0068854_100056187 | Ga0068854_1000561873 | 263 |
| 388 | 3300005617 | Ga0068859_100010053 | Ga0068859_1000100538 | 263 |
| 389 | 3300005618 | Ga0068864_100001463 | Ga0068864_1000014632 | 263 |
| 390 | 3300005719 | Ga0068861_100046165 | Ga0068861_1000461654 | 263 |
| 391 | 3300005834 | Ga0068851_10160699 | Ga0068851_101606991 | 263 |
| 392 | 3300005841 | Ga0068863_100283544 | Ga0068863_1002835442 | 263 |
| 393 | 3300005842 | Ga0068858_100011584 | Ga0068858_1000115847 | 263 |
| 394 | 3300005844 | Ga0068862_100093982 | Ga0068862_1000939822 | 263 |
| 395 | 3300006237 | Ga0097621_100057405 | Ga0097621_1000574053 | 263 |
| 396 | 3300006358 | Ga0068871_100077658 | Ga0068871_1000776584 | 263 |
| 397 | 3300006846 | Ga0075430_100012821 | Ga0075430_1000128212 | 263 |
| 398 | 3300006847 | Ga0075431_100002850 | Ga0075431_10000285012 | 263 |
| 399 | 3300006847 | Ga0075431_100163293 | Ga0075431_1001632932 | 263 |
| 400 | 3300006871 | Ga0075434_100052065 | Ga0075434_1000520652 | 263 |
| 401 | 3300006880 | Ga0075429_100080569 | Ga0075429_1000805692 | 263 |
| 402 | 3300006881 | Ga0068865_100158436 | Ga0068865_1001584362 | 263 |
| 403 | 3300006931 | Ga0097620_100010053 | Ga0097620_1000100538 | 263 |
| 404 | 3300007076 | Ga0075435_100211384 | Ga0075435_1002113842 | 263 |
| 405 | 3300009094 | Ga0111539_10445188 | Ga0111539_104451882 | 263 |
| 406 | 3300009098 | Ga0105245_10171232 | Ga0105245_101712322 | 263 |
| 407 | 3300009147 | Ga0114129_10072480 | Ga0114129_100724804 | 263 |
| 408 | 3300009148 | Ga0105243_10040301 | Ga0105243_100403012 | 263 |
| 409 | 3300009176 | Ga0105242_10021582 | Ga0105242_100215823 | 263 |
| 410 | 3300009176 | Ga0105242_10115400 | Ga0105242_101154002 | 263 |
| 411 | 3300009177 | Ga0105248_10080234 | Ga0105248_100802342 | 263 |
| 412 | 3300009553 | Ga0105249_10079624 | Ga0105249_100796243 | 263 |
| 413 | 3300009553 | Ga0105249_10090602 | Ga0105249_100906023 | 263 |
| 414 | 3300013308 | Ga0157375_10285477 | Ga0157375_102854772 | 263 |
| 415 | 3300014325 | Ga0163163_10020609 | Ga0163163_100206095 | 263 |
| 416 | 3300014325 | Ga0163163_10075895 | Ga0163163_100758952 | 263 |
| 417 | 3300014968 | Ga0157379_10049404 | Ga0157379_100494042 | 263 |
| 418 | 3300014969 | Ga0157376_10327049 | Ga0157376_103270492 | 263 |
| 419 | 3300014969 | Ga0157376_10376071 | Ga0157376_103760711 | 263 |
| 420 | 3300017792 | Ga0163161_10223126 | Ga0163161_102231261 | 263 |
| 421 | 3300025321 | Ga0207656_10068267 | Ga0207656_100682671 | 263 |
| 422 | 3300025885 | Ga0207653_10010751 | Ga0207653_100107512 | 263 |
| 423 | 3300025893 | Ga0207682_10039867 | Ga0207682_100398672 | 263 |
| 424 | 3300025899 | Ga0207642_10058446 | Ga0207642_100584462 | 263 |
| 425 | 3300025903 | Ga0207680_10196389 | Ga0207680_101963892 | 263 |
| 426 | 3300025907 | Ga0207645_10019805 | Ga0207645_100198054 | 263 |
| 427 | 3300025907 | Ga0207645_10250132 | Ga0207645_102501321 | 263 |
| 428 | 3300025922 | Ga0207646_10290799 | Ga0207646_102907991 | 263 |
| 429 | 3300025925 | Ga0207650_10007617 | Ga0207650_100076175 | 263 |
| 430 | 3300025926 | Ga0207659_10001251 | Ga0207659_100012515 | 263 |
| 431 | 3300025931 | Ga0207644_10007517 | Ga0207644_100075177 | 263 |
| 432 | 3300025933 | Ga0207706_10043340 | Ga0207706_100433402 | 263 |
| 433 | 3300025934 | Ga0207686_10085005 | Ga0207686_100850052 | 263 |
| 434 | 3300025936 | Ga0207670_10003407 | Ga0207670_100034077 | 263 |
| 435 | 3300025937 | Ga0207669_10120603 | Ga0207669_101206032 | 263 |
| 436 | 3300025938 | Ga0207704_10108423 | Ga0207704_101084232 | 263 |
| 437 | 3300025940 | Ga0207691_10006856 | Ga0207691_100068562 | 263 |
| 438 | 3300025941 | Ga0207711_10128246 | Ga0207711_101282462 | 263 |
| 439 | 3300025942 | Ga0207689_10019551 | Ga0207689_100195512 | 263 |
| 440 | 3300025942 | Ga0207689_10027831 | Ga0207689_100278312 | 263 |
| 441 | 3300025960 | Ga0207651_10009356 | Ga0207651_100093562 | 263 |
| 442 | 3300025960 | Ga0207651_10130199 | Ga0207651_101301992 | 263 |
| 443 | 3300025961 | Ga0207712_10104512 | Ga0207712_101045122 | 263 |
| 444 | 3300025961 | Ga0207712_10122453 | Ga0207712_101224532 | 263 |
| 445 | 3300025972 | Ga0207668_10125874 | Ga0207668_101258742 | 263 |
| 446 | 3300025981 | Ga0207640_10058290 | Ga0207640_100582904 | 263 |
| 447 | 3300025986 | Ga0207658_10020226 | Ga0207658_100202264 | 263 |
| 448 | 3300026023 | Ga0207677_10017562 | Ga0207677_100175622 | 263 |
| 449 | 3300026035 | Ga0207703_10004365 | Ga0207703_100043657 | 263 |
| 450 | 3300026088 | Ga0207641_10194187 | Ga0207641_101941872 | 263 |
| 451 | 3300026089 | Ga0207648_10004610 | Ga0207648_100046104 | 263 |
| 452 | 3300026089 | Ga0207648_10046855 | Ga0207648_100468552 | 263 |
| 453 | 3300026089 | Ga0207648_10212826 | Ga0207648_102128262 | 263 |
| 454 | 3300026095 | Ga0207676_10005188 | Ga0207676_100051882 | 263 |
| 455 | 3300026116 | Ga0207674_10082456 | Ga0207674_100824562 | 263 |
| 456 | 3300026116 | Ga0207674_10308002 | Ga0207674_103080022 | 263 |
| 457 | 3300026118 | Ga0207675_100012377 | Ga0207675_1000123778 | 263 |
| 458 | 3300026118 | Ga0207675_100033418 | Ga0207675_1000334181 | 263 |
| 459 | 3300026121 | Ga0207683_10003366 | Ga0207683_100033669 | 263 |
| 460 | 3300027378 | Ga0209981_1001982 | Ga0209981_10019822 | 263 |
| 461 | 3300027462 | Ga0210000_1001061 | Ga0210000_10010612 | 263 |
| 462 | 3300027471 | Ga0209995_1006498 | Ga0209995_10064982 | 263 |
| 463 | 3300027665 | Ga0209983_1041104 | Ga0209983_10411042 | 263 |
| 464 | 3300027695 | Ga0209966_1036012 | Ga0209966_10360122 | 263 |
| 465 | 3300027907 | Ga0207428_10000119 | Ga0207428_1000011954 | 263 |
| 466 | 3300028380 | Ga0268265_10177590 | Ga0268265_101775902 | 263 |
| 467 | 3300038996 | Ga0242420_022072 | Ga0242420_022072_60_851 | 263 |
| 468 | 3300039437 | Ga0436365_1520353 | Ga0436365_1520353_779_1570 | 263 |
| 469 | 3300039450 | Ga0436363_0880215 | Ga0436363_0880215_1303_2094 | 263 |
| 470 | 3300041410 | Ga0439461_0001739 | Ga0439461_0001739_1854_2645 | 263 |
| 471 | 3300042156 | Ga0439446_0006283 | Ga0439446_0006283_214_1005 | 263 |
| 472 | 3300042435 | Ga0439434_0000566 | Ga0439434_0000566_4536_5327 | 263 |
| 473 | 3300042436 | Ga0439435_0000524 | Ga0439435_0000524_3368_4159 | 263 |
| 474 | 3300042876 | Ga0451577_0001635 | Ga0451577_0001635_13420_14211 | 263 |
| 475 | 3300044673 | Ga0453683_0047014 | Ga0453683_0047014_1551_2342 | 263 |
| 476 | 3300044712 | Ga0453684_0022118 | Ga0453684_0022118_8032_8823 | 263 |
| 477 | 3300045051 | Ga0451576_0019593 | Ga0451576_0019593_6144_6935 | 263 |
| 478 | 3300045051 | Ga0451576_0074686 | Ga0451576_0074686_231_1022 | 263 |
| 479 | 3300046539 | Ga0495621_0071254 | Ga0495621_0071254_112_903 | 263 |
| 480 | 3300048908 | Ga0496105_0204856 | Ga0496105_0204856_356_1147 | 263 |
| 481 | 3300048911 | Ga0496108_0316490 | Ga0496108_0316490_539_1330 | 263 |
| 482 | 3300048912 | Ga0496109_0257590 | Ga0496109_0257590_495_1286 | 263 |
| 483 | 3300048917 | Ga0496114_0287885 | Ga0496114_0287885_91_882 | 263 |
| 484 | 3300048917 | Ga0496114_0452875 | Ga0496114_0452875_119_910 | 263 |
| 485 | 3300049575 | Ga0501039_0240371 | Ga0501039_0240371_490_1323 | 263 |
| 486 | 3300049576 | Ga0501040_0115421 | Ga0501040_0115421_365_1213 | 263 |
| 487 | 3300049577 | Ga0501041_0060322 | Ga0501041_0060322_1145_1978 | 263 |
| 488 | 3300049591 | Ga0501075_0158687 | Ga0501075_0158687_134_937 | 263 |
| 489 | 3300049593 | Ga0501077_0184671 | Ga0501077_0184671_373_1176 | 263 |
| 490 | 3300049742 | Ga0501080_0293904 | Ga0501080_0293904_501_1298 | 263 |
| 491 | 3300049743 | Ga0501081_0279404 | Ga0501081_0279404_347_1195 | 263 |
| 492 | 3300049824 | Ga0501045_0031538 | Ga0501045_0031538_880_1728 | 263 |
| 493 | 3300050507 | nmdc:mga05p37_108241_c1 | nmdc:mga05p37_108241_c1_703_1497 | 263 |
| 494 | 3300050508 | nmdc:mga09592_68020_c1 | nmdc:mga09592_68020_c1_496_1290 | 263 |
| 495 | 3300050510 | nmdc:mga06r32_295477_c1 | nmdc:mga06r32_295477_c1_718_1518 | 263 |
| 496 | 3300050510 | nmdc:mga06r32_543_c1 | nmdc:mga06r32_543_c1_26539_27330 | 263 |
| 497 | 3300050511 | nmdc:mga08y16_135113_c1 | nmdc:mga08y16_135113_c1_1672_2487 | 263 |
| 498 | 3300050511 | nmdc:mga08y16_221892_c1 | nmdc:mga08y16_221892_c1_559_1350 | 263 |
| 499 | 3300050515 | nmdc:mga0a205_325115_c1 | nmdc:mga0a205_325115_c1_52_843 | 263 |
| 500 | 3300050515 | nmdc:mga0a205_4195_c1 | nmdc:mga0a205_4195_c1_4753_5544 | 263 |
| 501 | 3300061734 | Ga0530510_0067050 | Ga0530510_0067050_1624_2427 | 263 |
| 502 | 3300005327 | Ga0070658_10017377 | Ga0070658_100173777 | 264 |
| 503 | 3300005328 | Ga0070676_10019502 | Ga0070676_100195022 | 264 |
| 504 | 3300005328 | Ga0070676_10035668 | Ga0070676_100356681 | 264 |
| 505 | 3300005328 | Ga0070676_10124159 | Ga0070676_101241592 | 264 |
| 506 | 3300005328 | Ga0070676_10165179 | Ga0070676_101651791 | 264 |
| 507 | 3300005329 | Ga0070683_100040525 | Ga0070683_1000405254 | 264 |
| 508 | 3300005329 | Ga0070683_100271984 | Ga0070683_1002719842 | 264 |
| 509 | 3300005330 | Ga0070690_100139918 | Ga0070690_1001399182 | 264 |
| 510 | 3300005330 | Ga0070690_100404943 | Ga0070690_1004049431 | 264 |
| 511 | 3300005331 | Ga0070670_100012669 | Ga0070670_1000126692 | 264 |
| 512 | 3300005331 | Ga0070670_100197982 | Ga0070670_1001979822 | 264 |
| 513 | 3300005333 | Ga0070677_10001601 | Ga0070677_100016015 | 264 |
| 514 | 3300005333 | Ga0070677_10022340 | Ga0070677_100223403 | 264 |
| 515 | 3300005334 | Ga0068869_100063073 | Ga0068869_1000630733 | 264 |
| 516 | 3300005334 | Ga0068869_100137523 | Ga0068869_1001375232 | 264 |
| 517 | 3300005335 | Ga0070666_10051995 | Ga0070666_100519952 | 264 |
| 518 | 3300005336 | Ga0070680_100017402 | Ga0070680_1000174026 | 264 |
| 519 | 3300005336 | Ga0070680_100020755 | Ga0070680_1000207556 | 264 |
| 520 | 3300005338 | Ga0068868_100011500 | Ga0068868_1000115006 | 264 |
| 521 | 3300005338 | Ga0068868_100021226 | Ga0068868_1000212262 | 264 |
| 522 | 3300005339 | Ga0070660_100521387 | Ga0070660_1005213871 | 264 |
| 523 | 3300005341 | Ga0070691_10043311 | Ga0070691_100433112 | 264 |
| 524 | 3300005343 | Ga0070687_100006985 | Ga0070687_1000069853 | 264 |
| 525 | 3300005343 | Ga0070687_100165095 | Ga0070687_1001650952 | 264 |
| 526 | 3300005344 | Ga0070661_100014385 | Ga0070661_1000143855 | 264 |
| 527 | 3300005344 | Ga0070661_100175352 | Ga0070661_1001753522 | 264 |
| 528 | 3300005345 | Ga0070692_10063082 | Ga0070692_100630822 | 264 |
| 529 | 3300005347 | Ga0070668_100008548 | Ga0070668_1000085484 | 264 |
| 530 | 3300005347 | Ga0070668_100234735 | Ga0070668_1002347352 | 264 |
| 531 | 3300005353 | Ga0070669_100008226 | Ga0070669_1000082269 | 264 |
| 532 | 3300005353 | Ga0070669_100017213 | Ga0070669_1000172134 | 264 |
| 533 | 3300005353 | Ga0070669_100427719 | Ga0070669_1004277191 | 264 |
| 534 | 3300005354 | Ga0070675_100001473 | Ga0070675_1000014738 | 264 |
| 535 | 3300005354 | Ga0070675_100067768 | Ga0070675_1000677683 | 264 |
| 536 | 3300005354 | Ga0070675_100071907 | Ga0070675_1000719072 | 264 |
| 537 | 3300005354 | Ga0070675_100123743 | Ga0070675_1001237433 | 264 |
| 538 | 3300005354 | Ga0070675_100141154 | Ga0070675_1001411542 | 264 |
| 539 | 3300005354 | Ga0070675_100165162 | Ga0070675_1001651622 | 264 |
| 540 | 3300005355 | Ga0070671_100084085 | Ga0070671_1000840851 | 264 |
| 541 | 3300005355 | Ga0070671_100140401 | Ga0070671_1001404013 | 264 |
| 542 | 3300005355 | Ga0070671_100401901 | Ga0070671_1004019011 | 264 |
| 543 | 3300005356 | Ga0070674_100002004 | Ga0070674_1000020049 | 264 |
| 544 | 3300005356 | Ga0070674_100028613 | Ga0070674_1000286134 | 264 |
| 545 | 3300005364 | Ga0070673_100101863 | Ga0070673_1001018633 | 264 |
| 546 | 3300005364 | Ga0070673_100158064 | Ga0070673_1001580642 | 264 |
| 547 | 3300005366 | Ga0070659_100010360 | Ga0070659_1000103602 | 264 |
| 548 | 3300005366 | Ga0070659_100060037 | Ga0070659_1000600373 | 264 |
| 549 | 3300005366 | Ga0070659_100191593 | Ga0070659_1001915932 | 264 |
| 550 | 3300005367 | Ga0070667_100044986 | Ga0070667_1000449863 | 264 |
| 551 | 3300005367 | Ga0070667_100105902 | Ga0070667_1001059022 | 264 |
| 552 | 3300005367 | Ga0070667_100301233 | Ga0070667_1003012332 | 264 |
| 553 | 3300005441 | Ga0070700_100032115 | Ga0070700_1000321153 | 264 |
| 554 | 3300005444 | Ga0070694_100007631 | Ga0070694_1000076314 | 264 |
| 555 | 3300005444 | Ga0070694_100171856 | Ga0070694_1001718562 | 264 |
| 556 | 3300005445 | Ga0070708_100073242 | Ga0070708_1000732423 | 264 |
| 557 | 3300005445 | Ga0070708_100073742 | Ga0070708_1000737423 | 264 |
| 558 | 3300005455 | Ga0070663_100023705 | Ga0070663_1000237052 | 264 |
| 559 | 3300005455 | Ga0070663_100051958 | Ga0070663_1000519583 | 264 |
| 560 | 3300005456 | Ga0070678_100005290 | Ga0070678_1000052904 | 264 |
| 561 | 3300005456 | Ga0070678_100009981 | Ga0070678_1000099816 | 264 |
| 562 | 3300005456 | Ga0070678_100202337 | Ga0070678_1002023372 | 264 |
| 563 | 3300005456 | Ga0070678_100223072 | Ga0070678_1002230722 | 264 |
| 564 | 3300005457 | Ga0070662_100033808 | Ga0070662_1000338084 | 264 |
| 565 | 3300005457 | Ga0070662_100202242 | Ga0070662_1002022422 | 264 |
| 566 | 3300005459 | Ga0068867_100009158 | Ga0068867_1000091582 | 264 |
| 567 | 3300005459 | Ga0068867_100257763 | Ga0068867_1002577632 | 264 |
| 568 | 3300005467 | Ga0070706_100042313 | Ga0070706_1000423135 | 264 |
| 569 | 3300005471 | Ga0070698_100239084 | Ga0070698_1002390842 | 264 |
| 570 | 3300005518 | Ga0070699_100060621 | Ga0070699_1000606214 | 264 |
| 571 | 3300005530 | Ga0070679_100033201 | Ga0070679_1000332012 | 264 |
| 572 | 3300005535 | Ga0070684_100010489 | Ga0070684_1000104895 | 264 |
| 573 | 3300005535 | Ga0070684_100017959 | Ga0070684_1000179595 | 264 |
| 574 | 3300005536 | Ga0070697_100019590 | Ga0070697_1000195902 | 264 |
| 575 | 3300005536 | Ga0070697_100374499 | Ga0070697_1003744991 | 264 |
| 576 | 3300005543 | Ga0070672_100000367 | Ga0070672_1000003676 | 264 |
| 577 | 3300005543 | Ga0070672_100007088 | Ga0070672_1000070882 | 264 |
| 578 | 3300005543 | Ga0070672_100061957 | Ga0070672_1000619572 | 264 |
| 579 | 3300005543 | Ga0070672_100101293 | Ga0070672_1001012932 | 264 |
| 580 | 3300005543 | Ga0070672_100113183 | Ga0070672_1001131832 | 264 |
| 581 | 3300005543 | Ga0070672_100217578 | Ga0070672_1002175782 | 264 |
| 582 | 3300005545 | Ga0070695_100014436 | Ga0070695_1000144364 | 264 |
| 583 | 3300005546 | Ga0070696_100025581 | Ga0070696_1000255815 | 264 |
| 584 | 3300005547 | Ga0070693_100051699 | Ga0070693_1000516992 | 264 |
| 585 | 3300005547 | Ga0070693_100207726 | Ga0070693_1002077261 | 264 |
| 586 | 3300005548 | Ga0070665_100206576 | Ga0070665_1002065762 | 264 |
| 587 | 3300005549 | Ga0070704_100002668 | Ga0070704_10000266811 | 264 |
| 588 | 3300005563 | Ga0068855_100047419 | Ga0068855_1000474194 | 264 |
| 589 | 3300005563 | Ga0068855_100296977 | Ga0068855_1002969772 | 264 |
| 590 | 3300005564 | Ga0070664_100044502 | Ga0070664_1000445024 | 264 |
| 591 | 3300005564 | Ga0070664_100142653 | Ga0070664_1001426533 | 264 |
| 592 | 3300005564 | Ga0070664_100345530 | Ga0070664_1003455302 | 264 |
| 593 | 3300005577 | Ga0068857_100017565 | Ga0068857_1000175657 | 264 |
| 594 | 3300005578 | Ga0068854_100066784 | Ga0068854_1000667843 | 264 |
| 595 | 3300005614 | Ga0068856_100134328 | Ga0068856_1001343282 | 264 |
| 596 | 3300005614 | Ga0068856_100201548 | Ga0068856_1002015482 | 264 |
| 597 | 3300005615 | Ga0070702_100058658 | Ga0070702_1000586583 | 264 |
| 598 | 3300005616 | Ga0068852_100003436 | Ga0068852_10000343611 | 264 |
| 599 | 3300005616 | Ga0068852_100060689 | Ga0068852_1000606893 | 264 |
| 600 | 3300005617 | Ga0068859_100195161 | Ga0068859_1001951612 | 264 |
| 601 | 3300005718 | Ga0068866_10023300 | Ga0068866_100233003 | 264 |
| 602 | 3300005718 | Ga0068866_10351328 | Ga0068866_103513281 | 264 |
| 603 | 3300005719 | Ga0068861_100057457 | Ga0068861_1000574572 | 264 |
| 604 | 3300005719 | Ga0068861_100243854 | Ga0068861_1002438542 | 264 |
| 605 | 3300005719 | Ga0068861_100325479 | Ga0068861_1003254791 | 264 |
| 606 | 3300005834 | Ga0068851_10007610 | Ga0068851_100076106 | 264 |
| 607 | 3300005840 | Ga0068870_10154212 | Ga0068870_101542121 | 264 |
| 608 | 3300005841 | Ga0068863_100061813 | Ga0068863_1000618132 | 264 |
| 609 | 3300005841 | Ga0068863_100331919 | Ga0068863_1003319192 | 264 |
| 610 | 3300005842 | Ga0068858_100030957 | Ga0068858_1000309576 | 264 |
| 611 | 3300005843 | Ga0068860_100032817 | Ga0068860_1000328173 | 264 |
| 612 | 3300005844 | Ga0068862_100055423 | Ga0068862_1000554232 | 264 |
| 613 | 3300005844 | Ga0068862_100154945 | Ga0068862_1001549453 | 264 |
| 614 | 3300005844 | Ga0068862_100534187 | Ga0068862_1005341872 | 264 |
| 615 | 3300005983 | Ga0081540_1001963 | Ga0081540_10019631 | 264 |
| 616 | 3300006175 | Ga0070712_100003912 | Ga0070712_1000039128 | 264 |
| 617 | 3300006237 | Ga0097621_100027168 | Ga0097621_1000271683 | 264 |
| 618 | 3300006358 | Ga0068871_100053922 | Ga0068871_1000539224 | 264 |
| 619 | 3300006358 | Ga0068871_100077544 | Ga0068871_1000775441 | 264 |
| 620 | 3300006844 | Ga0075428_100208263 | Ga0075428_1002082632 | 264 |
| 621 | 3300006844 | Ga0075428_100219056 | Ga0075428_1002190562 | 264 |
| 622 | 3300006844 | Ga0075428_100628764 | Ga0075428_1006287642 | 264 |
| 623 | 3300006846 | Ga0075430_100004554 | Ga0075430_1000045544 | 264 |
| 624 | 3300006846 | Ga0075430_100066435 | Ga0075430_1000664352 | 264 |
| 625 | 3300006847 | Ga0075431_100308463 | Ga0075431_1003084632 | 264 |
| 626 | 3300006847 | Ga0075431_100412554 | Ga0075431_1004125542 | 264 |
| 627 | 3300006847 | Ga0075431_100451208 | Ga0075431_1004512082 | 264 |
| 628 | 3300006871 | Ga0075434_100027528 | Ga0075434_1000275282 | 264 |
| 629 | 3300006871 | Ga0075434_100333616 | Ga0075434_1003336162 | 264 |
| 630 | 3300006880 | Ga0075429_100179331 | Ga0075429_1001793312 | 264 |
| 631 | 3300006881 | Ga0068865_100027578 | Ga0068865_1000275784 | 264 |
| 632 | 3300006881 | Ga0068865_100106877 | Ga0068865_1001068772 | 264 |
| 633 | 3300006931 | Ga0097620_100195163 | Ga0097620_1001951633 | 264 |
| 634 | 3300007076 | Ga0075435_100002991 | Ga0075435_1000029916 | 264 |
| 635 | 3300009093 | Ga0105240_10204521 | Ga0105240_102045211 | 264 |
| 636 | 3300009094 | Ga0111539_10446254 | Ga0111539_104462542 | 264 |
| 637 | 3300009098 | Ga0105245_10292954 | Ga0105245_102929541 | 264 |
| 638 | 3300009147 | Ga0114129_10040169 | Ga0114129_100401696 | 264 |
| 639 | 3300009148 | Ga0105243_10051221 | Ga0105243_100512214 | 264 |
| 640 | 3300009148 | Ga0105243_10079378 | Ga0105243_100793783 | 264 |
| 641 | 3300009148 | Ga0105243_10144850 | Ga0105243_101448503 | 264 |
| 642 | 3300009176 | Ga0105242_10003134 | Ga0105242_100031345 | 264 |
| 643 | 3300009177 | Ga0105248_10347494 | Ga0105248_103474942 | 264 |
| 644 | 3300009545 | Ga0105237_10145509 | Ga0105237_101455093 | 264 |
| 645 | 3300009551 | Ga0105238_10007362 | Ga0105238_100073628 | 264 |
| 646 | 3300009553 | Ga0105249_10128679 | Ga0105249_101286793 | 264 |
| 647 | 3300010375 | Ga0105239_10137492 | Ga0105239_101374923 | 264 |
| 648 | 3300013100 | Ga0157373_10029670 | Ga0157373_100296701 | 264 |
| 649 | 3300013102 | Ga0157371_10037931 | Ga0157371_100379315 | 264 |
| 650 | 3300013104 | Ga0157370_10279402 | Ga0157370_102794022 | 264 |
| 651 | 3300013105 | Ga0157369_10022216 | Ga0157369_100222166 | 264 |
| 652 | 3300013296 | Ga0157374_10027157 | Ga0157374_100271573 | 264 |
| 653 | 3300013306 | Ga0163162_10048029 | Ga0163162_100480293 | 264 |
| 654 | 3300013306 | Ga0163162_10281320 | Ga0163162_102813202 | 264 |
| 655 | 3300013308 | Ga0157375_10019729 | Ga0157375_100197296 | 264 |
| 656 | 3300013308 | Ga0157375_10055410 | Ga0157375_100554103 | 264 |
| 657 | 3300013308 | Ga0157375_10122639 | Ga0157375_101226391 | 264 |
| 658 | 3300013308 | Ga0157375_10356485 | Ga0157375_103564852 | 264 |
| 659 | 3300014326 | Ga0157380_10017786 | Ga0157380_100177865 | 264 |
| 660 | 3300014326 | Ga0157380_10070708 | Ga0157380_100707082 | 264 |
| 661 | 3300014745 | Ga0157377_10013835 | Ga0157377_100138353 | 264 |
| 662 | 3300014745 | Ga0157377_10130712 | Ga0157377_101307122 | 264 |
| 663 | 3300014968 | Ga0157379_10049604 | Ga0157379_100496044 | 264 |
| 664 | 3300014968 | Ga0157379_10086963 | Ga0157379_100869632 | 264 |
| 665 | 3300017792 | Ga0163161_10038748 | Ga0163161_100387484 | 264 |
| 666 | 3300017792 | Ga0163161_10096543 | Ga0163161_100965433 | 264 |
| 667 | 3300025315 | Ga0207697_10012608 | Ga0207697_100126084 | 264 |
| 668 | 3300025315 | Ga0207697_10054956 | Ga0207697_100549562 | 264 |
| 669 | 3300025321 | Ga0207656_10006250 | Ga0207656_100062502 | 264 |
| 670 | 3300025893 | Ga0207682_10001930 | Ga0207682_1000193010 | 264 |
| 671 | 3300025893 | Ga0207682_10071731 | Ga0207682_100717312 | 264 |
| 672 | 3300025899 | Ga0207642_10007895 | Ga0207642_100078952 | 264 |
| 673 | 3300025899 | Ga0207642_10280851 | Ga0207642_102808511 | 264 |
| 674 | 3300025901 | Ga0207688_10044220 | Ga0207688_100442202 | 264 |
| 675 | 3300025901 | Ga0207688_10087373 | Ga0207688_100873732 | 264 |
| 676 | 3300025903 | Ga0207680_10042049 | Ga0207680_100420493 | 264 |
| 677 | 3300025907 | Ga0207645_10027607 | Ga0207645_100276072 | 264 |
| 678 | 3300025907 | Ga0207645_10030712 | Ga0207645_100307123 | 264 |
| 679 | 3300025907 | Ga0207645_10033748 | Ga0207645_100337482 | 264 |
| 680 | 3300025907 | Ga0207645_10042982 | Ga0207645_100429824 | 264 |
| 681 | 3300025908 | Ga0207643_10019020 | Ga0207643_100190203 | 264 |
| 682 | 3300025908 | Ga0207643_10029595 | Ga0207643_100295953 | 264 |
| 683 | 3300025910 | Ga0207684_10113792 | Ga0207684_101137923 | 264 |
| 684 | 3300025915 | Ga0207693_10017649 | Ga0207693_100176492 | 264 |
| 685 | 3300025917 | Ga0207660_10018952 | Ga0207660_100189526 | 264 |
| 686 | 3300025918 | Ga0207662_10021081 | Ga0207662_100210813 | 264 |
| 687 | 3300025918 | Ga0207662_10042917 | Ga0207662_100429173 | 264 |
| 688 | 3300025919 | Ga0207657_10100472 | Ga0207657_101004723 | 264 |
| 689 | 3300025919 | Ga0207657_10213023 | Ga0207657_102130232 | 264 |
| 690 | 3300025920 | Ga0207649_10068246 | Ga0207649_100682461 | 264 |
| 691 | 3300025921 | Ga0207652_10082207 | Ga0207652_100822073 | 264 |
| 692 | 3300025922 | Ga0207646_10665423 | Ga0207646_106654231 | 264 |
| 693 | 3300025923 | Ga0207681_10004718 | Ga0207681_100047184 | 264 |
| 694 | 3300025923 | Ga0207681_10071611 | Ga0207681_100716112 | 264 |
| 695 | 3300025924 | Ga0207694_10010481 | Ga0207694_100104817 | 264 |
| 696 | 3300025925 | Ga0207650_10002288 | Ga0207650_100022889 | 264 |
| 697 | 3300025925 | Ga0207650_10489180 | Ga0207650_104891801 | 264 |
| 698 | 3300025926 | Ga0207659_10008394 | Ga0207659_100083944 | 264 |
| 699 | 3300025926 | Ga0207659_10042664 | Ga0207659_100426642 | 264 |
| 700 | 3300025926 | Ga0207659_10048389 | Ga0207659_100483893 | 264 |
| 701 | 3300025926 | Ga0207659_10098723 | Ga0207659_100987231 | 264 |
| 702 | 3300025926 | Ga0207659_10136798 | Ga0207659_101367982 | 264 |
| 703 | 3300025927 | Ga0207687_10516559 | Ga0207687_105165591 | 264 |
| 704 | 3300025931 | Ga0207644_10004038 | Ga0207644_1000403812 | 264 |
| 705 | 3300025931 | Ga0207644_10055781 | Ga0207644_100557813 | 264 |
| 706 | 3300025931 | Ga0207644_10151962 | Ga0207644_101519622 | 264 |
| 707 | 3300025931 | Ga0207644_10326758 | Ga0207644_103267582 | 264 |
| 708 | 3300025932 | Ga0207690_10037362 | Ga0207690_100373623 | 264 |
| 709 | 3300025933 | Ga0207706_10047809 | Ga0207706_100478095 | 264 |
| 710 | 3300025933 | Ga0207706_10122724 | Ga0207706_101227242 | 264 |
| 711 | 3300025933 | Ga0207706_10133013 | Ga0207706_101330132 | 264 |
| 712 | 3300025933 | Ga0207706_10154489 | Ga0207706_101544893 | 264 |
| 713 | 3300025934 | Ga0207686_10017797 | Ga0207686_100177973 | 264 |
| 714 | 3300025935 | Ga0207709_10005183 | Ga0207709_100051834 | 264 |
| 715 | 3300025935 | Ga0207709_10248760 | Ga0207709_102487601 | 264 |
| 716 | 3300025937 | Ga0207669_10006304 | Ga0207669_100063045 | 264 |
| 717 | 3300025937 | Ga0207669_10016994 | Ga0207669_100169943 | 264 |
| 718 | 3300025937 | Ga0207669_10312289 | Ga0207669_103122891 | 264 |
| 719 | 3300025938 | Ga0207704_10037100 | Ga0207704_100371003 | 264 |
| 720 | 3300025938 | Ga0207704_10120544 | Ga0207704_101205442 | 264 |
| 721 | 3300025938 | Ga0207704_10446031 | Ga0207704_104460311 | 264 |
| 722 | 3300025940 | Ga0207691_10001841 | Ga0207691_1000184119 | 264 |
| 723 | 3300025940 | Ga0207691_10031141 | Ga0207691_100311415 | 264 |
| 724 | 3300025940 | Ga0207691_10057440 | Ga0207691_100574404 | 264 |
| 725 | 3300025940 | Ga0207691_10082635 | Ga0207691_100826352 | 264 |
| 726 | 3300025940 | Ga0207691_10091124 | Ga0207691_100911243 | 264 |
| 727 | 3300025941 | Ga0207711_10006733 | Ga0207711_100067337 | 264 |
| 728 | 3300025942 | Ga0207689_10003015 | Ga0207689_100030154 | 264 |
| 729 | 3300025942 | Ga0207689_10081455 | Ga0207689_100814552 | 264 |
| 730 | 3300025942 | Ga0207689_10088553 | Ga0207689_100885532 | 264 |
| 731 | 3300025944 | Ga0207661_10063406 | Ga0207661_100634063 | 264 |
| 732 | 3300025945 | Ga0207679_10031738 | Ga0207679_100317385 | 264 |
| 733 | 3300025945 | Ga0207679_10101871 | Ga0207679_101018712 | 264 |
| 734 | 3300025945 | Ga0207679_10311838 | Ga0207679_103118382 | 264 |
| 735 | 3300025949 | Ga0207667_10066485 | Ga0207667_100664854 | 264 |
| 736 | 3300025949 | Ga0207667_10120562 | Ga0207667_101205623 | 264 |
| 737 | 3300025960 | Ga0207651_10058708 | Ga0207651_100587083 | 264 |
| 738 | 3300025972 | Ga0207668_10162154 | Ga0207668_101621542 | 264 |
| 739 | 3300025981 | Ga0207640_10178391 | Ga0207640_101783912 | 264 |
| 740 | 3300025981 | Ga0207640_10295073 | Ga0207640_102950731 | 264 |
| 741 | 3300025986 | Ga0207658_10038082 | Ga0207658_100380823 | 264 |
| 742 | 3300025986 | Ga0207658_10052272 | Ga0207658_100522722 | 264 |
| 743 | 3300026023 | Ga0207677_10010426 | Ga0207677_100104262 | 264 |
| 744 | 3300026023 | Ga0207677_10179252 | Ga0207677_101792523 | 264 |
| 745 | 3300026035 | Ga0207703_10072760 | Ga0207703_100727603 | 264 |
| 746 | 3300026035 | Ga0207703_10713381 | Ga0207703_107133811 | 264 |
| 747 | 3300026041 | Ga0207639_10184678 | Ga0207639_101846783 | 264 |
| 748 | 3300026067 | Ga0207678_10080961 | Ga0207678_100809612 | 264 |
| 749 | 3300026075 | Ga0207708_10014113 | Ga0207708_100141134 | 264 |
| 750 | 3300026088 | Ga0207641_10029872 | Ga0207641_100298724 | 264 |
| 751 | 3300026089 | Ga0207648_10013731 | Ga0207648_100137312 | 264 |
| 752 | 3300026089 | Ga0207648_10017318 | Ga0207648_100173185 | 264 |
| 753 | 3300026089 | Ga0207648_10084566 | Ga0207648_100845662 | 264 |
| 754 | 3300026089 | Ga0207648_10107263 | Ga0207648_101072632 | 264 |
| 755 | 3300026095 | Ga0207676_10233920 | Ga0207676_102339202 | 264 |
| 756 | 3300026116 | Ga0207674_10030783 | Ga0207674_100307834 | 264 |
| 757 | 3300026116 | Ga0207674_10073163 | Ga0207674_100731634 | 264 |
| 758 | 3300026116 | Ga0207674_10224399 | Ga0207674_102243992 | 264 |
| 759 | 3300026118 | Ga0207675_100004260 | Ga0207675_1000042609 | 264 |
| 760 | 3300026118 | Ga0207675_100004346 | Ga0207675_1000043468 | 264 |
| 761 | 3300026118 | Ga0207675_100196474 | Ga0207675_1001964742 | 264 |
| 762 | 3300026118 | Ga0207675_100639557 | Ga0207675_1006395572 | 264 |
| 763 | 3300026121 | Ga0207683_10005954 | Ga0207683_1000595410 | 264 |
| 764 | 3300026121 | Ga0207683_10094734 | Ga0207683_100947342 | 264 |
| 765 | 3300026121 | Ga0207683_10133862 | Ga0207683_101338622 | 264 |
| 766 | 3300026121 | Ga0207683_10134607 | Ga0207683_101346072 | 264 |
| 767 | 3300026121 | Ga0207683_10175710 | Ga0207683_101757102 | 264 |
| 768 | 3300026121 | Ga0207683_10190770 | Ga0207683_101907702 | 264 |
| 769 | 3300026121 | Ga0207683_10243090 | Ga0207683_102430902 | 264 |
| 770 | 3300026142 | Ga0207698_10052265 | Ga0207698_100522653 | 264 |
| 771 | 3300026142 | Ga0207698_10067046 | Ga0207698_100670462 | 264 |
| 772 | 3300026142 | Ga0207698_10090778 | Ga0207698_100907782 | 264 |
| 773 | 3300027364 | Ga0209967_1020007 | Ga0209967_10200071 | 264 |
| 774 | 3300027543 | Ga0209999_1032194 | Ga0209999_10321941 | 264 |
| 775 | 3300027682 | Ga0209971_1017284 | Ga0209971_10172842 | 264 |
| 776 | 3300027876 | Ga0209974_10052163 | Ga0209974_100521632 | 264 |
| 777 | 3300028380 | Ga0268265_10108103 | Ga0268265_101081033 | 264 |
| 778 | 3300028380 | Ga0268265_10558898 | Ga0268265_105588981 | 264 |
| 779 | 3300028381 | Ga0268264_10060752 | Ga0268264_100607523 | 264 |
| 780 | 3300028381 | Ga0268264_10547194 | Ga0268264_105471942 | 264 |
| 781 | 3300031548 | Ga0307408_100089046 | Ga0307408_1000890462 | 264 |
| 782 | 3300031548 | Ga0307408_100362041 | Ga0307408_1003620412 | 264 |
| 783 | 3300031548 | Ga0307408_100452824 | Ga0307408_1004528241 | 264 |
| 784 | 3300031731 | Ga0307405_10009151 | Ga0307405_100091512 | 264 |
| 785 | 3300031824 | Ga0307413_10008938 | Ga0307413_100089384 | 264 |
| 786 | 3300031824 | Ga0307413_10440086 | Ga0307413_104400861 | 264 |
| 787 | 3300031852 | Ga0307410_10006974 | Ga0307410_100069745 | 264 |
| 788 | 3300031852 | Ga0307410_10328838 | Ga0307410_103288381 | 264 |
| 789 | 3300031901 | Ga0307406_10005307 | Ga0307406_100053076 | 264 |
| 790 | 3300031901 | Ga0307406_10010219 | Ga0307406_100102193 | 264 |
| 791 | 3300031901 | Ga0307406_10269485 | Ga0307406_102694852 | 264 |
| 792 | 3300031901 | Ga0307406_10597047 | Ga0307406_105970471 | 264 |
| 793 | 3300031903 | Ga0307407_10059107 | Ga0307407_100591071 | 264 |
| 794 | 3300031911 | Ga0307412_10021971 | Ga0307412_100219713 | 264 |
| 795 | 3300031911 | Ga0307412_10058416 | Ga0307412_100584163 | 264 |
| 796 | 3300031995 | Ga0307409_100003845 | Ga0307409_1000038456 | 264 |
| 797 | 3300032002 | Ga0307416_100006103 | Ga0307416_1000061037 | 264 |
| 798 | 3300032002 | Ga0307416_100015064 | Ga0307416_1000150642 | 264 |
| 799 | 3300032002 | Ga0307416_100360128 | Ga0307416_1003601282 | 264 |
| 800 | 3300032005 | Ga0307411_10001686 | Ga0307411_1000168611 | 264 |
| 801 | 3300032126 | Ga0307415_100003156 | Ga0307415_1000031566 | 264 |
| 802 | 3300032126 | Ga0307415_100047172 | Ga0307415_1000471723 | 264 |
| 803 | 3300035724 | Ga0373933_0095147 | Ga0373933_0095147_426_1232 | 264 |
| 804 | 3300036401 | Ga0373937_0137560 | Ga0373937_0137560_1457_2263 | 264 |
| 805 | 3300042001 | Ga0439441_008013 | Ga0439441_008013_607_1404 | 264 |
| 806 | 3300045051 | Ga0451576_0836521 | Ga0451576_0836521_102_896 | 264 |
| 807 | 3300045051 | Ga0451576_0842872 | Ga0451576_0842872_43_837 | 264 |
| 808 | 3300046455 | Ga0495603_0351960 | Ga0495603_0351960_24_818 | 264 |
| 809 | 3300046472 | Ga0495580_0019936 | Ga0495580_0019936_442_1236 | 264 |
| 810 | 3300046539 | Ga0495621_0006110 | Ga0495621_0006110_1550_2344 | 264 |
| 811 | 3300046683 | Ga0495658_0173618 | Ga0495658_0173618_347_1144 | 264 |
| 812 | 3300048904 | Ga0496101_0126385 | Ga0496101_0126385_41_835 | 264 |
| 813 | 3300048905 | Ga0496102_0117883 | Ga0496102_0117883_1423_2232 | 264 |
| 814 | 3300048905 | Ga0496102_0254605 | Ga0496102_0254605_228_1022 | 264 |
| 815 | 3300048907 | Ga0496104_0148482 | Ga0496104_0148482_112_906 | 264 |
| 816 | 3300048910 | Ga0496107_0057725 | Ga0496107_0057725_1354_2148 | 264 |
| 817 | 3300048911 | Ga0496108_0112494 | Ga0496108_0112494_207_1037 | 264 |
| 818 | 3300048913 | Ga0496110_0115029 | Ga0496110_0115029_882_1676 | 264 |
| 819 | 3300048916 | Ga0496113_0026700 | Ga0496113_0026700_2942_3736 | 264 |
| 820 | 3300049572 | Ga0501036_0109508 | Ga0501036_0109508_841_1638 | 264 |
| 821 | 3300049574 | Ga0501038_0185490 | Ga0501038_0185490_361_1158 | 264 |
| 822 | 3300049575 | Ga0501039_0016381 | Ga0501039_0016381_1289_2098 | 264 |
| 823 | 3300049575 | Ga0501039_0097688 | Ga0501039_0097688_1287_2084 | 264 |
| 824 | 3300049575 | Ga0501039_0102901 | Ga0501039_0102901_214_1011 | 264 |
| 825 | 3300049576 | Ga0501040_0060582 | Ga0501040_0060582_573_1370 | 264 |
| 826 | 3300049576 | Ga0501040_0166778 | Ga0501040_0166778_628_1425 | 264 |
| 827 | 3300049577 | Ga0501041_0059931 | Ga0501041_0059931_421_1218 | 264 |
| 828 | 3300049577 | Ga0501041_0082721 | Ga0501041_0082721_517_1314 | 264 |
| 829 | 3300049578 | Ga0501042_0023557 | Ga0501042_0023557_1801_2610 | 264 |
| 830 | 3300049578 | Ga0501042_0162492 | Ga0501042_0162492_686_1483 | 264 |
| 831 | 3300049578 | Ga0501042_0275288 | Ga0501042_0275288_304_1101 | 264 |
| 832 | 3300049580 | Ga0501046_0029661 | Ga0501046_0029661_751_1560 | 264 |
| 833 | 3300049580 | Ga0501046_0479502 | Ga0501046_0479502_30_827 | 264 |
| 834 | 3300049582 | Ga0501048_0066840 | Ga0501048_0066840_1375_2172 | 264 |
| 835 | 3300049584 | Ga0501068_0054829 | Ga0501068_0054829_41_850 | 264 |
| 836 | 3300049587 | Ga0501071_0165472 | Ga0501071_0165472_24_833 | 264 |
| 837 | 3300049588 | Ga0501072_0016554 | Ga0501072_0016554_1128_1925 | 264 |
| 838 | 3300049591 | Ga0501075_0018565 | Ga0501075_0018565_2334_3131 | 264 |
| 839 | 3300049591 | Ga0501075_0055799 | Ga0501075_0055799_2011_2820 | 264 |
| 840 | 3300049591 | Ga0501075_0185736 | Ga0501075_0185736_692_1567 | 264 |
| 841 | 3300049592 | Ga0501076_0001091 | Ga0501076_0001091_70_867 | 264 |
| 842 | 3300049593 | Ga0501077_0052158 | Ga0501077_0052158_1147_1944 | 264 |
| 843 | 3300049741 | Ga0501079_0006372 | Ga0501079_0006372_4686_5483 | 264 |
| 844 | 3300049741 | Ga0501079_0023390 | Ga0501079_0023390_2006_2815 | 264 |
| 845 | 3300049743 | Ga0501081_0017507 | Ga0501081_0017507_2879_3676 | 264 |
| 846 | 3300049822 | Ga0501035_0268450 | Ga0501035_0268450_374_1249 | 264 |
| 847 | 3300049824 | Ga0501045_0042286 | Ga0501045_0042286_695_1492 | 264 |
| 848 | 3300050509 | nmdc:mga0qj67_101406_c1 | nmdc:mga0qj67_101406_c1_194_991 | 264 |
| 849 | 3300050509 | nmdc:mga0qj67_259865_c1 | nmdc:mga0qj67_259865_c1_193_990 | 264 |
| 850 | 3300050509 | nmdc:mga0qj67_3331_c1 | nmdc:mga0qj67_3331_c1_6685_7503 | 264 |
| 851 | 3300050509 | nmdc:mga0qj67_3567_c1 | nmdc:mga0qj67_3567_c1_8726_9523 | 264 |
| 852 | 3300050510 | nmdc:mga06r32_153767_c1 | nmdc:mga06r32_153767_c1_634_1431 | 264 |
| 853 | 3300050510 | nmdc:mga06r32_30382_c1 | nmdc:mga06r32_30382_c1_4083_4901 | 264 |
| 854 | 3300050511 | nmdc:mga08y16_119992_c1 | nmdc:mga08y16_119992_c1_1073_1870 | 264 |
| 855 | 3300050512 | nmdc:mga0n895_188271_c1 | nmdc:mga0n895_188271_c1_336_1130 | 264 |
| 856 | 3300050514 | nmdc:mga08x19_186760_c1 | nmdc:mga08x19_186760_c1_407_1201 | 264 |
| 857 | 3300054114 | Ga0501084_0021396 | Ga0501084_0021396_3000_3809 | 264 |
| 858 | 3300054114 | Ga0501084_0087975 | Ga0501084_0087975_622_1419 | 264 |
| 859 | 3300060353 | Ga0501082_0087674 | Ga0501082_0087674_463_1260 | 264 |
| 860 | 3300060353 | Ga0501082_0118018 | Ga0501082_0118018_756_1565 | 264 |
| 861 | 3300061734 | Ga0530510_0058471 | Ga0530510_0058471_1130_1927 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7eum-assembly1.cif.gz_E | crystal structure of apo nmar_1308 protein at cryogenic temperature | 0.9273 | 10 | 228 |
| 7eum-assembly1.cif.gz_F | crystal structure of apo nmar_1308 protein at cryogenic temperature | 0.9269 | 10 | 228 |
| 7eum-assembly1.cif.gz_D | crystal structure of apo nmar_1308 protein at cryogenic temperature | 0.9268 | 10 | 228 |
| 4els-assembly1.cif.gz_C | structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with bicarbonate | 0.9239 | 4 | 223 |
| 6n92-assembly1.cif.gz_D | methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl-coa | 0.923 | 9 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9921 | 10 | 63 | 3.30.300.220 |
| af_O50402_25_213_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9469 | 10 | 182 | 3.90.226.10 |
| 3hinB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9419 | 11 | 209 | 3.90.226.10 |
| 4k2nA01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9374 | 9 | 209 | 3.90.226.10 |
| 2qq3L01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9218 | 9 | 209 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327UVW7-F1-model_v4 | Enoyl-CoA hydratase/carnithine racemase | 0.9711 | 11 | 264 |
|
| AF-A0A7V8HHN3-F1-model_v4 | deleted | 0.9675 | 11 | 196 |
|
| AF-A0A4Q6D293-F1-model_v4 | deleted | 0.9633 | 9 | 141 |
|
| AF-A0A432KCX9-F1-model_v4 | Enoyl-CoA hydratase | 0.9575 | 9 | 224 |
GO:0006635
GO:0016836 |
| AF-A0A3M1MTY6-F1-model_v4 | Crotonase | 0.9502 | 9 | 139 |
GO:0003824
GO:0006635 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar