F483837

General Info

Members Datasets Scaffolds Average Seq Length
861 277 861 266

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100055423|Ga0068862_1000554232
Length 323
Sequence LRDCGTRTQEVHSERVVACVQFKFTLAPALCASHPGCPGPVRARTQLLRSLPPLTQHPFVEPTAAPTDHVLVTRDGAIVTLTFNRPEARNAMTWEMYQRLYDICEEVDADESVRVLVLRGAGGKAFVAGTDISQFTEFNSGEDGLRYERDGDKRSGRIARVKKPVIAQIQGFAVGGGFGIAAGADLRIATPDARFGAPIARTLGNCLSMQAYARYLDLLGPSRLKELIFTARLMPADEALAAGFVHEIVPADTIEARVHELAQTIASHAPITLWVTKEAVRRIQESRALPDGDDLIATTYGSADFREGVRAFIDKRPPRWIGK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10017377 3300005327 Bacteria 5755
2 Ga0070676_10019502 3300005328 Bacteria 3774
3 Ga0070676_10035668 3300005328 Bacteria 2862
4 Ga0070676_10036618 3300005328 Bacteria 2827
5 Ga0070676_10124159 3300005328 Bacteria 1624
6 Ga0070676_10165179 3300005328 Bacteria 1428
7 Ga0070683_100040525 3300005329 Bacteria 4283
8 Ga0070683_100271984 3300005329 Bacteria 1611
9 Ga0070690_100139918 3300005330 Bacteria 1642
10 Ga0070690_100320569 3300005330 Bacteria 1117
11 Ga0070690_100404943 3300005330 Bacteria 1003
12 Ga0070670_100012669 3300005331 Bacteria 7219
13 Ga0070670_100106110 3300005331 Bacteria 2420
14 Ga0070670_100197982 3300005331 Bacteria 1745
15 Ga0070677_10001601 3300005333 Bacteria 7161
16 Ga0070677_10022340 3300005333 Bacteria 2328
17 Ga0070677_10057509 3300005333 Bacteria 1594
18 Ga0068869_100002738 3300005334 Bacteria 10667
19 Ga0068869_100009682 3300005334 Bacteria 6257
20 Ga0068869_100031324 3300005334 Bacteria 3741
21 Ga0068869_100063073 3300005334 Bacteria 2721
22 Ga0068869_100137523 3300005334 Bacteria 1883
23 Ga0070666_10051995 3300005335 Bacteria 2760
24 Ga0070666_10081998 3300005335 Bacteria 2205
25 Ga0070680_100017402 3300005336 Bacteria 5668
26 Ga0070680_100020755 3300005336 Bacteria 5212
27 Ga0070680_100186308 3300005336 Bacteria 1748
28 Ga0070682_100006921 3300005337 Bacteria 6375
29 Ga0068868_100011500 3300005338 Bacteria 6446
30 Ga0068868_100021226 3300005338 Bacteria 4890
31 Ga0068868_100041953 3300005338 Bacteria 3567
32 Ga0068868_100198876 3300005338 Bacteria 1670
33 Ga0070660_100521387 3300005339 Bacteria 990
34 Ga0070689_100254267 3300005340 Bacteria 1450
35 Ga0070691_10007474 3300005341 Bacteria 5011
36 Ga0070691_10043311 3300005341 Bacteria 2132
37 Ga0070691_10080104 3300005341 Bacteria 1597
38 Ga0070687_100006985 3300005343 Bacteria 4671
39 Ga0070687_100165095 3300005343 Bacteria 1313
40 Ga0070661_100014385 3300005344 Bacteria 5575
41 Ga0070661_100175352 3300005344 Bacteria 1629
42 Ga0070692_10010738 3300005345 Bacteria 4182
43 Ga0070692_10019330 3300005345 Bacteria 3286
44 Ga0070692_10063082 3300005345 Bacteria 1957
45 Ga0070668_100008548 3300005347 Bacteria 7603
46 Ga0070668_100234735 3300005347 Bacteria 1517
47 Ga0070669_100008226 3300005353 Bacteria 7450
48 Ga0070669_100017213 3300005353 Bacteria 5157
49 Ga0070669_100136963 3300005353 Bacteria 1884
50 Ga0070669_100427719 3300005353 Bacteria 1088
51 Ga0070675_100001473 3300005354 Bacteria 17347
52 Ga0070675_100002028 3300005354 Bacteria 15019
53 Ga0070675_100067768 3300005354 Bacteria 2953
54 Ga0070675_100071907 3300005354 Bacteria 2870
55 Ga0070675_100123743 3300005354 Bacteria 2199
56 Ga0070675_100141154 3300005354 Bacteria 2059
57 Ga0070675_100165162 3300005354 Bacteria 1906
58 Ga0070671_100009036 3300005355 Bacteria 7995
59 Ga0070671_100036288 3300005355 Bacteria 4087
60 Ga0070671_100084085 3300005355 Bacteria 2661
61 Ga0070671_100140401 3300005355 Bacteria 2039
62 Ga0070671_100401901 3300005355 Bacteria 1172
63 Ga0070674_100002004 3300005356 Bacteria 11146
64 Ga0070674_100028613 3300005356 Bacteria 3661
65 Ga0070674_100175157 3300005356 Bacteria 1638
66 Ga0070673_100101863 3300005364 Bacteria 2366
67 Ga0070673_100124185 3300005364 Bacteria 2157
68 Ga0070673_100158064 3300005364 Bacteria 1925
69 Ga0070673_100406408 3300005364 Bacteria 1218
70 Ga0070688_100047448 3300005365 Bacteria 2665
71 Ga0070659_100010360 3300005366 Bacteria 6855
72 Ga0070659_100060037 3300005366 Bacteria 3003
73 Ga0070659_100191593 3300005366 Bacteria 1681
74 Ga0070667_100006537 3300005367 Bacteria 9688
75 Ga0070667_100044986 3300005367 Bacteria 3710
76 Ga0070667_100105902 3300005367 Bacteria 2434
77 Ga0070667_100301233 3300005367 Bacteria 1443
78 Ga0070703_10013028 3300005406 Bacteria 2358
79 Ga0070701_10013724 3300005438 Bacteria 3693
80 Ga0070701_10026441 3300005438 Bacteria 2830
81 Ga0070705_100013330 3300005440 Bacteria 4200
82 Ga0070700_100032115 3300005441 Bacteria 3153
83 Ga0070694_100007631 3300005444 Bacteria 6605
84 Ga0070694_100010632 3300005444 Bacteria 5684
85 Ga0070694_100021213 3300005444 Bacteria 4147
86 Ga0070694_100059069 3300005444 Bacteria 2610
87 Ga0070694_100098524 3300005444 Bacteria 2064
88 Ga0070694_100171856 3300005444 Bacteria 1597
89 Ga0070708_100029627 3300005445 Bacteria 4721
90 Ga0070708_100073242 3300005445 Bacteria 3087
91 Ga0070708_100073742 3300005445 Bacteria 3077
92 Ga0070708_100347983 3300005445 Bacteria 1396
93 Ga0070708_100390521 3300005445 Bacteria 1312
94 Ga0070663_100023705 3300005455 Bacteria 4117
95 Ga0070663_100051958 3300005455 Bacteria 2922
96 Ga0070663_100251018 3300005455 Bacteria 1400
97 Ga0070678_100005290 3300005456 Bacteria 7437
98 Ga0070678_100008881 3300005456 Bacteria 6048
99 Ga0070678_100009981 3300005456 Bacteria 5777
100 Ga0070678_100202337 3300005456 Bacteria 1640
101 Ga0070678_100223072 3300005456 Bacteria 1567
102 Ga0070662_100018150 3300005457 Bacteria 4755
103 Ga0070662_100033808 3300005457 Bacteria 3602
104 Ga0070662_100074293 3300005457 Bacteria 2514
105 Ga0070662_100202242 3300005457 Bacteria 1577
106 Ga0068867_100009158 3300005459 Bacteria 6987
107 Ga0068867_100039396 3300005459 Bacteria 3445
108 Ga0068867_100092052 3300005459 Bacteria 2302
109 Ga0068867_100257763 3300005459 Bacteria 1421
110 Ga0070685_10219435 3300005466 Bacteria 1245
111 Ga0070706_100042313 3300005467 Bacteria 4208
112 Ga0070706_100073656 3300005467 Bacteria 3161
113 Ga0070707_100006533 3300005468 Bacteria 10828
114 Ga0070707_100041813 3300005468 Bacteria 4387
115 Ga0070707_100044956 3300005468 Bacteria 4227
116 Ga0070707_100069854 3300005468 Bacteria 3382
117 Ga0070707_100354277 3300005468 Bacteria 1425
118 Ga0070707_100481496 3300005468 Bacteria 1202
119 Ga0070698_100006586 3300005471 Bacteria 12593
120 Ga0070698_100038527 3300005471 Bacteria 4925
121 Ga0070698_100239084 3300005471 Bacteria 1749
122 Ga0070698_100300525 3300005471 Unclassified 1536
123 Ga0070698_100663025 3300005471 Bacteria 985
124 Ga0070699_100019038 3300005518 Bacteria 5905
125 Ga0070699_100060621 3300005518 Bacteria 3279
126 Ga0070699_100440720 3300005518 Bacteria 1180
127 Ga0070679_100033201 3300005530 Bacteria 5110
128 Ga0070679_100115287 3300005530 Bacteria 2672
129 Ga0070684_100010489 3300005535 Bacteria 7343
130 Ga0070684_100017959 3300005535 Bacteria 5815
131 Ga0070684_100517726 3300005535 Bacteria 1105
132 Ga0070697_100012294 3300005536 Bacteria 6706
133 Ga0070697_100019590 3300005536 Bacteria 5345
134 Ga0070697_100312598 3300005536 Bacteria 1352
135 Ga0070697_100374499 3300005536 Bacteria 1232
136 Ga0070672_100000367 3300005543 Bacteria 25974
137 Ga0070672_100007088 3300005543 Bacteria 7582
138 Ga0070672_100061957 3300005543 Bacteria 2950
139 Ga0070672_100101293 3300005543 Bacteria 2336
140 Ga0070672_100113183 3300005543 Bacteria 2214
141 Ga0070672_100217578 3300005543 Bacteria 1601
142 Ga0070672_100321905 3300005543 Bacteria 1315
143 Ga0070686_100039323 3300005544 Bacteria 2947
144 Ga0070695_100002303 3300005545 Bacteria 10951
145 Ga0070695_100014436 3300005545 Bacteria 4762
146 Ga0070695_100293142 3300005545 Bacteria 1200
147 Ga0070696_100001449 3300005546 Bacteria 15529
148 Ga0070696_100025581 3300005546 Unclassified 4014
149 Ga0070696_100044578 3300005546 Bacteria 3071
150 Ga0070693_100000500 3300005547 Bacteria 17545
151 Ga0070693_100051699 3300005547 Bacteria 2354
152 Ga0070693_100207726 3300005547 Bacteria 1276
153 Ga0070665_100206576 3300005548 Bacteria 1964
154 Ga0070704_100002668 3300005549 Bacteria 10079
155 Ga0070704_100113857 3300005549 Bacteria 2063
156 Ga0070704_100208137 3300005549 Bacteria 1583
157 Ga0068855_100047419 3300005563 Bacteria 5075
158 Ga0068855_100296977 3300005563 Bacteria 1790
159 Ga0070664_100044502 3300005564 Bacteria 3748
160 Ga0070664_100097835 3300005564 Bacteria 2548
161 Ga0070664_100142653 3300005564 Bacteria 2110
162 Ga0070664_100277572 3300005564 Bacteria 1510
163 Ga0070664_100345530 3300005564 Bacteria 1352
164 Ga0068857_100010492 3300005577 Bacteria 8051
165 Ga0068857_100017565 3300005577 Bacteria 6272
166 Ga0068854_100022784 3300005578 Bacteria 4273
167 Ga0068854_100056187 3300005578 Bacteria 2836
168 Ga0068854_100066784 3300005578 Bacteria 2618
169 Ga0068856_100059275 3300005614 Bacteria 3781
170 Ga0068856_100134328 3300005614 Bacteria 2480
171 Ga0068856_100201548 3300005614 Bacteria 2004
172 Ga0070702_100058658 3300005615 Bacteria 2231
173 Ga0068852_100003436 3300005616 Bacteria 11066
174 Ga0068852_100060689 3300005616 Bacteria 3283
175 Ga0068852_100143093 3300005616 Bacteria 2215
176 Ga0068859_100010053 3300005617 Bacteria 9540
177 Ga0068859_100048511 3300005617 Bacteria 4265
178 Ga0068859_100190461 3300005617 Bacteria 2135
179 Ga0068859_100195161 3300005617 Bacteria 2109
180 Ga0068864_100001463 3300005618 Bacteria 19462
181 Ga0068864_100057592 3300005618 Bacteria 3357
182 Ga0068864_100380419 3300005618 Bacteria 1338
183 Ga0068866_10023300 3300005718 Bacteria 2878
184 Ga0068866_10351328 3300005718 Bacteria 937
185 Ga0068861_100021240 3300005719 Bacteria 4666
186 Ga0068861_100046165 3300005719 Bacteria 3283
187 Ga0068861_100057457 3300005719 Bacteria 2972
188 Ga0068861_100243854 3300005719 Bacteria 1530
189 Ga0068861_100325479 3300005719 Bacteria 1340
190 Ga0068861_100670006 3300005719 Bacteria 960
191 Ga0068851_10007610 3300005834 Bacteria 4980
192 Ga0068851_10160699 3300005834 Bacteria 1234
193 Ga0068870_10002795 3300005840 Bacteria 7343
194 Ga0068870_10154212 3300005840 Bacteria 1356
195 Ga0068863_100061813 3300005841 Bacteria 3541
196 Ga0068863_100173374 3300005841 Bacteria 2069
197 Ga0068863_100283544 3300005841 Bacteria 1605
198 Ga0068863_100331919 3300005841 Bacteria 1478
199 Ga0068858_100011584 3300005842 Bacteria 8317
200 Ga0068858_100030957 3300005842 Bacteria 4969
201 Ga0068858_100076480 3300005842 Bacteria 3109
202 Ga0068860_100032817 3300005843 Bacteria 4987
203 Ga0068860_100076166 3300005843 Bacteria 3191
204 Ga0068860_100077735 3300005843 Bacteria 3156
205 Ga0068862_100016038 3300005844 Bacteria 6231
206 Ga0068862_100055423 3300005844 Bacteria 3396
207 Ga0068862_100079266 3300005844 Bacteria 2847
208 Ga0068862_100093982 3300005844 Bacteria 2615
209 Ga0068862_100154945 3300005844 Bacteria 2042
210 Ga0068862_100298665 3300005844 Bacteria 1481
211 Ga0068862_100459674 3300005844 Bacteria 1201
212 Ga0068862_100534187 3300005844 Bacteria 1118
213 Ga0081455_10005497 3300005937 Bacteria 13890
214 Ga0081540_1001963 3300005983 Bacteria 17161
215 Ga0070712_100003912 3300006175 Bacteria 9172
216 Ga0097621_100027168 3300006237 Bacteria 4498
217 Ga0097621_100057405 3300006237 Bacteria 3183
218 Ga0068871_100053922 3300006358 Bacteria 3261
219 Ga0068871_100077544 3300006358 Bacteria 2746
220 Ga0068871_100077658 3300006358 Bacteria 2744
221 Ga0068871_100370051 3300006358 Bacteria 1271
222 Ga0075428_100049288 3300006844 Bacteria 4621
223 Ga0075428_100208263 3300006844 Bacteria 2113
224 Ga0075428_100219056 3300006844 Bacteria 2055
225 Ga0075428_100320061 3300006844 Bacteria 1667
226 Ga0075428_100628764 3300006844 Bacteria 1146
227 Ga0075430_100004554 3300006846 Bacteria 11672
228 Ga0075430_100012821 3300006846 Bacteria 7142
229 Ga0075430_100066435 3300006846 Bacteria 3028
230 Ga0075431_100001553 3300006847 Bacteria 21303
231 Ga0075431_100002850 3300006847 Bacteria 16729
232 Ga0075431_100030281 3300006847 Bacteria 5574
233 Ga0075431_100073471 3300006847 Bacteria 3528
234 Ga0075431_100131330 3300006847 Bacteria 2583
235 Ga0075431_100163293 3300006847 Bacteria 2290
236 Ga0075431_100243790 3300006847 Bacteria 1827
237 Ga0075431_100308463 3300006847 Bacteria 1598
238 Ga0075431_100412554 3300006847 Bacteria 1350
239 Ga0075431_100451208 3300006847 Bacteria 1282
240 Ga0075433_10003788 3300006852 Bacteria 11715
241 Ga0075433_10037773 3300006852 Bacteria 4167
242 Ga0075434_100008812 3300006871 Bacteria 9390
243 Ga0075434_100010825 3300006871 Bacteria 8572
244 Ga0075434_100027528 3300006871 Bacteria 5583
245 Ga0075434_100052065 3300006871 Bacteria 4068
246 Ga0075434_100333616 3300006871 Bacteria 1537
247 Ga0075429_100002484 3300006880 Bacteria 15519
248 Ga0075429_100003767 3300006880 Bacteria 12927
249 Ga0075429_100080569 3300006880 Bacteria 2838
250 Ga0075429_100179331 3300006880 Bacteria 1856
251 Ga0075429_100598244 3300006880 Unclassified 966
252 Ga0068865_100027578 3300006881 Bacteria 3752
253 Ga0068865_100106877 3300006881 Bacteria 2058
254 Ga0068865_100158436 3300006881 Bacteria 1724
255 Ga0097620_100010053 3300006931 Bacteria 9540
256 Ga0097620_100048512 3300006931 Bacteria 4265
257 Ga0097620_100190449 3300006931 Bacteria 2135
258 Ga0097620_100195163 3300006931 Bacteria 2109
259 Ga0075435_100002991 3300007076 Bacteria 11373
260 Ga0075435_100109652 3300007076 Bacteria 2295
261 Ga0075435_100211384 3300007076 Bacteria 1646
262 Ga0105250_10138870 3300009092 Bacteria 1006
263 Ga0105240_10204521 3300009093 Bacteria 2312
264 Ga0111539_10064141 3300009094 Bacteria 4348
265 Ga0111539_10080686 3300009094 Bacteria 3827
266 Ga0111539_10445188 3300009094 Bacteria 1508
267 Ga0111539_10446254 3300009094 Bacteria 1506
268 Ga0111539_10742846 3300009094 Bacteria 1142
269 Ga0105245_10171232 3300009098 Bacteria 2068
270 Ga0105245_10292954 3300009098 Bacteria 1595
271 Ga0114129_10000404 3300009147 Bacteria 50669
272 Ga0114129_10012932 3300009147 Bacteria 11877
273 Ga0114129_10020555 3300009147 Bacteria 9389
274 Ga0114129_10030580 3300009147 Bacteria 7619
275 Ga0114129_10040169 3300009147 Bacteria 6596
276 Ga0114129_10072480 3300009147 Bacteria 4801
277 Ga0114129_10330122 3300009147 Bacteria 2025
278 Ga0105243_10040301 3300009148 Bacteria 3646
279 Ga0105243_10051221 3300009148 Bacteria 3265
280 Ga0105243_10079378 3300009148 Bacteria 2675
281 Ga0105243_10144850 3300009148 Bacteria 2031
282 Ga0105242_10003134 3300009176 Bacteria 12908
283 Ga0105242_10021582 3300009176 Bacteria 5058
284 Ga0105242_10115400 3300009176 Bacteria 2296
285 Ga0105248_10021675 3300009177 Bacteria 7117
286 Ga0105248_10080234 3300009177 Bacteria 3667
287 Ga0105248_10347494 3300009177 Bacteria 1670
288 Ga0105237_10145509 3300009545 Bacteria 2365
289 Ga0105238_10007362 3300009551 Bacteria 11022
290 Ga0105249_10058975 3300009553 Bacteria 3519
291 Ga0105249_10078076 3300009553 Bacteria 3072
292 Ga0105249_10079624 3300009553 Bacteria 3042
293 Ga0105249_10090602 3300009553 Bacteria 2859
294 Ga0105249_10128679 3300009553 Bacteria 2415
295 Ga0105249_10489576 3300009553 Bacteria 1273
296 Ga0105249_10708819 3300009553 Bacteria 1067
297 Ga0105239_10137492 3300010375 Bacteria 2720
298 Ga0105246_10432177 3300011119 Bacteria 1102
299 Ga0157373_10009169 3300013100 Bacteria 7317
300 Ga0157373_10029670 3300013100 Bacteria 3938
301 Ga0157371_10037931 3300013102 Bacteria 3448
302 Ga0157370_10279402 3300013104 Bacteria 1543
303 Ga0157369_10022216 3300013105 Bacteria 7085
304 Ga0157369_10159570 3300013105 Bacteria 2380
305 Ga0157374_10027157 3300013296 Bacteria 5160
306 Ga0157378_10142178 3300013297 Bacteria 2229
307 Ga0163162_10048029 3300013306 Bacteria 4277
308 Ga0163162_10281320 3300013306 Bacteria 1796
309 Ga0157372_10100255 3300013307 Bacteria 3305
310 Ga0157375_10019729 3300013308 Bacteria 6141
311 Ga0157375_10055410 3300013308 Bacteria 3909
312 Ga0157375_10122639 3300013308 Bacteria 2710
313 Ga0157375_10285477 3300013308 Bacteria 1814
314 Ga0157375_10356485 3300013308 Bacteria 1629
315 Ga0163163_10020609 3300014325 Bacteria 6214
316 Ga0163163_10066450 3300014325 Bacteria 3581
317 Ga0163163_10075895 3300014325 Bacteria 3355
318 Ga0163163_10457677 3300014325 Bacteria 1336
319 Ga0157380_10017786 3300014326 Bacteria 5267
320 Ga0157380_10070708 3300014326 Bacteria 2821
321 Ga0157377_10013835 3300014745 Bacteria 4091
322 Ga0157377_10130712 3300014745 Bacteria 1533
323 Ga0157379_10049404 3300014968 Bacteria 3756
324 Ga0157379_10049604 3300014968 Bacteria 3749
325 Ga0157379_10086963 3300014968 Bacteria 2803
326 Ga0157379_10134992 3300014968 Bacteria 2223
327 Ga0157376_10327049 3300014969 Bacteria 1459
328 Ga0157376_10376071 3300014969 Bacteria 1367
329 Ga0163161_10038748 3300017792 Bacteria 3419
330 Ga0163161_10096543 3300017792 Bacteria 2194
331 Ga0163161_10223126 3300017792 Bacteria 1460
332 Ga0207697_10012608 3300025315 Bacteria 3540
333 Ga0207697_10054956 3300025315 Bacteria 1650
334 Ga0207656_10006250 3300025321 Bacteria 4268
335 Ga0207656_10068267 3300025321 Bacteria 1575
336 Ga0207653_10010751 3300025885 Bacteria 2855
337 Ga0207682_10001930 3300025893 Bacteria 9419
338 Ga0207682_10039867 3300025893 Bacteria 1911
339 Ga0207682_10071731 3300025893 Bacteria 1468
340 Ga0207642_10007895 3300025899 Bacteria 3617
341 Ga0207642_10058446 3300025899 Bacteria 1779
342 Ga0207642_10280851 3300025899 Bacteria 958
343 Ga0207688_10017353 3300025901 Bacteria 3911
344 Ga0207688_10044220 3300025901 Bacteria 2482
345 Ga0207688_10087373 3300025901 Bacteria 1787
346 Ga0207680_10042049 3300025903 Bacteria 2671
347 Ga0207680_10196389 3300025903 Bacteria 1372
348 Ga0207645_10000202 3300025907 Bacteria 48725
349 Ga0207645_10019805 3300025907 Bacteria 4406
350 Ga0207645_10027607 3300025907 Bacteria 3663
351 Ga0207645_10030712 3300025907 Bacteria 3462
352 Ga0207645_10033748 3300025907 Bacteria 3288
353 Ga0207645_10042982 3300025907 Bacteria 2891
354 Ga0207645_10250132 3300025907 Bacteria 1172
355 Ga0207643_10001338 3300025908 Bacteria 14254
356 Ga0207643_10019020 3300025908 Bacteria 3762
357 Ga0207643_10029595 3300025908 Bacteria 3046
358 Ga0207684_10000570 3300025910 Bacteria 44869
359 Ga0207684_10091874 3300025910 Bacteria 2587
360 Ga0207684_10113792 3300025910 Bacteria 2316
361 Ga0207707_10001262 3300025912 Bacteria 23671
362 Ga0207693_10017649 3300025915 Bacteria 5690
363 Ga0207660_10004094 3300025917 Bacteria 9496
364 Ga0207660_10018952 3300025917 Bacteria 4596
365 Ga0207662_10021081 3300025918 Bacteria 3720
366 Ga0207662_10042917 3300025918 Bacteria 2667
367 Ga0207657_10028062 3300025919 Bacteria 5143
368 Ga0207657_10100472 3300025919 Bacteria 2401
369 Ga0207657_10213023 3300025919 Bacteria 1550
370 Ga0207649_10068246 3300025920 Bacteria 2260
371 Ga0207652_10082207 3300025921 Bacteria 2818
372 Ga0207646_10000408 3300025922 Bacteria 57610
373 Ga0207646_10009380 3300025922 Bacteria 9674
374 Ga0207646_10268432 3300025922 Bacteria 1542
375 Ga0207646_10290799 3300025922 Bacteria 1476
376 Ga0207646_10665423 3300025922 Bacteria 932
377 Ga0207681_10004718 3300025923 Bacteria 8386
378 Ga0207681_10071611 3300025923 Bacteria 2418
379 Ga0207694_10010481 3300025924 Bacteria 6990
380 Ga0207650_10002288 3300025925 Bacteria 13348
381 Ga0207650_10007617 3300025925 Bacteria 7378
382 Ga0207650_10489180 3300025925 Bacteria 1027
383 Ga0207650_10530028 3300025925 Bacteria 986
384 Ga0207659_10001251 3300025926 Bacteria 15213
385 Ga0207659_10008394 3300025926 Bacteria 6410
386 Ga0207659_10042664 3300025926 Bacteria 3182
387 Ga0207659_10048389 3300025926 Bacteria 3012
388 Ga0207659_10098723 3300025926 Bacteria 2196
389 Ga0207659_10136798 3300025926 Bacteria 1897
390 Ga0207687_10516559 3300025927 Bacteria 999
391 Ga0207644_10004038 3300025931 Bacteria 9522
392 Ga0207644_10007517 3300025931 Bacteria 7105
393 Ga0207644_10055781 3300025931 Bacteria 2849
394 Ga0207644_10151962 3300025931 Bacteria 1792
395 Ga0207644_10326758 3300025931 Bacteria 1241
396 Ga0207690_10037362 3300025932 Bacteria 3152
397 Ga0207706_10001207 3300025933 Bacteria 26108
398 Ga0207706_10043340 3300025933 Bacteria 3988
399 Ga0207706_10047809 3300025933 Bacteria 3785
400 Ga0207706_10122724 3300025933 Bacteria 2285
401 Ga0207706_10133013 3300025933 Bacteria 2188
402 Ga0207706_10154489 3300025933 Bacteria 2019
403 Ga0207686_10017797 3300025934 Bacteria 4010
404 Ga0207686_10085005 3300025934 Bacteria 2074
405 Ga0207709_10005183 3300025935 Bacteria 7423
406 Ga0207709_10142700 3300025935 Bacteria 1648
407 Ga0207709_10248760 3300025935 Bacteria 1297
408 Ga0207670_10003407 3300025936 Bacteria 8440
409 Ga0207669_10006304 3300025937 Bacteria 5408
410 Ga0207669_10016994 3300025937 Bacteria 3717
411 Ga0207669_10120603 3300025937 Bacteria 1779
412 Ga0207669_10312289 3300025937 Bacteria 1199
413 Ga0207704_10037100 3300025938 Bacteria 2812
414 Ga0207704_10108423 3300025938 Bacteria 1870
415 Ga0207704_10120544 3300025938 Bacteria 1794
416 Ga0207704_10446031 3300025938 Bacteria 1032
417 Ga0207665_10033122 3300025939 Bacteria 3423
418 Ga0207691_10001841 3300025940 Bacteria 20724
419 Ga0207691_10006856 3300025940 Bacteria 10989
420 Ga0207691_10031141 3300025940 Bacteria 4981
421 Ga0207691_10057440 3300025940 Bacteria 3541
422 Ga0207691_10082635 3300025940 Bacteria 2885
423 Ga0207691_10091124 3300025940 Bacteria 2732
424 Ga0207691_10259486 3300025940 Bacteria 1498
425 Ga0207711_10006733 3300025941 Bacteria 9666
426 Ga0207711_10128246 3300025941 Bacteria 2271
427 Ga0207689_10000275 3300025942 Bacteria 46532
428 Ga0207689_10003015 3300025942 Bacteria 15525
429 Ga0207689_10009225 3300025942 Bacteria 8532
430 Ga0207689_10019551 3300025942 Bacteria 5707
431 Ga0207689_10027831 3300025942 Bacteria 4730
432 Ga0207689_10081455 3300025942 Bacteria 2660
433 Ga0207689_10088553 3300025942 Bacteria 2543
434 Ga0207661_10063406 3300025944 Bacteria 2993
435 Ga0207679_10031738 3300025945 Bacteria 3700
436 Ga0207679_10101871 3300025945 Bacteria 2247
437 Ga0207679_10311838 3300025945 Bacteria 1359
438 Ga0207667_10001262 3300025949 Bacteria 31744
439 Ga0207667_10066485 3300025949 Bacteria 3757
440 Ga0207667_10120562 3300025949 Bacteria 2703
441 Ga0207651_10009356 3300025960 Bacteria 5358
442 Ga0207651_10058708 3300025960 Bacteria 2660
443 Ga0207651_10130199 3300025960 Bacteria 1925
444 Ga0207651_10254175 3300025960 Bacteria 1439
445 Ga0207712_10077336 3300025961 Bacteria 2411
446 Ga0207712_10104512 3300025961 Bacteria 2112
447 Ga0207712_10122453 3300025961 Bacteria 1970
448 Ga0207712_10410413 3300025961 Bacteria 1140
449 Ga0207712_10432998 3300025961 Bacteria 1112
450 Ga0207668_10125874 3300025972 Bacteria 1948
451 Ga0207668_10162154 3300025972 Bacteria 1743
452 Ga0207640_10058290 3300025981 Bacteria 2543
453 Ga0207640_10178391 3300025981 Bacteria 1590
454 Ga0207640_10295073 3300025981 Bacteria 1280
455 Ga0207658_10020226 3300025986 Bacteria 4609
456 Ga0207658_10038082 3300025986 Bacteria 3462
457 Ga0207658_10052272 3300025986 Bacteria 3014
458 Ga0207677_10010426 3300026023 Bacteria 5258
459 Ga0207677_10017562 3300026023 Bacteria 4271
460 Ga0207677_10179252 3300026023 Bacteria 1665
461 Ga0207703_10004365 3300026035 Bacteria 11622
462 Ga0207703_10072760 3300026035 Bacteria 2842
463 Ga0207703_10188136 3300026035 Bacteria 1826
464 Ga0207703_10713381 3300026035 Bacteria 954
465 Ga0207639_10030572 3300026041 Bacteria 3950
466 Ga0207639_10184678 3300026041 Bacteria 1777
467 Ga0207678_10018359 3300026067 Bacteria 6143
468 Ga0207678_10080961 3300026067 Bacteria 2779
469 Ga0207708_10014113 3300026075 Bacteria 5971
470 Ga0207702_10004046 3300026078 Bacteria 13163
471 Ga0207641_10029872 3300026088 Bacteria 4508
472 Ga0207641_10194187 3300026088 Bacteria 1867
473 Ga0207641_10290888 3300026088 Bacteria 1540
474 Ga0207648_10004610 3300026089 Bacteria 14130
475 Ga0207648_10005184 3300026089 Bacteria 13193
476 Ga0207648_10013731 3300026089 Bacteria 7519
477 Ga0207648_10017318 3300026089 Bacteria 6562
478 Ga0207648_10046855 3300026089 Bacteria 3790
479 Ga0207648_10084566 3300026089 Bacteria 2767
480 Ga0207648_10107263 3300026089 Bacteria 2451
481 Ga0207648_10212826 3300026089 Bacteria 1716
482 Ga0207676_10005188 3300026095 Bacteria 9216
483 Ga0207676_10233920 3300026095 Bacteria 1644
484 Ga0207674_10030783 3300026116 Bacteria 5641
485 Ga0207674_10056283 3300026116 Bacteria 3995
486 Ga0207674_10073163 3300026116 Bacteria 3441
487 Ga0207674_10082456 3300026116 Bacteria 3217
488 Ga0207674_10224399 3300026116 Bacteria 1827
489 Ga0207674_10308002 3300026116 Bacteria 1533
490 Ga0207675_100004260 3300026118 Bacteria 13842
491 Ga0207675_100004346 3300026118 Bacteria 13695
492 Ga0207675_100012377 3300026118 Bacteria 7969
493 Ga0207675_100033418 3300026118 Bacteria 4793
494 Ga0207675_100134300 3300026118 Bacteria 2347
495 Ga0207675_100196474 3300026118 Bacteria 1936
496 Ga0207675_100639557 3300026118 Bacteria 1069
497 Ga0207683_10003366 3300026121 Bacteria 13938
498 Ga0207683_10005954 3300026121 Bacteria 10447
499 Ga0207683_10094734 3300026121 Bacteria 2661
500 Ga0207683_10133862 3300026121 Bacteria 2230
501 Ga0207683_10134607 3300026121 Bacteria 2224
502 Ga0207683_10175710 3300026121 Bacteria 1941
503 Ga0207683_10190770 3300026121 Bacteria 1861
504 Ga0207683_10243090 3300026121 Bacteria 1642
505 Ga0207698_10052265 3300026142 Bacteria 3129
506 Ga0207698_10067046 3300026142 Bacteria 2829
507 Ga0207698_10090778 3300026142 Bacteria 2499
508 Ga0209969_1010615 3300027360 Bacteria 1319
509 Ga0209967_1020007 3300027364 Bacteria 974
510 Ga0209981_1001982 3300027378 Bacteria 2617
511 Ga0209984_1001927 3300027424 Bacteria 2288
512 Ga0210000_1001061 3300027462 Bacteria 3845
513 Ga0209995_1001661 3300027471 Bacteria 3457
514 Ga0209995_1006498 3300027471 Bacteria 1880
515 Ga0209968_1001914 3300027526 Bacteria 3161
516 Ga0209999_1032194 3300027543 Bacteria 974
517 Ga0209970_1001146 3300027614 Bacteria 4677
518 Ga0210002_1003471 3300027617 Bacteria 2322
519 Ga0209983_1002311 3300027665 Bacteria 4182
520 Ga0209983_1041104 3300027665 Bacteria 1000
521 Ga0209588_1003903 3300027671 Bacteria 4164
522 Ga0209971_1000011 3300027682 Bacteria 74088
523 Ga0209971_1017284 3300027682 Bacteria 1710
524 Ga0209966_1003478 3300027695 Bacteria 2648
525 Ga0209966_1007982 3300027695 Bacteria 1867
526 Ga0209966_1036012 3300027695 Bacteria 1017
527 Ga0209998_10000474 3300027717 Bacteria 11098
528 Ga0209998_10020832 3300027717 Bacteria 1404
529 Ga0209974_10007324 3300027876 Bacteria 3803
530 Ga0209974_10052163 3300027876 Bacteria 1376
531 Ga0207428_10000119 3300027907 Bacteria 106261
532 Ga0268265_10064526 3300028380 Bacteria 2821
533 Ga0268265_10071179 3300028380 Bacteria 2707
534 Ga0268265_10108103 3300028380 Bacteria 2263
535 Ga0268265_10177590 3300028380 Bacteria 1826
536 Ga0268265_10558898 3300028380 Bacteria 1087
537 Ga0268264_10060752 3300028381 Bacteria 3168
538 Ga0268264_10547194 3300028381 Bacteria 1135
539 Ga0307408_100062178 3300031548 Bacteria 2728
540 Ga0307408_100089046 3300031548 Bacteria 2326
541 Ga0307408_100362041 3300031548 Bacteria 1234
542 Ga0307408_100452824 3300031548 Bacteria 1114
543 Ga0307405_10009151 3300031731 Bacteria 5065
544 Ga0307413_10008938 3300031824 Bacteria 4763
545 Ga0307413_10440086 3300031824 Bacteria 1032
546 Ga0307410_10006974 3300031852 Bacteria 6149
547 Ga0307410_10328838 3300031852 Bacteria 1215
548 Ga0307406_10005307 3300031901 Bacteria 7050
549 Ga0307406_10010219 3300031901 Bacteria 5288
550 Ga0307406_10269485 3300031901 Bacteria 1293
551 Ga0307406_10597047 3300031901 Bacteria 910
552 Ga0307407_10059107 3300031903 Bacteria 2231
553 Ga0307412_10021971 3300031911 Bacteria 3904
554 Ga0307412_10058416 3300031911 Bacteria 2580
555 Ga0307409_100003845 3300031995 Bacteria 8290
556 Ga0307409_100037551 3300031995 Bacteria 3572
557 Ga0307416_100006103 3300032002 Bacteria 7504
558 Ga0307416_100015064 3300032002 Bacteria 5325
559 Ga0307416_100113922 3300032002 Bacteria 2391
560 Ga0307416_100360128 3300032002 Bacteria 1476
561 Ga0307411_10001686 3300032005 Bacteria 9255
562 Ga0307415_100003156 3300032126 Bacteria 8348
563 Ga0307415_100047172 3300032126 Bacteria 2899
564 Ga0373959_0007156 3300034820 Bacteria 1872
565 Ga0373928_0052373 3300035084 Bacteria 967
566 Ga0373949_0021317 3300035090 Bacteria 1489
567 Ga0373951_0081861 3300035091 Bacteria 836
568 Ga0373961_0062378 3300035241 Bacteria 1135
569 Ga0373933_0095147 3300035724 Bacteria 1843
570 Ga0373947_0181586 3300035725 Bacteria 1370
571 Ga0373937_0137560 3300036401 Bacteria 2284
572 Ga0242420_022072 3300038996 Bacteria 1143
573 Ga0436365_1520353 3300039437 Bacteria 3141
574 Ga0436363_0880215 3300039450 Bacteria 2540
575 Ga0439453_0024817 3300041408 Unclassified 1103
576 Ga0439461_0001739 3300041410 Bacteria 3402
577 Ga0439441_001036 3300042001 Bacteria 3443
578 Ga0439441_008013 3300042001 Bacteria 1717
579 Ga0439443_002298 3300042003 Bacteria 2268
580 Ga0439446_0006283 3300042156 Bacteria 3093
581 Ga0439458_0004746 3300042157 Bacteria 3091
582 Ga0439434_0000566 3300042435 Bacteria 10672
583 Ga0439435_0000236 3300042436 Bacteria 7940
584 Ga0439435_0000524 3300042436 Bacteria 6133
585 Ga0439444_0000850 3300042437 Bacteria 3702
586 Ga0439460_0000310 3300042461 Bacteria 10225
587 Ga0439460_0004249 3300042461 Bacteria 3488
588 Ga0451577_0001635 3300042876 Bacteria 29060
589 Ga0451577_0092249 3300042876 Bacteria 2704
590 Ga0451577_0286305 3300042876 Bacteria 1493
591 Ga0453683_0033006 3300044673 Bacteria 3264
592 Ga0453683_0047014 3300044673 Bacteria 2705
593 Ga0453683_0049783 3300044673 Bacteria 2626
594 Ga0453684_0022118 3300044712 Bacteria 9455
595 Ga0453684_0378835 3300044712 Bacteria 1589
596 Ga0451576_0013359 3300045051 Bacteria 9189
597 Ga0451576_0019593 3300045051 Bacteria 7384
598 Ga0451576_0020850 3300045051 Bacteria 7132
599 Ga0451576_0074686 3300045051 Bacteria 3527
600 Ga0451576_0161126 3300045051 Bacteria 2341
601 Ga0451576_0228419 3300045051 Bacteria 1943
602 Ga0451576_0733477 3300045051 Bacteria 1038
603 Ga0451576_0836521 3300045051 Bacteria 966
604 Ga0451576_0842872 3300045051 Bacteria 962
605 Ga0495603_0351960 3300046455 Bacteria 845
606 Ga0495580_0019936 3300046472 Bacteria 4971
607 Ga0495580_0056906 3300046472 Bacteria 2753
608 Ga0495580_0169160 3300046472 Bacteria 1511
609 Ga0495621_0006110 3300046539 Bacteria 3499
610 Ga0495621_0071254 3300046539 Bacteria 1281
611 Ga0495658_0173618 3300046683 Bacteria 1335
612 Ga0496101_0126385 3300048904 Bacteria 1938
613 Ga0496102_0117883 3300048905 Bacteria 2478
614 Ga0496102_0254605 3300048905 Bacteria 1655
615 Ga0496103_0239181 3300048906 Bacteria 1168
616 Ga0496104_0148482 3300048907 Bacteria 2251
617 Ga0496105_0204856 3300048908 Bacteria 1609
618 Ga0496106_0207056 3300048909 Bacteria 1562
619 Ga0496107_0057725 3300048910 Bacteria 2806
620 Ga0496108_0112494 3300048911 Bacteria 2329
621 Ga0496108_0316490 3300048911 Bacteria 1360
622 Ga0496109_0092083 3300048912 Bacteria 2804
623 Ga0496109_0257590 3300048912 Bacteria 1643
624 Ga0496110_0115029 3300048913 Bacteria 2421
625 Ga0496112_0237799 3300048915 Bacteria 1775
626 Ga0496113_0026700 3300048916 Bacteria 4132
627 Ga0496114_0287885 3300048917 Bacteria 1449
628 Ga0496114_0452875 3300048917 Bacteria 1136
629 Ga0501032_0141009 3300049569 Bacteria 1587
630 Ga0501033_0002516 3300049570 Bacteria 15525
631 Ga0501033_0117913 3300049570 Bacteria 1928
632 Ga0501033_0423512 3300049570 Bacteria 927
633 Ga0501036_0002550 3300049572 Bacteria 14321
634 Ga0501036_0008089 3300049572 Bacteria 8616
635 Ga0501036_0109508 3300049572 Bacteria 2334
636 Ga0501036_0150770 3300049572 Bacteria 1961
637 Ga0501036_0175440 3300049572 Bacteria 1805
638 Ga0501036_0382201 3300049572 Bacteria 1175
639 Ga0501037_0041574 3300049573 Bacteria 3381
640 Ga0501037_0155445 3300049573 Bacteria 1633
641 Ga0501038_0015810 3300049574 Bacteria 6857
642 Ga0501038_0038049 3300049574 Bacteria 4214
643 Ga0501038_0158731 3300049574 Bacteria 1840
644 Ga0501038_0185490 3300049574 Bacteria 1677
645 Ga0501038_0214400 3300049574 Bacteria 1539
646 Ga0501038_0389645 3300049574 Bacteria 1080
647 Ga0501039_0000890 3300049575 Bacteria 21739
648 Ga0501039_0016381 3300049575 Bacteria 5680
649 Ga0501039_0017620 3300049575 Bacteria 5479
650 Ga0501039_0026742 3300049575 Bacteria 4434
651 Ga0501039_0044475 3300049575 Bacteria 3430
652 Ga0501039_0097688 3300049575 Bacteria 2290
653 Ga0501039_0102901 3300049575 Bacteria 2229
654 Ga0501039_0240371 3300049575 Bacteria 1424
655 Ga0501040_0000166 3300049576 Bacteria 37216
656 Ga0501040_0001379 3300049576 Bacteria 15333
657 Ga0501040_0006519 3300049576 Bacteria 7580
658 Ga0501040_0030519 3300049576 Bacteria 3641
659 Ga0501040_0060582 3300049576 Bacteria 2601
660 Ga0501040_0109842 3300049576 Bacteria 1928
661 Ga0501040_0115421 3300049576 Bacteria 1880
662 Ga0501040_0139886 3300049576 Bacteria 1705
663 Ga0501040_0166778 3300049576 Bacteria 1558
664 Ga0501040_0192711 3300049576 Bacteria 1447
665 Ga0501040_0284053 3300049576 Bacteria 1182
666 Ga0501041_0000454 3300049577 Bacteria 20790
667 Ga0501041_0018036 3300049577 Bacteria 4202
668 Ga0501041_0031014 3300049577 Bacteria 3227
669 Ga0501041_0032491 3300049577 Bacteria 3154
670 Ga0501041_0036688 3300049577 Bacteria 2969
671 Ga0501041_0037895 3300049577 Bacteria 2923
672 Ga0501041_0041322 3300049577 Bacteria 2801
673 Ga0501041_0059931 3300049577 Bacteria 2329
674 Ga0501041_0060322 3300049577 Bacteria 2322
675 Ga0501041_0082721 3300049577 Bacteria 1978
676 Ga0501041_0179294 3300049577 Bacteria 1326
677 Ga0501041_0347950 3300049577 Bacteria 936
678 Ga0501042_0000055 3300049578 Bacteria 39662
679 Ga0501042_0009408 3300049578 Bacteria 6511
680 Ga0501042_0023557 3300049578 Bacteria 4310
681 Ga0501042_0040969 3300049578 Bacteria 3292
682 Ga0501042_0162492 3300049578 Bacteria 1611
683 Ga0501042_0177289 3300049578 Bacteria 1537
684 Ga0501042_0261059 3300049578 Bacteria 1250
685 Ga0501042_0275288 3300049578 Bacteria 1215
686 Ga0501042_0386265 3300049578 Bacteria 1014
687 Ga0501043_0022803 3300049579 Bacteria 4909
688 Ga0501043_0301187 3300049579 Bacteria 1225
689 Ga0501043_0474511 3300049579 Bacteria 937
690 Ga0501046_0002718 3300049580 Bacteria 16467
691 Ga0501046_0004575 3300049580 Bacteria 12508
692 Ga0501046_0028752 3300049580 Bacteria 4525
693 Ga0501046_0029661 3300049580 Bacteria 4446
694 Ga0501046_0032087 3300049580 Bacteria 4255
695 Ga0501046_0175575 3300049580 Bacteria 1605
696 Ga0501046_0479502 3300049580 Bacteria 892
697 Ga0501048_0000123 3300049582 Bacteria 44886
698 Ga0501048_0015656 3300049582 Bacteria 5597
699 Ga0501048_0041686 3300049582 Bacteria 3287
700 Ga0501048_0066840 3300049582 Bacteria 2541
701 Ga0501048_0073797 3300049582 Bacteria 2408
702 Ga0501068_0005780 3300049584 Bacteria 6784
703 Ga0501068_0036323 3300049584 Bacteria 2945
704 Ga0501068_0050238 3300049584 Bacteria 2521
705 Ga0501068_0054829 3300049584 Bacteria 2415
706 Ga0501068_0097325 3300049584 Bacteria 1821
707 Ga0501068_0152375 3300049584 Bacteria 1453
708 Ga0501068_0159569 3300049584 Bacteria 1421
709 Ga0501070_0443676 3300049586 Bacteria 1047
710 Ga0501071_0000151 3300049587 Bacteria 29305
711 Ga0501071_0056191 3300049587 Bacteria 2842
712 Ga0501071_0074525 3300049587 Bacteria 2477
713 Ga0501071_0086066 3300049587 Bacteria 2305
714 Ga0501071_0165472 3300049587 Bacteria 1654
715 Ga0501071_0230201 3300049587 Bacteria 1396
716 Ga0501072_0000139 3300049588 Bacteria 54279
717 Ga0501072_0002950 3300049588 Bacteria 12808
718 Ga0501072_0006314 3300049588 Bacteria 9025
719 Ga0501072_0016554 3300049588 Bacteria 5664
720 Ga0501072_0051233 3300049588 Bacteria 3251
721 Ga0501072_0100091 3300049588 Bacteria 2304
722 Ga0501072_0258539 3300049588 Bacteria 1386
723 Ga0501073_0169020 3300049589 Bacteria 1514
724 Ga0501073_0346042 3300049589 Bacteria 1026
725 Ga0501074_0016213 3300049590 Bacteria 5413
726 Ga0501074_0059946 3300049590 Bacteria 2741
727 Ga0501074_0278548 3300049590 Bacteria 1189
728 Ga0501075_0000051 3300049591 Bacteria 49296
729 Ga0501075_0000488 3300049591 Bacteria 23707
730 Ga0501075_0001002 3300049591 Bacteria 18052
731 Ga0501075_0018565 3300049591 Bacteria 5035
732 Ga0501075_0033179 3300049591 Bacteria 3840
733 Ga0501075_0055799 3300049591 Bacteria 2973
734 Ga0501075_0158687 3300049591 Bacteria 1725
735 Ga0501075_0180372 3300049591 Bacteria 1611
736 Ga0501075_0185736 3300049591 Bacteria 1586
737 Ga0501075_0252758 3300049591 Bacteria 1343
738 Ga0501076_0000008 3300049592 Bacteria 121885
739 Ga0501076_0000047 3300049592 Bacteria 59013
740 Ga0501076_0001091 3300049592 Bacteria 17844
741 Ga0501076_0002593 3300049592 Bacteria 12432
742 Ga0501076_0031876 3300049592 Bacteria 4113
743 Ga0501076_0067898 3300049592 Bacteria 2847
744 Ga0501076_0077788 3300049592 Bacteria 2662
745 Ga0501076_0445799 3300049592 Bacteria 1065
746 Ga0501076_0480395 3300049592 Bacteria 1024
747 Ga0501077_0000528 3300049593 Bacteria 23159
748 Ga0501077_0027236 3300049593 Bacteria 3629
749 Ga0501077_0039200 3300049593 Bacteria 3017
750 Ga0501077_0052158 3300049593 Bacteria 2598
751 Ga0501077_0156287 3300049593 Bacteria 1447
752 Ga0501077_0184671 3300049593 Bacteria 1325
753 Ga0501077_0212388 3300049593 Bacteria 1230
754 Ga0501077_0421647 3300049593 Bacteria 854
755 Ga0501079_0000131 3300049741 Bacteria 40400
756 Ga0501079_0000914 3300049741 Bacteria 20276
757 Ga0501079_0006372 3300049741 Bacteria 8858
758 Ga0501079_0007436 3300049741 Bacteria 8289
759 Ga0501079_0023390 3300049741 Bacteria 4742
760 Ga0501079_0077715 3300049741 Bacteria 2567
761 Ga0501079_0120079 3300049741 Bacteria 2044
762 Ga0501079_0216978 3300049741 Bacteria 1494
763 Ga0501079_0450510 3300049741 Bacteria 1011
764 Ga0501080_0000612 3300049742 Bacteria 28266
765 Ga0501080_0011259 3300049742 Bacteria 8188
766 Ga0501080_0025507 3300049742 Bacteria 5487
767 Ga0501080_0293904 3300049742 Bacteria 1475
768 Ga0501080_0336946 3300049742 Bacteria 1363
769 Ga0501081_0000048 3300049743 Bacteria 44786
770 Ga0501081_0001721 3300049743 Bacteria 13589
771 Ga0501081_0001746 3300049743 Bacteria 13495
772 Ga0501081_0015286 3300049743 Bacteria 5063
773 Ga0501081_0017507 3300049743 Bacteria 4744
774 Ga0501081_0020303 3300049743 Bacteria 4427
775 Ga0501081_0053906 3300049743 Bacteria 2777
776 Ga0501081_0066636 3300049743 Bacteria 2504
777 Ga0501081_0243983 3300049743 Bacteria 1310
778 Ga0501081_0279404 3300049743 Bacteria 1222
779 Ga0501083_0024095 3300049744 Bacteria 4219
780 Ga0501083_0090789 3300049744 Bacteria 2017
781 Ga0501035_0002691 3300049822 Bacteria 17293
782 Ga0501035_0268450 3300049822 Bacteria 1445
783 Ga0501045_0000061 3300049824 Bacteria 50353
784 Ga0501045_0031538 3300049824 Bacteria 3839
785 Ga0501045_0042286 3300049824 Bacteria 3317
786 Ga0501045_0064493 3300049824 Bacteria 2689
787 Ga0501045_0076513 3300049824 Bacteria 2466
788 Ga0501045_0129033 3300049824 Bacteria 1879
789 Ga0501045_0195373 3300049824 Bacteria 1508
790 nmdc:mga05p37_108241_c1 3300050507 Bacteria 3419
791 nmdc:mga05p37_116397_c1 3300050507 Bacteria 3285
792 nmdc:mga05p37_18859_c1 3300050507 Bacteria 5312
793 nmdc:mga05p37_2127_c1 3300050507 Bacteria 23133
794 nmdc:mga05p37_265904_c1 3300050507 Bacteria 2051
795 nmdc:mga05p37_78391_c1 3300050507 Bacteria 4068
796 nmdc:mga05p37_80731_c1 3300050507 Bacteria 4006
797 nmdc:mga09592_674_c1 3300050508 Bacteria 26100
798 nmdc:mga09592_68020_c1 3300050508 Bacteria 3021
799 nmdc:mga0qj67_101406_c1 3300050509 Bacteria 2321
800 nmdc:mga0qj67_2207_c1 3300050509 Bacteria 13837
801 nmdc:mga0qj67_259865_c1 3300050509 Bacteria 1408
802 nmdc:mga0qj67_3331_c1 3300050509 Bacteria 11585
803 nmdc:mga0qj67_3567_c1 3300050509 Bacteria 11232
804 nmdc:mga0qj67_83261_c1 3300050509 Bacteria 2565
805 nmdc:mga06r32_152197_c1 3300050510 Bacteria 2292
806 nmdc:mga06r32_153767_c1 3300050510 Bacteria 2280
807 nmdc:mga06r32_295477_c1 3300050510 Bacteria 1606
808 nmdc:mga06r32_30382_c1 3300050510 Bacteria 5069
809 nmdc:mga06r32_383732_c1 3300050510 Bacteria 1388
810 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
811 nmdc:mga06r32_5622_c1 3300050510 Bacteria 11275
812 nmdc:mga08y16_119992_c1 3300050511 Bacteria 2737
813 nmdc:mga08y16_135113_c1 3300050511 Bacteria 2563
814 nmdc:mga08y16_221892_c1 3300050511 Bacteria 1957
815 nmdc:mga08y16_33274_c1 3300050511 Bacteria 5414
816 nmdc:mga08y16_343821_c1 3300050511 Bacteria 1533
817 nmdc:mga0n895_15712_c1 3300050512 Bacteria 6918
818 nmdc:mga0n895_188271_c1 3300050512 Bacteria 2095
819 nmdc:mga0n895_287750_c1 3300050512 Bacteria 1666
820 nmdc:mga0rr50_942_c1 3300050513 Bacteria 15732
821 nmdc:mga08x19_14009_c1 3300050514 Bacteria 4860
822 nmdc:mga08x19_186760_c1 3300050514 Bacteria 1417
823 nmdc:mga08x19_29982_c1 3300050514 Bacteria 3415
824 nmdc:mga0a205_126371_c1 3300050515 Bacteria 2457
825 nmdc:mga0a205_2435_c1 3300050515 Bacteria 16411
826 nmdc:mga0a205_294543_c1 3300050515 Bacteria 1496
827 nmdc:mga0a205_325115_c1 3300050515 Bacteria 1408
828 nmdc:mga0a205_39243_c1 3300050515 Bacteria 4558
829 nmdc:mga0a205_4195_c1 3300050515 Bacteria 12923
830 Ga0501084_0000174 3300054114 Bacteria 50134
831 Ga0501084_0006749 3300054114 Bacteria 9436
832 Ga0501084_0008479 3300054114 Bacteria 8501
833 Ga0501084_0021396 3300054114 Bacteria 5390
834 Ga0501084_0051510 3300054114 Bacteria 3445
835 Ga0501084_0060883 3300054114 Bacteria 3161
836 Ga0501084_0087975 3300054114 Bacteria 2608
837 Ga0501084_0091977 3300054114 Bacteria 2547
838 Ga0501084_0151796 3300054114 Bacteria 1953
839 Ga0501084_0465752 3300054114 Bacteria 1068
840 Ga0501082_0000601 3300060353 Bacteria 31739
841 Ga0501082_0001345 3300060353 Bacteria 21591
842 Ga0501082_0011002 3300060353 Bacteria 7780
843 Ga0501082_0017580 3300060353 Bacteria 6159
844 Ga0501082_0029210 3300060353 Bacteria 4749
845 Ga0501082_0060561 3300060353 Bacteria 3259
846 Ga0501082_0064316 3300060353 Bacteria 3159
847 Ga0501082_0087674 3300060353 Bacteria 2685
848 Ga0501082_0118018 3300060353 Bacteria 2298
849 Ga0530510_0000011 3300061734 Bacteria 125603
850 Ga0530510_0000120 3300061734 Bacteria 44746
851 Ga0530510_0000904 3300061734 Bacteria 19576
852 Ga0530510_0002221 3300061734 Bacteria 13335
853 Ga0530510_0006444 3300061734 Bacteria 8174
854 Ga0530510_0008621 3300061734 Bacteria 7122
855 Ga0530510_0033419 3300061734 Bacteria 3703
856 Ga0530510_0058471 3300061734 Bacteria 2787
857 Ga0530510_0067050 3300061734 Bacteria 2603
858 Ga0530510_0089052 3300061734 Bacteria 2250
859 Ga0530510_0144720 3300061734 Bacteria 1753
860 Ga0530510_0181427 3300061734 Bacteria 1561
861 Ga0530510_0388102 3300061734 Bacteria 1051

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0039200 Ga0501077_0039200_14_676 220
2 3300049592 Ga0501076_0480395 Ga0501076_0480395_19_795 231
3 3300049593 Ga0501077_0421647 Ga0501077_0421647_63_839 231
4 3300049578 Ga0501042_0386265 Ga0501042_0386265_290_988 232
5 3300006844 Ga0075428_100320061 Ga0075428_1003200612 236
6 3300049578 Ga0501042_0261059 Ga0501042_0261059_153_956 236
7 3300054114 Ga0501084_0151796 Ga0501084_0151796_577_1380 236
8 3300049580 Ga0501046_0175575 Ga0501046_0175575_570_1376 237
9 3300049743 Ga0501081_0243983 Ga0501081_0243983_171_977 237
10 3300009094 Ga0111539_10080686 Ga0111539_100806862 241
11 3300050511 nmdc:mga08y16_343821_c1 nmdc:mga08y16_343821_c1_327_1115 241
12 3300005466 Ga0070685_10219435 Ga0070685_102194352 257
13 3300006844 Ga0075428_100049288 Ga0075428_1000492886 257
14 3300006847 Ga0075431_100001553 Ga0075431_10000155317 257
15 3300006880 Ga0075429_100003767 Ga0075429_10000376716 257
16 3300027695 Ga0209966_1003478 Ga0209966_10034783 257
17 3300027717 Ga0209998_10020832 Ga0209998_100208322 257
18 3300050510 nmdc:mga06r32_383732_c1 nmdc:mga06r32_383732_c1_573_1355 257
19 3300005445 Ga0070708_100390521 Ga0070708_1003905212 258
20 3300005536 Ga0070697_100312598 Ga0070697_1003125981 258
21 3300006847 Ga0075431_100243790 Ga0075431_1002437902 258
22 3300006880 Ga0075429_100002484 Ga0075429_10000248416 258
23 3300049572 Ga0501036_0382201 Ga0501036_0382201_38_814 258
24 3300049574 Ga0501038_0389645 Ga0501038_0389645_91_867 258
25 3300049577 Ga0501041_0031014 Ga0501041_0031014_98_874 258
26 3300049584 Ga0501068_0050238 Ga0501068_0050238_227_1003 258
27 3300049592 Ga0501076_0445799 Ga0501076_0445799_85_861 258
28 3300049593 Ga0501077_0027236 Ga0501077_0027236_2071_2847 258
29 3300049824 Ga0501045_0064493 Ga0501045_0064493_1158_1934 258
30 3300050507 nmdc:mga05p37_18859_c1 nmdc:mga05p37_18859_c1_290_1066 258
31 3300050508 nmdc:mga09592_674_c1 nmdc:mga09592_674_c1_268_1044 258
32 3300050509 nmdc:mga0qj67_2207_c1 nmdc:mga0qj67_2207_c1_12028_12804 258
33 3300050509 nmdc:mga0qj67_83261_c1 nmdc:mga0qj67_83261_c1_289_1065 258
34 3300050510 nmdc:mga06r32_5622_c1 nmdc:mga06r32_5622_c1_289_1065 258
35 3300060353 Ga0501082_0011002 Ga0501082_0011002_2118_2894 258
36 3300061734 Ga0530510_0002221 Ga0530510_0002221_3402_4178 258
37 3300061734 Ga0530510_0006444 Ga0530510_0006444_2403_3179 258
38 3300005330 Ga0070690_100320569 Ga0070690_1003205691 259
39 3300005438 Ga0070701_10013724 Ga0070701_100137242 259
40 3300005468 Ga0070707_100006533 Ga0070707_1000065333 259
41 3300005468 Ga0070707_100041813 Ga0070707_1000418134 259
42 3300005471 Ga0070698_100300525 Ga0070698_1003005252 259
43 3300005471 Ga0070698_100663025 Ga0070698_1006630251 259
44 3300005549 Ga0070704_100208137 Ga0070704_1002081372 259
45 3300005617 Ga0068859_100190461 Ga0068859_1001904612 259
46 3300005719 Ga0068861_100670006 Ga0068861_1006700061 259
47 3300005843 Ga0068860_100077735 Ga0068860_1000777353 259
48 3300005844 Ga0068862_100459674 Ga0068862_1004596742 259
49 3300005937 Ga0081455_10005497 Ga0081455_100054979 259
50 3300006880 Ga0075429_100598244 Ga0075429_1005982441 259
51 3300006931 Ga0097620_100190449 Ga0097620_1001904492 259
52 3300009092 Ga0105250_10138870 Ga0105250_101388701 259
53 3300009094 Ga0111539_10064141 Ga0111539_100641413 259
54 3300009147 Ga0114129_10012932 Ga0114129_100129323 259
55 3300009177 Ga0105248_10021675 Ga0105248_100216752 259
56 3300014325 Ga0163163_10457677 Ga0163163_104576771 259
57 3300035725 Ga0373947_0181586 Ga0373947_0181586_30_815 259
58 3300049576 Ga0501040_0284053 Ga0501040_0284053_115_912 259
59 3300049577 Ga0501041_0018036 Ga0501041_0018036_2824_3621 259
60 3300049741 Ga0501079_0216978 Ga0501079_0216978_291_1088 259
61 3300049824 Ga0501045_0076513 Ga0501045_0076513_426_1223 259
62 3300050507 nmdc:mga05p37_80731_c1 nmdc:mga05p37_80731_c1_206_991 259
63 3300050511 nmdc:mga08y16_33274_c1 nmdc:mga08y16_33274_c1_2979_3764 259
64 3300054114 Ga0501084_0060883 Ga0501084_0060883_1389_2186 259
65 3300060353 Ga0501082_0060561 Ga0501082_0060561_613_1410 259
66 3300061734 Ga0530510_0144720 Ga0530510_0144720_675_1472 259
67 3300005328 Ga0070676_10036618 Ga0070676_100366182 260
68 3300005331 Ga0070670_100106110 Ga0070670_1001061102 260
69 3300005334 Ga0068869_100002738 Ga0068869_1000027386 260
70 3300005334 Ga0068869_100009682 Ga0068869_1000096828 260
71 3300005336 Ga0070680_100186308 Ga0070680_1001863082 260
72 3300005337 Ga0070682_100006921 Ga0070682_1000069213 260
73 3300005338 Ga0068868_100198876 Ga0068868_1001988762 260
74 3300005341 Ga0070691_10007474 Ga0070691_100074746 260
75 3300005345 Ga0070692_10010738 Ga0070692_100107381 260
76 3300005353 Ga0070669_100136963 Ga0070669_1001369633 260
77 3300005364 Ga0070673_100124185 Ga0070673_1001241853 260
78 3300005406 Ga0070703_10013028 Ga0070703_100130284 260
79 3300005444 Ga0070694_100010632 Ga0070694_1000106322 260
80 3300005444 Ga0070694_100021213 Ga0070694_1000212136 260
81 3300005444 Ga0070694_100059069 Ga0070694_1000590694 260
82 3300005455 Ga0070663_100251018 Ga0070663_1002510181 260
83 3300005457 Ga0070662_100074293 Ga0070662_1000742935 260
84 3300005467 Ga0070706_100073656 Ga0070706_1000736563 260
85 3300005468 Ga0070707_100044956 Ga0070707_1000449567 260
86 3300005468 Ga0070707_100354277 Ga0070707_1003542772 260
87 3300005468 Ga0070707_100481496 Ga0070707_1004814962 260
88 3300005471 Ga0070698_100006586 Ga0070698_1000065862 260
89 3300005471 Ga0070698_100038527 Ga0070698_1000385273 260
90 3300005530 Ga0070679_100115287 Ga0070679_1001152874 260
91 3300005535 Ga0070684_100517726 Ga0070684_1005177261 260
92 3300005536 Ga0070697_100012294 Ga0070697_1000122943 260
93 3300005543 Ga0070672_100321905 Ga0070672_1003219052 260
94 3300005545 Ga0070695_100002303 Ga0070695_10000230313 260
95 3300005545 Ga0070695_100293142 Ga0070695_1002931422 260
96 3300005546 Ga0070696_100001449 Ga0070696_10000144918 260
97 3300005547 Ga0070693_100000500 Ga0070693_1000005002 260
98 3300005564 Ga0070664_100097835 Ga0070664_1000978355 260
99 3300005578 Ga0068854_100022784 Ga0068854_1000227841 260
100 3300005614 Ga0068856_100059275 Ga0068856_1000592754 260
101 3300005617 Ga0068859_100048511 Ga0068859_1000485114 260
102 3300005618 Ga0068864_100057592 Ga0068864_1000575923 260
103 3300005719 Ga0068861_100021240 Ga0068861_1000212406 260
104 3300005840 Ga0068870_10002795 Ga0068870_100027956 260
105 3300005841 Ga0068863_100173374 Ga0068863_1001733742 260
106 3300005842 Ga0068858_100076480 Ga0068858_1000764805 260
107 3300005843 Ga0068860_100076166 Ga0068860_1000761662 260
108 3300005844 Ga0068862_100016038 Ga0068862_1000160382 260
109 3300005844 Ga0068862_100079266 Ga0068862_1000792662 260
110 3300006358 Ga0068871_100370051 Ga0068871_1003700512 260
111 3300006852 Ga0075433_10037773 Ga0075433_100377737 260
112 3300006871 Ga0075434_100008812 Ga0075434_1000088125 260
113 3300006871 Ga0075434_100010825 Ga0075434_1000108254 260
114 3300006931 Ga0097620_100048512 Ga0097620_1000485124 260
115 3300007076 Ga0075435_100109652 Ga0075435_1001096522 260
116 3300009147 Ga0114129_10020555 Ga0114129_100205552 260
117 3300009147 Ga0114129_10030580 Ga0114129_100305804 260
118 3300009553 Ga0105249_10058975 Ga0105249_100589753 260
119 3300011119 Ga0105246_10432177 Ga0105246_104321771 260
120 3300013100 Ga0157373_10009169 Ga0157373_100091698 260
121 3300013105 Ga0157369_10159570 Ga0157369_101595703 260
122 3300013307 Ga0157372_10100255 Ga0157372_101002551 260
123 3300014325 Ga0163163_10066450 Ga0163163_100664505 260
124 3300025901 Ga0207688_10017353 Ga0207688_100173533 260
125 3300025907 Ga0207645_10000202 Ga0207645_1000020247 260
126 3300025908 Ga0207643_10001338 Ga0207643_100013386 260
127 3300025910 Ga0207684_10000570 Ga0207684_1000057015 260
128 3300025910 Ga0207684_10091874 Ga0207684_100918741 260
129 3300025912 Ga0207707_10001262 Ga0207707_1000126225 260
130 3300025917 Ga0207660_10004094 Ga0207660_100040942 260
131 3300025919 Ga0207657_10028062 Ga0207657_100280628 260
132 3300025922 Ga0207646_10000408 Ga0207646_1000040843 260
133 3300025922 Ga0207646_10009380 Ga0207646_100093804 260
134 3300025922 Ga0207646_10268432 Ga0207646_102684321 260
135 3300025925 Ga0207650_10530028 Ga0207650_105300282 260
136 3300025933 Ga0207706_10001207 Ga0207706_1000120727 260
137 3300025935 Ga0207709_10142700 Ga0207709_101427002 260
138 3300025939 Ga0207665_10033122 Ga0207665_100331223 260
139 3300025940 Ga0207691_10259486 Ga0207691_102594862 260
140 3300025942 Ga0207689_10000275 Ga0207689_1000027512 260
141 3300025942 Ga0207689_10009225 Ga0207689_100092259 260
142 3300025949 Ga0207667_10001262 Ga0207667_1000126234 260
143 3300025960 Ga0207651_10254175 Ga0207651_102541752 260
144 3300025961 Ga0207712_10077336 Ga0207712_100773362 260
145 3300026035 Ga0207703_10188136 Ga0207703_101881362 260
146 3300026041 Ga0207639_10030572 Ga0207639_100305724 260
147 3300026067 Ga0207678_10018359 Ga0207678_100183596 260
148 3300026078 Ga0207702_10004046 Ga0207702_100040464 260
149 3300026088 Ga0207641_10290888 Ga0207641_102908882 260
150 3300026089 Ga0207648_10005184 Ga0207648_1000518416 260
151 3300026116 Ga0207674_10056283 Ga0207674_100562832 260
152 3300026118 Ga0207675_100134300 Ga0207675_1001343003 260
153 3300027360 Ga0209969_1010615 Ga0209969_10106151 260
154 3300027424 Ga0209984_1001927 Ga0209984_10019273 260
155 3300027471 Ga0209995_1001661 Ga0209995_10016614 260
156 3300027526 Ga0209968_1001914 Ga0209968_10019142 260
157 3300027614 Ga0209970_1001146 Ga0209970_10011462 260
158 3300027617 Ga0210002_1003471 Ga0210002_10034713 260
159 3300027665 Ga0209983_1002311 Ga0209983_10023114 260
160 3300027671 Ga0209588_1003903 Ga0209588_10039032 260
161 3300027682 Ga0209971_1000011 Ga0209971_100001116 260
162 3300027695 Ga0209966_1007982 Ga0209966_10079822 260
163 3300027717 Ga0209998_10000474 Ga0209998_100004747 260
164 3300027876 Ga0209974_10007324 Ga0209974_100073243 260
165 3300028380 Ga0268265_10064526 Ga0268265_100645262 260
166 3300028380 Ga0268265_10071179 Ga0268265_100711793 260
167 3300034820 Ga0373959_0007156 Ga0373959_0007156_489_1292 260
168 3300035084 Ga0373928_0052373 Ga0373928_0052373_120_923 260
169 3300035090 Ga0373949_0021317 Ga0373949_0021317_507_1310 260
170 3300035091 Ga0373951_0081861 Ga0373951_0081861_20_802 260
171 3300035241 Ga0373961_0062378 Ga0373961_0062378_310_1113 260
172 3300042157 Ga0439458_0004746 Ga0439458_0004746_949_1752 260
173 3300042461 Ga0439460_0004249 Ga0439460_0004249_2157_2939 260
174 3300042876 Ga0451577_0092249 Ga0451577_0092249_1506_2309 260
175 3300042876 Ga0451577_0286305 Ga0451577_0286305_545_1327 260
176 3300044673 Ga0453683_0033006 Ga0453683_0033006_364_1197 260
177 3300044673 Ga0453683_0049783 Ga0453683_0049783_912_1733 260
178 3300044712 Ga0453684_0378835 Ga0453684_0378835_216_1019 260
179 3300045051 Ga0451576_0013359 Ga0451576_0013359_4231_5055 260
180 3300045051 Ga0451576_0020850 Ga0451576_0020850_2415_3239 260
181 3300045051 Ga0451576_0161126 Ga0451576_0161126_1365_2168 260
182 3300045051 Ga0451576_0228419 Ga0451576_0228419_19_801 260
183 3300046472 Ga0495580_0056906 Ga0495580_0056906_1641_2465 260
184 3300046472 Ga0495580_0169160 Ga0495580_0169160_25_807 260
185 3300048906 Ga0496103_0239181 Ga0496103_0239181_369_1151 260
186 3300048912 Ga0496109_0092083 Ga0496109_0092083_980_1783 260
187 3300048915 Ga0496112_0237799 Ga0496112_0237799_724_1527 260
188 3300049572 Ga0501036_0150770 Ga0501036_0150770_208_1182 260
189 3300049572 Ga0501036_0175440 Ga0501036_0175440_217_999 260
190 3300049573 Ga0501037_0155445 Ga0501037_0155445_79_1053 260
191 3300049574 Ga0501038_0158731 Ga0501038_0158731_349_1131 260
192 3300049574 Ga0501038_0214400 Ga0501038_0214400_267_1049 260
193 3300049575 Ga0501039_0017620 Ga0501039_0017620_2585_3559 260
194 3300049576 Ga0501040_0001379 Ga0501040_0001379_277_1251 260
195 3300049576 Ga0501040_0030519 Ga0501040_0030519_683_1465 260
196 3300049576 Ga0501040_0109842 Ga0501040_0109842_1033_1815 260
197 3300049576 Ga0501040_0139886 Ga0501040_0139886_384_1166 260
198 3300049577 Ga0501041_0036688 Ga0501041_0036688_1683_2657 260
199 3300049577 Ga0501041_0037895 Ga0501041_0037895_553_1335 260
200 3300049577 Ga0501041_0179294 Ga0501041_0179294_327_1109 260
201 3300049577 Ga0501041_0347950 Ga0501041_0347950_120_902 260
202 3300049578 Ga0501042_0040969 Ga0501042_0040969_514_1296 260
203 3300049579 Ga0501043_0301187 Ga0501043_0301187_204_986 260
204 3300049580 Ga0501046_0004575 Ga0501046_0004575_3055_4029 260
205 3300049582 Ga0501048_0041686 Ga0501048_0041686_312_1286 260
206 3300049582 Ga0501048_0073797 Ga0501048_0073797_56_838 260
207 3300049584 Ga0501068_0036323 Ga0501068_0036323_658_1440 260
208 3300049584 Ga0501068_0097325 Ga0501068_0097325_386_1168 260
209 3300049584 Ga0501068_0152375 Ga0501068_0152375_196_1170 260
210 3300049586 Ga0501070_0443676 Ga0501070_0443676_153_935 260
211 3300049587 Ga0501071_0074525 Ga0501071_0074525_1452_2234 260
212 3300049587 Ga0501071_0086066 Ga0501071_0086066_1289_2263 260
213 3300049587 Ga0501071_0230201 Ga0501071_0230201_16_798 260
214 3300049588 Ga0501072_0051233 Ga0501072_0051233_308_1282 260
215 3300049588 Ga0501072_0258539 Ga0501072_0258539_28_810 260
216 3300049589 Ga0501073_0169020 Ga0501073_0169020_544_1326 260
217 3300049590 Ga0501074_0059946 Ga0501074_0059946_1409_2191 260
218 3300049590 Ga0501074_0278548 Ga0501074_0278548_153_935 260
219 3300049591 Ga0501075_0033179 Ga0501075_0033179_228_1010 260
220 3300049591 Ga0501075_0180372 Ga0501075_0180372_405_1187 260
221 3300049591 Ga0501075_0252758 Ga0501075_0252758_302_1276 260
222 3300049592 Ga0501076_0031876 Ga0501076_0031876_183_965 260
223 3300049592 Ga0501076_0067898 Ga0501076_0067898_517_1491 260
224 3300049592 Ga0501076_0077788 Ga0501076_0077788_1058_1840 260
225 3300049593 Ga0501077_0156287 Ga0501077_0156287_519_1301 260
226 3300049741 Ga0501079_0000914 Ga0501079_0000914_8249_9223 260
227 3300049741 Ga0501079_0077715 Ga0501079_0077715_487_1269 260
228 3300049742 Ga0501080_0011259 Ga0501080_0011259_447_1229 260
229 3300049743 Ga0501081_0001721 Ga0501081_0001721_3306_4088 260
230 3300049743 Ga0501081_0020303 Ga0501081_0020303_572_1546 260
231 3300049743 Ga0501081_0066636 Ga0501081_0066636_1666_2448 260
232 3300049744 Ga0501083_0090789 Ga0501083_0090789_503_1477 260
233 3300050507 nmdc:mga05p37_116397_c1 nmdc:mga05p37_116397_c1_1560_2342 260
234 3300050507 nmdc:mga05p37_78391_c1 nmdc:mga05p37_78391_c1_2957_3781 260
235 3300050512 nmdc:mga0n895_15712_c1 nmdc:mga0n895_15712_c1_270_1094 260
236 3300050513 nmdc:mga0rr50_942_c1 nmdc:mga0rr50_942_c1_10922_11746 260
237 3300050514 nmdc:mga08x19_14009_c1 nmdc:mga08x19_14009_c1_3144_3968 260
238 3300050514 nmdc:mga08x19_29982_c1 nmdc:mga08x19_29982_c1_610_1434 260
239 3300050515 nmdc:mga0a205_126371_c1 nmdc:mga0a205_126371_c1_502_1305 260
240 3300050515 nmdc:mga0a205_39243_c1 nmdc:mga0a205_39243_c1_1863_2687 260
241 3300054114 Ga0501084_0006749 Ga0501084_0006749_7487_8461 260
242 3300054114 Ga0501084_0008479 Ga0501084_0008479_5387_6169 260
243 3300054114 Ga0501084_0465752 Ga0501084_0465752_82_864 260
244 3300060353 Ga0501082_0000601 Ga0501082_0000601_3183_4157 260
245 3300060353 Ga0501082_0029210 Ga0501082_0029210_2181_2963 260
246 3300061734 Ga0530510_0033419 Ga0530510_0033419_488_1270 260
247 3300061734 Ga0530510_0089052 Ga0530510_0089052_724_1698 260
248 3300061734 Ga0530510_0181427 Ga0530510_0181427_734_1516 260
249 3300061734 Ga0530510_0388102 Ga0530510_0388102_184_966 260
250 3300042001 Ga0439441_001036 Ga0439441_001036_1638_2426 261
251 3300042003 Ga0439443_002298 Ga0439443_002298_1302_2090 261
252 3300042436 Ga0439435_0000236 Ga0439435_0000236_2791_3579 261
253 3300042437 Ga0439444_0000850 Ga0439444_0000850_2868_3656 261
254 3300042461 Ga0439460_0000310 Ga0439460_0000310_4457_5245 261
255 3300049741 Ga0501079_0450510 Ga0501079_0450510_182_970 261
256 3300005544 Ga0070686_100039323 Ga0070686_1000393232 262
257 3300005616 Ga0068852_100143093 Ga0068852_1001430932 262
258 3300005618 Ga0068864_100380419 Ga0068864_1003804192 262
259 3300005844 Ga0068862_100298665 Ga0068862_1002986652 262
260 3300006847 Ga0075431_100030281 Ga0075431_1000302816 262
261 3300006847 Ga0075431_100073471 Ga0075431_1000734712 262
262 3300006847 Ga0075431_100131330 Ga0075431_1001313302 262
263 3300006852 Ga0075433_10003788 Ga0075433_100037889 262
264 3300009094 Ga0111539_10742846 Ga0111539_107428462 262
265 3300009147 Ga0114129_10000404 Ga0114129_1000040440 262
266 3300009147 Ga0114129_10330122 Ga0114129_103301222 262
267 3300009553 Ga0105249_10078076 Ga0105249_100780762 262
268 3300009553 Ga0105249_10489576 Ga0105249_104895761 262
269 3300009553 Ga0105249_10708819 Ga0105249_107088191 262
270 3300013297 Ga0157378_10142178 Ga0157378_101421783 262
271 3300014968 Ga0157379_10134992 Ga0157379_101349922 262
272 3300025961 Ga0207712_10410413 Ga0207712_104104131 262
273 3300025961 Ga0207712_10432998 Ga0207712_104329981 262
274 3300031548 Ga0307408_100062178 Ga0307408_1000621783 262
275 3300031995 Ga0307409_100037551 Ga0307409_1000375513 262
276 3300032002 Ga0307416_100113922 Ga0307416_1001139223 262
277 3300041408 Ga0439453_0024817 Ga0439453_0024817_74_862 262
278 3300045051 Ga0451576_0733477 Ga0451576_0733477_27_815 262
279 3300048909 Ga0496106_0207056 Ga0496106_0207056_240_1028 262
280 3300049569 Ga0501032_0141009 Ga0501032_0141009_44_832 262
281 3300049570 Ga0501033_0002516 Ga0501033_0002516_4855_5643 262
282 3300049570 Ga0501033_0117913 Ga0501033_0117913_212_1000 262
283 3300049570 Ga0501033_0423512 Ga0501033_0423512_81_887 262
284 3300049572 Ga0501036_0002550 Ga0501036_0002550_6258_7046 262
285 3300049572 Ga0501036_0008089 Ga0501036_0008089_7458_8246 262
286 3300049573 Ga0501037_0041574 Ga0501037_0041574_1147_1935 262
287 3300049574 Ga0501038_0015810 Ga0501038_0015810_710_1498 262
288 3300049574 Ga0501038_0038049 Ga0501038_0038049_2404_3192 262
289 3300049575 Ga0501039_0000890 Ga0501039_0000890_7975_8763 262
290 3300049575 Ga0501039_0026742 Ga0501039_0026742_192_980 262
291 3300049575 Ga0501039_0044475 Ga0501039_0044475_727_1515 262
292 3300049576 Ga0501040_0000166 Ga0501040_0000166_30061_30849 262
293 3300049576 Ga0501040_0006519 Ga0501040_0006519_486_1274 262
294 3300049576 Ga0501040_0192711 Ga0501040_0192711_51_839 262
295 3300049577 Ga0501041_0000454 Ga0501041_0000454_10863_11651 262
296 3300049577 Ga0501041_0032491 Ga0501041_0032491_1635_2423 262
297 3300049577 Ga0501041_0041322 Ga0501041_0041322_1639_2427 262
298 3300049578 Ga0501042_0000055 Ga0501042_0000055_1622_2410 262
299 3300049578 Ga0501042_0009408 Ga0501042_0009408_2649_3437 262
300 3300049578 Ga0501042_0177289 Ga0501042_0177289_391_1179 262
301 3300049579 Ga0501043_0022803 Ga0501043_0022803_3342_4130 262
302 3300049579 Ga0501043_0474511 Ga0501043_0474511_121_909 262
303 3300049580 Ga0501046_0002718 Ga0501046_0002718_14691_15479 262
304 3300049580 Ga0501046_0028752 Ga0501046_0028752_1092_1880 262
305 3300049580 Ga0501046_0032087 Ga0501046_0032087_2997_3785 262
306 3300049582 Ga0501048_0000123 Ga0501048_0000123_36947_37735 262
307 3300049582 Ga0501048_0015656 Ga0501048_0015656_1822_2610 262
308 3300049584 Ga0501068_0005780 Ga0501068_0005780_4902_5690 262
309 3300049584 Ga0501068_0159569 Ga0501068_0159569_335_1123 262
310 3300049587 Ga0501071_0000151 Ga0501071_0000151_7911_8699 262
311 3300049587 Ga0501071_0056191 Ga0501071_0056191_234_1022 262
312 3300049588 Ga0501072_0000139 Ga0501072_0000139_15959_16747 262
313 3300049588 Ga0501072_0002950 Ga0501072_0002950_6145_6933 262
314 3300049588 Ga0501072_0006314 Ga0501072_0006314_5180_5968 262
315 3300049588 Ga0501072_0100091 Ga0501072_0100091_474_1262 262
316 3300049589 Ga0501073_0346042 Ga0501073_0346042_225_1013 262
317 3300049590 Ga0501074_0016213 Ga0501074_0016213_2501_3289 262
318 3300049591 Ga0501075_0000051 Ga0501075_0000051_16588_17376 262
319 3300049591 Ga0501075_0000488 Ga0501075_0000488_10283_11071 262
320 3300049591 Ga0501075_0001002 Ga0501075_0001002_10420_11208 262
321 3300049592 Ga0501076_0000008 Ga0501076_0000008_31826_32614 262
322 3300049592 Ga0501076_0000047 Ga0501076_0000047_43254_44042 262
323 3300049592 Ga0501076_0002593 Ga0501076_0002593_5503_6291 262
324 3300049593 Ga0501077_0000528 Ga0501077_0000528_16240_17028 262
325 3300049593 Ga0501077_0212388 Ga0501077_0212388_392_1180 262
326 3300049741 Ga0501079_0000131 Ga0501079_0000131_31469_32257 262
327 3300049741 Ga0501079_0007436 Ga0501079_0007436_1479_2267 262
328 3300049741 Ga0501079_0120079 Ga0501079_0120079_930_1718 262
329 3300049742 Ga0501080_0000612 Ga0501080_0000612_12768_13556 262
330 3300049742 Ga0501080_0025507 Ga0501080_0025507_1655_2443 262
331 3300049742 Ga0501080_0336946 Ga0501080_0336946_407_1195 262
332 3300049743 Ga0501081_0000048 Ga0501081_0000048_29444_30232 262
333 3300049743 Ga0501081_0001746 Ga0501081_0001746_10631_11419 262
334 3300049743 Ga0501081_0015286 Ga0501081_0015286_471_1259 262
335 3300049743 Ga0501081_0053906 Ga0501081_0053906_1864_2652 262
336 3300049744 Ga0501083_0024095 Ga0501083_0024095_2955_3743 262
337 3300049822 Ga0501035_0002691 Ga0501035_0002691_253_1041 262
338 3300049824 Ga0501045_0000061 Ga0501045_0000061_33217_34005 262
339 3300049824 Ga0501045_0129033 Ga0501045_0129033_623_1411 262
340 3300049824 Ga0501045_0195373 Ga0501045_0195373_227_1015 262
341 3300050507 nmdc:mga05p37_2127_c1 nmdc:mga05p37_2127_c1_12949_13737 262
342 3300050507 nmdc:mga05p37_265904_c1 nmdc:mga05p37_265904_c1_399_1193 262
343 3300050510 nmdc:mga06r32_152197_c1 nmdc:mga06r32_152197_c1_691_1479 262
344 3300050512 nmdc:mga0n895_287750_c1 nmdc:mga0n895_287750_c1_789_1577 262
345 3300050515 nmdc:mga0a205_2435_c1 nmdc:mga0a205_2435_c1_3355_4143 262
346 3300050515 nmdc:mga0a205_294543_c1 nmdc:mga0a205_294543_c1_475_1263 262
347 3300054114 Ga0501084_0000174 Ga0501084_0000174_14465_15253 262
348 3300054114 Ga0501084_0051510 Ga0501084_0051510_89_877 262
349 3300054114 Ga0501084_0091977 Ga0501084_0091977_1178_1966 262
350 3300060353 Ga0501082_0001345 Ga0501082_0001345_9314_10102 262
351 3300060353 Ga0501082_0017580 Ga0501082_0017580_1006_1794 262
352 3300060353 Ga0501082_0064316 Ga0501082_0064316_460_1248 262
353 3300061734 Ga0530510_0000011 Ga0530510_0000011_16537_17325 262
354 3300061734 Ga0530510_0000120 Ga0530510_0000120_13932_14720 262
355 3300061734 Ga0530510_0000904 Ga0530510_0000904_15335_16123 262
356 3300061734 Ga0530510_0008621 Ga0530510_0008621_4944_5732 262
357 3300005333 Ga0070677_10057509 Ga0070677_100575092 263
358 3300005334 Ga0068869_100031324 Ga0068869_1000313242 263
359 3300005335 Ga0070666_10081998 Ga0070666_100819982 263
360 3300005338 Ga0068868_100041953 Ga0068868_1000419534 263
361 3300005340 Ga0070689_100254267 Ga0070689_1002542672 263
362 3300005341 Ga0070691_10080104 Ga0070691_100801042 263
363 3300005345 Ga0070692_10019330 Ga0070692_100193302 263
364 3300005354 Ga0070675_100002028 Ga0070675_1000020282 263
365 3300005355 Ga0070671_100009036 Ga0070671_1000090364 263
366 3300005355 Ga0070671_100036288 Ga0070671_1000362884 263
367 3300005356 Ga0070674_100175157 Ga0070674_1001751572 263
368 3300005364 Ga0070673_100406408 Ga0070673_1004064082 263
369 3300005365 Ga0070688_100047448 Ga0070688_1000474482 263
370 3300005367 Ga0070667_100006537 Ga0070667_1000065379 263
371 3300005438 Ga0070701_10026441 Ga0070701_100264413 263
372 3300005440 Ga0070705_100013330 Ga0070705_1000133301 263
373 3300005444 Ga0070694_100098524 Ga0070694_1000985241 263
374 3300005445 Ga0070708_100029627 Ga0070708_1000296274 263
375 3300005445 Ga0070708_100347983 Ga0070708_1003479832 263
376 3300005456 Ga0070678_100008881 Ga0070678_1000088814 263
377 3300005457 Ga0070662_100018150 Ga0070662_1000181504 263
378 3300005459 Ga0068867_100039396 Ga0068867_1000393964 263
379 3300005459 Ga0068867_100092052 Ga0068867_1000920521 263
380 3300005468 Ga0070707_100069854 Ga0070707_1000698544 263
381 3300005518 Ga0070699_100019038 Ga0070699_1000190383 263
382 3300005518 Ga0070699_100440720 Ga0070699_1004407202 263
383 3300005546 Ga0070696_100044578 Ga0070696_1000445783 263
384 3300005549 Ga0070704_100113857 Ga0070704_1001138572 263
385 3300005564 Ga0070664_100277572 Ga0070664_1002775722 263
386 3300005577 Ga0068857_100010492 Ga0068857_1000104922 263
387 3300005578 Ga0068854_100056187 Ga0068854_1000561873 263
388 3300005617 Ga0068859_100010053 Ga0068859_1000100538 263
389 3300005618 Ga0068864_100001463 Ga0068864_1000014632 263
390 3300005719 Ga0068861_100046165 Ga0068861_1000461654 263
391 3300005834 Ga0068851_10160699 Ga0068851_101606991 263
392 3300005841 Ga0068863_100283544 Ga0068863_1002835442 263
393 3300005842 Ga0068858_100011584 Ga0068858_1000115847 263
394 3300005844 Ga0068862_100093982 Ga0068862_1000939822 263
395 3300006237 Ga0097621_100057405 Ga0097621_1000574053 263
396 3300006358 Ga0068871_100077658 Ga0068871_1000776584 263
397 3300006846 Ga0075430_100012821 Ga0075430_1000128212 263
398 3300006847 Ga0075431_100002850 Ga0075431_10000285012 263
399 3300006847 Ga0075431_100163293 Ga0075431_1001632932 263
400 3300006871 Ga0075434_100052065 Ga0075434_1000520652 263
401 3300006880 Ga0075429_100080569 Ga0075429_1000805692 263
402 3300006881 Ga0068865_100158436 Ga0068865_1001584362 263
403 3300006931 Ga0097620_100010053 Ga0097620_1000100538 263
404 3300007076 Ga0075435_100211384 Ga0075435_1002113842 263
405 3300009094 Ga0111539_10445188 Ga0111539_104451882 263
406 3300009098 Ga0105245_10171232 Ga0105245_101712322 263
407 3300009147 Ga0114129_10072480 Ga0114129_100724804 263
408 3300009148 Ga0105243_10040301 Ga0105243_100403012 263
409 3300009176 Ga0105242_10021582 Ga0105242_100215823 263
410 3300009176 Ga0105242_10115400 Ga0105242_101154002 263
411 3300009177 Ga0105248_10080234 Ga0105248_100802342 263
412 3300009553 Ga0105249_10079624 Ga0105249_100796243 263
413 3300009553 Ga0105249_10090602 Ga0105249_100906023 263
414 3300013308 Ga0157375_10285477 Ga0157375_102854772 263
415 3300014325 Ga0163163_10020609 Ga0163163_100206095 263
416 3300014325 Ga0163163_10075895 Ga0163163_100758952 263
417 3300014968 Ga0157379_10049404 Ga0157379_100494042 263
418 3300014969 Ga0157376_10327049 Ga0157376_103270492 263
419 3300014969 Ga0157376_10376071 Ga0157376_103760711 263
420 3300017792 Ga0163161_10223126 Ga0163161_102231261 263
421 3300025321 Ga0207656_10068267 Ga0207656_100682671 263
422 3300025885 Ga0207653_10010751 Ga0207653_100107512 263
423 3300025893 Ga0207682_10039867 Ga0207682_100398672 263
424 3300025899 Ga0207642_10058446 Ga0207642_100584462 263
425 3300025903 Ga0207680_10196389 Ga0207680_101963892 263
426 3300025907 Ga0207645_10019805 Ga0207645_100198054 263
427 3300025907 Ga0207645_10250132 Ga0207645_102501321 263
428 3300025922 Ga0207646_10290799 Ga0207646_102907991 263
429 3300025925 Ga0207650_10007617 Ga0207650_100076175 263
430 3300025926 Ga0207659_10001251 Ga0207659_100012515 263
431 3300025931 Ga0207644_10007517 Ga0207644_100075177 263
432 3300025933 Ga0207706_10043340 Ga0207706_100433402 263
433 3300025934 Ga0207686_10085005 Ga0207686_100850052 263
434 3300025936 Ga0207670_10003407 Ga0207670_100034077 263
435 3300025937 Ga0207669_10120603 Ga0207669_101206032 263
436 3300025938 Ga0207704_10108423 Ga0207704_101084232 263
437 3300025940 Ga0207691_10006856 Ga0207691_100068562 263
438 3300025941 Ga0207711_10128246 Ga0207711_101282462 263
439 3300025942 Ga0207689_10019551 Ga0207689_100195512 263
440 3300025942 Ga0207689_10027831 Ga0207689_100278312 263
441 3300025960 Ga0207651_10009356 Ga0207651_100093562 263
442 3300025960 Ga0207651_10130199 Ga0207651_101301992 263
443 3300025961 Ga0207712_10104512 Ga0207712_101045122 263
444 3300025961 Ga0207712_10122453 Ga0207712_101224532 263
445 3300025972 Ga0207668_10125874 Ga0207668_101258742 263
446 3300025981 Ga0207640_10058290 Ga0207640_100582904 263
447 3300025986 Ga0207658_10020226 Ga0207658_100202264 263
448 3300026023 Ga0207677_10017562 Ga0207677_100175622 263
449 3300026035 Ga0207703_10004365 Ga0207703_100043657 263
450 3300026088 Ga0207641_10194187 Ga0207641_101941872 263
451 3300026089 Ga0207648_10004610 Ga0207648_100046104 263
452 3300026089 Ga0207648_10046855 Ga0207648_100468552 263
453 3300026089 Ga0207648_10212826 Ga0207648_102128262 263
454 3300026095 Ga0207676_10005188 Ga0207676_100051882 263
455 3300026116 Ga0207674_10082456 Ga0207674_100824562 263
456 3300026116 Ga0207674_10308002 Ga0207674_103080022 263
457 3300026118 Ga0207675_100012377 Ga0207675_1000123778 263
458 3300026118 Ga0207675_100033418 Ga0207675_1000334181 263
459 3300026121 Ga0207683_10003366 Ga0207683_100033669 263
460 3300027378 Ga0209981_1001982 Ga0209981_10019822 263
461 3300027462 Ga0210000_1001061 Ga0210000_10010612 263
462 3300027471 Ga0209995_1006498 Ga0209995_10064982 263
463 3300027665 Ga0209983_1041104 Ga0209983_10411042 263
464 3300027695 Ga0209966_1036012 Ga0209966_10360122 263
465 3300027907 Ga0207428_10000119 Ga0207428_1000011954 263
466 3300028380 Ga0268265_10177590 Ga0268265_101775902 263
467 3300038996 Ga0242420_022072 Ga0242420_022072_60_851 263
468 3300039437 Ga0436365_1520353 Ga0436365_1520353_779_1570 263
469 3300039450 Ga0436363_0880215 Ga0436363_0880215_1303_2094 263
470 3300041410 Ga0439461_0001739 Ga0439461_0001739_1854_2645 263
471 3300042156 Ga0439446_0006283 Ga0439446_0006283_214_1005 263
472 3300042435 Ga0439434_0000566 Ga0439434_0000566_4536_5327 263
473 3300042436 Ga0439435_0000524 Ga0439435_0000524_3368_4159 263
474 3300042876 Ga0451577_0001635 Ga0451577_0001635_13420_14211 263
475 3300044673 Ga0453683_0047014 Ga0453683_0047014_1551_2342 263
476 3300044712 Ga0453684_0022118 Ga0453684_0022118_8032_8823 263
477 3300045051 Ga0451576_0019593 Ga0451576_0019593_6144_6935 263
478 3300045051 Ga0451576_0074686 Ga0451576_0074686_231_1022 263
479 3300046539 Ga0495621_0071254 Ga0495621_0071254_112_903 263
480 3300048908 Ga0496105_0204856 Ga0496105_0204856_356_1147 263
481 3300048911 Ga0496108_0316490 Ga0496108_0316490_539_1330 263
482 3300048912 Ga0496109_0257590 Ga0496109_0257590_495_1286 263
483 3300048917 Ga0496114_0287885 Ga0496114_0287885_91_882 263
484 3300048917 Ga0496114_0452875 Ga0496114_0452875_119_910 263
485 3300049575 Ga0501039_0240371 Ga0501039_0240371_490_1323 263
486 3300049576 Ga0501040_0115421 Ga0501040_0115421_365_1213 263
487 3300049577 Ga0501041_0060322 Ga0501041_0060322_1145_1978 263
488 3300049591 Ga0501075_0158687 Ga0501075_0158687_134_937 263
489 3300049593 Ga0501077_0184671 Ga0501077_0184671_373_1176 263
490 3300049742 Ga0501080_0293904 Ga0501080_0293904_501_1298 263
491 3300049743 Ga0501081_0279404 Ga0501081_0279404_347_1195 263
492 3300049824 Ga0501045_0031538 Ga0501045_0031538_880_1728 263
493 3300050507 nmdc:mga05p37_108241_c1 nmdc:mga05p37_108241_c1_703_1497 263
494 3300050508 nmdc:mga09592_68020_c1 nmdc:mga09592_68020_c1_496_1290 263
495 3300050510 nmdc:mga06r32_295477_c1 nmdc:mga06r32_295477_c1_718_1518 263
496 3300050510 nmdc:mga06r32_543_c1 nmdc:mga06r32_543_c1_26539_27330 263
497 3300050511 nmdc:mga08y16_135113_c1 nmdc:mga08y16_135113_c1_1672_2487 263
498 3300050511 nmdc:mga08y16_221892_c1 nmdc:mga08y16_221892_c1_559_1350 263
499 3300050515 nmdc:mga0a205_325115_c1 nmdc:mga0a205_325115_c1_52_843 263
500 3300050515 nmdc:mga0a205_4195_c1 nmdc:mga0a205_4195_c1_4753_5544 263
501 3300061734 Ga0530510_0067050 Ga0530510_0067050_1624_2427 263
502 3300005327 Ga0070658_10017377 Ga0070658_100173777 264
503 3300005328 Ga0070676_10019502 Ga0070676_100195022 264
504 3300005328 Ga0070676_10035668 Ga0070676_100356681 264
505 3300005328 Ga0070676_10124159 Ga0070676_101241592 264
506 3300005328 Ga0070676_10165179 Ga0070676_101651791 264
507 3300005329 Ga0070683_100040525 Ga0070683_1000405254 264
508 3300005329 Ga0070683_100271984 Ga0070683_1002719842 264
509 3300005330 Ga0070690_100139918 Ga0070690_1001399182 264
510 3300005330 Ga0070690_100404943 Ga0070690_1004049431 264
511 3300005331 Ga0070670_100012669 Ga0070670_1000126692 264
512 3300005331 Ga0070670_100197982 Ga0070670_1001979822 264
513 3300005333 Ga0070677_10001601 Ga0070677_100016015 264
514 3300005333 Ga0070677_10022340 Ga0070677_100223403 264
515 3300005334 Ga0068869_100063073 Ga0068869_1000630733 264
516 3300005334 Ga0068869_100137523 Ga0068869_1001375232 264
517 3300005335 Ga0070666_10051995 Ga0070666_100519952 264
518 3300005336 Ga0070680_100017402 Ga0070680_1000174026 264
519 3300005336 Ga0070680_100020755 Ga0070680_1000207556 264
520 3300005338 Ga0068868_100011500 Ga0068868_1000115006 264
521 3300005338 Ga0068868_100021226 Ga0068868_1000212262 264
522 3300005339 Ga0070660_100521387 Ga0070660_1005213871 264
523 3300005341 Ga0070691_10043311 Ga0070691_100433112 264
524 3300005343 Ga0070687_100006985 Ga0070687_1000069853 264
525 3300005343 Ga0070687_100165095 Ga0070687_1001650952 264
526 3300005344 Ga0070661_100014385 Ga0070661_1000143855 264
527 3300005344 Ga0070661_100175352 Ga0070661_1001753522 264
528 3300005345 Ga0070692_10063082 Ga0070692_100630822 264
529 3300005347 Ga0070668_100008548 Ga0070668_1000085484 264
530 3300005347 Ga0070668_100234735 Ga0070668_1002347352 264
531 3300005353 Ga0070669_100008226 Ga0070669_1000082269 264
532 3300005353 Ga0070669_100017213 Ga0070669_1000172134 264
533 3300005353 Ga0070669_100427719 Ga0070669_1004277191 264
534 3300005354 Ga0070675_100001473 Ga0070675_1000014738 264
535 3300005354 Ga0070675_100067768 Ga0070675_1000677683 264
536 3300005354 Ga0070675_100071907 Ga0070675_1000719072 264
537 3300005354 Ga0070675_100123743 Ga0070675_1001237433 264
538 3300005354 Ga0070675_100141154 Ga0070675_1001411542 264
539 3300005354 Ga0070675_100165162 Ga0070675_1001651622 264
540 3300005355 Ga0070671_100084085 Ga0070671_1000840851 264
541 3300005355 Ga0070671_100140401 Ga0070671_1001404013 264
542 3300005355 Ga0070671_100401901 Ga0070671_1004019011 264
543 3300005356 Ga0070674_100002004 Ga0070674_1000020049 264
544 3300005356 Ga0070674_100028613 Ga0070674_1000286134 264
545 3300005364 Ga0070673_100101863 Ga0070673_1001018633 264
546 3300005364 Ga0070673_100158064 Ga0070673_1001580642 264
547 3300005366 Ga0070659_100010360 Ga0070659_1000103602 264
548 3300005366 Ga0070659_100060037 Ga0070659_1000600373 264
549 3300005366 Ga0070659_100191593 Ga0070659_1001915932 264
550 3300005367 Ga0070667_100044986 Ga0070667_1000449863 264
551 3300005367 Ga0070667_100105902 Ga0070667_1001059022 264
552 3300005367 Ga0070667_100301233 Ga0070667_1003012332 264
553 3300005441 Ga0070700_100032115 Ga0070700_1000321153 264
554 3300005444 Ga0070694_100007631 Ga0070694_1000076314 264
555 3300005444 Ga0070694_100171856 Ga0070694_1001718562 264
556 3300005445 Ga0070708_100073242 Ga0070708_1000732423 264
557 3300005445 Ga0070708_100073742 Ga0070708_1000737423 264
558 3300005455 Ga0070663_100023705 Ga0070663_1000237052 264
559 3300005455 Ga0070663_100051958 Ga0070663_1000519583 264
560 3300005456 Ga0070678_100005290 Ga0070678_1000052904 264
561 3300005456 Ga0070678_100009981 Ga0070678_1000099816 264
562 3300005456 Ga0070678_100202337 Ga0070678_1002023372 264
563 3300005456 Ga0070678_100223072 Ga0070678_1002230722 264
564 3300005457 Ga0070662_100033808 Ga0070662_1000338084 264
565 3300005457 Ga0070662_100202242 Ga0070662_1002022422 264
566 3300005459 Ga0068867_100009158 Ga0068867_1000091582 264
567 3300005459 Ga0068867_100257763 Ga0068867_1002577632 264
568 3300005467 Ga0070706_100042313 Ga0070706_1000423135 264
569 3300005471 Ga0070698_100239084 Ga0070698_1002390842 264
570 3300005518 Ga0070699_100060621 Ga0070699_1000606214 264
571 3300005530 Ga0070679_100033201 Ga0070679_1000332012 264
572 3300005535 Ga0070684_100010489 Ga0070684_1000104895 264
573 3300005535 Ga0070684_100017959 Ga0070684_1000179595 264
574 3300005536 Ga0070697_100019590 Ga0070697_1000195902 264
575 3300005536 Ga0070697_100374499 Ga0070697_1003744991 264
576 3300005543 Ga0070672_100000367 Ga0070672_1000003676 264
577 3300005543 Ga0070672_100007088 Ga0070672_1000070882 264
578 3300005543 Ga0070672_100061957 Ga0070672_1000619572 264
579 3300005543 Ga0070672_100101293 Ga0070672_1001012932 264
580 3300005543 Ga0070672_100113183 Ga0070672_1001131832 264
581 3300005543 Ga0070672_100217578 Ga0070672_1002175782 264
582 3300005545 Ga0070695_100014436 Ga0070695_1000144364 264
583 3300005546 Ga0070696_100025581 Ga0070696_1000255815 264
584 3300005547 Ga0070693_100051699 Ga0070693_1000516992 264
585 3300005547 Ga0070693_100207726 Ga0070693_1002077261 264
586 3300005548 Ga0070665_100206576 Ga0070665_1002065762 264
587 3300005549 Ga0070704_100002668 Ga0070704_10000266811 264
588 3300005563 Ga0068855_100047419 Ga0068855_1000474194 264
589 3300005563 Ga0068855_100296977 Ga0068855_1002969772 264
590 3300005564 Ga0070664_100044502 Ga0070664_1000445024 264
591 3300005564 Ga0070664_100142653 Ga0070664_1001426533 264
592 3300005564 Ga0070664_100345530 Ga0070664_1003455302 264
593 3300005577 Ga0068857_100017565 Ga0068857_1000175657 264
594 3300005578 Ga0068854_100066784 Ga0068854_1000667843 264
595 3300005614 Ga0068856_100134328 Ga0068856_1001343282 264
596 3300005614 Ga0068856_100201548 Ga0068856_1002015482 264
597 3300005615 Ga0070702_100058658 Ga0070702_1000586583 264
598 3300005616 Ga0068852_100003436 Ga0068852_10000343611 264
599 3300005616 Ga0068852_100060689 Ga0068852_1000606893 264
600 3300005617 Ga0068859_100195161 Ga0068859_1001951612 264
601 3300005718 Ga0068866_10023300 Ga0068866_100233003 264
602 3300005718 Ga0068866_10351328 Ga0068866_103513281 264
603 3300005719 Ga0068861_100057457 Ga0068861_1000574572 264
604 3300005719 Ga0068861_100243854 Ga0068861_1002438542 264
605 3300005719 Ga0068861_100325479 Ga0068861_1003254791 264
606 3300005834 Ga0068851_10007610 Ga0068851_100076106 264
607 3300005840 Ga0068870_10154212 Ga0068870_101542121 264
608 3300005841 Ga0068863_100061813 Ga0068863_1000618132 264
609 3300005841 Ga0068863_100331919 Ga0068863_1003319192 264
610 3300005842 Ga0068858_100030957 Ga0068858_1000309576 264
611 3300005843 Ga0068860_100032817 Ga0068860_1000328173 264
612 3300005844 Ga0068862_100055423 Ga0068862_1000554232 264
613 3300005844 Ga0068862_100154945 Ga0068862_1001549453 264
614 3300005844 Ga0068862_100534187 Ga0068862_1005341872 264
615 3300005983 Ga0081540_1001963 Ga0081540_10019631 264
616 3300006175 Ga0070712_100003912 Ga0070712_1000039128 264
617 3300006237 Ga0097621_100027168 Ga0097621_1000271683 264
618 3300006358 Ga0068871_100053922 Ga0068871_1000539224 264
619 3300006358 Ga0068871_100077544 Ga0068871_1000775441 264
620 3300006844 Ga0075428_100208263 Ga0075428_1002082632 264
621 3300006844 Ga0075428_100219056 Ga0075428_1002190562 264
622 3300006844 Ga0075428_100628764 Ga0075428_1006287642 264
623 3300006846 Ga0075430_100004554 Ga0075430_1000045544 264
624 3300006846 Ga0075430_100066435 Ga0075430_1000664352 264
625 3300006847 Ga0075431_100308463 Ga0075431_1003084632 264
626 3300006847 Ga0075431_100412554 Ga0075431_1004125542 264
627 3300006847 Ga0075431_100451208 Ga0075431_1004512082 264
628 3300006871 Ga0075434_100027528 Ga0075434_1000275282 264
629 3300006871 Ga0075434_100333616 Ga0075434_1003336162 264
630 3300006880 Ga0075429_100179331 Ga0075429_1001793312 264
631 3300006881 Ga0068865_100027578 Ga0068865_1000275784 264
632 3300006881 Ga0068865_100106877 Ga0068865_1001068772 264
633 3300006931 Ga0097620_100195163 Ga0097620_1001951633 264
634 3300007076 Ga0075435_100002991 Ga0075435_1000029916 264
635 3300009093 Ga0105240_10204521 Ga0105240_102045211 264
636 3300009094 Ga0111539_10446254 Ga0111539_104462542 264
637 3300009098 Ga0105245_10292954 Ga0105245_102929541 264
638 3300009147 Ga0114129_10040169 Ga0114129_100401696 264
639 3300009148 Ga0105243_10051221 Ga0105243_100512214 264
640 3300009148 Ga0105243_10079378 Ga0105243_100793783 264
641 3300009148 Ga0105243_10144850 Ga0105243_101448503 264
642 3300009176 Ga0105242_10003134 Ga0105242_100031345 264
643 3300009177 Ga0105248_10347494 Ga0105248_103474942 264
644 3300009545 Ga0105237_10145509 Ga0105237_101455093 264
645 3300009551 Ga0105238_10007362 Ga0105238_100073628 264
646 3300009553 Ga0105249_10128679 Ga0105249_101286793 264
647 3300010375 Ga0105239_10137492 Ga0105239_101374923 264
648 3300013100 Ga0157373_10029670 Ga0157373_100296701 264
649 3300013102 Ga0157371_10037931 Ga0157371_100379315 264
650 3300013104 Ga0157370_10279402 Ga0157370_102794022 264
651 3300013105 Ga0157369_10022216 Ga0157369_100222166 264
652 3300013296 Ga0157374_10027157 Ga0157374_100271573 264
653 3300013306 Ga0163162_10048029 Ga0163162_100480293 264
654 3300013306 Ga0163162_10281320 Ga0163162_102813202 264
655 3300013308 Ga0157375_10019729 Ga0157375_100197296 264
656 3300013308 Ga0157375_10055410 Ga0157375_100554103 264
657 3300013308 Ga0157375_10122639 Ga0157375_101226391 264
658 3300013308 Ga0157375_10356485 Ga0157375_103564852 264
659 3300014326 Ga0157380_10017786 Ga0157380_100177865 264
660 3300014326 Ga0157380_10070708 Ga0157380_100707082 264
661 3300014745 Ga0157377_10013835 Ga0157377_100138353 264
662 3300014745 Ga0157377_10130712 Ga0157377_101307122 264
663 3300014968 Ga0157379_10049604 Ga0157379_100496044 264
664 3300014968 Ga0157379_10086963 Ga0157379_100869632 264
665 3300017792 Ga0163161_10038748 Ga0163161_100387484 264
666 3300017792 Ga0163161_10096543 Ga0163161_100965433 264
667 3300025315 Ga0207697_10012608 Ga0207697_100126084 264
668 3300025315 Ga0207697_10054956 Ga0207697_100549562 264
669 3300025321 Ga0207656_10006250 Ga0207656_100062502 264
670 3300025893 Ga0207682_10001930 Ga0207682_1000193010 264
671 3300025893 Ga0207682_10071731 Ga0207682_100717312 264
672 3300025899 Ga0207642_10007895 Ga0207642_100078952 264
673 3300025899 Ga0207642_10280851 Ga0207642_102808511 264
674 3300025901 Ga0207688_10044220 Ga0207688_100442202 264
675 3300025901 Ga0207688_10087373 Ga0207688_100873732 264
676 3300025903 Ga0207680_10042049 Ga0207680_100420493 264
677 3300025907 Ga0207645_10027607 Ga0207645_100276072 264
678 3300025907 Ga0207645_10030712 Ga0207645_100307123 264
679 3300025907 Ga0207645_10033748 Ga0207645_100337482 264
680 3300025907 Ga0207645_10042982 Ga0207645_100429824 264
681 3300025908 Ga0207643_10019020 Ga0207643_100190203 264
682 3300025908 Ga0207643_10029595 Ga0207643_100295953 264
683 3300025910 Ga0207684_10113792 Ga0207684_101137923 264
684 3300025915 Ga0207693_10017649 Ga0207693_100176492 264
685 3300025917 Ga0207660_10018952 Ga0207660_100189526 264
686 3300025918 Ga0207662_10021081 Ga0207662_100210813 264
687 3300025918 Ga0207662_10042917 Ga0207662_100429173 264
688 3300025919 Ga0207657_10100472 Ga0207657_101004723 264
689 3300025919 Ga0207657_10213023 Ga0207657_102130232 264
690 3300025920 Ga0207649_10068246 Ga0207649_100682461 264
691 3300025921 Ga0207652_10082207 Ga0207652_100822073 264
692 3300025922 Ga0207646_10665423 Ga0207646_106654231 264
693 3300025923 Ga0207681_10004718 Ga0207681_100047184 264
694 3300025923 Ga0207681_10071611 Ga0207681_100716112 264
695 3300025924 Ga0207694_10010481 Ga0207694_100104817 264
696 3300025925 Ga0207650_10002288 Ga0207650_100022889 264
697 3300025925 Ga0207650_10489180 Ga0207650_104891801 264
698 3300025926 Ga0207659_10008394 Ga0207659_100083944 264
699 3300025926 Ga0207659_10042664 Ga0207659_100426642 264
700 3300025926 Ga0207659_10048389 Ga0207659_100483893 264
701 3300025926 Ga0207659_10098723 Ga0207659_100987231 264
702 3300025926 Ga0207659_10136798 Ga0207659_101367982 264
703 3300025927 Ga0207687_10516559 Ga0207687_105165591 264
704 3300025931 Ga0207644_10004038 Ga0207644_1000403812 264
705 3300025931 Ga0207644_10055781 Ga0207644_100557813 264
706 3300025931 Ga0207644_10151962 Ga0207644_101519622 264
707 3300025931 Ga0207644_10326758 Ga0207644_103267582 264
708 3300025932 Ga0207690_10037362 Ga0207690_100373623 264
709 3300025933 Ga0207706_10047809 Ga0207706_100478095 264
710 3300025933 Ga0207706_10122724 Ga0207706_101227242 264
711 3300025933 Ga0207706_10133013 Ga0207706_101330132 264
712 3300025933 Ga0207706_10154489 Ga0207706_101544893 264
713 3300025934 Ga0207686_10017797 Ga0207686_100177973 264
714 3300025935 Ga0207709_10005183 Ga0207709_100051834 264
715 3300025935 Ga0207709_10248760 Ga0207709_102487601 264
716 3300025937 Ga0207669_10006304 Ga0207669_100063045 264
717 3300025937 Ga0207669_10016994 Ga0207669_100169943 264
718 3300025937 Ga0207669_10312289 Ga0207669_103122891 264
719 3300025938 Ga0207704_10037100 Ga0207704_100371003 264
720 3300025938 Ga0207704_10120544 Ga0207704_101205442 264
721 3300025938 Ga0207704_10446031 Ga0207704_104460311 264
722 3300025940 Ga0207691_10001841 Ga0207691_1000184119 264
723 3300025940 Ga0207691_10031141 Ga0207691_100311415 264
724 3300025940 Ga0207691_10057440 Ga0207691_100574404 264
725 3300025940 Ga0207691_10082635 Ga0207691_100826352 264
726 3300025940 Ga0207691_10091124 Ga0207691_100911243 264
727 3300025941 Ga0207711_10006733 Ga0207711_100067337 264
728 3300025942 Ga0207689_10003015 Ga0207689_100030154 264
729 3300025942 Ga0207689_10081455 Ga0207689_100814552 264
730 3300025942 Ga0207689_10088553 Ga0207689_100885532 264
731 3300025944 Ga0207661_10063406 Ga0207661_100634063 264
732 3300025945 Ga0207679_10031738 Ga0207679_100317385 264
733 3300025945 Ga0207679_10101871 Ga0207679_101018712 264
734 3300025945 Ga0207679_10311838 Ga0207679_103118382 264
735 3300025949 Ga0207667_10066485 Ga0207667_100664854 264
736 3300025949 Ga0207667_10120562 Ga0207667_101205623 264
737 3300025960 Ga0207651_10058708 Ga0207651_100587083 264
738 3300025972 Ga0207668_10162154 Ga0207668_101621542 264
739 3300025981 Ga0207640_10178391 Ga0207640_101783912 264
740 3300025981 Ga0207640_10295073 Ga0207640_102950731 264
741 3300025986 Ga0207658_10038082 Ga0207658_100380823 264
742 3300025986 Ga0207658_10052272 Ga0207658_100522722 264
743 3300026023 Ga0207677_10010426 Ga0207677_100104262 264
744 3300026023 Ga0207677_10179252 Ga0207677_101792523 264
745 3300026035 Ga0207703_10072760 Ga0207703_100727603 264
746 3300026035 Ga0207703_10713381 Ga0207703_107133811 264
747 3300026041 Ga0207639_10184678 Ga0207639_101846783 264
748 3300026067 Ga0207678_10080961 Ga0207678_100809612 264
749 3300026075 Ga0207708_10014113 Ga0207708_100141134 264
750 3300026088 Ga0207641_10029872 Ga0207641_100298724 264
751 3300026089 Ga0207648_10013731 Ga0207648_100137312 264
752 3300026089 Ga0207648_10017318 Ga0207648_100173185 264
753 3300026089 Ga0207648_10084566 Ga0207648_100845662 264
754 3300026089 Ga0207648_10107263 Ga0207648_101072632 264
755 3300026095 Ga0207676_10233920 Ga0207676_102339202 264
756 3300026116 Ga0207674_10030783 Ga0207674_100307834 264
757 3300026116 Ga0207674_10073163 Ga0207674_100731634 264
758 3300026116 Ga0207674_10224399 Ga0207674_102243992 264
759 3300026118 Ga0207675_100004260 Ga0207675_1000042609 264
760 3300026118 Ga0207675_100004346 Ga0207675_1000043468 264
761 3300026118 Ga0207675_100196474 Ga0207675_1001964742 264
762 3300026118 Ga0207675_100639557 Ga0207675_1006395572 264
763 3300026121 Ga0207683_10005954 Ga0207683_1000595410 264
764 3300026121 Ga0207683_10094734 Ga0207683_100947342 264
765 3300026121 Ga0207683_10133862 Ga0207683_101338622 264
766 3300026121 Ga0207683_10134607 Ga0207683_101346072 264
767 3300026121 Ga0207683_10175710 Ga0207683_101757102 264
768 3300026121 Ga0207683_10190770 Ga0207683_101907702 264
769 3300026121 Ga0207683_10243090 Ga0207683_102430902 264
770 3300026142 Ga0207698_10052265 Ga0207698_100522653 264
771 3300026142 Ga0207698_10067046 Ga0207698_100670462 264
772 3300026142 Ga0207698_10090778 Ga0207698_100907782 264
773 3300027364 Ga0209967_1020007 Ga0209967_10200071 264
774 3300027543 Ga0209999_1032194 Ga0209999_10321941 264
775 3300027682 Ga0209971_1017284 Ga0209971_10172842 264
776 3300027876 Ga0209974_10052163 Ga0209974_100521632 264
777 3300028380 Ga0268265_10108103 Ga0268265_101081033 264
778 3300028380 Ga0268265_10558898 Ga0268265_105588981 264
779 3300028381 Ga0268264_10060752 Ga0268264_100607523 264
780 3300028381 Ga0268264_10547194 Ga0268264_105471942 264
781 3300031548 Ga0307408_100089046 Ga0307408_1000890462 264
782 3300031548 Ga0307408_100362041 Ga0307408_1003620412 264
783 3300031548 Ga0307408_100452824 Ga0307408_1004528241 264
784 3300031731 Ga0307405_10009151 Ga0307405_100091512 264
785 3300031824 Ga0307413_10008938 Ga0307413_100089384 264
786 3300031824 Ga0307413_10440086 Ga0307413_104400861 264
787 3300031852 Ga0307410_10006974 Ga0307410_100069745 264
788 3300031852 Ga0307410_10328838 Ga0307410_103288381 264
789 3300031901 Ga0307406_10005307 Ga0307406_100053076 264
790 3300031901 Ga0307406_10010219 Ga0307406_100102193 264
791 3300031901 Ga0307406_10269485 Ga0307406_102694852 264
792 3300031901 Ga0307406_10597047 Ga0307406_105970471 264
793 3300031903 Ga0307407_10059107 Ga0307407_100591071 264
794 3300031911 Ga0307412_10021971 Ga0307412_100219713 264
795 3300031911 Ga0307412_10058416 Ga0307412_100584163 264
796 3300031995 Ga0307409_100003845 Ga0307409_1000038456 264
797 3300032002 Ga0307416_100006103 Ga0307416_1000061037 264
798 3300032002 Ga0307416_100015064 Ga0307416_1000150642 264
799 3300032002 Ga0307416_100360128 Ga0307416_1003601282 264
800 3300032005 Ga0307411_10001686 Ga0307411_1000168611 264
801 3300032126 Ga0307415_100003156 Ga0307415_1000031566 264
802 3300032126 Ga0307415_100047172 Ga0307415_1000471723 264
803 3300035724 Ga0373933_0095147 Ga0373933_0095147_426_1232 264
804 3300036401 Ga0373937_0137560 Ga0373937_0137560_1457_2263 264
805 3300042001 Ga0439441_008013 Ga0439441_008013_607_1404 264
806 3300045051 Ga0451576_0836521 Ga0451576_0836521_102_896 264
807 3300045051 Ga0451576_0842872 Ga0451576_0842872_43_837 264
808 3300046455 Ga0495603_0351960 Ga0495603_0351960_24_818 264
809 3300046472 Ga0495580_0019936 Ga0495580_0019936_442_1236 264
810 3300046539 Ga0495621_0006110 Ga0495621_0006110_1550_2344 264
811 3300046683 Ga0495658_0173618 Ga0495658_0173618_347_1144 264
812 3300048904 Ga0496101_0126385 Ga0496101_0126385_41_835 264
813 3300048905 Ga0496102_0117883 Ga0496102_0117883_1423_2232 264
814 3300048905 Ga0496102_0254605 Ga0496102_0254605_228_1022 264
815 3300048907 Ga0496104_0148482 Ga0496104_0148482_112_906 264
816 3300048910 Ga0496107_0057725 Ga0496107_0057725_1354_2148 264
817 3300048911 Ga0496108_0112494 Ga0496108_0112494_207_1037 264
818 3300048913 Ga0496110_0115029 Ga0496110_0115029_882_1676 264
819 3300048916 Ga0496113_0026700 Ga0496113_0026700_2942_3736 264
820 3300049572 Ga0501036_0109508 Ga0501036_0109508_841_1638 264
821 3300049574 Ga0501038_0185490 Ga0501038_0185490_361_1158 264
822 3300049575 Ga0501039_0016381 Ga0501039_0016381_1289_2098 264
823 3300049575 Ga0501039_0097688 Ga0501039_0097688_1287_2084 264
824 3300049575 Ga0501039_0102901 Ga0501039_0102901_214_1011 264
825 3300049576 Ga0501040_0060582 Ga0501040_0060582_573_1370 264
826 3300049576 Ga0501040_0166778 Ga0501040_0166778_628_1425 264
827 3300049577 Ga0501041_0059931 Ga0501041_0059931_421_1218 264
828 3300049577 Ga0501041_0082721 Ga0501041_0082721_517_1314 264
829 3300049578 Ga0501042_0023557 Ga0501042_0023557_1801_2610 264
830 3300049578 Ga0501042_0162492 Ga0501042_0162492_686_1483 264
831 3300049578 Ga0501042_0275288 Ga0501042_0275288_304_1101 264
832 3300049580 Ga0501046_0029661 Ga0501046_0029661_751_1560 264
833 3300049580 Ga0501046_0479502 Ga0501046_0479502_30_827 264
834 3300049582 Ga0501048_0066840 Ga0501048_0066840_1375_2172 264
835 3300049584 Ga0501068_0054829 Ga0501068_0054829_41_850 264
836 3300049587 Ga0501071_0165472 Ga0501071_0165472_24_833 264
837 3300049588 Ga0501072_0016554 Ga0501072_0016554_1128_1925 264
838 3300049591 Ga0501075_0018565 Ga0501075_0018565_2334_3131 264
839 3300049591 Ga0501075_0055799 Ga0501075_0055799_2011_2820 264
840 3300049591 Ga0501075_0185736 Ga0501075_0185736_692_1567 264
841 3300049592 Ga0501076_0001091 Ga0501076_0001091_70_867 264
842 3300049593 Ga0501077_0052158 Ga0501077_0052158_1147_1944 264
843 3300049741 Ga0501079_0006372 Ga0501079_0006372_4686_5483 264
844 3300049741 Ga0501079_0023390 Ga0501079_0023390_2006_2815 264
845 3300049743 Ga0501081_0017507 Ga0501081_0017507_2879_3676 264
846 3300049822 Ga0501035_0268450 Ga0501035_0268450_374_1249 264
847 3300049824 Ga0501045_0042286 Ga0501045_0042286_695_1492 264
848 3300050509 nmdc:mga0qj67_101406_c1 nmdc:mga0qj67_101406_c1_194_991 264
849 3300050509 nmdc:mga0qj67_259865_c1 nmdc:mga0qj67_259865_c1_193_990 264
850 3300050509 nmdc:mga0qj67_3331_c1 nmdc:mga0qj67_3331_c1_6685_7503 264
851 3300050509 nmdc:mga0qj67_3567_c1 nmdc:mga0qj67_3567_c1_8726_9523 264
852 3300050510 nmdc:mga06r32_153767_c1 nmdc:mga06r32_153767_c1_634_1431 264
853 3300050510 nmdc:mga06r32_30382_c1 nmdc:mga06r32_30382_c1_4083_4901 264
854 3300050511 nmdc:mga08y16_119992_c1 nmdc:mga08y16_119992_c1_1073_1870 264
855 3300050512 nmdc:mga0n895_188271_c1 nmdc:mga0n895_188271_c1_336_1130 264
856 3300050514 nmdc:mga08x19_186760_c1 nmdc:mga08x19_186760_c1_407_1201 264
857 3300054114 Ga0501084_0021396 Ga0501084_0021396_3000_3809 264
858 3300054114 Ga0501084_0087975 Ga0501084_0087975_622_1419 264
859 3300060353 Ga0501082_0087674 Ga0501082_0087674_463_1260 264
860 3300060353 Ga0501082_0118018 Ga0501082_0118018_756_1565 264
861 3300061734 Ga0530510_0058471 Ga0530510_0058471_1130_1927 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

73

323

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

78

264

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eum-assembly1.cif.gz_E crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9273 10 228
7eum-assembly1.cif.gz_F crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9269 10 228
7eum-assembly1.cif.gz_D crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9268 10 228
4els-assembly1.cif.gz_C structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with bicarbonate 0.9239 4 223
6n92-assembly1.cif.gz_D methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl-coa 0.923 9 264
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9921 10 63 3.30.300.220
af_O50402_25_213_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9469 10 182 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9419 11 209 3.90.226.10
4k2nA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9374 9 209 3.90.226.10
2qq3L01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9218 9 209 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A327UVW7-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9711 11 264
AF-A0A7V8HHN3-F1-model_v4 deleted 0.9675 11 196
AF-A0A4Q6D293-F1-model_v4 deleted 0.9633 9 141
AF-A0A432KCX9-F1-model_v4 Enoyl-CoA hydratase 0.9575 9 224 GO:0006635
GO:0016836
AF-A0A3M1MTY6-F1-model_v4 Crotonase 0.9502 9 139 GO:0003824
GO:0006635

Feature Viewer

pLDDT pTM Quality
94.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map