F483805
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 860 | 305 | 1720 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300006173|Ga0070716_100817837|Ga0070716_1008178372 |
| Length | 131 |
| Sequence | VIPGPVDAVCTLTVTEPTWYIRDMEAVLRALADDSRRKMLEALTGGPATAGDLAALLPIARPGVSRHLRVLRETGLVEVRQEAQRRVYSLRAEPLAEVDEWLGRYRALWQQRLDALHTEVARGKRERRGTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 94 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 95 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 96 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 216 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 217 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 220 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.53 |
| Rhizosphere | 89.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070716_100817837 | 3300006173 | Bacteria | 723 |
| 2 | JGI24738J21930_10086276 | 3300002075 | Bacteria | 660 |
| 3 | Ga0070658_10657861 | 3300005327 | Bacteria | 909 |
| 4 | Ga0070676_10224296 | 3300005328 | Bacteria | 1243 |
| 5 | Ga0070683_100018795 | 3300005329 | Bacteria | 6128 |
| 6 | Ga0070683_100156979 | 3300005329 | Bacteria | 2158 |
| 7 | Ga0070683_100172648 | 3300005329 | Unclassified | 2052 |
| 8 | Ga0070690_100610760 | 3300005330 | Bacteria | 829 |
| 9 | Ga0070670_101157953 | 3300005331 | Bacteria | 706 |
| 10 | Ga0068869_100087932 | 3300005334 | Bacteria | 2331 |
| 11 | Ga0068869_100174447 | 3300005334 | Bacteria | 1681 |
| 12 | Ga0068869_101425073 | 3300005334 | Bacteria | 614 |
| 13 | Ga0070666_10271472 | 3300005335 | Bacteria | 1204 |
| 14 | Ga0070680_100530014 | 3300005336 | Bacteria | 1009 |
| 15 | Ga0070682_100016266 | 3300005337 | Bacteria | 4323 |
| 16 | Ga0070682_100183482 | 3300005337 | Bacteria | 1463 |
| 17 | Ga0070682_100566959 | 3300005337 | Unclassified | 891 |
| 18 | Ga0070682_101236719 | 3300005337 | Unclassified | 632 |
| 19 | Ga0068868_100002586 | 3300005338 | Bacteria | 12547 |
| 20 | Ga0068868_100119092 | 3300005338 | Bacteria | 2152 |
| 21 | Ga0068868_101019959 | 3300005338 | Bacteria | 758 |
| 22 | Ga0068868_101707547 | 3300005338 | Bacteria | 593 |
| 23 | Ga0070660_100026588 | 3300005339 | Bacteria | 4310 |
| 24 | Ga0070660_101228160 | 3300005339 | Bacteria | 636 |
| 25 | Ga0070691_10316057 | 3300005341 | Bacteria | 857 |
| 26 | Ga0070687_100587599 | 3300005343 | Bacteria | 763 |
| 27 | Ga0070687_101289589 | 3300005343 | Bacteria | 542 |
| 28 | Ga0070661_100165915 | 3300005344 | Bacteria | 1675 |
| 29 | Ga0070692_10050908 | 3300005345 | Bacteria | 2152 |
| 30 | Ga0070671_100221479 | 3300005355 | Bacteria | 1605 |
| 31 | Ga0070671_100446260 | 3300005355 | Bacteria | 1110 |
| 32 | Ga0070671_102104447 | 3300005355 | Bacteria | 503 |
| 33 | Ga0070673_100108132 | 3300005364 | Bacteria | 2302 |
| 34 | Ga0070688_101659577 | 3300005365 | Bacteria | 523 |
| 35 | Ga0070659_100011184 | 3300005366 | Bacteria | 6631 |
| 36 | Ga0070659_100336523 | 3300005366 | Bacteria | 1264 |
| 37 | Ga0070659_100506418 | 3300005366 | Bacteria | 1029 |
| 38 | Ga0070667_100206433 | 3300005367 | Bacteria | 1745 |
| 39 | Ga0070703_10379099 | 3300005406 | Bacteria | 611 |
| 40 | Ga0070709_10209005 | 3300005434 | Bacteria | 1386 |
| 41 | Ga0070709_10229906 | 3300005434 | Bacteria | 1326 |
| 42 | Ga0070709_10356207 | 3300005434 | Bacteria | 1082 |
| 43 | Ga0070709_10718330 | 3300005434 | Bacteria | 779 |
| 44 | Ga0070714_100065816 | 3300005435 | Bacteria | 3122 |
| 45 | Ga0070714_100074431 | 3300005435 | Bacteria | 2944 |
| 46 | Ga0070714_100216986 | 3300005435 | Bacteria | 1756 |
| 47 | Ga0070714_100555530 | 3300005435 | Bacteria | 1099 |
| 48 | Ga0070713_100071744 | 3300005436 | Bacteria | 2927 |
| 49 | Ga0070713_100207009 | 3300005436 | Bacteria | 1774 |
| 50 | Ga0070713_100597223 | 3300005436 | Bacteria | 1048 |
| 51 | Ga0070713_100926324 | 3300005436 | Bacteria | 839 |
| 52 | Ga0070710_10034196 | 3300005437 | Bacteria | 2764 |
| 53 | Ga0070710_10195077 | 3300005437 | Bacteria | 1275 |
| 54 | Ga0070710_10222100 | 3300005437 | Bacteria | 1202 |
| 55 | Ga0070710_10281248 | 3300005437 | Bacteria | 1080 |
| 56 | Ga0070710_10878960 | 3300005437 | Bacteria | 645 |
| 57 | Ga0070710_11366826 | 3300005437 | Bacteria | 528 |
| 58 | Ga0070710_11410719 | 3300005437 | Bacteria | 521 |
| 59 | Ga0070701_10135789 | 3300005438 | Bacteria | 1402 |
| 60 | Ga0070701_10235330 | 3300005438 | Bacteria | 1099 |
| 61 | Ga0070711_100292426 | 3300005439 | Bacteria | 1292 |
| 62 | Ga0070711_100490435 | 3300005439 | Bacteria | 1011 |
| 63 | Ga0070711_100718028 | 3300005439 | Bacteria | 842 |
| 64 | Ga0070705_100176929 | 3300005440 | Bacteria | 1442 |
| 65 | Ga0070694_100431887 | 3300005444 | Bacteria | 1037 |
| 66 | Ga0070694_101069531 | 3300005444 | Bacteria | 672 |
| 67 | Ga0070708_100008382 | 3300005445 | Bacteria | 8300 |
| 68 | Ga0070708_100063351 | 3300005445 | Bacteria | 3310 |
| 69 | Ga0070708_100317354 | 3300005445 | Unclassified | 1468 |
| 70 | Ga0070663_100140293 | 3300005455 | Bacteria | 1844 |
| 71 | Ga0070663_100463937 | 3300005455 | Bacteria | 1046 |
| 72 | Ga0070663_101219577 | 3300005455 | Unclassified | 662 |
| 73 | Ga0070663_101382515 | 3300005455 | Bacteria | 623 |
| 74 | Ga0070678_100244519 | 3300005456 | Bacteria | 1502 |
| 75 | Ga0070678_101123257 | 3300005456 | Bacteria | 726 |
| 76 | Ga0070662_100370480 | 3300005457 | Bacteria | 1177 |
| 77 | Ga0070662_100505967 | 3300005457 | Bacteria | 1008 |
| 78 | Ga0070662_100517068 | 3300005457 | Bacteria | 997 |
| 79 | Ga0070681_10081404 | 3300005458 | Bacteria | 3194 |
| 80 | Ga0070681_10113376 | 3300005458 | Bacteria | 2650 |
| 81 | Ga0070681_10138489 | 3300005458 | Bacteria | 2363 |
| 82 | Ga0070681_10411150 | 3300005458 | Bacteria | 1265 |
| 83 | Ga0070681_10542078 | 3300005458 | Bacteria | 1077 |
| 84 | Ga0070681_10711007 | 3300005458 | Bacteria | 921 |
| 85 | Ga0068867_101570444 | 3300005459 | Bacteria | 614 |
| 86 | Ga0070685_10106140 | 3300005466 | Bacteria | 1723 |
| 87 | Ga0070706_100001286 | 3300005467 | Bacteria | 26758 |
| 88 | Ga0070706_100007825 | 3300005467 | Bacteria | 9992 |
| 89 | Ga0070706_100579750 | 3300005467 | Unclassified | 1043 |
| 90 | Ga0070706_100763374 | 3300005467 | Bacteria | 896 |
| 91 | Ga0070707_100003579 | 3300005468 | Bacteria | 14651 |
| 92 | Ga0070707_100098156 | 3300005468 | Plasmid | 2837 |
| 93 | Ga0070707_100593788 | 3300005468 | Bacteria | 1070 |
| 94 | Ga0070707_102265320 | 3300005468 | Bacteria | 511 |
| 95 | Ga0070698_100000708 | 3300005471 | Bacteria | 35672 |
| 96 | Ga0070698_100012678 | 3300005471 | Bacteria | 8923 |
| 97 | Ga0070699_100032606 | 3300005518 | Bacteria | 4498 |
| 98 | Ga0070699_100761178 | 3300005518 | Bacteria | 886 |
| 99 | Ga0070699_101735310 | 3300005518 | Bacteria | 572 |
| 100 | Ga0070699_102043795 | 3300005518 | Bacteria | 524 |
| 101 | Ga0070679_100064495 | 3300005530 | Bacteria | 3651 |
| 102 | Ga0070679_100456207 | 3300005530 | Bacteria | 1223 |
| 103 | Ga0070684_100245303 | 3300005535 | Bacteria | 1637 |
| 104 | Ga0070684_100387394 | 3300005535 | Bacteria | 1288 |
| 105 | Ga0070684_101083132 | 3300005535 | Bacteria | 753 |
| 106 | Ga0070684_101645649 | 3300005535 | Bacteria | 606 |
| 107 | Ga0070697_100156043 | 3300005536 | Bacteria | 1926 |
| 108 | Ga0070697_100264214 | 3300005536 | Bacteria | 1474 |
| 109 | Ga0070672_100749502 | 3300005543 | Bacteria | 857 |
| 110 | Ga0070672_100935241 | 3300005543 | Bacteria | 767 |
| 111 | Ga0070672_101163035 | 3300005543 | Bacteria | 687 |
| 112 | Ga0070686_100204825 | 3300005544 | Bacteria | 1417 |
| 113 | Ga0070686_101849252 | 3300005544 | Bacteria | 515 |
| 114 | Ga0070695_100003301 | 3300005545 | Bacteria | 9431 |
| 115 | Ga0070695_100545171 | 3300005545 | Bacteria | 903 |
| 116 | Ga0070696_100661072 | 3300005546 | Unclassified | 848 |
| 117 | Ga0070696_101497488 | 3300005546 | Bacteria | 577 |
| 118 | Ga0070693_100052191 | 3300005547 | Bacteria | 2344 |
| 119 | Ga0070704_101189689 | 3300005549 | Unclassified | 695 |
| 120 | Ga0068855_100545117 | 3300005563 | Bacteria | 1256 |
| 121 | Ga0068855_101102324 | 3300005563 | Bacteria | 830 |
| 122 | Ga0070664_101740452 | 3300005564 | Bacteria | 591 |
| 123 | Ga0068854_100159129 | 3300005578 | Bacteria | 1747 |
| 124 | Ga0068854_100294949 | 3300005578 | Bacteria | 1310 |
| 125 | Ga0068856_100007194 | 3300005614 | Bacteria | 10855 |
| 126 | Ga0068856_100207945 | 3300005614 | Bacteria | 1972 |
| 127 | Ga0068856_100252304 | 3300005614 | Bacteria | 1779 |
| 128 | Ga0070702_100128761 | 3300005615 | Bacteria | 1595 |
| 129 | Ga0070702_100598829 | 3300005615 | Bacteria | 826 |
| 130 | Ga0068852_100157871 | 3300005616 | Bacteria | 2115 |
| 131 | Ga0068852_100275696 | 3300005616 | Bacteria | 1620 |
| 132 | Ga0068852_100663025 | 3300005616 | Bacteria | 1051 |
| 133 | Ga0068852_100685412 | 3300005616 | Bacteria | 1034 |
| 134 | Ga0068859_100526513 | 3300005617 | Unclassified | 1277 |
| 135 | Ga0068864_100120012 | 3300005618 | Bacteria | 2350 |
| 136 | Ga0068851_10275166 | 3300005834 | Bacteria | 961 |
| 137 | Ga0068870_10154772 | 3300005840 | Bacteria | 1354 |
| 138 | Ga0068863_100885665 | 3300005841 | Bacteria | 892 |
| 139 | Ga0068858_100006881 | 3300005842 | Bacteria | 11054 |
| 140 | Ga0068858_101610547 | 3300005842 | Bacteria | 641 |
| 141 | Ga0068860_100365280 | 3300005843 | Bacteria | 1423 |
| 142 | Ga0068862_100904580 | 3300005844 | Bacteria | 868 |
| 143 | Ga0081455_10000145 | 3300005937 | Bacteria | 84152 |
| 144 | Ga0081455_10011497 | 3300005937 | Bacteria | 8891 |
| 145 | Ga0081540_1001295 | 3300005983 | Bacteria | 21835 |
| 146 | Ga0081540_1182012 | 3300005983 | Bacteria | 785 |
| 147 | Ga0070717_10002692 | 3300006028 | Bacteria | 12524 |
| 148 | Ga0070717_10015080 | 3300006028 | Bacteria | 5958 |
| 149 | Ga0070717_10016256 | 3300006028 | Bacteria | 5766 |
| 150 | Ga0070717_10176294 | 3300006028 | Bacteria | 1861 |
| 151 | Ga0070717_10396373 | 3300006028 | Bacteria | 1239 |
| 152 | Ga0070715_10178809 | 3300006163 | Bacteria | 1062 |
| 153 | Ga0070715_11001783 | 3300006163 | Bacteria | 521 |
| 154 | Ga0070716_100010438 | 3300006173 | Bacteria | 4656 |
| 155 | Ga0070716_100389398 | 3300006173 | Unclassified | 999 |
| 156 | Ga0070716_100660318 | 3300006173 | Bacteria | 794 |
| 157 | Ga0070712_100006790 | 3300006175 | Bacteria | 7122 |
| 158 | Ga0070712_100187861 | 3300006175 | Bacteria | 1614 |
| 159 | Ga0070712_100453876 | 3300006175 | Bacteria | 1068 |
| 160 | Ga0097621_100327168 | 3300006237 | Bacteria | 1359 |
| 161 | Ga0097621_100866705 | 3300006237 | Bacteria | 840 |
| 162 | Ga0068871_100319558 | 3300006358 | Bacteria | 1367 |
| 163 | Ga0075433_10035948 | 3300006852 | Bacteria | 4263 |
| 164 | Ga0075433_10320754 | 3300006852 | Bacteria | 1371 |
| 165 | Ga0075433_10486888 | 3300006852 | Unclassified | 1086 |
| 166 | Ga0075433_11144014 | 3300006852 | Bacteria | 676 |
| 167 | Ga0075434_100003275 | 3300006871 | Bacteria | 14484 |
| 168 | Ga0075434_100096072 | 3300006871 | Unclassified | 2968 |
| 169 | Ga0075434_100358461 | 3300006871 | Bacteria | 1479 |
| 170 | Ga0075436_100175019 | 3300006914 | Bacteria | 1515 |
| 171 | Ga0075436_100590630 | 3300006914 | Bacteria | 817 |
| 172 | Ga0075436_101279773 | 3300006914 | Bacteria | 554 |
| 173 | Ga0097620_100526432 | 3300006931 | Unclassified | 1277 |
| 174 | Ga0075435_100001051 | 3300007076 | Bacteria | 17481 |
| 175 | Ga0075435_100012800 | 3300007076 | Bacteria | 6216 |
| 176 | Ga0075435_101767789 | 3300007076 | Bacteria | 543 |
| 177 | Ga0105251_10076228 | 3300009011 | Bacteria | 1556 |
| 178 | Ga0105240_10104411 | 3300009093 | Bacteria | 3441 |
| 179 | Ga0105240_10201017 | 3300009093 | Bacteria | 2335 |
| 180 | Ga0105240_10616470 | 3300009093 | Bacteria | 1193 |
| 181 | Ga0111539_10484233 | 3300009094 | Bacteria | 1441 |
| 182 | Ga0111539_10545617 | 3300009094 | Bacteria | 1351 |
| 183 | Ga0105245_10006987 | 3300009098 | Bacteria | 9900 |
| 184 | Ga0105245_10010010 | 3300009098 | Bacteria | 8256 |
| 185 | Ga0105245_10353620 | 3300009098 | Bacteria | 1456 |
| 186 | Ga0105245_10361146 | 3300009098 | Bacteria | 1441 |
| 187 | Ga0105245_10390295 | 3300009098 | Bacteria | 1389 |
| 188 | Ga0105245_10438091 | 3300009098 | Bacteria | 1313 |
| 189 | Ga0105245_10571091 | 3300009098 | Bacteria | 1155 |
| 190 | Ga0105245_11506016 | 3300009098 | Bacteria | 724 |
| 191 | Ga0105247_10115306 | 3300009101 | Unclassified | 1734 |
| 192 | Ga0105247_10329566 | 3300009101 | Bacteria | 1068 |
| 193 | Ga0114129_10070147 | 3300009147 | Bacteria | 4886 |
| 194 | Ga0114129_10361422 | 3300009147 | Unclassified | 1921 |
| 195 | Ga0105243_10058922 | 3300009148 | Bacteria | 3062 |
| 196 | Ga0105243_10092116 | 3300009148 | Bacteria | 2498 |
| 197 | Ga0105243_10209765 | 3300009148 | Bacteria | 1714 |
| 198 | Ga0105243_12715448 | 3300009148 | Bacteria | 535 |
| 199 | Ga0105241_10168043 | 3300009174 | Bacteria | 1809 |
| 200 | Ga0105241_10638958 | 3300009174 | Bacteria | 965 |
| 201 | Ga0105241_12176839 | 3300009174 | Unclassified | 549 |
| 202 | Ga0105242_10245858 | 3300009176 | Bacteria | 1610 |
| 203 | Ga0105242_10288727 | 3300009176 | Bacteria | 1493 |
| 204 | Ga0105248_10215406 | 3300009177 | Bacteria | 2163 |
| 205 | Ga0105248_10223091 | 3300009177 | Bacteria | 2122 |
| 206 | Ga0105248_10259759 | 3300009177 | Bacteria | 1955 |
| 207 | Ga0105248_12385743 | 3300009177 | Bacteria | 602 |
| 208 | Ga0105248_12480757 | 3300009177 | Bacteria | 591 |
| 209 | Ga0105237_10011266 | 3300009545 | Bacteria | 9461 |
| 210 | Ga0105237_10032523 | 3300009545 | Bacteria | 5280 |
| 211 | Ga0105237_10266799 | 3300009545 | Bacteria | 1715 |
| 212 | Ga0105237_11368353 | 3300009545 | Bacteria | 714 |
| 213 | Ga0105237_11450575 | 3300009545 | Bacteria | 693 |
| 214 | Ga0105238_10012335 | 3300009551 | Bacteria | 8619 |
| 215 | Ga0105238_10337797 | 3300009551 | Bacteria | 1494 |
| 216 | Ga0105238_10428271 | 3300009551 | Bacteria | 1318 |
| 217 | Ga0105238_11290256 | 3300009551 | Bacteria | 756 |
| 218 | Ga0105238_11987079 | 3300009551 | Unclassified | 615 |
| 219 | Ga0105238_12563881 | 3300009551 | Bacteria | 546 |
| 220 | Ga0105249_10241621 | 3300009553 | Bacteria | 1786 |
| 221 | Ga0105249_10289554 | 3300009553 | Bacteria | 1639 |
| 222 | Ga0105249_10686032 | 3300009553 | Bacteria | 1084 |
| 223 | Ga0105249_13364313 | 3300009553 | Unclassified | 515 |
| 224 | Ga0105239_10134812 | 3300010375 | Bacteria | 2749 |
| 225 | Ga0105239_10397514 | 3300010375 | Bacteria | 1559 |
| 226 | Ga0105239_10918754 | 3300010375 | Bacteria | 1005 |
| 227 | Ga0105239_11056673 | 3300010375 | Bacteria | 934 |
| 228 | Ga0105239_11346329 | 3300010375 | Bacteria | 824 |
| 229 | Ga0105239_12019287 | 3300010375 | Bacteria | 669 |
| 230 | Ga0105246_10015061 | 3300011119 | Bacteria | 4873 |
| 231 | Ga0105246_10229911 | 3300011119 | Bacteria | 1460 |
| 232 | Ga0105246_10431253 | 3300011119 | Bacteria | 1103 |
| 233 | Ga0157336_1001942 | 3300012477 | Bacteria | 1124 |
| 234 | Ga0157329_1021328 | 3300012491 | Bacteria | 609 |
| 235 | Ga0157339_1051189 | 3300012505 | Bacteria | 547 |
| 236 | Ga0157342_1004931 | 3300012507 | Bacteria | 1208 |
| 237 | Ga0157373_10170630 | 3300013100 | Bacteria | 1531 |
| 238 | Ga0157373_10852139 | 3300013100 | Bacteria | 674 |
| 239 | Ga0157371_10029530 | 3300013102 | Bacteria | 3963 |
| 240 | Ga0157371_10974204 | 3300013102 | Bacteria | 646 |
| 241 | Ga0157370_10569853 | 3300013104 | Bacteria | 1038 |
| 242 | Ga0157370_11028633 | 3300013104 | Bacteria | 745 |
| 243 | Ga0157370_11135323 | 3300013104 | Bacteria | 706 |
| 244 | Ga0157369_10234855 | 3300013105 | Bacteria | 1916 |
| 245 | Ga0157369_10351309 | 3300013105 | Bacteria | 1531 |
| 246 | Ga0157369_10794913 | 3300013105 | Bacteria | 972 |
| 247 | Ga0157369_10996465 | 3300013105 | Bacteria | 858 |
| 248 | Ga0157374_10010845 | 3300013296 | Bacteria | 7864 |
| 249 | Ga0157374_10047741 | 3300013296 | Bacteria | 3971 |
| 250 | Ga0157374_12876414 | 3300013296 | Bacteria | 509 |
| 251 | Ga0157378_10515440 | 3300013297 | Bacteria | 1196 |
| 252 | Ga0157378_10667476 | 3300013297 | Bacteria | 1057 |
| 253 | Ga0163162_10146691 | 3300013306 | Bacteria | 2476 |
| 254 | Ga0163162_10184829 | 3300013306 | Bacteria | 2211 |
| 255 | Ga0163162_10286856 | 3300013306 | Bacteria | 1778 |
| 256 | Ga0163162_10313686 | 3300013306 | Bacteria | 1701 |
| 257 | Ga0163162_10701792 | 3300013306 | Bacteria | 1133 |
| 258 | Ga0163162_11374792 | 3300013306 | Bacteria | 803 |
| 259 | Ga0163162_11776452 | 3300013306 | Bacteria | 705 |
| 260 | Ga0157372_10012067 | 3300013307 | Bacteria | 9202 |
| 261 | Ga0157372_10014787 | 3300013307 | Bacteria | 8354 |
| 262 | Ga0157372_10143994 | 3300013307 | Bacteria | 2748 |
| 263 | Ga0157372_10214220 | 3300013307 | Bacteria | 2232 |
| 264 | Ga0157372_10363273 | 3300013307 | Bacteria | 1687 |
| 265 | Ga0157372_10607346 | 3300013307 | Bacteria | 1275 |
| 266 | Ga0157372_11457840 | 3300013307 | Bacteria | 789 |
| 267 | Ga0157372_11481981 | 3300013307 | Bacteria | 782 |
| 268 | Ga0157372_11658563 | 3300013307 | Bacteria | 736 |
| 269 | Ga0157372_12969373 | 3300013307 | Bacteria | 542 |
| 270 | Ga0157375_10057488 | 3300013308 | Bacteria | 3845 |
| 271 | Ga0157375_10281850 | 3300013308 | Bacteria | 1825 |
| 272 | Ga0157375_10424272 | 3300013308 | Bacteria | 1496 |
| 273 | Ga0157375_10643849 | 3300013308 | Bacteria | 1216 |
| 274 | Ga0157375_11077918 | 3300013308 | Bacteria | 940 |
| 275 | Ga0157375_11246758 | 3300013308 | Bacteria | 873 |
| 276 | Ga0157375_13776836 | 3300013308 | Bacteria | 503 |
| 277 | Ga0163163_10033673 | 3300014325 | Bacteria | 4958 |
| 278 | Ga0163163_10120652 | 3300014325 | Bacteria | 2656 |
| 279 | Ga0163163_10372930 | 3300014325 | Bacteria | 1484 |
| 280 | Ga0163163_10436168 | 3300014325 | Bacteria | 1369 |
| 281 | Ga0163163_10642249 | 3300014325 | Bacteria | 1125 |
| 282 | Ga0157380_10252770 | 3300014326 | Bacteria | 1596 |
| 283 | Ga0157377_10021661 | 3300014745 | Bacteria | 3384 |
| 284 | Ga0157377_10035718 | 3300014745 | Bacteria | 2728 |
| 285 | Ga0157377_10231336 | 3300014745 | Bacteria | 1189 |
| 286 | Ga0157377_10758303 | 3300014745 | Bacteria | 711 |
| 287 | Ga0157377_11149401 | 3300014745 | Unclassified | 598 |
| 288 | Ga0157379_10025657 | 3300014968 | Bacteria | 5238 |
| 289 | Ga0157379_10045059 | 3300014968 | Bacteria | 3937 |
| 290 | Ga0157379_10336369 | 3300014968 | Bacteria | 1380 |
| 291 | Ga0157379_11009806 | 3300014968 | Bacteria | 793 |
| 292 | Ga0157376_10004340 | 3300014969 | Bacteria | 9861 |
| 293 | Ga0157376_10265451 | 3300014969 | Bacteria | 1610 |
| 294 | Ga0157376_10865592 | 3300014969 | Bacteria | 920 |
| 295 | Ga0163161_10075486 | 3300017792 | Unclassified | 2474 |
| 296 | Ga0163161_10643686 | 3300017792 | Bacteria | 878 |
| 297 | Ga0163161_11882688 | 3300017792 | Bacteria | 532 |
| 298 | Ga0206353_10179416 | 3300020082 | Bacteria | 562 |
| 299 | Ga0206353_11362772 | 3300020082 | Bacteria | 952 |
| 300 | Ga0206353_12070973 | 3300020082 | Bacteria | 1083 |
| 301 | Ga0213873_10089231 | 3300021358 | Bacteria | 873 |
| 302 | Ga0207713_1086827 | 3300025735 | Bacteria | 1110 |
| 303 | Ga0207653_10387942 | 3300025885 | Bacteria | 547 |
| 304 | Ga0207692_10041692 | 3300025898 | Bacteria | 2275 |
| 305 | Ga0207692_10046554 | 3300025898 | Bacteria | 2175 |
| 306 | Ga0207692_10131230 | 3300025898 | Unclassified | 1415 |
| 307 | Ga0207692_10173129 | 3300025898 | Bacteria | 1252 |
| 308 | Ga0207710_10260482 | 3300025900 | Bacteria | 869 |
| 309 | Ga0207710_10410689 | 3300025900 | Unclassified | 696 |
| 310 | Ga0207688_10002447 | 3300025901 | Bacteria | 9997 |
| 311 | Ga0207685_10251572 | 3300025905 | Bacteria | 855 |
| 312 | Ga0207699_10007103 | 3300025906 | Bacteria | 5460 |
| 313 | Ga0207699_10055321 | 3300025906 | Bacteria | 2360 |
| 314 | Ga0207699_10389818 | 3300025906 | Bacteria | 990 |
| 315 | Ga0207699_10394489 | 3300025906 | Bacteria | 985 |
| 316 | Ga0207645_10311357 | 3300025907 | Bacteria | 1049 |
| 317 | Ga0207645_11114332 | 3300025907 | Bacteria | 532 |
| 318 | Ga0207643_10085466 | 3300025908 | Bacteria | 1832 |
| 319 | Ga0207684_10001357 | 3300025910 | Bacteria | 26760 |
| 320 | Ga0207684_10001846 | 3300025910 | Bacteria | 22058 |
| 321 | Ga0207684_10005848 | 3300025910 | Bacteria | 11264 |
| 322 | Ga0207684_10161681 | 3300025910 | Bacteria | 1929 |
| 323 | Ga0207684_10333281 | 3300025910 | Bacteria | 1307 |
| 324 | Ga0207684_10461660 | 3300025910 | Unclassified | 1090 |
| 325 | Ga0207654_10063300 | 3300025911 | Bacteria | 2170 |
| 326 | Ga0207654_10637050 | 3300025911 | Bacteria | 763 |
| 327 | Ga0207707_10582047 | 3300025912 | Bacteria | 949 |
| 328 | Ga0207707_10674732 | 3300025912 | Bacteria | 869 |
| 329 | Ga0207707_10714627 | 3300025912 | Bacteria | 840 |
| 330 | Ga0207695_10106395 | 3300025913 | Bacteria | 2791 |
| 331 | Ga0207695_10514165 | 3300025913 | Bacteria | 1079 |
| 332 | Ga0207671_10099273 | 3300025914 | Bacteria | 2203 |
| 333 | Ga0207671_10413053 | 3300025914 | Bacteria | 1074 |
| 334 | Ga0207693_10011846 | 3300025915 | Bacteria | 7049 |
| 335 | Ga0207693_10022242 | 3300025915 | Bacteria | 5039 |
| 336 | Ga0207693_10096553 | 3300025915 | Bacteria | 2317 |
| 337 | Ga0207663_10222824 | 3300025916 | Bacteria | 1373 |
| 338 | Ga0207663_10247102 | 3300025916 | Bacteria | 1311 |
| 339 | Ga0207663_10271787 | 3300025916 | Bacteria | 1256 |
| 340 | Ga0207660_10392243 | 3300025917 | Bacteria | 1117 |
| 341 | Ga0207657_10002845 | 3300025919 | Bacteria | 18597 |
| 342 | Ga0207657_10015127 | 3300025919 | Bacteria | 7493 |
| 343 | Ga0207649_10960638 | 3300025920 | Bacteria | 671 |
| 344 | Ga0207652_10497668 | 3300025921 | Bacteria | 1097 |
| 345 | Ga0207646_10001416 | 3300025922 | Bacteria | 29797 |
| 346 | Ga0207646_10008894 | 3300025922 | Bacteria | 10003 |
| 347 | Ga0207646_10336328 | 3300025922 | Unclassified | 1364 |
| 348 | Ga0207646_10538526 | 3300025922 | Bacteria | 1050 |
| 349 | Ga0207646_11296703 | 3300025922 | Bacteria | 636 |
| 350 | Ga0207681_10565652 | 3300025923 | Bacteria | 937 |
| 351 | Ga0207694_10016140 | 3300025924 | Bacteria | 5636 |
| 352 | Ga0207694_10401588 | 3300025924 | Bacteria | 1140 |
| 353 | Ga0207650_11764712 | 3300025925 | Bacteria | 524 |
| 354 | Ga0207659_10434871 | 3300025926 | Bacteria | 1103 |
| 355 | Ga0207687_10000711 | 3300025927 | Bacteria | 22543 |
| 356 | Ga0207687_10181347 | 3300025927 | Bacteria | 1632 |
| 357 | Ga0207700_10106229 | 3300025928 | Bacteria | 2250 |
| 358 | Ga0207700_10124301 | 3300025928 | Bacteria | 2096 |
| 359 | Ga0207700_10172703 | 3300025928 | Bacteria | 1804 |
| 360 | Ga0207700_10206201 | 3300025928 | Bacteria | 1659 |
| 361 | Ga0207700_10298111 | 3300025928 | Bacteria | 1391 |
| 362 | Ga0207700_10558853 | 3300025928 | Bacteria | 1016 |
| 363 | Ga0207664_10010860 | 3300025929 | Bacteria | 6449 |
| 364 | Ga0207664_10013341 | 3300025929 | Bacteria | 5894 |
| 365 | Ga0207664_10037551 | 3300025929 | Bacteria | 3750 |
| 366 | Ga0207664_10065779 | 3300025929 | Bacteria | 2903 |
| 367 | Ga0207664_10172047 | 3300025929 | Bacteria | 1854 |
| 368 | Ga0207664_10214135 | 3300025929 | Bacteria | 1668 |
| 369 | Ga0207664_10496796 | 3300025929 | Bacteria | 1092 |
| 370 | Ga0207644_10213145 | 3300025931 | Bacteria | 1528 |
| 371 | Ga0207690_10287705 | 3300025932 | Bacteria | 1282 |
| 372 | Ga0207690_10354643 | 3300025932 | Bacteria | 1161 |
| 373 | Ga0207706_10450943 | 3300025933 | Bacteria | 1113 |
| 374 | Ga0207706_10970610 | 3300025933 | Bacteria | 715 |
| 375 | Ga0207686_10040376 | 3300025934 | Unclassified | 2837 |
| 376 | Ga0207709_10020394 | 3300025935 | Bacteria | 3739 |
| 377 | Ga0207709_10124021 | 3300025935 | Bacteria | 1749 |
| 378 | Ga0207709_10458377 | 3300025935 | Bacteria | 987 |
| 379 | Ga0207670_11526919 | 3300025936 | Bacteria | 568 |
| 380 | Ga0207704_11496572 | 3300025938 | Bacteria | 579 |
| 381 | Ga0207665_10030553 | 3300025939 | Bacteria | 3561 |
| 382 | Ga0207665_10074146 | 3300025939 | Bacteria | 2329 |
| 383 | Ga0207691_10634707 | 3300025940 | Bacteria | 903 |
| 384 | Ga0207691_11300047 | 3300025940 | Bacteria | 601 |
| 385 | Ga0207691_11729841 | 3300025940 | Bacteria | 505 |
| 386 | Ga0207711_10351808 | 3300025941 | Bacteria | 1364 |
| 387 | Ga0207711_10418379 | 3300025941 | Bacteria | 1246 |
| 388 | Ga0207711_10514303 | 3300025941 | Bacteria | 1116 |
| 389 | Ga0207711_11607444 | 3300025941 | Bacteria | 593 |
| 390 | Ga0207689_10045020 | 3300025942 | Bacteria | 3649 |
| 391 | Ga0207689_10306282 | 3300025942 | Bacteria | 1317 |
| 392 | Ga0207661_10400137 | 3300025944 | Bacteria | 1245 |
| 393 | Ga0207661_10477361 | 3300025944 | Bacteria | 1138 |
| 394 | Ga0207661_10509172 | 3300025944 | Unclassified | 1100 |
| 395 | Ga0207661_10919663 | 3300025944 | Bacteria | 806 |
| 396 | Ga0207667_10017784 | 3300025949 | Bacteria | 7994 |
| 397 | Ga0207667_10855683 | 3300025949 | Bacteria | 903 |
| 398 | Ga0207667_10911036 | 3300025949 | Bacteria | 870 |
| 399 | Ga0207651_10112116 | 3300025960 | Bacteria | 2050 |
| 400 | Ga0207712_10080504 | 3300025961 | Bacteria | 2369 |
| 401 | Ga0207712_10166169 | 3300025961 | Bacteria | 1720 |
| 402 | Ga0207668_10104245 | 3300025972 | Bacteria | 2114 |
| 403 | Ga0207668_10619818 | 3300025972 | Bacteria | 944 |
| 404 | Ga0207640_10111678 | 3300025981 | Bacteria | 1939 |
| 405 | Ga0207640_10682247 | 3300025981 | Bacteria | 879 |
| 406 | Ga0207640_11821814 | 3300025981 | Bacteria | 550 |
| 407 | Ga0207658_10528293 | 3300025986 | Bacteria | 1054 |
| 408 | Ga0207658_11533783 | 3300025986 | Bacteria | 609 |
| 409 | Ga0207677_10437402 | 3300026023 | Bacteria | 1118 |
| 410 | Ga0207703_10024083 | 3300026035 | Bacteria | 4789 |
| 411 | Ga0207703_10340079 | 3300026035 | Bacteria | 1379 |
| 412 | Ga0207639_10305924 | 3300026041 | Bacteria | 1407 |
| 413 | Ga0207639_10544007 | 3300026041 | Bacteria | 1065 |
| 414 | Ga0207639_11336484 | 3300026041 | Bacteria | 673 |
| 415 | Ga0207678_10227655 | 3300026067 | Bacteria | 1596 |
| 416 | Ga0207678_11331955 | 3300026067 | Unclassified | 635 |
| 417 | Ga0207708_11340404 | 3300026075 | Bacteria | 627 |
| 418 | Ga0207702_10016249 | 3300026078 | Bacteria | 6159 |
| 419 | Ga0207702_11087727 | 3300026078 | Unclassified | 793 |
| 420 | Ga0207702_12502408 | 3300026078 | Bacteria | 503 |
| 421 | Ga0207648_10293209 | 3300026089 | Bacteria | 1457 |
| 422 | Ga0207648_11015645 | 3300026089 | Bacteria | 777 |
| 423 | Ga0207676_11608569 | 3300026095 | Bacteria | 647 |
| 424 | Ga0207676_12107176 | 3300026095 | Bacteria | 562 |
| 425 | Ga0207674_10505324 | 3300026116 | Bacteria | 1168 |
| 426 | Ga0207675_100177172 | 3300026118 | Bacteria | 2040 |
| 427 | Ga0207675_100562643 | 3300026118 | Bacteria | 1140 |
| 428 | Ga0207683_10056092 | 3300026121 | Bacteria | 3455 |
| 429 | Ga0207698_10444210 | 3300026142 | Bacteria | 1250 |
| 430 | Ga0207698_10547262 | 3300026142 | Bacteria | 1134 |
| 431 | Ga0207698_10896162 | 3300026142 | Bacteria | 894 |
| 432 | Ga0207698_12377291 | 3300026142 | Bacteria | 541 |
| 433 | Ga0268266_10827460 | 3300028379 | Bacteria | 894 |
| 434 | Ga0268264_10622401 | 3300028381 | Bacteria | 1066 |
| 435 | Ga0268264_10630310 | 3300028381 | Bacteria | 1059 |
| 436 | Ga0265760_10053399 | 3300031090 | Bacteria | 1219 |
| 437 | Ga0373948_0044226 | 3300034817 | Bacteria | 941 |
| 438 | Ga0373950_0044001 | 3300034818 | Bacteria | 862 |
| 439 | Ga0373958_0042643 | 3300034819 | Bacteria | 933 |
| 440 | Ga0373926_0000190 | 3300035083 | Bacteria | 13981 |
| 441 | Ga0373926_0145794 | 3300035083 | Bacteria | 900 |
| 442 | Ga0373929_0043193 | 3300035085 | Bacteria | 1008 |
| 443 | Ga0373934_0051168 | 3300035086 | Bacteria | 1637 |
| 444 | Ga0373940_0020119 | 3300035088 | Bacteria | 1693 |
| 445 | Ga0373940_0360418 | 3300035088 | Bacteria | 512 |
| 446 | Ga0373944_0002379 | 3300035089 | Bacteria | 4792 |
| 447 | Ga0373944_0080483 | 3300035089 | Bacteria | 1075 |
| 448 | Ga0373944_0371059 | 3300035089 | Bacteria | 547 |
| 449 | Ga0373949_0177313 | 3300035090 | Bacteria | 629 |
| 450 | Ga0373923_0000224 | 3300035111 | Bacteria | 11874 |
| 451 | Ga0373923_0013512 | 3300035111 | Bacteria | 3045 |
| 452 | Ga0373932_0012798 | 3300035112 | Bacteria | 2073 |
| 453 | Ga0373936_0000374 | 3300035113 | Bacteria | 15155 |
| 454 | Ga0373936_0221840 | 3300035113 | Bacteria | 839 |
| 455 | Ga0373936_0305750 | 3300035113 | Bacteria | 718 |
| 456 | Ga0373939_0029486 | 3300035114 | Bacteria | 1570 |
| 457 | Ga0373941_0050243 | 3300035115 | Bacteria | 1323 |
| 458 | Ga0373945_0001007 | 3300035116 | Bacteria | 8422 |
| 459 | Ga0373953_0000462 | 3300035117 | Bacteria | 11173 |
| 460 | Ga0373953_0023598 | 3300035117 | Bacteria | 2329 |
| 461 | Ga0373953_0110289 | 3300035117 | Bacteria | 1163 |
| 462 | Ga0373954_0000725 | 3300035118 | Bacteria | 12713 |
| 463 | Ga0373954_0084506 | 3300035118 | Bacteria | 1519 |
| 464 | Ga0373956_0002808 | 3300035119 | Bacteria | 7039 |
| 465 | Ga0373956_0040506 | 3300035119 | Bacteria | 2066 |
| 466 | Ga0373956_0198054 | 3300035119 | Bacteria | 952 |
| 467 | Ga0373956_0520965 | 3300035119 | Bacteria | 567 |
| 468 | Ga0373957_0001454 | 3300035120 | Bacteria | 6413 |
| 469 | Ga0373957_0011975 | 3300035120 | Bacteria | 2909 |
| 470 | Ga0373957_0018411 | 3300035120 | Bacteria | 2446 |
| 471 | Ga0373943_0000279 | 3300035170 | Bacteria | 21102 |
| 472 | Ga0373943_0099749 | 3300035170 | Bacteria | 1517 |
| 473 | Ga0373943_0283431 | 3300035170 | Bacteria | 937 |
| 474 | Ga0373946_0079946 | 3300035171 | Bacteria | 1429 |
| 475 | Ga0373946_0122265 | 3300035171 | Bacteria | 1189 |
| 476 | Ga0373946_0189714 | 3300035171 | Bacteria | 979 |
| 477 | Ga0373946_0555499 | 3300035171 | Bacteria | 592 |
| 478 | Ga0373955_0001286 | 3300035172 | Bacteria | 10680 |
| 479 | Ga0373955_0009059 | 3300035172 | Bacteria | 4648 |
| 480 | Ga0373955_0495627 | 3300035172 | Unclassified | 746 |
| 481 | Ga0373942_0123107 | 3300035207 | Bacteria | 812 |
| 482 | Ga0373942_0308578 | 3300035207 | Unclassified | 551 |
| 483 | Ga0373962_0086958 | 3300035242 | Bacteria | 957 |
| 484 | Ga0373924_0003085 | 3300035410 | Bacteria | 5687 |
| 485 | Ga0373924_0026213 | 3300035410 | Bacteria | 2310 |
| 486 | Ga0373924_0148613 | 3300035410 | Bacteria | 1024 |
| 487 | Ga0373924_0211646 | 3300035410 | Bacteria | 856 |
| 488 | Ga0373931_0157991 | 3300035691 | Bacteria | 1327 |
| 489 | Ga0373931_0300691 | 3300035691 | Bacteria | 991 |
| 490 | Ga0373931_0681103 | 3300035691 | Bacteria | 678 |
| 491 | Ga0373931_1127581 | 3300035691 | Bacteria | 535 |
| 492 | Ga0373935_0006058 | 3300035692 | Bacteria | 7187 |
| 493 | Ga0373935_0681089 | 3300035692 | Bacteria | 755 |
| 494 | Ga0373927_0000787 | 3300035695 | Bacteria | 24230 |
| 495 | Ga0373927_0295056 | 3300035695 | Bacteria | 1067 |
| 496 | Ga0373927_0353577 | 3300035695 | Unclassified | 968 |
| 497 | Ga0373927_0558596 | 3300035695 | Bacteria | 756 |
| 498 | Ga0373927_1015007 | 3300035695 | Bacteria | 547 |
| 499 | Ga0373933_0004280 | 3300035724 | Bacteria | 7844 |
| 500 | Ga0373933_0063472 | 3300035724 | Bacteria | 2233 |
| 501 | Ga0373933_0407276 | 3300035724 | Bacteria | 887 |
| 502 | Ga0373933_0520669 | 3300035724 | Bacteria | 779 |
| 503 | Ga0373947_0092837 | 3300035725 | Bacteria | 1885 |
| 504 | Ga0373947_0189775 | 3300035725 | Bacteria | 1340 |
| 505 | Ga0373947_0661736 | 3300035725 | Unclassified | 712 |
| 506 | Ga0373937_0022313 | 3300036401 | Bacteria | 5691 |
| 507 | Ga0373937_0482459 | 3300036401 | Bacteria | 1177 |
| 508 | Ga0373937_0484791 | 3300036401 | Bacteria | 1174 |
| 509 | Ga0373937_0923840 | 3300036401 | Bacteria | 821 |
| 510 | Ga0373937_0943851 | 3300036401 | Bacteria | 811 |
| 511 | Ga0372808_018662 | 3300036459 | Bacteria | 996 |
| 512 | Ga0373925_0017114 | 3300037068 | Bacteria | 5248 |
| 513 | Ga0373925_0081826 | 3300037068 | Bacteria | 2456 |
| 514 | Ga0373925_0137590 | 3300037068 | Bacteria | 1909 |
| 515 | Ga0373925_0161454 | 3300037068 | Unclassified | 1765 |
| 516 | Ga0373925_0380331 | 3300037068 | Bacteria | 1149 |
| 517 | Ga0373925_0600476 | 3300037068 | Bacteria | 906 |
| 518 | Ga0373925_0908376 | 3300037068 | Bacteria | 726 |
| 519 | Ga0395898_0415826 | 3300037466 | Bacteria | 1282 |
| 520 | Ga0436364_0702615 | 3300037853 | Unclassified | 1134 |
| 521 | Ga0395901_0334182 | 3300038443 | Unclassified | 1566 |
| 522 | Ga0242420_137572 | 3300038996 | Bacteria | 542 |
| 523 | Ga0436361_1023671 | 3300039447 | Bacteria | 861 |
| 524 | Ga0436363_1362369 | 3300039450 | Bacteria | 1258 |
| 525 | Ga0436362_0119803 | 3300039453 | Bacteria | 572 |
| 526 | Ga0436362_0459129 | 3300039453 | Bacteria | 858 |
| 527 | Ga0436362_0574285 | 3300039453 | Bacteria | 668 |
| 528 | Ga0451833_0364065 | 3300041491 | Bacteria | 696 |
| 529 | Ga0451839_0127947 | 3300041496 | Bacteria | 834 |
| 530 | Ga0451843_0322056 | 3300041509 | Bacteria | 557 |
| 531 | Ga0451853_1391916 | 3300041512 | Bacteria | 890 |
| 532 | Ga0451853_2994508 | 3300041512 | Bacteria | 630 |
| 533 | Ga0451853_3831011 | 3300041512 | Bacteria | 1005 |
| 534 | Ga0450888_012043 | 3300042126 | Unclassified | 1021 |
| 535 | Ga0439435_0308826 | 3300042436 | Bacteria | 543 |
| 536 | Ga0466961_0519733 | 3300044693 | Bacteria | 718 |
| 537 | Ga0466963_0143853 | 3300044694 | Bacteria | 1653 |
| 538 | Ga0466963_0152475 | 3300044694 | Bacteria | 1605 |
| 539 | Ga0466963_0709867 | 3300044694 | Unclassified | 709 |
| 540 | Ga0466964_0016818 | 3300044706 | Unclassified | 2795 |
| 541 | Ga0466964_0044528 | 3300044706 | Bacteria | 1803 |
| 542 | Ga0466964_0068139 | 3300044706 | Bacteria | 1498 |
| 543 | Ga0466964_0834515 | 3300044706 | Bacteria | 523 |
| 544 | Ga0466957_0986798 | 3300044842 | Unclassified | 604 |
| 545 | Ga0466960_1028914 | 3300044901 | Bacteria | 507 |
| 546 | Ga0466960_1054432 | 3300044901 | Bacteria | 501 |
| 547 | Ga0466958_0706889 | 3300045836 | Bacteria | 656 |
| 548 | Ga0466967_0184373 | 3300045976 | Bacteria | 1970 |
| 549 | Ga0466967_0360482 | 3300045976 | Unclassified | 1408 |
| 550 | Ga0466967_1100981 | 3300045976 | Bacteria | 791 |
| 551 | Ga0466967_1771226 | 3300045976 | Bacteria | 615 |
| 552 | Ga0466967_2237718 | 3300045976 | Bacteria | 542 |
| 553 | Ga0495592_0015135 | 3300046454 | Bacteria | 5860 |
| 554 | Ga0495592_0019409 | 3300046454 | Bacteria | 5170 |
| 555 | Ga0495592_0130471 | 3300046454 | Bacteria | 1759 |
| 556 | Ga0495592_0154108 | 3300046454 | Bacteria | 1586 |
| 557 | Ga0495592_0239594 | 3300046454 | Bacteria | 1204 |
| 558 | Ga0495603_0012040 | 3300046455 | Bacteria | 5236 |
| 559 | Ga0495603_0056113 | 3300046455 | Bacteria | 2333 |
| 560 | Ga0495603_0095684 | 3300046455 | Bacteria | 1735 |
| 561 | Ga0495603_0330615 | 3300046455 | Bacteria | 875 |
| 562 | Ga0495629_0000229 | 3300046459 | Bacteria | 50275 |
| 563 | Ga0495629_0002198 | 3300046459 | Bacteria | 15040 |
| 564 | Ga0495629_0008917 | 3300046459 | Bacteria | 7373 |
| 565 | Ga0495629_0068145 | 3300046459 | Bacteria | 2483 |
| 566 | Ga0495641_0001628 | 3300046461 | Bacteria | 18907 |
| 567 | Ga0495641_0006898 | 3300046461 | Bacteria | 7248 |
| 568 | Ga0495641_0035629 | 3300046461 | Bacteria | 2343 |
| 569 | Ga0495641_0182371 | 3300046461 | Bacteria | 940 |
| 570 | Ga0495651_0017178 | 3300046462 | Bacteria | 5605 |
| 571 | Ga0495651_0110380 | 3300046462 | Bacteria | 2034 |
| 572 | Ga0495651_0131833 | 3300046462 | Bacteria | 1823 |
| 573 | Ga0495651_0153770 | 3300046462 | Bacteria | 1655 |
| 574 | Ga0495653_0030039 | 3300046463 | Bacteria | 4332 |
| 575 | Ga0495653_0036742 | 3300046463 | Bacteria | 3855 |
| 576 | Ga0495653_0044255 | 3300046463 | Bacteria | 3455 |
| 577 | Ga0495653_0151853 | 3300046463 | Bacteria | 1617 |
| 578 | Ga0495653_0159666 | 3300046463 | Bacteria | 1566 |
| 579 | Ga0495653_0259276 | 3300046463 | Bacteria | 1150 |
| 580 | Ga0495653_0869343 | 3300046463 | Bacteria | 538 |
| 581 | Ga0495580_0013431 | 3300046472 | Bacteria | 6246 |
| 582 | Ga0495580_0148774 | 3300046472 | Bacteria | 1622 |
| 583 | Ga0495582_0012920 | 3300046473 | Bacteria | 4600 |
| 584 | Ga0495582_0034326 | 3300046473 | Bacteria | 2788 |
| 585 | Ga0495582_0132191 | 3300046473 | Bacteria | 1410 |
| 586 | Ga0495582_0165727 | 3300046473 | Bacteria | 1257 |
| 587 | Ga0495639_0000347 | 3300046475 | Bacteria | 22348 |
| 588 | Ga0495639_0024477 | 3300046475 | Bacteria | 2658 |
| 589 | Ga0495639_0091716 | 3300046475 | Bacteria | 1426 |
| 590 | Ga0495662_0000350 | 3300046476 | Bacteria | 20203 |
| 591 | Ga0495662_0104758 | 3300046476 | Bacteria | 1384 |
| 592 | Ga0495664_0002744 | 3300046477 | Bacteria | 9466 |
| 593 | Ga0495664_0044436 | 3300046477 | Bacteria | 2632 |
| 594 | Ga0495664_0066909 | 3300046477 | Bacteria | 2143 |
| 595 | Ga0495664_0075452 | 3300046477 | Bacteria | 2017 |
| 596 | Ga0495664_0139670 | 3300046477 | Bacteria | 1469 |
| 597 | Ga0495664_0257457 | 3300046477 | Bacteria | 1055 |
| 598 | Ga0495594_0060355 | 3300046499 | Bacteria | 2097 |
| 599 | Ga0495594_0264797 | 3300046499 | Bacteria | 979 |
| 600 | Ga0495594_0554705 | 3300046499 | Bacteria | 652 |
| 601 | Ga0495608_0020627 | 3300046511 | Bacteria | 4528 |
| 602 | Ga0495608_0043080 | 3300046511 | Bacteria | 3016 |
| 603 | Ga0495608_0133857 | 3300046511 | Bacteria | 1585 |
| 604 | Ga0495618_0008326 | 3300046514 | Bacteria | 6279 |
| 605 | Ga0495618_0014658 | 3300046514 | Bacteria | 4779 |
| 606 | Ga0495618_0018376 | 3300046514 | Bacteria | 4292 |
| 607 | Ga0495618_0165652 | 3300046514 | Bacteria | 1407 |
| 608 | Ga0495618_0187279 | 3300046514 | Bacteria | 1314 |
| 609 | Ga0495618_0520112 | 3300046514 | Bacteria | 715 |
| 610 | Ga0495628_0013693 | 3300046516 | Bacteria | 6815 |
| 611 | Ga0495628_0039965 | 3300046516 | Bacteria | 3750 |
| 612 | Ga0495628_0052026 | 3300046516 | Unclassified | 3236 |
| 613 | Ga0495628_0334794 | 3300046516 | Bacteria | 1115 |
| 614 | Ga0495628_0375102 | 3300046516 | Bacteria | 1042 |
| 615 | Ga0495630_0008052 | 3300046517 | Bacteria | 7578 |
| 616 | Ga0495630_0009109 | 3300046517 | Bacteria | 7136 |
| 617 | Ga0495630_0082589 | 3300046517 | Bacteria | 2425 |
| 618 | Ga0495630_0088749 | 3300046517 | Bacteria | 2335 |
| 619 | Ga0495666_0004835 | 3300046526 | Bacteria | 6807 |
| 620 | Ga0495666_0033541 | 3300046526 | Bacteria | 2507 |
| 621 | Ga0495652_0001732 | 3300046529 | Bacteria | 23441 |
| 622 | Ga0495652_0004765 | 3300046529 | Bacteria | 12906 |
| 623 | Ga0495652_0042415 | 3300046529 | Bacteria | 3923 |
| 624 | Ga0495652_0627846 | 3300046529 | Bacteria | 730 |
| 625 | Ga0495665_0001140 | 3300046531 | Bacteria | 14107 |
| 626 | Ga0495665_0005038 | 3300046531 | Bacteria | 7123 |
| 627 | Ga0495665_0219484 | 3300046531 | Bacteria | 983 |
| 628 | Ga0495640_0005487 | 3300046533 | Bacteria | 10085 |
| 629 | Ga0495640_0008952 | 3300046533 | Bacteria | 7816 |
| 630 | Ga0495640_0009794 | 3300046533 | Bacteria | 7443 |
| 631 | Ga0495640_0015987 | 3300046533 | Bacteria | 5628 |
| 632 | Ga0495640_0040345 | 3300046533 | Bacteria | 3269 |
| 633 | Ga0495586_0009551 | 3300046535 | Bacteria | 5167 |
| 634 | Ga0495586_0014453 | 3300046535 | Bacteria | 4193 |
| 635 | Ga0495586_0018702 | 3300046535 | Bacteria | 3688 |
| 636 | Ga0495587_0009033 | 3300046536 | Bacteria | 6398 |
| 637 | Ga0495587_0021344 | 3300046536 | Bacteria | 3992 |
| 638 | Ga0495587_0024241 | 3300046536 | Bacteria | 3721 |
| 639 | Ga0495587_0143090 | 3300046536 | Bacteria | 1364 |
| 640 | Ga0495645_0027300 | 3300046543 | Bacteria | 4146 |
| 641 | Ga0495645_0130456 | 3300046543 | Unclassified | 1762 |
| 642 | Ga0495645_0295319 | 3300046543 | Bacteria | 1060 |
| 643 | Ga0495645_0421133 | 3300046543 | Bacteria | 847 |
| 644 | Ga0495622_0262686 | 3300046557 | Bacteria | 757 |
| 645 | Ga0495667_0019524 | 3300046559 | Bacteria | 4573 |
| 646 | Ga0495667_0055864 | 3300046559 | Bacteria | 2596 |
| 647 | Ga0495667_0355325 | 3300046559 | Bacteria | 925 |
| 648 | Ga0495667_0441659 | 3300046559 | Bacteria | 818 |
| 649 | Ga0495634_0002674 | 3300046642 | Bacteria | 14646 |
| 650 | Ga0495634_0044123 | 3300046642 | Bacteria | 3019 |
| 651 | Ga0495634_0048975 | 3300046642 | Bacteria | 2842 |
| 652 | Ga0495634_0550053 | 3300046642 | Bacteria | 673 |
| 653 | Ga0495635_0013700 | 3300046663 | Bacteria | 5673 |
| 654 | Ga0495635_0032547 | 3300046663 | Bacteria | 3617 |
| 655 | Ga0495635_0048739 | 3300046663 | Bacteria | 2920 |
| 656 | Ga0495635_0096684 | 3300046663 | Bacteria | 2018 |
| 657 | Ga0495588_0208433 | 3300046674 | Bacteria | 1032 |
| 658 | Ga0495657_0075227 | 3300046675 | Bacteria | 2195 |
| 659 | Ga0495657_0185580 | 3300046675 | Bacteria | 1273 |
| 660 | Ga0495657_0309630 | 3300046675 | Bacteria | 940 |
| 661 | Ga0495657_0884170 | 3300046675 | Bacteria | 508 |
| 662 | Ga0495599_0002017 | 3300046678 | Bacteria | 11744 |
| 663 | Ga0495599_0007619 | 3300046678 | Bacteria | 6573 |
| 664 | Ga0495599_0036598 | 3300046678 | Bacteria | 3083 |
| 665 | Ga0495599_0074739 | 3300046678 | Bacteria | 2116 |
| 666 | Ga0495599_0228177 | 3300046678 | Bacteria | 1137 |
| 667 | Ga0495623_0002796 | 3300046679 | Bacteria | 11515 |
| 668 | Ga0495623_0048263 | 3300046679 | Bacteria | 2701 |
| 669 | Ga0495623_0134372 | 3300046679 | Bacteria | 1477 |
| 670 | Ga0495646_0000774 | 3300046680 | Bacteria | 17844 |
| 671 | Ga0495646_0024467 | 3300046680 | Bacteria | 3802 |
| 672 | Ga0495647_0020669 | 3300046681 | Bacteria | 2365 |
| 673 | Ga0495647_0141082 | 3300046681 | Bacteria | 1027 |
| 674 | Ga0495658_0039400 | 3300046683 | Bacteria | 2621 |
| 675 | Ga0495658_0070987 | 3300046683 | Bacteria | 2022 |
| 676 | Ga0495658_0330906 | 3300046683 | Bacteria | 966 |
| 677 | Ga0495613_0033416 | 3300046689 | Bacteria | 3823 |
| 678 | Ga0495613_0054307 | 3300046689 | Bacteria | 2945 |
| 679 | Ga0495613_0080210 | 3300046689 | Bacteria | 2372 |
| 680 | Ga0495624_0017598 | 3300046690 | Bacteria | 4794 |
| 681 | Ga0495624_0115502 | 3300046690 | Bacteria | 1650 |
| 682 | Ga0495624_0214171 | 3300046690 | Bacteria | 1168 |
| 683 | Ga0495600_0001143 | 3300046809 | Bacteria | 14500 |
| 684 | Ga0495600_0062315 | 3300046809 | Bacteria | 2436 |
| 685 | Ga0495600_0386816 | 3300046809 | Bacteria | 872 |
| 686 | Ga0495600_0599621 | 3300046809 | Unclassified | 669 |
| 687 | Ga0495581_0007390 | 3300047315 | Bacteria | 6352 |
| 688 | Ga0495581_0091224 | 3300047315 | Bacteria | 1767 |
| 689 | Ga0495581_0401148 | 3300047315 | Bacteria | 800 |
| 690 | Ga0495581_0570005 | 3300047315 | Bacteria | 656 |
| 691 | Ga0495604_0003357 | 3300047317 | Bacteria | 12764 |
| 692 | Ga0495604_0061852 | 3300047317 | Bacteria | 2862 |
| 693 | Ga0495604_0118552 | 3300047317 | Bacteria | 1918 |
| 694 | Ga0495674_0001819 | 3300047319 | Bacteria | 21027 |
| 695 | Ga0495674_0004281 | 3300047319 | Bacteria | 13737 |
| 696 | Ga0495674_0008850 | 3300047319 | Bacteria | 9577 |
| 697 | Ga0495674_0014580 | 3300047319 | Bacteria | 7354 |
| 698 | Ga0495674_0021848 | 3300047319 | Bacteria | 5912 |
| 699 | Ga0495674_0060755 | 3300047319 | Bacteria | 3296 |
| 700 | Ga0495674_0414121 | 3300047319 | Bacteria | 1086 |
| 701 | Ga0495676_0026905 | 3300047321 | Bacteria | 4941 |
| 702 | Ga0495676_0079281 | 3300047321 | Bacteria | 2497 |
| 703 | Ga0495676_0323700 | 3300047321 | Bacteria | 1035 |
| 704 | Ga0495676_0748381 | 3300047321 | Bacteria | 631 |
| 705 | Ga0495676_0802143 | 3300047321 | Bacteria | 606 |
| 706 | Ga0495676_0948041 | 3300047321 | Bacteria | 550 |
| 707 | Ga0495680_0003483 | 3300047322 | Bacteria | 15458 |
| 708 | Ga0495680_0004400 | 3300047322 | Bacteria | 13481 |
| 709 | Ga0495680_0025738 | 3300047322 | Bacteria | 4865 |
| 710 | Ga0495680_0244425 | 3300047322 | Bacteria | 1273 |
| 711 | Ga0495675_0002634 | 3300047444 | Bacteria | 10759 |
| 712 | Ga0495675_0007699 | 3300047444 | Bacteria | 6643 |
| 713 | Ga0495684_0002597 | 3300047471 | Bacteria | 14353 |
| 714 | Ga0495684_0004492 | 3300047471 | Bacteria | 10896 |
| 715 | Ga0495684_0004498 | 3300047471 | Bacteria | 10887 |
| 716 | Ga0495684_0100883 | 3300047471 | Bacteria | 2182 |
| 717 | Ga0495684_0235469 | 3300047471 | Bacteria | 1337 |
| 718 | Ga0495684_0530892 | 3300047471 | Bacteria | 804 |
| 719 | Ga0495593_0002363 | 3300047673 | Bacteria | 11333 |
| 720 | Ga0495593_0005458 | 3300047673 | Bacteria | 7512 |
| 721 | Ga0495593_0086972 | 3300047673 | Bacteria | 1611 |
| 722 | Ga0495593_0397531 | 3300047673 | Bacteria | 689 |
| 723 | Ga0495602_0009228 | 3300048088 | Bacteria | 10266 |
| 724 | Ga0495602_0044146 | 3300048088 | Bacteria | 4046 |
| 725 | Ga0495602_0125276 | 3300048088 | Bacteria | 2059 |
| 726 | Ga0495602_0334578 | 3300048088 | Bacteria | 1097 |
| 727 | Ga0495602_0372009 | 3300048088 | Bacteria | 1026 |
| 728 | Ga0495614_0008901 | 3300048089 | Bacteria | 4454 |
| 729 | Ga0495614_0017954 | 3300048089 | Bacteria | 3068 |
| 730 | Ga0495614_0025484 | 3300048089 | Bacteria | 2551 |
| 731 | Ga0496100_0016808 | 3300048903 | Bacteria | 4304 |
| 732 | Ga0496100_0216584 | 3300048903 | Bacteria | 1403 |
| 733 | Ga0496100_0651445 | 3300048903 | Bacteria | 820 |
| 734 | Ga0496100_0988605 | 3300048903 | Bacteria | 662 |
| 735 | Ga0496100_1031401 | 3300048903 | Bacteria | 647 |
| 736 | Ga0496101_0001184 | 3300048904 | Bacteria | 15601 |
| 737 | Ga0496101_0039357 | 3300048904 | Bacteria | 3362 |
| 738 | Ga0496101_0140636 | 3300048904 | Bacteria | 1839 |
| 739 | Ga0496101_0565873 | 3300048904 | Bacteria | 899 |
| 740 | Ga0496101_0895748 | 3300048904 | Bacteria | 699 |
| 741 | Ga0496101_0940303 | 3300048904 | Bacteria | 680 |
| 742 | Ga0496102_0001014 | 3300048905 | Bacteria | 26227 |
| 743 | Ga0496102_0041753 | 3300048905 | Bacteria | 4155 |
| 744 | Ga0496102_0091832 | 3300048905 | Bacteria | 2811 |
| 745 | Ga0496102_0231283 | 3300048905 | Bacteria | 1743 |
| 746 | Ga0496102_0318193 | 3300048905 | Bacteria | 1466 |
| 747 | Ga0496103_0002279 | 3300048906 | Bacteria | 12128 |
| 748 | Ga0496103_0046934 | 3300048906 | Bacteria | 2667 |
| 749 | Ga0496103_0085359 | 3300048906 | Bacteria | 1989 |
| 750 | Ga0496104_0030236 | 3300048907 | Bacteria | 5031 |
| 751 | Ga0496104_0085241 | 3300048907 | Bacteria | 3015 |
| 752 | Ga0496104_0117423 | 3300048907 | Bacteria | 2553 |
| 753 | Ga0496104_0268271 | 3300048907 | Bacteria | 1619 |
| 754 | Ga0496104_0418916 | 3300048907 | Bacteria | 1251 |
| 755 | Ga0496105_0006723 | 3300048908 | Bacteria | 8847 |
| 756 | Ga0496105_0024359 | 3300048908 | Bacteria | 4917 |
| 757 | Ga0496105_0076184 | 3300048908 | Bacteria | 2770 |
| 758 | Ga0496105_0105427 | 3300048908 | Bacteria | 2327 |
| 759 | Ga0496105_0285912 | 3300048908 | Bacteria | 1328 |
| 760 | Ga0496106_0002365 | 3300048909 | Bacteria | 14037 |
| 761 | Ga0496106_0055589 | 3300048909 | Bacteria | 2992 |
| 762 | Ga0496106_0125083 | 3300048909 | Bacteria | 2012 |
| 763 | Ga0496106_0380996 | 3300048909 | Bacteria | 1133 |
| 764 | Ga0496106_0554407 | 3300048909 | Bacteria | 922 |
| 765 | Ga0496106_0781317 | 3300048909 | Bacteria | 758 |
| 766 | Ga0496107_0000576 | 3300048910 | Bacteria | 20475 |
| 767 | Ga0496107_0041102 | 3300048910 | Bacteria | 3320 |
| 768 | Ga0496107_0219699 | 3300048910 | Bacteria | 1413 |
| 769 | Ga0496107_1087170 | 3300048910 | Bacteria | 578 |
| 770 | Ga0496107_1222197 | 3300048910 | Bacteria | 540 |
| 771 | Ga0496108_0000504 | 3300048911 | Bacteria | 30868 |
| 772 | Ga0496108_0128242 | 3300048911 | Bacteria | 2179 |
| 773 | Ga0496108_0190235 | 3300048911 | Bacteria | 1779 |
| 774 | Ga0496108_0210112 | 3300048911 | Bacteria | 1689 |
| 775 | Ga0496108_0463329 | 3300048911 | Bacteria | 1107 |
| 776 | Ga0496108_0463874 | 3300048911 | Bacteria | 1107 |
| 777 | Ga0496108_0552459 | 3300048911 | Bacteria | 1004 |
| 778 | Ga0496108_0642840 | 3300048911 | Bacteria | 922 |
| 779 | Ga0496108_0742470 | 3300048911 | Bacteria | 849 |
| 780 | Ga0496109_0029002 | 3300048912 | Bacteria | 4953 |
| 781 | Ga0496109_0270646 | 3300048912 | Bacteria | 1600 |
| 782 | Ga0496109_0402278 | 3300048912 | Bacteria | 1293 |
| 783 | Ga0496109_0423470 | 3300048912 | Bacteria | 1258 |
| 784 | Ga0496109_0490369 | 3300048912 | Bacteria | 1160 |
| 785 | Ga0496109_0612163 | 3300048912 | Bacteria | 1025 |
| 786 | Ga0496109_0976989 | 3300048912 | Bacteria | 784 |
| 787 | Ga0496110_0086911 | 3300048913 | Bacteria | 2792 |
| 788 | Ga0496110_0215355 | 3300048913 | Bacteria | 1746 |
| 789 | Ga0496110_1615840 | 3300048913 | Bacteria | 558 |
| 790 | Ga0496111_0000431 | 3300048914 | Bacteria | 21230 |
| 791 | Ga0496111_0017497 | 3300048914 | Bacteria | 4956 |
| 792 | Ga0496111_0054250 | 3300048914 | Bacteria | 2897 |
| 793 | Ga0496111_0070323 | 3300048914 | Bacteria | 2545 |
| 794 | Ga0496111_0233649 | 3300048914 | Bacteria | 1365 |
| 795 | Ga0496111_0512989 | 3300048914 | Bacteria | 882 |
| 796 | Ga0496112_0005214 | 3300048915 | Bacteria | 11185 |
| 797 | Ga0496112_0007209 | 3300048915 | Bacteria | 9853 |
| 798 | Ga0496112_0120968 | 3300048915 | Bacteria | 2588 |
| 799 | Ga0496112_0267092 | 3300048915 | Bacteria | 1660 |
| 800 | Ga0496113_0000873 | 3300048916 | Bacteria | 15806 |
| 801 | Ga0496113_0282109 | 3300048916 | Bacteria | 1328 |
| 802 | Ga0496113_0797305 | 3300048916 | Bacteria | 750 |
| 803 | Ga0496114_0018554 | 3300048917 | Bacteria | 5627 |
| 804 | Ga0496114_0024253 | 3300048917 | Bacteria | 4949 |
| 805 | Ga0496114_0123933 | 3300048917 | Unclassified | 2225 |
| 806 | Ga0496114_0147399 | 3300048917 | Bacteria | 2041 |
| 807 | Ga0496114_0148786 | 3300048917 | Bacteria | 2031 |
| 808 | Ga0496114_0158188 | 3300048917 | Bacteria | 1968 |
| 809 | Ga0496115_0004906 | 3300048918 | Bacteria | 9711 |
| 810 | Ga0496115_0012001 | 3300048918 | Bacteria | 6511 |
| 811 | Ga0496115_0050872 | 3300048918 | Bacteria | 3321 |
| 812 | Ga0496115_0201534 | 3300048918 | Unclassified | 1644 |
| 813 | Ga0496126_1255975 | 3300048929 | Unclassified | 542 |
| 814 | Ga0501067_0257109 | 3300049583 | Bacteria | 972 |
| 815 | Ga0501069_0452593 | 3300049585 | Bacteria | 763 |
| 816 | nmdc:mga05p37_16060_c1 | 3300050507 | Bacteria | 9010 |
| 817 | nmdc:mga05p37_542127_c1 | 3300050507 | Bacteria | 1326 |
| 818 | nmdc:mga08y16_78757_c1 | 3300050511 | Bacteria | 3435 |
| 819 | nmdc:mga0n895_1967966_c1 | 3300050512 | Bacteria | 543 |
| 820 | nmdc:mga0n895_22503_c1 | 3300050512 | Bacteria | 5911 |
| 821 | nmdc:mga0n895_28839_c1 | 3300050512 | Bacteria | 5285 |
| 822 | nmdc:mga0n895_377725_c1 | 3300050512 | Bacteria | 1434 |
| 823 | nmdc:mga0n895_8474_c1 | 3300050512 | Bacteria | 8902 |
| 824 | nmdc:mga0n895_86365_c1 | 3300050512 | Bacteria | 3134 |
| 825 | nmdc:mga0rr50_223030_c1 | 3300050513 | Bacteria | 1557 |
| 826 | nmdc:mga0rr50_313401_c1 | 3300050513 | Bacteria | 1314 |
| 827 | nmdc:mga0rr50_318181_c1 | 3300050513 | Bacteria | 1304 |
| 828 | nmdc:mga0rr50_365699_c1 | 3300050513 | Unclassified | 1215 |
| 829 | nmdc:mga0rr50_40027_c1 | 3300050513 | Bacteria | 3405 |
| 830 | nmdc:mga0rr50_801_c1 | 3300050513 | Bacteria | 16963 |
| 831 | nmdc:mga08x19_123117_c1 | 3300050514 | Bacteria | 1740 |
| 832 | nmdc:mga08x19_20127_c1 | 3300050514 | Bacteria | 4107 |
| 833 | nmdc:mga08x19_388912_c1 | 3300050514 | Bacteria | 977 |
| 834 | nmdc:mga08x19_652214_c1 | 3300050514 | Unclassified | 747 |
| 835 | nmdc:mga08x19_85585_c1 | 3300050514 | Bacteria | 2075 |
| 836 | nmdc:mga08x19_948926_c1 | 3300050514 | Bacteria | 611 |
| 837 | nmdc:mga0a205_139810_c1 | 3300050515 | Bacteria | 2322 |
| 838 | nmdc:mga0a205_217219_c1 | 3300050515 | Bacteria | 1799 |
| 839 | nmdc:mga0a205_346791_c1 | 3300050515 | Bacteria | 1353 |
| 840 | Ga0495601_0037304 | 3300053077 | Bacteria | 3038 |
| 841 | Ga0495601_0051846 | 3300053077 | Bacteria | 2590 |
| 842 | Ga0495601_0073150 | 3300053077 | Unclassified | 2191 |
| 843 | Ga0495601_0096372 | 3300053077 | Unclassified | 1908 |
| 844 | Ga0495601_0143786 | 3300053077 | Bacteria | 1556 |
| 845 | Ga0495601_0477036 | 3300053077 | Unclassified | 806 |
| 846 | Ga0495612_0004948 | 3300053078 | Bacteria | 5514 |
| 847 | Ga0495612_0315939 | 3300053078 | Bacteria | 702 |
| 848 | Ga0495655_0101895 | 3300053083 | Bacteria | 851 |
| 849 | Ga0495595_0007539 | 3300053084 | Bacteria | 4456 |
| 850 | Ga0495595_0013829 | 3300053084 | Bacteria | 3415 |
| 851 | Ga0495595_0034344 | 3300053084 | Bacteria | 2293 |
| 852 | Ga0495595_0060976 | 3300053084 | Bacteria | 1766 |
| 853 | Ga0495595_0427637 | 3300053084 | Bacteria | 672 |
| 854 | Ga0495619_0001069 | 3300053085 | Bacteria | 17953 |
| 855 | Ga0495619_0006015 | 3300053085 | Bacteria | 7689 |
| 856 | Ga0495619_0108646 | 3300053085 | Bacteria | 1893 |
| 857 | Ga0495619_0199649 | 3300053085 | Bacteria | 1384 |
| 858 | Ga0495619_0266086 | 3300053085 | Bacteria | 1188 |
| 859 | Ga0495619_0378637 | 3300053085 | Bacteria | 978 |
| 860 | Ga0466962_0073235 | 3300061719 | Bacteria | 1637 |
| 861 | Ga0070716_100817837 | |||
| 862 | JGI24738J21930_10086276 | |||
| 863 | Ga0070658_10657861 | |||
| 864 | Ga0070676_10224296 | |||
| 865 | Ga0070683_100018795 | |||
| 866 | Ga0070683_100156979 | |||
| 867 | Ga0070683_100172648 | |||
| 868 | Ga0070690_100610760 | |||
| 869 | Ga0070670_101157953 | |||
| 870 | Ga0068869_100087932 | |||
| 871 | Ga0068869_100174447 | |||
| 872 | Ga0068869_101425073 | |||
| 873 | Ga0070666_10271472 | |||
| 874 | Ga0070680_100530014 | |||
| 875 | Ga0070682_100016266 | |||
| 876 | Ga0070682_100183482 | |||
| 877 | Ga0070682_100566959 | |||
| 878 | Ga0070682_101236719 | |||
| 879 | Ga0068868_100002586 | |||
| 880 | Ga0068868_100119092 | |||
| 881 | Ga0068868_101019959 | |||
| 882 | Ga0068868_101707547 | |||
| 883 | Ga0070660_100026588 | |||
| 884 | Ga0070660_101228160 | |||
| 885 | Ga0070691_10316057 | |||
| 886 | Ga0070687_100587599 | |||
| 887 | Ga0070687_101289589 | |||
| 888 | Ga0070661_100165915 | |||
| 889 | Ga0070692_10050908 | |||
| 890 | Ga0070671_100221479 | |||
| 891 | Ga0070671_100446260 | |||
| 892 | Ga0070671_102104447 | |||
| 893 | Ga0070673_100108132 | |||
| 894 | Ga0070688_101659577 | |||
| 895 | Ga0070659_100011184 | |||
| 896 | Ga0070659_100336523 | |||
| 897 | Ga0070659_100506418 | |||
| 898 | Ga0070667_100206433 | |||
| 899 | Ga0070703_10379099 | |||
| 900 | Ga0070709_10209005 | |||
| 901 | Ga0070709_10229906 | |||
| 902 | Ga0070709_10356207 | |||
| 903 | Ga0070709_10718330 | |||
| 904 | Ga0070714_100065816 | |||
| 905 | Ga0070714_100074431 | |||
| 906 | Ga0070714_100216986 | |||
| 907 | Ga0070714_100555530 | |||
| 908 | Ga0070713_100071744 | |||
| 909 | Ga0070713_100207009 | |||
| 910 | Ga0070713_100597223 | |||
| 911 | Ga0070713_100926324 | |||
| 912 | Ga0070710_10034196 | |||
| 913 | Ga0070710_10195077 | |||
| 914 | Ga0070710_10222100 | |||
| 915 | Ga0070710_10281248 | |||
| 916 | Ga0070710_10878960 | |||
| 917 | Ga0070710_11366826 | |||
| 918 | Ga0070710_11410719 | |||
| 919 | Ga0070701_10135789 | |||
| 920 | Ga0070701_10235330 | |||
| 921 | Ga0070711_100292426 | |||
| 922 | Ga0070711_100490435 | |||
| 923 | Ga0070711_100718028 | |||
| 924 | Ga0070705_100176929 | |||
| 925 | Ga0070694_100431887 | |||
| 926 | Ga0070694_101069531 | |||
| 927 | Ga0070708_100008382 | |||
| 928 | Ga0070708_100063351 | |||
| 929 | Ga0070708_100317354 | |||
| 930 | Ga0070663_100140293 | |||
| 931 | Ga0070663_100463937 | |||
| 932 | Ga0070663_101219577 | |||
| 933 | Ga0070663_101382515 | |||
| 934 | Ga0070678_100244519 | |||
| 935 | Ga0070678_101123257 | |||
| 936 | Ga0070662_100370480 | |||
| 937 | Ga0070662_100505967 | |||
| 938 | Ga0070662_100517068 | |||
| 939 | Ga0070681_10081404 | |||
| 940 | Ga0070681_10113376 | |||
| 941 | Ga0070681_10138489 | |||
| 942 | Ga0070681_10411150 | |||
| 943 | Ga0070681_10542078 | |||
| 944 | Ga0070681_10711007 | |||
| 945 | Ga0068867_101570444 | |||
| 946 | Ga0070685_10106140 | |||
| 947 | Ga0070706_100001286 | |||
| 948 | Ga0070706_100007825 | |||
| 949 | Ga0070706_100579750 | |||
| 950 | Ga0070706_100763374 | |||
| 951 | Ga0070707_100003579 | |||
| 952 | Ga0070707_100098156 | |||
| 953 | Ga0070707_100593788 | |||
| 954 | Ga0070707_102265320 | |||
| 955 | Ga0070698_100000708 | |||
| 956 | Ga0070698_100012678 | |||
| 957 | Ga0070699_100032606 | |||
| 958 | Ga0070699_100761178 | |||
| 959 | Ga0070699_101735310 | |||
| 960 | Ga0070699_102043795 | |||
| 961 | Ga0070679_100064495 | |||
| 962 | Ga0070679_100456207 | |||
| 963 | Ga0070684_100245303 | |||
| 964 | Ga0070684_100387394 | |||
| 965 | Ga0070684_101083132 | |||
| 966 | Ga0070684_101645649 | |||
| 967 | Ga0070697_100156043 | |||
| 968 | Ga0070697_100264214 | |||
| 969 | Ga0070672_100749502 | |||
| 970 | Ga0070672_100935241 | |||
| 971 | Ga0070672_101163035 | |||
| 972 | Ga0070686_100204825 | |||
| 973 | Ga0070686_101849252 | |||
| 974 | Ga0070695_100003301 | |||
| 975 | Ga0070695_100545171 | |||
| 976 | Ga0070696_100661072 | |||
| 977 | Ga0070696_101497488 | |||
| 978 | Ga0070693_100052191 | |||
| 979 | Ga0070704_101189689 | |||
| 980 | Ga0068855_100545117 | |||
| 981 | Ga0068855_101102324 | |||
| 982 | Ga0070664_101740452 | |||
| 983 | Ga0068854_100159129 | |||
| 984 | Ga0068854_100294949 | |||
| 985 | Ga0068856_100007194 | |||
| 986 | Ga0068856_100207945 | |||
| 987 | Ga0068856_100252304 | |||
| 988 | Ga0070702_100128761 | |||
| 989 | Ga0070702_100598829 | |||
| 990 | Ga0068852_100157871 | |||
| 991 | Ga0068852_100275696 | |||
| 992 | Ga0068852_100663025 | |||
| 993 | Ga0068852_100685412 | |||
| 994 | Ga0068859_100526513 | |||
| 995 | Ga0068864_100120012 | |||
| 996 | Ga0068851_10275166 | |||
| 997 | Ga0068870_10154772 | |||
| 998 | Ga0068863_100885665 | |||
| 999 | Ga0068858_100006881 | |||
| 1000 | Ga0068858_101610547 | |||
| 1001 | Ga0068860_100365280 | |||
| 1002 | Ga0068862_100904580 | |||
| 1003 | Ga0081455_10000145 | |||
| 1004 | Ga0081455_10011497 | |||
| 1005 | Ga0081540_1001295 | |||
| 1006 | Ga0081540_1182012 | |||
| 1007 | Ga0070717_10002692 | |||
| 1008 | Ga0070717_10015080 | |||
| 1009 | Ga0070717_10016256 | |||
| 1010 | Ga0070717_10176294 | |||
| 1011 | Ga0070717_10396373 | |||
| 1012 | Ga0070715_10178809 | |||
| 1013 | Ga0070715_11001783 | |||
| 1014 | Ga0070716_100010438 | |||
| 1015 | Ga0070716_100389398 | |||
| 1016 | Ga0070716_100660318 | |||
| 1017 | Ga0070712_100006790 | |||
| 1018 | Ga0070712_100187861 | |||
| 1019 | Ga0070712_100453876 | |||
| 1020 | Ga0097621_100327168 | |||
| 1021 | Ga0097621_100866705 | |||
| 1022 | Ga0068871_100319558 | |||
| 1023 | Ga0075433_10035948 | |||
| 1024 | Ga0075433_10320754 | |||
| 1025 | Ga0075433_10486888 | |||
| 1026 | Ga0075433_11144014 | |||
| 1027 | Ga0075434_100003275 | |||
| 1028 | Ga0075434_100096072 | |||
| 1029 | Ga0075434_100358461 | |||
| 1030 | Ga0075436_100175019 | |||
| 1031 | Ga0075436_100590630 | |||
| 1032 | Ga0075436_101279773 | |||
| 1033 | Ga0097620_100526432 | |||
| 1034 | Ga0075435_100001051 | |||
| 1035 | Ga0075435_100012800 | |||
| 1036 | Ga0075435_101767789 | |||
| 1037 | Ga0105251_10076228 | |||
| 1038 | Ga0105240_10104411 | |||
| 1039 | Ga0105240_10201017 | |||
| 1040 | Ga0105240_10616470 | |||
| 1041 | Ga0111539_10484233 | |||
| 1042 | Ga0111539_10545617 | |||
| 1043 | Ga0105245_10006987 | |||
| 1044 | Ga0105245_10010010 | |||
| 1045 | Ga0105245_10353620 | |||
| 1046 | Ga0105245_10361146 | |||
| 1047 | Ga0105245_10390295 | |||
| 1048 | Ga0105245_10438091 | |||
| 1049 | Ga0105245_10571091 | |||
| 1050 | Ga0105245_11506016 | |||
| 1051 | Ga0105247_10115306 | |||
| 1052 | Ga0105247_10329566 | |||
| 1053 | Ga0114129_10070147 | |||
| 1054 | Ga0114129_10361422 | |||
| 1055 | Ga0105243_10058922 | |||
| 1056 | Ga0105243_10092116 | |||
| 1057 | Ga0105243_10209765 | |||
| 1058 | Ga0105243_12715448 | |||
| 1059 | Ga0105241_10168043 | |||
| 1060 | Ga0105241_10638958 | |||
| 1061 | Ga0105241_12176839 | |||
| 1062 | Ga0105242_10245858 | |||
| 1063 | Ga0105242_10288727 | |||
| 1064 | Ga0105248_10215406 | |||
| 1065 | Ga0105248_10223091 | |||
| 1066 | Ga0105248_10259759 | |||
| 1067 | Ga0105248_12385743 | |||
| 1068 | Ga0105248_12480757 | |||
| 1069 | Ga0105237_10011266 | |||
| 1070 | Ga0105237_10032523 | |||
| 1071 | Ga0105237_10266799 | |||
| 1072 | Ga0105237_11368353 | |||
| 1073 | Ga0105237_11450575 | |||
| 1074 | Ga0105238_10012335 | |||
| 1075 | Ga0105238_10337797 | |||
| 1076 | Ga0105238_10428271 | |||
| 1077 | Ga0105238_11290256 | |||
| 1078 | Ga0105238_11987079 | |||
| 1079 | Ga0105238_12563881 | |||
| 1080 | Ga0105249_10241621 | |||
| 1081 | Ga0105249_10289554 | |||
| 1082 | Ga0105249_10686032 | |||
| 1083 | Ga0105249_13364313 | |||
| 1084 | Ga0105239_10134812 | |||
| 1085 | Ga0105239_10397514 | |||
| 1086 | Ga0105239_10918754 | |||
| 1087 | Ga0105239_11056673 | |||
| 1088 | Ga0105239_11346329 | |||
| 1089 | Ga0105239_12019287 | |||
| 1090 | Ga0105246_10015061 | |||
| 1091 | Ga0105246_10229911 | |||
| 1092 | Ga0105246_10431253 | |||
| 1093 | Ga0157336_1001942 | |||
| 1094 | Ga0157329_1021328 | |||
| 1095 | Ga0157339_1051189 | |||
| 1096 | Ga0157342_1004931 | |||
| 1097 | Ga0157373_10170630 | |||
| 1098 | Ga0157373_10852139 | |||
| 1099 | Ga0157371_10029530 | |||
| 1100 | Ga0157371_10974204 | |||
| 1101 | Ga0157370_10569853 | |||
| 1102 | Ga0157370_11028633 | |||
| 1103 | Ga0157370_11135323 | |||
| 1104 | Ga0157369_10234855 | |||
| 1105 | Ga0157369_10351309 | |||
| 1106 | Ga0157369_10794913 | |||
| 1107 | Ga0157369_10996465 | |||
| 1108 | Ga0157374_10010845 | |||
| 1109 | Ga0157374_10047741 | |||
| 1110 | Ga0157374_12876414 | |||
| 1111 | Ga0157378_10515440 | |||
| 1112 | Ga0157378_10667476 | |||
| 1113 | Ga0163162_10146691 | |||
| 1114 | Ga0163162_10184829 | |||
| 1115 | Ga0163162_10286856 | |||
| 1116 | Ga0163162_10313686 | |||
| 1117 | Ga0163162_10701792 | |||
| 1118 | Ga0163162_11374792 | |||
| 1119 | Ga0163162_11776452 | |||
| 1120 | Ga0157372_10012067 | |||
| 1121 | Ga0157372_10014787 | |||
| 1122 | Ga0157372_10143994 | |||
| 1123 | Ga0157372_10214220 | |||
| 1124 | Ga0157372_10363273 | |||
| 1125 | Ga0157372_10607346 | |||
| 1126 | Ga0157372_11457840 | |||
| 1127 | Ga0157372_11481981 | |||
| 1128 | Ga0157372_11658563 | |||
| 1129 | Ga0157372_12969373 | |||
| 1130 | Ga0157375_10057488 | |||
| 1131 | Ga0157375_10281850 | |||
| 1132 | Ga0157375_10424272 | |||
| 1133 | Ga0157375_10643849 | |||
| 1134 | Ga0157375_11077918 | |||
| 1135 | Ga0157375_11246758 | |||
| 1136 | Ga0157375_13776836 | |||
| 1137 | Ga0163163_10033673 | |||
| 1138 | Ga0163163_10120652 | |||
| 1139 | Ga0163163_10372930 | |||
| 1140 | Ga0163163_10436168 | |||
| 1141 | Ga0163163_10642249 | |||
| 1142 | Ga0157380_10252770 | |||
| 1143 | Ga0157377_10021661 | |||
| 1144 | Ga0157377_10035718 | |||
| 1145 | Ga0157377_10231336 | |||
| 1146 | Ga0157377_10758303 | |||
| 1147 | Ga0157377_11149401 | |||
| 1148 | Ga0157379_10025657 | |||
| 1149 | Ga0157379_10045059 | |||
| 1150 | Ga0157379_10336369 | |||
| 1151 | Ga0157379_11009806 | |||
| 1152 | Ga0157376_10004340 | |||
| 1153 | Ga0157376_10265451 | |||
| 1154 | Ga0157376_10865592 | |||
| 1155 | Ga0163161_10075486 | |||
| 1156 | Ga0163161_10643686 | |||
| 1157 | Ga0163161_11882688 | |||
| 1158 | Ga0206353_10179416 | |||
| 1159 | Ga0206353_11362772 | |||
| 1160 | Ga0206353_12070973 | |||
| 1161 | Ga0213873_10089231 | |||
| 1162 | Ga0207713_1086827 | |||
| 1163 | Ga0207653_10387942 | |||
| 1164 | Ga0207692_10041692 | |||
| 1165 | Ga0207692_10046554 | |||
| 1166 | Ga0207692_10131230 | |||
| 1167 | Ga0207692_10173129 | |||
| 1168 | Ga0207710_10260482 | |||
| 1169 | Ga0207710_10410689 | |||
| 1170 | Ga0207688_10002447 | |||
| 1171 | Ga0207685_10251572 | |||
| 1172 | Ga0207699_10007103 | |||
| 1173 | Ga0207699_10055321 | |||
| 1174 | Ga0207699_10389818 | |||
| 1175 | Ga0207699_10394489 | |||
| 1176 | Ga0207645_10311357 | |||
| 1177 | Ga0207645_11114332 | |||
| 1178 | Ga0207643_10085466 | |||
| 1179 | Ga0207684_10001357 | |||
| 1180 | Ga0207684_10001846 | |||
| 1181 | Ga0207684_10005848 | |||
| 1182 | Ga0207684_10161681 | |||
| 1183 | Ga0207684_10333281 | |||
| 1184 | Ga0207684_10461660 | |||
| 1185 | Ga0207654_10063300 | |||
| 1186 | Ga0207654_10637050 | |||
| 1187 | Ga0207707_10582047 | |||
| 1188 | Ga0207707_10674732 | |||
| 1189 | Ga0207707_10714627 | |||
| 1190 | Ga0207695_10106395 | |||
| 1191 | Ga0207695_10514165 | |||
| 1192 | Ga0207671_10099273 | |||
| 1193 | Ga0207671_10413053 | |||
| 1194 | Ga0207693_10011846 | |||
| 1195 | Ga0207693_10022242 | |||
| 1196 | Ga0207693_10096553 | |||
| 1197 | Ga0207663_10222824 | |||
| 1198 | Ga0207663_10247102 | |||
| 1199 | Ga0207663_10271787 | |||
| 1200 | Ga0207660_10392243 | |||
| 1201 | Ga0207657_10002845 | |||
| 1202 | Ga0207657_10015127 | |||
| 1203 | Ga0207649_10960638 | |||
| 1204 | Ga0207652_10497668 | |||
| 1205 | Ga0207646_10001416 | |||
| 1206 | Ga0207646_10008894 | |||
| 1207 | Ga0207646_10336328 | |||
| 1208 | Ga0207646_10538526 | |||
| 1209 | Ga0207646_11296703 | |||
| 1210 | Ga0207681_10565652 | |||
| 1211 | Ga0207694_10016140 | |||
| 1212 | Ga0207694_10401588 | |||
| 1213 | Ga0207650_11764712 | |||
| 1214 | Ga0207659_10434871 | |||
| 1215 | Ga0207687_10000711 | |||
| 1216 | Ga0207687_10181347 | |||
| 1217 | Ga0207700_10106229 | |||
| 1218 | Ga0207700_10124301 | |||
| 1219 | Ga0207700_10172703 | |||
| 1220 | Ga0207700_10206201 | |||
| 1221 | Ga0207700_10298111 | |||
| 1222 | Ga0207700_10558853 | |||
| 1223 | Ga0207664_10010860 | |||
| 1224 | Ga0207664_10013341 | |||
| 1225 | Ga0207664_10037551 | |||
| 1226 | Ga0207664_10065779 | |||
| 1227 | Ga0207664_10172047 | |||
| 1228 | Ga0207664_10214135 | |||
| 1229 | Ga0207664_10496796 | |||
| 1230 | Ga0207644_10213145 | |||
| 1231 | Ga0207690_10287705 | |||
| 1232 | Ga0207690_10354643 | |||
| 1233 | Ga0207706_10450943 | |||
| 1234 | Ga0207706_10970610 | |||
| 1235 | Ga0207686_10040376 | |||
| 1236 | Ga0207709_10020394 | |||
| 1237 | Ga0207709_10124021 | |||
| 1238 | Ga0207709_10458377 | |||
| 1239 | Ga0207670_11526919 | |||
| 1240 | Ga0207704_11496572 | |||
| 1241 | Ga0207665_10030553 | |||
| 1242 | Ga0207665_10074146 | |||
| 1243 | Ga0207691_10634707 | |||
| 1244 | Ga0207691_11300047 | |||
| 1245 | Ga0207691_11729841 | |||
| 1246 | Ga0207711_10351808 | |||
| 1247 | Ga0207711_10418379 | |||
| 1248 | Ga0207711_10514303 | |||
| 1249 | Ga0207711_11607444 | |||
| 1250 | Ga0207689_10045020 | |||
| 1251 | Ga0207689_10306282 | |||
| 1252 | Ga0207661_10400137 | |||
| 1253 | Ga0207661_10477361 | |||
| 1254 | Ga0207661_10509172 | |||
| 1255 | Ga0207661_10919663 | |||
| 1256 | Ga0207667_10017784 | |||
| 1257 | Ga0207667_10855683 | |||
| 1258 | Ga0207667_10911036 | |||
| 1259 | Ga0207651_10112116 | |||
| 1260 | Ga0207712_10080504 | |||
| 1261 | Ga0207712_10166169 | |||
| 1262 | Ga0207668_10104245 | |||
| 1263 | Ga0207668_10619818 | |||
| 1264 | Ga0207640_10111678 | |||
| 1265 | Ga0207640_10682247 | |||
| 1266 | Ga0207640_11821814 | |||
| 1267 | Ga0207658_10528293 | |||
| 1268 | Ga0207658_11533783 | |||
| 1269 | Ga0207677_10437402 | |||
| 1270 | Ga0207703_10024083 | |||
| 1271 | Ga0207703_10340079 | |||
| 1272 | Ga0207639_10305924 | |||
| 1273 | Ga0207639_10544007 | |||
| 1274 | Ga0207639_11336484 | |||
| 1275 | Ga0207678_10227655 | |||
| 1276 | Ga0207678_11331955 | |||
| 1277 | Ga0207708_11340404 | |||
| 1278 | Ga0207702_10016249 | |||
| 1279 | Ga0207702_11087727 | |||
| 1280 | Ga0207702_12502408 | |||
| 1281 | Ga0207648_10293209 | |||
| 1282 | Ga0207648_11015645 | |||
| 1283 | Ga0207676_11608569 | |||
| 1284 | Ga0207676_12107176 | |||
| 1285 | Ga0207674_10505324 | |||
| 1286 | Ga0207675_100177172 | |||
| 1287 | Ga0207675_100562643 | |||
| 1288 | Ga0207683_10056092 | |||
| 1289 | Ga0207698_10444210 | |||
| 1290 | Ga0207698_10547262 | |||
| 1291 | Ga0207698_10896162 | |||
| 1292 | Ga0207698_12377291 | |||
| 1293 | Ga0268266_10827460 | |||
| 1294 | Ga0268264_10622401 | |||
| 1295 | Ga0268264_10630310 | |||
| 1296 | Ga0265760_10053399 | |||
| 1297 | Ga0373948_0044226 | |||
| 1298 | Ga0373950_0044001 | |||
| 1299 | Ga0373958_0042643 | |||
| 1300 | Ga0373926_0000190 | |||
| 1301 | Ga0373926_0145794 | |||
| 1302 | Ga0373929_0043193 | |||
| 1303 | Ga0373934_0051168 | |||
| 1304 | Ga0373940_0020119 | |||
| 1305 | Ga0373940_0360418 | |||
| 1306 | Ga0373944_0002379 | |||
| 1307 | Ga0373944_0080483 | |||
| 1308 | Ga0373944_0371059 | |||
| 1309 | Ga0373949_0177313 | |||
| 1310 | Ga0373923_0000224 | |||
| 1311 | Ga0373923_0013512 | |||
| 1312 | Ga0373932_0012798 | |||
| 1313 | Ga0373936_0000374 | |||
| 1314 | Ga0373936_0221840 | |||
| 1315 | Ga0373936_0305750 | |||
| 1316 | Ga0373939_0029486 | |||
| 1317 | Ga0373941_0050243 | |||
| 1318 | Ga0373945_0001007 | |||
| 1319 | Ga0373953_0000462 | |||
| 1320 | Ga0373953_0023598 | |||
| 1321 | Ga0373953_0110289 | |||
| 1322 | Ga0373954_0000725 | |||
| 1323 | Ga0373954_0084506 | |||
| 1324 | Ga0373956_0002808 | |||
| 1325 | Ga0373956_0040506 | |||
| 1326 | Ga0373956_0198054 | |||
| 1327 | Ga0373956_0520965 | |||
| 1328 | Ga0373957_0001454 | |||
| 1329 | Ga0373957_0011975 | |||
| 1330 | Ga0373957_0018411 | |||
| 1331 | Ga0373943_0000279 | |||
| 1332 | Ga0373943_0099749 | |||
| 1333 | Ga0373943_0283431 | |||
| 1334 | Ga0373946_0079946 | |||
| 1335 | Ga0373946_0122265 | |||
| 1336 | Ga0373946_0189714 | |||
| 1337 | Ga0373946_0555499 | |||
| 1338 | Ga0373955_0001286 | |||
| 1339 | Ga0373955_0009059 | |||
| 1340 | Ga0373955_0495627 | |||
| 1341 | Ga0373942_0123107 | |||
| 1342 | Ga0373942_0308578 | |||
| 1343 | Ga0373962_0086958 | |||
| 1344 | Ga0373924_0003085 | |||
| 1345 | Ga0373924_0026213 | |||
| 1346 | Ga0373924_0148613 | |||
| 1347 | Ga0373924_0211646 | |||
| 1348 | Ga0373931_0157991 | |||
| 1349 | Ga0373931_0300691 | |||
| 1350 | Ga0373931_0681103 | |||
| 1351 | Ga0373931_1127581 | |||
| 1352 | Ga0373935_0006058 | |||
| 1353 | Ga0373935_0681089 | |||
| 1354 | Ga0373927_0000787 | |||
| 1355 | Ga0373927_0295056 | |||
| 1356 | Ga0373927_0353577 | |||
| 1357 | Ga0373927_0558596 | |||
| 1358 | Ga0373927_1015007 | |||
| 1359 | Ga0373933_0004280 | |||
| 1360 | Ga0373933_0063472 | |||
| 1361 | Ga0373933_0407276 | |||
| 1362 | Ga0373933_0520669 | |||
| 1363 | Ga0373947_0092837 | |||
| 1364 | Ga0373947_0189775 | |||
| 1365 | Ga0373947_0661736 | |||
| 1366 | Ga0373937_0022313 | |||
| 1367 | Ga0373937_0482459 | |||
| 1368 | Ga0373937_0484791 | |||
| 1369 | Ga0373937_0923840 | |||
| 1370 | Ga0373937_0943851 | |||
| 1371 | Ga0372808_018662 | |||
| 1372 | Ga0373925_0017114 | |||
| 1373 | Ga0373925_0081826 | |||
| 1374 | Ga0373925_0137590 | |||
| 1375 | Ga0373925_0161454 | |||
| 1376 | Ga0373925_0380331 | |||
| 1377 | Ga0373925_0600476 | |||
| 1378 | Ga0373925_0908376 | |||
| 1379 | Ga0395898_0415826 | |||
| 1380 | Ga0436364_0702615 | |||
| 1381 | Ga0395901_0334182 | |||
| 1382 | Ga0242420_137572 | |||
| 1383 | Ga0436361_1023671 | |||
| 1384 | Ga0436363_1362369 | |||
| 1385 | Ga0436362_0119803 | |||
| 1386 | Ga0436362_0459129 | |||
| 1387 | Ga0436362_0574285 | |||
| 1388 | Ga0451833_0364065 | |||
| 1389 | Ga0451839_0127947 | |||
| 1390 | Ga0451843_0322056 | |||
| 1391 | Ga0451853_1391916 | |||
| 1392 | Ga0451853_2994508 | |||
| 1393 | Ga0451853_3831011 | |||
| 1394 | Ga0450888_012043 | |||
| 1395 | Ga0439435_0308826 | |||
| 1396 | Ga0466961_0519733 | |||
| 1397 | Ga0466963_0143853 | |||
| 1398 | Ga0466963_0152475 | |||
| 1399 | Ga0466963_0709867 | |||
| 1400 | Ga0466964_0016818 | |||
| 1401 | Ga0466964_0044528 | |||
| 1402 | Ga0466964_0068139 | |||
| 1403 | Ga0466964_0834515 | |||
| 1404 | Ga0466957_0986798 | |||
| 1405 | Ga0466960_1028914 | |||
| 1406 | Ga0466960_1054432 | |||
| 1407 | Ga0466958_0706889 | |||
| 1408 | Ga0466967_0184373 | |||
| 1409 | Ga0466967_0360482 | |||
| 1410 | Ga0466967_1100981 | |||
| 1411 | Ga0466967_1771226 | |||
| 1412 | Ga0466967_2237718 | |||
| 1413 | Ga0495592_0015135 | |||
| 1414 | Ga0495592_0019409 | |||
| 1415 | Ga0495592_0130471 | |||
| 1416 | Ga0495592_0154108 | |||
| 1417 | Ga0495592_0239594 | |||
| 1418 | Ga0495603_0012040 | |||
| 1419 | Ga0495603_0056113 | |||
| 1420 | Ga0495603_0095684 | |||
| 1421 | Ga0495603_0330615 | |||
| 1422 | Ga0495629_0000229 | |||
| 1423 | Ga0495629_0002198 | |||
| 1424 | Ga0495629_0008917 | |||
| 1425 | Ga0495629_0068145 | |||
| 1426 | Ga0495641_0001628 | |||
| 1427 | Ga0495641_0006898 | |||
| 1428 | Ga0495641_0035629 | |||
| 1429 | Ga0495641_0182371 | |||
| 1430 | Ga0495651_0017178 | |||
| 1431 | Ga0495651_0110380 | |||
| 1432 | Ga0495651_0131833 | |||
| 1433 | Ga0495651_0153770 | |||
| 1434 | Ga0495653_0030039 | |||
| 1435 | Ga0495653_0036742 | |||
| 1436 | Ga0495653_0044255 | |||
| 1437 | Ga0495653_0151853 | |||
| 1438 | Ga0495653_0159666 | |||
| 1439 | Ga0495653_0259276 | |||
| 1440 | Ga0495653_0869343 | |||
| 1441 | Ga0495580_0013431 | |||
| 1442 | Ga0495580_0148774 | |||
| 1443 | Ga0495582_0012920 | |||
| 1444 | Ga0495582_0034326 | |||
| 1445 | Ga0495582_0132191 | |||
| 1446 | Ga0495582_0165727 | |||
| 1447 | Ga0495639_0000347 | |||
| 1448 | Ga0495639_0024477 | |||
| 1449 | Ga0495639_0091716 | |||
| 1450 | Ga0495662_0000350 | |||
| 1451 | Ga0495662_0104758 | |||
| 1452 | Ga0495664_0002744 | |||
| 1453 | Ga0495664_0044436 | |||
| 1454 | Ga0495664_0066909 | |||
| 1455 | Ga0495664_0075452 | |||
| 1456 | Ga0495664_0139670 | |||
| 1457 | Ga0495664_0257457 | |||
| 1458 | Ga0495594_0060355 | |||
| 1459 | Ga0495594_0264797 | |||
| 1460 | Ga0495594_0554705 | |||
| 1461 | Ga0495608_0020627 | |||
| 1462 | Ga0495608_0043080 | |||
| 1463 | Ga0495608_0133857 | |||
| 1464 | Ga0495618_0008326 | |||
| 1465 | Ga0495618_0014658 | |||
| 1466 | Ga0495618_0018376 | |||
| 1467 | Ga0495618_0165652 | |||
| 1468 | Ga0495618_0187279 | |||
| 1469 | Ga0495618_0520112 | |||
| 1470 | Ga0495628_0013693 | |||
| 1471 | Ga0495628_0039965 | |||
| 1472 | Ga0495628_0052026 | |||
| 1473 | Ga0495628_0334794 | |||
| 1474 | Ga0495628_0375102 | |||
| 1475 | Ga0495630_0008052 | |||
| 1476 | Ga0495630_0009109 | |||
| 1477 | Ga0495630_0082589 | |||
| 1478 | Ga0495630_0088749 | |||
| 1479 | Ga0495666_0004835 | |||
| 1480 | Ga0495666_0033541 | |||
| 1481 | Ga0495652_0001732 | |||
| 1482 | Ga0495652_0004765 | |||
| 1483 | Ga0495652_0042415 | |||
| 1484 | Ga0495652_0627846 | |||
| 1485 | Ga0495665_0001140 | |||
| 1486 | Ga0495665_0005038 | |||
| 1487 | Ga0495665_0219484 | |||
| 1488 | Ga0495640_0005487 | |||
| 1489 | Ga0495640_0008952 | |||
| 1490 | Ga0495640_0009794 | |||
| 1491 | Ga0495640_0015987 | |||
| 1492 | Ga0495640_0040345 | |||
| 1493 | Ga0495586_0009551 | |||
| 1494 | Ga0495586_0014453 | |||
| 1495 | Ga0495586_0018702 | |||
| 1496 | Ga0495587_0009033 | |||
| 1497 | Ga0495587_0021344 | |||
| 1498 | Ga0495587_0024241 | |||
| 1499 | Ga0495587_0143090 | |||
| 1500 | Ga0495645_0027300 | |||
| 1501 | Ga0495645_0130456 | |||
| 1502 | Ga0495645_0295319 | |||
| 1503 | Ga0495645_0421133 | |||
| 1504 | Ga0495622_0262686 | |||
| 1505 | Ga0495667_0019524 | |||
| 1506 | Ga0495667_0055864 | |||
| 1507 | Ga0495667_0355325 | |||
| 1508 | Ga0495667_0441659 | |||
| 1509 | Ga0495634_0002674 | |||
| 1510 | Ga0495634_0044123 | |||
| 1511 | Ga0495634_0048975 | |||
| 1512 | Ga0495634_0550053 | |||
| 1513 | Ga0495635_0013700 | |||
| 1514 | Ga0495635_0032547 | |||
| 1515 | Ga0495635_0048739 | |||
| 1516 | Ga0495635_0096684 | |||
| 1517 | Ga0495588_0208433 | |||
| 1518 | Ga0495657_0075227 | |||
| 1519 | Ga0495657_0185580 | |||
| 1520 | Ga0495657_0309630 | |||
| 1521 | Ga0495657_0884170 | |||
| 1522 | Ga0495599_0002017 | |||
| 1523 | Ga0495599_0007619 | |||
| 1524 | Ga0495599_0036598 | |||
| 1525 | Ga0495599_0074739 | |||
| 1526 | Ga0495599_0228177 | |||
| 1527 | Ga0495623_0002796 | |||
| 1528 | Ga0495623_0048263 | |||
| 1529 | Ga0495623_0134372 | |||
| 1530 | Ga0495646_0000774 | |||
| 1531 | Ga0495646_0024467 | |||
| 1532 | Ga0495647_0020669 | |||
| 1533 | Ga0495647_0141082 | |||
| 1534 | Ga0495658_0039400 | |||
| 1535 | Ga0495658_0070987 | |||
| 1536 | Ga0495658_0330906 | |||
| 1537 | Ga0495613_0033416 | |||
| 1538 | Ga0495613_0054307 | |||
| 1539 | Ga0495613_0080210 | |||
| 1540 | Ga0495624_0017598 | |||
| 1541 | Ga0495624_0115502 | |||
| 1542 | Ga0495624_0214171 | |||
| 1543 | Ga0495600_0001143 | |||
| 1544 | Ga0495600_0062315 | |||
| 1545 | Ga0495600_0386816 | |||
| 1546 | Ga0495600_0599621 | |||
| 1547 | Ga0495581_0007390 | |||
| 1548 | Ga0495581_0091224 | |||
| 1549 | Ga0495581_0401148 | |||
| 1550 | Ga0495581_0570005 | |||
| 1551 | Ga0495604_0003357 | |||
| 1552 | Ga0495604_0061852 | |||
| 1553 | Ga0495604_0118552 | |||
| 1554 | Ga0495674_0001819 | |||
| 1555 | Ga0495674_0004281 | |||
| 1556 | Ga0495674_0008850 | |||
| 1557 | Ga0495674_0014580 | |||
| 1558 | Ga0495674_0021848 | |||
| 1559 | Ga0495674_0060755 | |||
| 1560 | Ga0495674_0414121 | |||
| 1561 | Ga0495676_0026905 | |||
| 1562 | Ga0495676_0079281 | |||
| 1563 | Ga0495676_0323700 | |||
| 1564 | Ga0495676_0748381 | |||
| 1565 | Ga0495676_0802143 | |||
| 1566 | Ga0495676_0948041 | |||
| 1567 | Ga0495680_0003483 | |||
| 1568 | Ga0495680_0004400 | |||
| 1569 | Ga0495680_0025738 | |||
| 1570 | Ga0495680_0244425 | |||
| 1571 | Ga0495675_0002634 | |||
| 1572 | Ga0495675_0007699 | |||
| 1573 | Ga0495684_0002597 | |||
| 1574 | Ga0495684_0004492 | |||
| 1575 | Ga0495684_0004498 | |||
| 1576 | Ga0495684_0100883 | |||
| 1577 | Ga0495684_0235469 | |||
| 1578 | Ga0495684_0530892 | |||
| 1579 | Ga0495593_0002363 | |||
| 1580 | Ga0495593_0005458 | |||
| 1581 | Ga0495593_0086972 | |||
| 1582 | Ga0495593_0397531 | |||
| 1583 | Ga0495602_0009228 | |||
| 1584 | Ga0495602_0044146 | |||
| 1585 | Ga0495602_0125276 | |||
| 1586 | Ga0495602_0334578 | |||
| 1587 | Ga0495602_0372009 | |||
| 1588 | Ga0495614_0008901 | |||
| 1589 | Ga0495614_0017954 | |||
| 1590 | Ga0495614_0025484 | |||
| 1591 | Ga0496100_0016808 | |||
| 1592 | Ga0496100_0216584 | |||
| 1593 | Ga0496100_0651445 | |||
| 1594 | Ga0496100_0988605 | |||
| 1595 | Ga0496100_1031401 | |||
| 1596 | Ga0496101_0001184 | |||
| 1597 | Ga0496101_0039357 | |||
| 1598 | Ga0496101_0140636 | |||
| 1599 | Ga0496101_0565873 | |||
| 1600 | Ga0496101_0895748 | |||
| 1601 | Ga0496101_0940303 | |||
| 1602 | Ga0496102_0001014 | |||
| 1603 | Ga0496102_0041753 | |||
| 1604 | Ga0496102_0091832 | |||
| 1605 | Ga0496102_0231283 | |||
| 1606 | Ga0496102_0318193 | |||
| 1607 | Ga0496103_0002279 | |||
| 1608 | Ga0496103_0046934 | |||
| 1609 | Ga0496103_0085359 | |||
| 1610 | Ga0496104_0030236 | |||
| 1611 | Ga0496104_0085241 | |||
| 1612 | Ga0496104_0117423 | |||
| 1613 | Ga0496104_0268271 | |||
| 1614 | Ga0496104_0418916 | |||
| 1615 | Ga0496105_0006723 | |||
| 1616 | Ga0496105_0024359 | |||
| 1617 | Ga0496105_0076184 | |||
| 1618 | Ga0496105_0105427 | |||
| 1619 | Ga0496105_0285912 | |||
| 1620 | Ga0496106_0002365 | |||
| 1621 | Ga0496106_0055589 | |||
| 1622 | Ga0496106_0125083 | |||
| 1623 | Ga0496106_0380996 | |||
| 1624 | Ga0496106_0554407 | |||
| 1625 | Ga0496106_0781317 | |||
| 1626 | Ga0496107_0000576 | |||
| 1627 | Ga0496107_0041102 | |||
| 1628 | Ga0496107_0219699 | |||
| 1629 | Ga0496107_1087170 | |||
| 1630 | Ga0496107_1222197 | |||
| 1631 | Ga0496108_0000504 | |||
| 1632 | Ga0496108_0128242 | |||
| 1633 | Ga0496108_0190235 | |||
| 1634 | Ga0496108_0210112 | |||
| 1635 | Ga0496108_0463329 | |||
| 1636 | Ga0496108_0463874 | |||
| 1637 | Ga0496108_0552459 | |||
| 1638 | Ga0496108_0642840 | |||
| 1639 | Ga0496108_0742470 | |||
| 1640 | Ga0496109_0029002 | |||
| 1641 | Ga0496109_0270646 | |||
| 1642 | Ga0496109_0402278 | |||
| 1643 | Ga0496109_0423470 | |||
| 1644 | Ga0496109_0490369 | |||
| 1645 | Ga0496109_0612163 | |||
| 1646 | Ga0496109_0976989 | |||
| 1647 | Ga0496110_0086911 | |||
| 1648 | Ga0496110_0215355 | |||
| 1649 | Ga0496110_1615840 | |||
| 1650 | Ga0496111_0000431 | |||
| 1651 | Ga0496111_0017497 | |||
| 1652 | Ga0496111_0054250 | |||
| 1653 | Ga0496111_0070323 | |||
| 1654 | Ga0496111_0233649 | |||
| 1655 | Ga0496111_0512989 | |||
| 1656 | Ga0496112_0005214 | |||
| 1657 | Ga0496112_0007209 | |||
| 1658 | Ga0496112_0120968 | |||
| 1659 | Ga0496112_0267092 | |||
| 1660 | Ga0496113_0000873 | |||
| 1661 | Ga0496113_0282109 | |||
| 1662 | Ga0496113_0797305 | |||
| 1663 | Ga0496114_0018554 | |||
| 1664 | Ga0496114_0024253 | |||
| 1665 | Ga0496114_0123933 | |||
| 1666 | Ga0496114_0147399 | |||
| 1667 | Ga0496114_0148786 | |||
| 1668 | Ga0496114_0158188 | |||
| 1669 | Ga0496115_0004906 | |||
| 1670 | Ga0496115_0012001 | |||
| 1671 | Ga0496115_0050872 | |||
| 1672 | Ga0496115_0201534 | |||
| 1673 | Ga0496126_1255975 | |||
| 1674 | Ga0501067_0257109 | |||
| 1675 | Ga0501069_0452593 | |||
| 1676 | nmdc:mga05p37_16060_c1 | |||
| 1677 | nmdc:mga05p37_542127_c1 | |||
| 1678 | nmdc:mga08y16_78757_c1 | |||
| 1679 | nmdc:mga0n895_1967966_c1 | |||
| 1680 | nmdc:mga0n895_22503_c1 | |||
| 1681 | nmdc:mga0n895_28839_c1 | |||
| 1682 | nmdc:mga0n895_377725_c1 | |||
| 1683 | nmdc:mga0n895_8474_c1 | |||
| 1684 | nmdc:mga0n895_86365_c1 | |||
| 1685 | nmdc:mga0rr50_223030_c1 | |||
| 1686 | nmdc:mga0rr50_313401_c1 | |||
| 1687 | nmdc:mga0rr50_318181_c1 | |||
| 1688 | nmdc:mga0rr50_365699_c1 | |||
| 1689 | nmdc:mga0rr50_40027_c1 | |||
| 1690 | nmdc:mga0rr50_801_c1 | |||
| 1691 | nmdc:mga08x19_123117_c1 | |||
| 1692 | nmdc:mga08x19_20127_c1 | |||
| 1693 | nmdc:mga08x19_388912_c1 | |||
| 1694 | nmdc:mga08x19_652214_c1 | |||
| 1695 | nmdc:mga08x19_85585_c1 | |||
| 1696 | nmdc:mga08x19_948926_c1 | |||
| 1697 | nmdc:mga0a205_139810_c1 | |||
| 1698 | nmdc:mga0a205_217219_c1 | |||
| 1699 | nmdc:mga0a205_346791_c1 | |||
| 1700 | Ga0495601_0037304 | |||
| 1701 | Ga0495601_0051846 | |||
| 1702 | Ga0495601_0073150 | |||
| 1703 | Ga0495601_0096372 | |||
| 1704 | Ga0495601_0143786 | |||
| 1705 | Ga0495601_0477036 | |||
| 1706 | Ga0495612_0004948 | |||
| 1707 | Ga0495612_0315939 | |||
| 1708 | Ga0495655_0101895 | |||
| 1709 | Ga0495595_0007539 | |||
| 1710 | Ga0495595_0013829 | |||
| 1711 | Ga0495595_0034344 | |||
| 1712 | Ga0495595_0060976 | |||
| 1713 | Ga0495595_0427637 | |||
| 1714 | Ga0495619_0001069 | |||
| 1715 | Ga0495619_0006015 | |||
| 1716 | Ga0495619_0108646 | |||
| 1717 | Ga0495619_0199649 | |||
| 1718 | Ga0495619_0266086 | |||
| 1719 | Ga0495619_0378637 | |||
| 1720 | Ga0466962_0073235 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9434 | 2 | 73 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.8929 | 2 | 87 |
| 3f6o-assembly1.cif.gz_A | crystal structure of arsr family transcriptional regulator, rha00566 | 0.8888 | 2 | 87 |
| 6j0e-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.8864 | 4 | 79 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.8844 | 4 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9219 | 2 | 80 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9064 | 2 | 79 | 1.10.10.10 |
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9057 | 2 | 79 | 1.10.10.10 |
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8929 | 2 | 87 | 1.10.10.10 |
| af_P91529_82_146_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8889 | 10 | 67 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A367B945-F1-model_v4 | ArsR family transcriptional regulator | 0.9665 | 3 | 102 |
GO:0003700
|
| AF-A0A7K0CVW1-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9643 | 2 | 97 |
GO:0003700
|
| AF-A0A0F0LQT0-F1-model_v4 | Transcriptional repressor SdpR | 0.9614 | 2 | 104 |
GO:0003700
|
| AF-A0A533VK57-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9583 | 1 | 102 |
GO:0003700
|
| AF-A0A1W9Y3J5-F1-model_v4 | deleted | 0.9578 | 2 | 99 |
|