F483805

General Info

Members Datasets Scaffolds Average Seq Length
860 305 1720 108

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100817837|Ga0070716_1008178372
Length 131
Sequence VIPGPVDAVCTLTVTEPTWYIRDMEAVLRALADDSRRKMLEALTGGPATAGDLAALLPIARPGVSRHLRVLRETGLVEVRQEAQRRVYSLRAEPLAEVDEWLGRYRALWQQRLDALHTEVARGKRERRGTT

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
94 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
95 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
96 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.53
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 5.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100817837 3300006173 Bacteria 723
2 JGI24738J21930_10086276 3300002075 Bacteria 660
3 Ga0070658_10657861 3300005327 Bacteria 909
4 Ga0070676_10224296 3300005328 Bacteria 1243
5 Ga0070683_100018795 3300005329 Bacteria 6128
6 Ga0070683_100156979 3300005329 Bacteria 2158
7 Ga0070683_100172648 3300005329 Unclassified 2052
8 Ga0070690_100610760 3300005330 Bacteria 829
9 Ga0070670_101157953 3300005331 Bacteria 706
10 Ga0068869_100087932 3300005334 Bacteria 2331
11 Ga0068869_100174447 3300005334 Bacteria 1681
12 Ga0068869_101425073 3300005334 Bacteria 614
13 Ga0070666_10271472 3300005335 Bacteria 1204
14 Ga0070680_100530014 3300005336 Bacteria 1009
15 Ga0070682_100016266 3300005337 Bacteria 4323
16 Ga0070682_100183482 3300005337 Bacteria 1463
17 Ga0070682_100566959 3300005337 Unclassified 891
18 Ga0070682_101236719 3300005337 Unclassified 632
19 Ga0068868_100002586 3300005338 Bacteria 12547
20 Ga0068868_100119092 3300005338 Bacteria 2152
21 Ga0068868_101019959 3300005338 Bacteria 758
22 Ga0068868_101707547 3300005338 Bacteria 593
23 Ga0070660_100026588 3300005339 Bacteria 4310
24 Ga0070660_101228160 3300005339 Bacteria 636
25 Ga0070691_10316057 3300005341 Bacteria 857
26 Ga0070687_100587599 3300005343 Bacteria 763
27 Ga0070687_101289589 3300005343 Bacteria 542
28 Ga0070661_100165915 3300005344 Bacteria 1675
29 Ga0070692_10050908 3300005345 Bacteria 2152
30 Ga0070671_100221479 3300005355 Bacteria 1605
31 Ga0070671_100446260 3300005355 Bacteria 1110
32 Ga0070671_102104447 3300005355 Bacteria 503
33 Ga0070673_100108132 3300005364 Bacteria 2302
34 Ga0070688_101659577 3300005365 Bacteria 523
35 Ga0070659_100011184 3300005366 Bacteria 6631
36 Ga0070659_100336523 3300005366 Bacteria 1264
37 Ga0070659_100506418 3300005366 Bacteria 1029
38 Ga0070667_100206433 3300005367 Bacteria 1745
39 Ga0070703_10379099 3300005406 Bacteria 611
40 Ga0070709_10209005 3300005434 Bacteria 1386
41 Ga0070709_10229906 3300005434 Bacteria 1326
42 Ga0070709_10356207 3300005434 Bacteria 1082
43 Ga0070709_10718330 3300005434 Bacteria 779
44 Ga0070714_100065816 3300005435 Bacteria 3122
45 Ga0070714_100074431 3300005435 Bacteria 2944
46 Ga0070714_100216986 3300005435 Bacteria 1756
47 Ga0070714_100555530 3300005435 Bacteria 1099
48 Ga0070713_100071744 3300005436 Bacteria 2927
49 Ga0070713_100207009 3300005436 Bacteria 1774
50 Ga0070713_100597223 3300005436 Bacteria 1048
51 Ga0070713_100926324 3300005436 Bacteria 839
52 Ga0070710_10034196 3300005437 Bacteria 2764
53 Ga0070710_10195077 3300005437 Bacteria 1275
54 Ga0070710_10222100 3300005437 Bacteria 1202
55 Ga0070710_10281248 3300005437 Bacteria 1080
56 Ga0070710_10878960 3300005437 Bacteria 645
57 Ga0070710_11366826 3300005437 Bacteria 528
58 Ga0070710_11410719 3300005437 Bacteria 521
59 Ga0070701_10135789 3300005438 Bacteria 1402
60 Ga0070701_10235330 3300005438 Bacteria 1099
61 Ga0070711_100292426 3300005439 Bacteria 1292
62 Ga0070711_100490435 3300005439 Bacteria 1011
63 Ga0070711_100718028 3300005439 Bacteria 842
64 Ga0070705_100176929 3300005440 Bacteria 1442
65 Ga0070694_100431887 3300005444 Bacteria 1037
66 Ga0070694_101069531 3300005444 Bacteria 672
67 Ga0070708_100008382 3300005445 Bacteria 8300
68 Ga0070708_100063351 3300005445 Bacteria 3310
69 Ga0070708_100317354 3300005445 Unclassified 1468
70 Ga0070663_100140293 3300005455 Bacteria 1844
71 Ga0070663_100463937 3300005455 Bacteria 1046
72 Ga0070663_101219577 3300005455 Unclassified 662
73 Ga0070663_101382515 3300005455 Bacteria 623
74 Ga0070678_100244519 3300005456 Bacteria 1502
75 Ga0070678_101123257 3300005456 Bacteria 726
76 Ga0070662_100370480 3300005457 Bacteria 1177
77 Ga0070662_100505967 3300005457 Bacteria 1008
78 Ga0070662_100517068 3300005457 Bacteria 997
79 Ga0070681_10081404 3300005458 Bacteria 3194
80 Ga0070681_10113376 3300005458 Bacteria 2650
81 Ga0070681_10138489 3300005458 Bacteria 2363
82 Ga0070681_10411150 3300005458 Bacteria 1265
83 Ga0070681_10542078 3300005458 Bacteria 1077
84 Ga0070681_10711007 3300005458 Bacteria 921
85 Ga0068867_101570444 3300005459 Bacteria 614
86 Ga0070685_10106140 3300005466 Bacteria 1723
87 Ga0070706_100001286 3300005467 Bacteria 26758
88 Ga0070706_100007825 3300005467 Bacteria 9992
89 Ga0070706_100579750 3300005467 Unclassified 1043
90 Ga0070706_100763374 3300005467 Bacteria 896
91 Ga0070707_100003579 3300005468 Bacteria 14651
92 Ga0070707_100098156 3300005468 Plasmid 2837
93 Ga0070707_100593788 3300005468 Bacteria 1070
94 Ga0070707_102265320 3300005468 Bacteria 511
95 Ga0070698_100000708 3300005471 Bacteria 35672
96 Ga0070698_100012678 3300005471 Bacteria 8923
97 Ga0070699_100032606 3300005518 Bacteria 4498
98 Ga0070699_100761178 3300005518 Bacteria 886
99 Ga0070699_101735310 3300005518 Bacteria 572
100 Ga0070699_102043795 3300005518 Bacteria 524
101 Ga0070679_100064495 3300005530 Bacteria 3651
102 Ga0070679_100456207 3300005530 Bacteria 1223
103 Ga0070684_100245303 3300005535 Bacteria 1637
104 Ga0070684_100387394 3300005535 Bacteria 1288
105 Ga0070684_101083132 3300005535 Bacteria 753
106 Ga0070684_101645649 3300005535 Bacteria 606
107 Ga0070697_100156043 3300005536 Bacteria 1926
108 Ga0070697_100264214 3300005536 Bacteria 1474
109 Ga0070672_100749502 3300005543 Bacteria 857
110 Ga0070672_100935241 3300005543 Bacteria 767
111 Ga0070672_101163035 3300005543 Bacteria 687
112 Ga0070686_100204825 3300005544 Bacteria 1417
113 Ga0070686_101849252 3300005544 Bacteria 515
114 Ga0070695_100003301 3300005545 Bacteria 9431
115 Ga0070695_100545171 3300005545 Bacteria 903
116 Ga0070696_100661072 3300005546 Unclassified 848
117 Ga0070696_101497488 3300005546 Bacteria 577
118 Ga0070693_100052191 3300005547 Bacteria 2344
119 Ga0070704_101189689 3300005549 Unclassified 695
120 Ga0068855_100545117 3300005563 Bacteria 1256
121 Ga0068855_101102324 3300005563 Bacteria 830
122 Ga0070664_101740452 3300005564 Bacteria 591
123 Ga0068854_100159129 3300005578 Bacteria 1747
124 Ga0068854_100294949 3300005578 Bacteria 1310
125 Ga0068856_100007194 3300005614 Bacteria 10855
126 Ga0068856_100207945 3300005614 Bacteria 1972
127 Ga0068856_100252304 3300005614 Bacteria 1779
128 Ga0070702_100128761 3300005615 Bacteria 1595
129 Ga0070702_100598829 3300005615 Bacteria 826
130 Ga0068852_100157871 3300005616 Bacteria 2115
131 Ga0068852_100275696 3300005616 Bacteria 1620
132 Ga0068852_100663025 3300005616 Bacteria 1051
133 Ga0068852_100685412 3300005616 Bacteria 1034
134 Ga0068859_100526513 3300005617 Unclassified 1277
135 Ga0068864_100120012 3300005618 Bacteria 2350
136 Ga0068851_10275166 3300005834 Bacteria 961
137 Ga0068870_10154772 3300005840 Bacteria 1354
138 Ga0068863_100885665 3300005841 Bacteria 892
139 Ga0068858_100006881 3300005842 Bacteria 11054
140 Ga0068858_101610547 3300005842 Bacteria 641
141 Ga0068860_100365280 3300005843 Bacteria 1423
142 Ga0068862_100904580 3300005844 Bacteria 868
143 Ga0081455_10000145 3300005937 Bacteria 84152
144 Ga0081455_10011497 3300005937 Bacteria 8891
145 Ga0081540_1001295 3300005983 Bacteria 21835
146 Ga0081540_1182012 3300005983 Bacteria 785
147 Ga0070717_10002692 3300006028 Bacteria 12524
148 Ga0070717_10015080 3300006028 Bacteria 5958
149 Ga0070717_10016256 3300006028 Bacteria 5766
150 Ga0070717_10176294 3300006028 Bacteria 1861
151 Ga0070717_10396373 3300006028 Bacteria 1239
152 Ga0070715_10178809 3300006163 Bacteria 1062
153 Ga0070715_11001783 3300006163 Bacteria 521
154 Ga0070716_100010438 3300006173 Bacteria 4656
155 Ga0070716_100389398 3300006173 Unclassified 999
156 Ga0070716_100660318 3300006173 Bacteria 794
157 Ga0070712_100006790 3300006175 Bacteria 7122
158 Ga0070712_100187861 3300006175 Bacteria 1614
159 Ga0070712_100453876 3300006175 Bacteria 1068
160 Ga0097621_100327168 3300006237 Bacteria 1359
161 Ga0097621_100866705 3300006237 Bacteria 840
162 Ga0068871_100319558 3300006358 Bacteria 1367
163 Ga0075433_10035948 3300006852 Bacteria 4263
164 Ga0075433_10320754 3300006852 Bacteria 1371
165 Ga0075433_10486888 3300006852 Unclassified 1086
166 Ga0075433_11144014 3300006852 Bacteria 676
167 Ga0075434_100003275 3300006871 Bacteria 14484
168 Ga0075434_100096072 3300006871 Unclassified 2968
169 Ga0075434_100358461 3300006871 Bacteria 1479
170 Ga0075436_100175019 3300006914 Bacteria 1515
171 Ga0075436_100590630 3300006914 Bacteria 817
172 Ga0075436_101279773 3300006914 Bacteria 554
173 Ga0097620_100526432 3300006931 Unclassified 1277
174 Ga0075435_100001051 3300007076 Bacteria 17481
175 Ga0075435_100012800 3300007076 Bacteria 6216
176 Ga0075435_101767789 3300007076 Bacteria 543
177 Ga0105251_10076228 3300009011 Bacteria 1556
178 Ga0105240_10104411 3300009093 Bacteria 3441
179 Ga0105240_10201017 3300009093 Bacteria 2335
180 Ga0105240_10616470 3300009093 Bacteria 1193
181 Ga0111539_10484233 3300009094 Bacteria 1441
182 Ga0111539_10545617 3300009094 Bacteria 1351
183 Ga0105245_10006987 3300009098 Bacteria 9900
184 Ga0105245_10010010 3300009098 Bacteria 8256
185 Ga0105245_10353620 3300009098 Bacteria 1456
186 Ga0105245_10361146 3300009098 Bacteria 1441
187 Ga0105245_10390295 3300009098 Bacteria 1389
188 Ga0105245_10438091 3300009098 Bacteria 1313
189 Ga0105245_10571091 3300009098 Bacteria 1155
190 Ga0105245_11506016 3300009098 Bacteria 724
191 Ga0105247_10115306 3300009101 Unclassified 1734
192 Ga0105247_10329566 3300009101 Bacteria 1068
193 Ga0114129_10070147 3300009147 Bacteria 4886
194 Ga0114129_10361422 3300009147 Unclassified 1921
195 Ga0105243_10058922 3300009148 Bacteria 3062
196 Ga0105243_10092116 3300009148 Bacteria 2498
197 Ga0105243_10209765 3300009148 Bacteria 1714
198 Ga0105243_12715448 3300009148 Bacteria 535
199 Ga0105241_10168043 3300009174 Bacteria 1809
200 Ga0105241_10638958 3300009174 Bacteria 965
201 Ga0105241_12176839 3300009174 Unclassified 549
202 Ga0105242_10245858 3300009176 Bacteria 1610
203 Ga0105242_10288727 3300009176 Bacteria 1493
204 Ga0105248_10215406 3300009177 Bacteria 2163
205 Ga0105248_10223091 3300009177 Bacteria 2122
206 Ga0105248_10259759 3300009177 Bacteria 1955
207 Ga0105248_12385743 3300009177 Bacteria 602
208 Ga0105248_12480757 3300009177 Bacteria 591
209 Ga0105237_10011266 3300009545 Bacteria 9461
210 Ga0105237_10032523 3300009545 Bacteria 5280
211 Ga0105237_10266799 3300009545 Bacteria 1715
212 Ga0105237_11368353 3300009545 Bacteria 714
213 Ga0105237_11450575 3300009545 Bacteria 693
214 Ga0105238_10012335 3300009551 Bacteria 8619
215 Ga0105238_10337797 3300009551 Bacteria 1494
216 Ga0105238_10428271 3300009551 Bacteria 1318
217 Ga0105238_11290256 3300009551 Bacteria 756
218 Ga0105238_11987079 3300009551 Unclassified 615
219 Ga0105238_12563881 3300009551 Bacteria 546
220 Ga0105249_10241621 3300009553 Bacteria 1786
221 Ga0105249_10289554 3300009553 Bacteria 1639
222 Ga0105249_10686032 3300009553 Bacteria 1084
223 Ga0105249_13364313 3300009553 Unclassified 515
224 Ga0105239_10134812 3300010375 Bacteria 2749
225 Ga0105239_10397514 3300010375 Bacteria 1559
226 Ga0105239_10918754 3300010375 Bacteria 1005
227 Ga0105239_11056673 3300010375 Bacteria 934
228 Ga0105239_11346329 3300010375 Bacteria 824
229 Ga0105239_12019287 3300010375 Bacteria 669
230 Ga0105246_10015061 3300011119 Bacteria 4873
231 Ga0105246_10229911 3300011119 Bacteria 1460
232 Ga0105246_10431253 3300011119 Bacteria 1103
233 Ga0157336_1001942 3300012477 Bacteria 1124
234 Ga0157329_1021328 3300012491 Bacteria 609
235 Ga0157339_1051189 3300012505 Bacteria 547
236 Ga0157342_1004931 3300012507 Bacteria 1208
237 Ga0157373_10170630 3300013100 Bacteria 1531
238 Ga0157373_10852139 3300013100 Bacteria 674
239 Ga0157371_10029530 3300013102 Bacteria 3963
240 Ga0157371_10974204 3300013102 Bacteria 646
241 Ga0157370_10569853 3300013104 Bacteria 1038
242 Ga0157370_11028633 3300013104 Bacteria 745
243 Ga0157370_11135323 3300013104 Bacteria 706
244 Ga0157369_10234855 3300013105 Bacteria 1916
245 Ga0157369_10351309 3300013105 Bacteria 1531
246 Ga0157369_10794913 3300013105 Bacteria 972
247 Ga0157369_10996465 3300013105 Bacteria 858
248 Ga0157374_10010845 3300013296 Bacteria 7864
249 Ga0157374_10047741 3300013296 Bacteria 3971
250 Ga0157374_12876414 3300013296 Bacteria 509
251 Ga0157378_10515440 3300013297 Bacteria 1196
252 Ga0157378_10667476 3300013297 Bacteria 1057
253 Ga0163162_10146691 3300013306 Bacteria 2476
254 Ga0163162_10184829 3300013306 Bacteria 2211
255 Ga0163162_10286856 3300013306 Bacteria 1778
256 Ga0163162_10313686 3300013306 Bacteria 1701
257 Ga0163162_10701792 3300013306 Bacteria 1133
258 Ga0163162_11374792 3300013306 Bacteria 803
259 Ga0163162_11776452 3300013306 Bacteria 705
260 Ga0157372_10012067 3300013307 Bacteria 9202
261 Ga0157372_10014787 3300013307 Bacteria 8354
262 Ga0157372_10143994 3300013307 Bacteria 2748
263 Ga0157372_10214220 3300013307 Bacteria 2232
264 Ga0157372_10363273 3300013307 Bacteria 1687
265 Ga0157372_10607346 3300013307 Bacteria 1275
266 Ga0157372_11457840 3300013307 Bacteria 789
267 Ga0157372_11481981 3300013307 Bacteria 782
268 Ga0157372_11658563 3300013307 Bacteria 736
269 Ga0157372_12969373 3300013307 Bacteria 542
270 Ga0157375_10057488 3300013308 Bacteria 3845
271 Ga0157375_10281850 3300013308 Bacteria 1825
272 Ga0157375_10424272 3300013308 Bacteria 1496
273 Ga0157375_10643849 3300013308 Bacteria 1216
274 Ga0157375_11077918 3300013308 Bacteria 940
275 Ga0157375_11246758 3300013308 Bacteria 873
276 Ga0157375_13776836 3300013308 Bacteria 503
277 Ga0163163_10033673 3300014325 Bacteria 4958
278 Ga0163163_10120652 3300014325 Bacteria 2656
279 Ga0163163_10372930 3300014325 Bacteria 1484
280 Ga0163163_10436168 3300014325 Bacteria 1369
281 Ga0163163_10642249 3300014325 Bacteria 1125
282 Ga0157380_10252770 3300014326 Bacteria 1596
283 Ga0157377_10021661 3300014745 Bacteria 3384
284 Ga0157377_10035718 3300014745 Bacteria 2728
285 Ga0157377_10231336 3300014745 Bacteria 1189
286 Ga0157377_10758303 3300014745 Bacteria 711
287 Ga0157377_11149401 3300014745 Unclassified 598
288 Ga0157379_10025657 3300014968 Bacteria 5238
289 Ga0157379_10045059 3300014968 Bacteria 3937
290 Ga0157379_10336369 3300014968 Bacteria 1380
291 Ga0157379_11009806 3300014968 Bacteria 793
292 Ga0157376_10004340 3300014969 Bacteria 9861
293 Ga0157376_10265451 3300014969 Bacteria 1610
294 Ga0157376_10865592 3300014969 Bacteria 920
295 Ga0163161_10075486 3300017792 Unclassified 2474
296 Ga0163161_10643686 3300017792 Bacteria 878
297 Ga0163161_11882688 3300017792 Bacteria 532
298 Ga0206353_10179416 3300020082 Bacteria 562
299 Ga0206353_11362772 3300020082 Bacteria 952
300 Ga0206353_12070973 3300020082 Bacteria 1083
301 Ga0213873_10089231 3300021358 Bacteria 873
302 Ga0207713_1086827 3300025735 Bacteria 1110
303 Ga0207653_10387942 3300025885 Bacteria 547
304 Ga0207692_10041692 3300025898 Bacteria 2275
305 Ga0207692_10046554 3300025898 Bacteria 2175
306 Ga0207692_10131230 3300025898 Unclassified 1415
307 Ga0207692_10173129 3300025898 Bacteria 1252
308 Ga0207710_10260482 3300025900 Bacteria 869
309 Ga0207710_10410689 3300025900 Unclassified 696
310 Ga0207688_10002447 3300025901 Bacteria 9997
311 Ga0207685_10251572 3300025905 Bacteria 855
312 Ga0207699_10007103 3300025906 Bacteria 5460
313 Ga0207699_10055321 3300025906 Bacteria 2360
314 Ga0207699_10389818 3300025906 Bacteria 990
315 Ga0207699_10394489 3300025906 Bacteria 985
316 Ga0207645_10311357 3300025907 Bacteria 1049
317 Ga0207645_11114332 3300025907 Bacteria 532
318 Ga0207643_10085466 3300025908 Bacteria 1832
319 Ga0207684_10001357 3300025910 Bacteria 26760
320 Ga0207684_10001846 3300025910 Bacteria 22058
321 Ga0207684_10005848 3300025910 Bacteria 11264
322 Ga0207684_10161681 3300025910 Bacteria 1929
323 Ga0207684_10333281 3300025910 Bacteria 1307
324 Ga0207684_10461660 3300025910 Unclassified 1090
325 Ga0207654_10063300 3300025911 Bacteria 2170
326 Ga0207654_10637050 3300025911 Bacteria 763
327 Ga0207707_10582047 3300025912 Bacteria 949
328 Ga0207707_10674732 3300025912 Bacteria 869
329 Ga0207707_10714627 3300025912 Bacteria 840
330 Ga0207695_10106395 3300025913 Bacteria 2791
331 Ga0207695_10514165 3300025913 Bacteria 1079
332 Ga0207671_10099273 3300025914 Bacteria 2203
333 Ga0207671_10413053 3300025914 Bacteria 1074
334 Ga0207693_10011846 3300025915 Bacteria 7049
335 Ga0207693_10022242 3300025915 Bacteria 5039
336 Ga0207693_10096553 3300025915 Bacteria 2317
337 Ga0207663_10222824 3300025916 Bacteria 1373
338 Ga0207663_10247102 3300025916 Bacteria 1311
339 Ga0207663_10271787 3300025916 Bacteria 1256
340 Ga0207660_10392243 3300025917 Bacteria 1117
341 Ga0207657_10002845 3300025919 Bacteria 18597
342 Ga0207657_10015127 3300025919 Bacteria 7493
343 Ga0207649_10960638 3300025920 Bacteria 671
344 Ga0207652_10497668 3300025921 Bacteria 1097
345 Ga0207646_10001416 3300025922 Bacteria 29797
346 Ga0207646_10008894 3300025922 Bacteria 10003
347 Ga0207646_10336328 3300025922 Unclassified 1364
348 Ga0207646_10538526 3300025922 Bacteria 1050
349 Ga0207646_11296703 3300025922 Bacteria 636
350 Ga0207681_10565652 3300025923 Bacteria 937
351 Ga0207694_10016140 3300025924 Bacteria 5636
352 Ga0207694_10401588 3300025924 Bacteria 1140
353 Ga0207650_11764712 3300025925 Bacteria 524
354 Ga0207659_10434871 3300025926 Bacteria 1103
355 Ga0207687_10000711 3300025927 Bacteria 22543
356 Ga0207687_10181347 3300025927 Bacteria 1632
357 Ga0207700_10106229 3300025928 Bacteria 2250
358 Ga0207700_10124301 3300025928 Bacteria 2096
359 Ga0207700_10172703 3300025928 Bacteria 1804
360 Ga0207700_10206201 3300025928 Bacteria 1659
361 Ga0207700_10298111 3300025928 Bacteria 1391
362 Ga0207700_10558853 3300025928 Bacteria 1016
363 Ga0207664_10010860 3300025929 Bacteria 6449
364 Ga0207664_10013341 3300025929 Bacteria 5894
365 Ga0207664_10037551 3300025929 Bacteria 3750
366 Ga0207664_10065779 3300025929 Bacteria 2903
367 Ga0207664_10172047 3300025929 Bacteria 1854
368 Ga0207664_10214135 3300025929 Bacteria 1668
369 Ga0207664_10496796 3300025929 Bacteria 1092
370 Ga0207644_10213145 3300025931 Bacteria 1528
371 Ga0207690_10287705 3300025932 Bacteria 1282
372 Ga0207690_10354643 3300025932 Bacteria 1161
373 Ga0207706_10450943 3300025933 Bacteria 1113
374 Ga0207706_10970610 3300025933 Bacteria 715
375 Ga0207686_10040376 3300025934 Unclassified 2837
376 Ga0207709_10020394 3300025935 Bacteria 3739
377 Ga0207709_10124021 3300025935 Bacteria 1749
378 Ga0207709_10458377 3300025935 Bacteria 987
379 Ga0207670_11526919 3300025936 Bacteria 568
380 Ga0207704_11496572 3300025938 Bacteria 579
381 Ga0207665_10030553 3300025939 Bacteria 3561
382 Ga0207665_10074146 3300025939 Bacteria 2329
383 Ga0207691_10634707 3300025940 Bacteria 903
384 Ga0207691_11300047 3300025940 Bacteria 601
385 Ga0207691_11729841 3300025940 Bacteria 505
386 Ga0207711_10351808 3300025941 Bacteria 1364
387 Ga0207711_10418379 3300025941 Bacteria 1246
388 Ga0207711_10514303 3300025941 Bacteria 1116
389 Ga0207711_11607444 3300025941 Bacteria 593
390 Ga0207689_10045020 3300025942 Bacteria 3649
391 Ga0207689_10306282 3300025942 Bacteria 1317
392 Ga0207661_10400137 3300025944 Bacteria 1245
393 Ga0207661_10477361 3300025944 Bacteria 1138
394 Ga0207661_10509172 3300025944 Unclassified 1100
395 Ga0207661_10919663 3300025944 Bacteria 806
396 Ga0207667_10017784 3300025949 Bacteria 7994
397 Ga0207667_10855683 3300025949 Bacteria 903
398 Ga0207667_10911036 3300025949 Bacteria 870
399 Ga0207651_10112116 3300025960 Bacteria 2050
400 Ga0207712_10080504 3300025961 Bacteria 2369
401 Ga0207712_10166169 3300025961 Bacteria 1720
402 Ga0207668_10104245 3300025972 Bacteria 2114
403 Ga0207668_10619818 3300025972 Bacteria 944
404 Ga0207640_10111678 3300025981 Bacteria 1939
405 Ga0207640_10682247 3300025981 Bacteria 879
406 Ga0207640_11821814 3300025981 Bacteria 550
407 Ga0207658_10528293 3300025986 Bacteria 1054
408 Ga0207658_11533783 3300025986 Bacteria 609
409 Ga0207677_10437402 3300026023 Bacteria 1118
410 Ga0207703_10024083 3300026035 Bacteria 4789
411 Ga0207703_10340079 3300026035 Bacteria 1379
412 Ga0207639_10305924 3300026041 Bacteria 1407
413 Ga0207639_10544007 3300026041 Bacteria 1065
414 Ga0207639_11336484 3300026041 Bacteria 673
415 Ga0207678_10227655 3300026067 Bacteria 1596
416 Ga0207678_11331955 3300026067 Unclassified 635
417 Ga0207708_11340404 3300026075 Bacteria 627
418 Ga0207702_10016249 3300026078 Bacteria 6159
419 Ga0207702_11087727 3300026078 Unclassified 793
420 Ga0207702_12502408 3300026078 Bacteria 503
421 Ga0207648_10293209 3300026089 Bacteria 1457
422 Ga0207648_11015645 3300026089 Bacteria 777
423 Ga0207676_11608569 3300026095 Bacteria 647
424 Ga0207676_12107176 3300026095 Bacteria 562
425 Ga0207674_10505324 3300026116 Bacteria 1168
426 Ga0207675_100177172 3300026118 Bacteria 2040
427 Ga0207675_100562643 3300026118 Bacteria 1140
428 Ga0207683_10056092 3300026121 Bacteria 3455
429 Ga0207698_10444210 3300026142 Bacteria 1250
430 Ga0207698_10547262 3300026142 Bacteria 1134
431 Ga0207698_10896162 3300026142 Bacteria 894
432 Ga0207698_12377291 3300026142 Bacteria 541
433 Ga0268266_10827460 3300028379 Bacteria 894
434 Ga0268264_10622401 3300028381 Bacteria 1066
435 Ga0268264_10630310 3300028381 Bacteria 1059
436 Ga0265760_10053399 3300031090 Bacteria 1219
437 Ga0373948_0044226 3300034817 Bacteria 941
438 Ga0373950_0044001 3300034818 Bacteria 862
439 Ga0373958_0042643 3300034819 Bacteria 933
440 Ga0373926_0000190 3300035083 Bacteria 13981
441 Ga0373926_0145794 3300035083 Bacteria 900
442 Ga0373929_0043193 3300035085 Bacteria 1008
443 Ga0373934_0051168 3300035086 Bacteria 1637
444 Ga0373940_0020119 3300035088 Bacteria 1693
445 Ga0373940_0360418 3300035088 Bacteria 512
446 Ga0373944_0002379 3300035089 Bacteria 4792
447 Ga0373944_0080483 3300035089 Bacteria 1075
448 Ga0373944_0371059 3300035089 Bacteria 547
449 Ga0373949_0177313 3300035090 Bacteria 629
450 Ga0373923_0000224 3300035111 Bacteria 11874
451 Ga0373923_0013512 3300035111 Bacteria 3045
452 Ga0373932_0012798 3300035112 Bacteria 2073
453 Ga0373936_0000374 3300035113 Bacteria 15155
454 Ga0373936_0221840 3300035113 Bacteria 839
455 Ga0373936_0305750 3300035113 Bacteria 718
456 Ga0373939_0029486 3300035114 Bacteria 1570
457 Ga0373941_0050243 3300035115 Bacteria 1323
458 Ga0373945_0001007 3300035116 Bacteria 8422
459 Ga0373953_0000462 3300035117 Bacteria 11173
460 Ga0373953_0023598 3300035117 Bacteria 2329
461 Ga0373953_0110289 3300035117 Bacteria 1163
462 Ga0373954_0000725 3300035118 Bacteria 12713
463 Ga0373954_0084506 3300035118 Bacteria 1519
464 Ga0373956_0002808 3300035119 Bacteria 7039
465 Ga0373956_0040506 3300035119 Bacteria 2066
466 Ga0373956_0198054 3300035119 Bacteria 952
467 Ga0373956_0520965 3300035119 Bacteria 567
468 Ga0373957_0001454 3300035120 Bacteria 6413
469 Ga0373957_0011975 3300035120 Bacteria 2909
470 Ga0373957_0018411 3300035120 Bacteria 2446
471 Ga0373943_0000279 3300035170 Bacteria 21102
472 Ga0373943_0099749 3300035170 Bacteria 1517
473 Ga0373943_0283431 3300035170 Bacteria 937
474 Ga0373946_0079946 3300035171 Bacteria 1429
475 Ga0373946_0122265 3300035171 Bacteria 1189
476 Ga0373946_0189714 3300035171 Bacteria 979
477 Ga0373946_0555499 3300035171 Bacteria 592
478 Ga0373955_0001286 3300035172 Bacteria 10680
479 Ga0373955_0009059 3300035172 Bacteria 4648
480 Ga0373955_0495627 3300035172 Unclassified 746
481 Ga0373942_0123107 3300035207 Bacteria 812
482 Ga0373942_0308578 3300035207 Unclassified 551
483 Ga0373962_0086958 3300035242 Bacteria 957
484 Ga0373924_0003085 3300035410 Bacteria 5687
485 Ga0373924_0026213 3300035410 Bacteria 2310
486 Ga0373924_0148613 3300035410 Bacteria 1024
487 Ga0373924_0211646 3300035410 Bacteria 856
488 Ga0373931_0157991 3300035691 Bacteria 1327
489 Ga0373931_0300691 3300035691 Bacteria 991
490 Ga0373931_0681103 3300035691 Bacteria 678
491 Ga0373931_1127581 3300035691 Bacteria 535
492 Ga0373935_0006058 3300035692 Bacteria 7187
493 Ga0373935_0681089 3300035692 Bacteria 755
494 Ga0373927_0000787 3300035695 Bacteria 24230
495 Ga0373927_0295056 3300035695 Bacteria 1067
496 Ga0373927_0353577 3300035695 Unclassified 968
497 Ga0373927_0558596 3300035695 Bacteria 756
498 Ga0373927_1015007 3300035695 Bacteria 547
499 Ga0373933_0004280 3300035724 Bacteria 7844
500 Ga0373933_0063472 3300035724 Bacteria 2233
501 Ga0373933_0407276 3300035724 Bacteria 887
502 Ga0373933_0520669 3300035724 Bacteria 779
503 Ga0373947_0092837 3300035725 Bacteria 1885
504 Ga0373947_0189775 3300035725 Bacteria 1340
505 Ga0373947_0661736 3300035725 Unclassified 712
506 Ga0373937_0022313 3300036401 Bacteria 5691
507 Ga0373937_0482459 3300036401 Bacteria 1177
508 Ga0373937_0484791 3300036401 Bacteria 1174
509 Ga0373937_0923840 3300036401 Bacteria 821
510 Ga0373937_0943851 3300036401 Bacteria 811
511 Ga0372808_018662 3300036459 Bacteria 996
512 Ga0373925_0017114 3300037068 Bacteria 5248
513 Ga0373925_0081826 3300037068 Bacteria 2456
514 Ga0373925_0137590 3300037068 Bacteria 1909
515 Ga0373925_0161454 3300037068 Unclassified 1765
516 Ga0373925_0380331 3300037068 Bacteria 1149
517 Ga0373925_0600476 3300037068 Bacteria 906
518 Ga0373925_0908376 3300037068 Bacteria 726
519 Ga0395898_0415826 3300037466 Bacteria 1282
520 Ga0436364_0702615 3300037853 Unclassified 1134
521 Ga0395901_0334182 3300038443 Unclassified 1566
522 Ga0242420_137572 3300038996 Bacteria 542
523 Ga0436361_1023671 3300039447 Bacteria 861
524 Ga0436363_1362369 3300039450 Bacteria 1258
525 Ga0436362_0119803 3300039453 Bacteria 572
526 Ga0436362_0459129 3300039453 Bacteria 858
527 Ga0436362_0574285 3300039453 Bacteria 668
528 Ga0451833_0364065 3300041491 Bacteria 696
529 Ga0451839_0127947 3300041496 Bacteria 834
530 Ga0451843_0322056 3300041509 Bacteria 557
531 Ga0451853_1391916 3300041512 Bacteria 890
532 Ga0451853_2994508 3300041512 Bacteria 630
533 Ga0451853_3831011 3300041512 Bacteria 1005
534 Ga0450888_012043 3300042126 Unclassified 1021
535 Ga0439435_0308826 3300042436 Bacteria 543
536 Ga0466961_0519733 3300044693 Bacteria 718
537 Ga0466963_0143853 3300044694 Bacteria 1653
538 Ga0466963_0152475 3300044694 Bacteria 1605
539 Ga0466963_0709867 3300044694 Unclassified 709
540 Ga0466964_0016818 3300044706 Unclassified 2795
541 Ga0466964_0044528 3300044706 Bacteria 1803
542 Ga0466964_0068139 3300044706 Bacteria 1498
543 Ga0466964_0834515 3300044706 Bacteria 523
544 Ga0466957_0986798 3300044842 Unclassified 604
545 Ga0466960_1028914 3300044901 Bacteria 507
546 Ga0466960_1054432 3300044901 Bacteria 501
547 Ga0466958_0706889 3300045836 Bacteria 656
548 Ga0466967_0184373 3300045976 Bacteria 1970
549 Ga0466967_0360482 3300045976 Unclassified 1408
550 Ga0466967_1100981 3300045976 Bacteria 791
551 Ga0466967_1771226 3300045976 Bacteria 615
552 Ga0466967_2237718 3300045976 Bacteria 542
553 Ga0495592_0015135 3300046454 Bacteria 5860
554 Ga0495592_0019409 3300046454 Bacteria 5170
555 Ga0495592_0130471 3300046454 Bacteria 1759
556 Ga0495592_0154108 3300046454 Bacteria 1586
557 Ga0495592_0239594 3300046454 Bacteria 1204
558 Ga0495603_0012040 3300046455 Bacteria 5236
559 Ga0495603_0056113 3300046455 Bacteria 2333
560 Ga0495603_0095684 3300046455 Bacteria 1735
561 Ga0495603_0330615 3300046455 Bacteria 875
562 Ga0495629_0000229 3300046459 Bacteria 50275
563 Ga0495629_0002198 3300046459 Bacteria 15040
564 Ga0495629_0008917 3300046459 Bacteria 7373
565 Ga0495629_0068145 3300046459 Bacteria 2483
566 Ga0495641_0001628 3300046461 Bacteria 18907
567 Ga0495641_0006898 3300046461 Bacteria 7248
568 Ga0495641_0035629 3300046461 Bacteria 2343
569 Ga0495641_0182371 3300046461 Bacteria 940
570 Ga0495651_0017178 3300046462 Bacteria 5605
571 Ga0495651_0110380 3300046462 Bacteria 2034
572 Ga0495651_0131833 3300046462 Bacteria 1823
573 Ga0495651_0153770 3300046462 Bacteria 1655
574 Ga0495653_0030039 3300046463 Bacteria 4332
575 Ga0495653_0036742 3300046463 Bacteria 3855
576 Ga0495653_0044255 3300046463 Bacteria 3455
577 Ga0495653_0151853 3300046463 Bacteria 1617
578 Ga0495653_0159666 3300046463 Bacteria 1566
579 Ga0495653_0259276 3300046463 Bacteria 1150
580 Ga0495653_0869343 3300046463 Bacteria 538
581 Ga0495580_0013431 3300046472 Bacteria 6246
582 Ga0495580_0148774 3300046472 Bacteria 1622
583 Ga0495582_0012920 3300046473 Bacteria 4600
584 Ga0495582_0034326 3300046473 Bacteria 2788
585 Ga0495582_0132191 3300046473 Bacteria 1410
586 Ga0495582_0165727 3300046473 Bacteria 1257
587 Ga0495639_0000347 3300046475 Bacteria 22348
588 Ga0495639_0024477 3300046475 Bacteria 2658
589 Ga0495639_0091716 3300046475 Bacteria 1426
590 Ga0495662_0000350 3300046476 Bacteria 20203
591 Ga0495662_0104758 3300046476 Bacteria 1384
592 Ga0495664_0002744 3300046477 Bacteria 9466
593 Ga0495664_0044436 3300046477 Bacteria 2632
594 Ga0495664_0066909 3300046477 Bacteria 2143
595 Ga0495664_0075452 3300046477 Bacteria 2017
596 Ga0495664_0139670 3300046477 Bacteria 1469
597 Ga0495664_0257457 3300046477 Bacteria 1055
598 Ga0495594_0060355 3300046499 Bacteria 2097
599 Ga0495594_0264797 3300046499 Bacteria 979
600 Ga0495594_0554705 3300046499 Bacteria 652
601 Ga0495608_0020627 3300046511 Bacteria 4528
602 Ga0495608_0043080 3300046511 Bacteria 3016
603 Ga0495608_0133857 3300046511 Bacteria 1585
604 Ga0495618_0008326 3300046514 Bacteria 6279
605 Ga0495618_0014658 3300046514 Bacteria 4779
606 Ga0495618_0018376 3300046514 Bacteria 4292
607 Ga0495618_0165652 3300046514 Bacteria 1407
608 Ga0495618_0187279 3300046514 Bacteria 1314
609 Ga0495618_0520112 3300046514 Bacteria 715
610 Ga0495628_0013693 3300046516 Bacteria 6815
611 Ga0495628_0039965 3300046516 Bacteria 3750
612 Ga0495628_0052026 3300046516 Unclassified 3236
613 Ga0495628_0334794 3300046516 Bacteria 1115
614 Ga0495628_0375102 3300046516 Bacteria 1042
615 Ga0495630_0008052 3300046517 Bacteria 7578
616 Ga0495630_0009109 3300046517 Bacteria 7136
617 Ga0495630_0082589 3300046517 Bacteria 2425
618 Ga0495630_0088749 3300046517 Bacteria 2335
619 Ga0495666_0004835 3300046526 Bacteria 6807
620 Ga0495666_0033541 3300046526 Bacteria 2507
621 Ga0495652_0001732 3300046529 Bacteria 23441
622 Ga0495652_0004765 3300046529 Bacteria 12906
623 Ga0495652_0042415 3300046529 Bacteria 3923
624 Ga0495652_0627846 3300046529 Bacteria 730
625 Ga0495665_0001140 3300046531 Bacteria 14107
626 Ga0495665_0005038 3300046531 Bacteria 7123
627 Ga0495665_0219484 3300046531 Bacteria 983
628 Ga0495640_0005487 3300046533 Bacteria 10085
629 Ga0495640_0008952 3300046533 Bacteria 7816
630 Ga0495640_0009794 3300046533 Bacteria 7443
631 Ga0495640_0015987 3300046533 Bacteria 5628
632 Ga0495640_0040345 3300046533 Bacteria 3269
633 Ga0495586_0009551 3300046535 Bacteria 5167
634 Ga0495586_0014453 3300046535 Bacteria 4193
635 Ga0495586_0018702 3300046535 Bacteria 3688
636 Ga0495587_0009033 3300046536 Bacteria 6398
637 Ga0495587_0021344 3300046536 Bacteria 3992
638 Ga0495587_0024241 3300046536 Bacteria 3721
639 Ga0495587_0143090 3300046536 Bacteria 1364
640 Ga0495645_0027300 3300046543 Bacteria 4146
641 Ga0495645_0130456 3300046543 Unclassified 1762
642 Ga0495645_0295319 3300046543 Bacteria 1060
643 Ga0495645_0421133 3300046543 Bacteria 847
644 Ga0495622_0262686 3300046557 Bacteria 757
645 Ga0495667_0019524 3300046559 Bacteria 4573
646 Ga0495667_0055864 3300046559 Bacteria 2596
647 Ga0495667_0355325 3300046559 Bacteria 925
648 Ga0495667_0441659 3300046559 Bacteria 818
649 Ga0495634_0002674 3300046642 Bacteria 14646
650 Ga0495634_0044123 3300046642 Bacteria 3019
651 Ga0495634_0048975 3300046642 Bacteria 2842
652 Ga0495634_0550053 3300046642 Bacteria 673
653 Ga0495635_0013700 3300046663 Bacteria 5673
654 Ga0495635_0032547 3300046663 Bacteria 3617
655 Ga0495635_0048739 3300046663 Bacteria 2920
656 Ga0495635_0096684 3300046663 Bacteria 2018
657 Ga0495588_0208433 3300046674 Bacteria 1032
658 Ga0495657_0075227 3300046675 Bacteria 2195
659 Ga0495657_0185580 3300046675 Bacteria 1273
660 Ga0495657_0309630 3300046675 Bacteria 940
661 Ga0495657_0884170 3300046675 Bacteria 508
662 Ga0495599_0002017 3300046678 Bacteria 11744
663 Ga0495599_0007619 3300046678 Bacteria 6573
664 Ga0495599_0036598 3300046678 Bacteria 3083
665 Ga0495599_0074739 3300046678 Bacteria 2116
666 Ga0495599_0228177 3300046678 Bacteria 1137
667 Ga0495623_0002796 3300046679 Bacteria 11515
668 Ga0495623_0048263 3300046679 Bacteria 2701
669 Ga0495623_0134372 3300046679 Bacteria 1477
670 Ga0495646_0000774 3300046680 Bacteria 17844
671 Ga0495646_0024467 3300046680 Bacteria 3802
672 Ga0495647_0020669 3300046681 Bacteria 2365
673 Ga0495647_0141082 3300046681 Bacteria 1027
674 Ga0495658_0039400 3300046683 Bacteria 2621
675 Ga0495658_0070987 3300046683 Bacteria 2022
676 Ga0495658_0330906 3300046683 Bacteria 966
677 Ga0495613_0033416 3300046689 Bacteria 3823
678 Ga0495613_0054307 3300046689 Bacteria 2945
679 Ga0495613_0080210 3300046689 Bacteria 2372
680 Ga0495624_0017598 3300046690 Bacteria 4794
681 Ga0495624_0115502 3300046690 Bacteria 1650
682 Ga0495624_0214171 3300046690 Bacteria 1168
683 Ga0495600_0001143 3300046809 Bacteria 14500
684 Ga0495600_0062315 3300046809 Bacteria 2436
685 Ga0495600_0386816 3300046809 Bacteria 872
686 Ga0495600_0599621 3300046809 Unclassified 669
687 Ga0495581_0007390 3300047315 Bacteria 6352
688 Ga0495581_0091224 3300047315 Bacteria 1767
689 Ga0495581_0401148 3300047315 Bacteria 800
690 Ga0495581_0570005 3300047315 Bacteria 656
691 Ga0495604_0003357 3300047317 Bacteria 12764
692 Ga0495604_0061852 3300047317 Bacteria 2862
693 Ga0495604_0118552 3300047317 Bacteria 1918
694 Ga0495674_0001819 3300047319 Bacteria 21027
695 Ga0495674_0004281 3300047319 Bacteria 13737
696 Ga0495674_0008850 3300047319 Bacteria 9577
697 Ga0495674_0014580 3300047319 Bacteria 7354
698 Ga0495674_0021848 3300047319 Bacteria 5912
699 Ga0495674_0060755 3300047319 Bacteria 3296
700 Ga0495674_0414121 3300047319 Bacteria 1086
701 Ga0495676_0026905 3300047321 Bacteria 4941
702 Ga0495676_0079281 3300047321 Bacteria 2497
703 Ga0495676_0323700 3300047321 Bacteria 1035
704 Ga0495676_0748381 3300047321 Bacteria 631
705 Ga0495676_0802143 3300047321 Bacteria 606
706 Ga0495676_0948041 3300047321 Bacteria 550
707 Ga0495680_0003483 3300047322 Bacteria 15458
708 Ga0495680_0004400 3300047322 Bacteria 13481
709 Ga0495680_0025738 3300047322 Bacteria 4865
710 Ga0495680_0244425 3300047322 Bacteria 1273
711 Ga0495675_0002634 3300047444 Bacteria 10759
712 Ga0495675_0007699 3300047444 Bacteria 6643
713 Ga0495684_0002597 3300047471 Bacteria 14353
714 Ga0495684_0004492 3300047471 Bacteria 10896
715 Ga0495684_0004498 3300047471 Bacteria 10887
716 Ga0495684_0100883 3300047471 Bacteria 2182
717 Ga0495684_0235469 3300047471 Bacteria 1337
718 Ga0495684_0530892 3300047471 Bacteria 804
719 Ga0495593_0002363 3300047673 Bacteria 11333
720 Ga0495593_0005458 3300047673 Bacteria 7512
721 Ga0495593_0086972 3300047673 Bacteria 1611
722 Ga0495593_0397531 3300047673 Bacteria 689
723 Ga0495602_0009228 3300048088 Bacteria 10266
724 Ga0495602_0044146 3300048088 Bacteria 4046
725 Ga0495602_0125276 3300048088 Bacteria 2059
726 Ga0495602_0334578 3300048088 Bacteria 1097
727 Ga0495602_0372009 3300048088 Bacteria 1026
728 Ga0495614_0008901 3300048089 Bacteria 4454
729 Ga0495614_0017954 3300048089 Bacteria 3068
730 Ga0495614_0025484 3300048089 Bacteria 2551
731 Ga0496100_0016808 3300048903 Bacteria 4304
732 Ga0496100_0216584 3300048903 Bacteria 1403
733 Ga0496100_0651445 3300048903 Bacteria 820
734 Ga0496100_0988605 3300048903 Bacteria 662
735 Ga0496100_1031401 3300048903 Bacteria 647
736 Ga0496101_0001184 3300048904 Bacteria 15601
737 Ga0496101_0039357 3300048904 Bacteria 3362
738 Ga0496101_0140636 3300048904 Bacteria 1839
739 Ga0496101_0565873 3300048904 Bacteria 899
740 Ga0496101_0895748 3300048904 Bacteria 699
741 Ga0496101_0940303 3300048904 Bacteria 680
742 Ga0496102_0001014 3300048905 Bacteria 26227
743 Ga0496102_0041753 3300048905 Bacteria 4155
744 Ga0496102_0091832 3300048905 Bacteria 2811
745 Ga0496102_0231283 3300048905 Bacteria 1743
746 Ga0496102_0318193 3300048905 Bacteria 1466
747 Ga0496103_0002279 3300048906 Bacteria 12128
748 Ga0496103_0046934 3300048906 Bacteria 2667
749 Ga0496103_0085359 3300048906 Bacteria 1989
750 Ga0496104_0030236 3300048907 Bacteria 5031
751 Ga0496104_0085241 3300048907 Bacteria 3015
752 Ga0496104_0117423 3300048907 Bacteria 2553
753 Ga0496104_0268271 3300048907 Bacteria 1619
754 Ga0496104_0418916 3300048907 Bacteria 1251
755 Ga0496105_0006723 3300048908 Bacteria 8847
756 Ga0496105_0024359 3300048908 Bacteria 4917
757 Ga0496105_0076184 3300048908 Bacteria 2770
758 Ga0496105_0105427 3300048908 Bacteria 2327
759 Ga0496105_0285912 3300048908 Bacteria 1328
760 Ga0496106_0002365 3300048909 Bacteria 14037
761 Ga0496106_0055589 3300048909 Bacteria 2992
762 Ga0496106_0125083 3300048909 Bacteria 2012
763 Ga0496106_0380996 3300048909 Bacteria 1133
764 Ga0496106_0554407 3300048909 Bacteria 922
765 Ga0496106_0781317 3300048909 Bacteria 758
766 Ga0496107_0000576 3300048910 Bacteria 20475
767 Ga0496107_0041102 3300048910 Bacteria 3320
768 Ga0496107_0219699 3300048910 Bacteria 1413
769 Ga0496107_1087170 3300048910 Bacteria 578
770 Ga0496107_1222197 3300048910 Bacteria 540
771 Ga0496108_0000504 3300048911 Bacteria 30868
772 Ga0496108_0128242 3300048911 Bacteria 2179
773 Ga0496108_0190235 3300048911 Bacteria 1779
774 Ga0496108_0210112 3300048911 Bacteria 1689
775 Ga0496108_0463329 3300048911 Bacteria 1107
776 Ga0496108_0463874 3300048911 Bacteria 1107
777 Ga0496108_0552459 3300048911 Bacteria 1004
778 Ga0496108_0642840 3300048911 Bacteria 922
779 Ga0496108_0742470 3300048911 Bacteria 849
780 Ga0496109_0029002 3300048912 Bacteria 4953
781 Ga0496109_0270646 3300048912 Bacteria 1600
782 Ga0496109_0402278 3300048912 Bacteria 1293
783 Ga0496109_0423470 3300048912 Bacteria 1258
784 Ga0496109_0490369 3300048912 Bacteria 1160
785 Ga0496109_0612163 3300048912 Bacteria 1025
786 Ga0496109_0976989 3300048912 Bacteria 784
787 Ga0496110_0086911 3300048913 Bacteria 2792
788 Ga0496110_0215355 3300048913 Bacteria 1746
789 Ga0496110_1615840 3300048913 Bacteria 558
790 Ga0496111_0000431 3300048914 Bacteria 21230
791 Ga0496111_0017497 3300048914 Bacteria 4956
792 Ga0496111_0054250 3300048914 Bacteria 2897
793 Ga0496111_0070323 3300048914 Bacteria 2545
794 Ga0496111_0233649 3300048914 Bacteria 1365
795 Ga0496111_0512989 3300048914 Bacteria 882
796 Ga0496112_0005214 3300048915 Bacteria 11185
797 Ga0496112_0007209 3300048915 Bacteria 9853
798 Ga0496112_0120968 3300048915 Bacteria 2588
799 Ga0496112_0267092 3300048915 Bacteria 1660
800 Ga0496113_0000873 3300048916 Bacteria 15806
801 Ga0496113_0282109 3300048916 Bacteria 1328
802 Ga0496113_0797305 3300048916 Bacteria 750
803 Ga0496114_0018554 3300048917 Bacteria 5627
804 Ga0496114_0024253 3300048917 Bacteria 4949
805 Ga0496114_0123933 3300048917 Unclassified 2225
806 Ga0496114_0147399 3300048917 Bacteria 2041
807 Ga0496114_0148786 3300048917 Bacteria 2031
808 Ga0496114_0158188 3300048917 Bacteria 1968
809 Ga0496115_0004906 3300048918 Bacteria 9711
810 Ga0496115_0012001 3300048918 Bacteria 6511
811 Ga0496115_0050872 3300048918 Bacteria 3321
812 Ga0496115_0201534 3300048918 Unclassified 1644
813 Ga0496126_1255975 3300048929 Unclassified 542
814 Ga0501067_0257109 3300049583 Bacteria 972
815 Ga0501069_0452593 3300049585 Bacteria 763
816 nmdc:mga05p37_16060_c1 3300050507 Bacteria 9010
817 nmdc:mga05p37_542127_c1 3300050507 Bacteria 1326
818 nmdc:mga08y16_78757_c1 3300050511 Bacteria 3435
819 nmdc:mga0n895_1967966_c1 3300050512 Bacteria 543
820 nmdc:mga0n895_22503_c1 3300050512 Bacteria 5911
821 nmdc:mga0n895_28839_c1 3300050512 Bacteria 5285
822 nmdc:mga0n895_377725_c1 3300050512 Bacteria 1434
823 nmdc:mga0n895_8474_c1 3300050512 Bacteria 8902
824 nmdc:mga0n895_86365_c1 3300050512 Bacteria 3134
825 nmdc:mga0rr50_223030_c1 3300050513 Bacteria 1557
826 nmdc:mga0rr50_313401_c1 3300050513 Bacteria 1314
827 nmdc:mga0rr50_318181_c1 3300050513 Bacteria 1304
828 nmdc:mga0rr50_365699_c1 3300050513 Unclassified 1215
829 nmdc:mga0rr50_40027_c1 3300050513 Bacteria 3405
830 nmdc:mga0rr50_801_c1 3300050513 Bacteria 16963
831 nmdc:mga08x19_123117_c1 3300050514 Bacteria 1740
832 nmdc:mga08x19_20127_c1 3300050514 Bacteria 4107
833 nmdc:mga08x19_388912_c1 3300050514 Bacteria 977
834 nmdc:mga08x19_652214_c1 3300050514 Unclassified 747
835 nmdc:mga08x19_85585_c1 3300050514 Bacteria 2075
836 nmdc:mga08x19_948926_c1 3300050514 Bacteria 611
837 nmdc:mga0a205_139810_c1 3300050515 Bacteria 2322
838 nmdc:mga0a205_217219_c1 3300050515 Bacteria 1799
839 nmdc:mga0a205_346791_c1 3300050515 Bacteria 1353
840 Ga0495601_0037304 3300053077 Bacteria 3038
841 Ga0495601_0051846 3300053077 Bacteria 2590
842 Ga0495601_0073150 3300053077 Unclassified 2191
843 Ga0495601_0096372 3300053077 Unclassified 1908
844 Ga0495601_0143786 3300053077 Bacteria 1556
845 Ga0495601_0477036 3300053077 Unclassified 806
846 Ga0495612_0004948 3300053078 Bacteria 5514
847 Ga0495612_0315939 3300053078 Bacteria 702
848 Ga0495655_0101895 3300053083 Bacteria 851
849 Ga0495595_0007539 3300053084 Bacteria 4456
850 Ga0495595_0013829 3300053084 Bacteria 3415
851 Ga0495595_0034344 3300053084 Bacteria 2293
852 Ga0495595_0060976 3300053084 Bacteria 1766
853 Ga0495595_0427637 3300053084 Bacteria 672
854 Ga0495619_0001069 3300053085 Bacteria 17953
855 Ga0495619_0006015 3300053085 Bacteria 7689
856 Ga0495619_0108646 3300053085 Bacteria 1893
857 Ga0495619_0199649 3300053085 Bacteria 1384
858 Ga0495619_0266086 3300053085 Bacteria 1188
859 Ga0495619_0378637 3300053085 Bacteria 978
860 Ga0466962_0073235 3300061719 Bacteria 1637
861 Ga0070716_100817837
862 JGI24738J21930_10086276
863 Ga0070658_10657861
864 Ga0070676_10224296
865 Ga0070683_100018795
866 Ga0070683_100156979
867 Ga0070683_100172648
868 Ga0070690_100610760
869 Ga0070670_101157953
870 Ga0068869_100087932
871 Ga0068869_100174447
872 Ga0068869_101425073
873 Ga0070666_10271472
874 Ga0070680_100530014
875 Ga0070682_100016266
876 Ga0070682_100183482
877 Ga0070682_100566959
878 Ga0070682_101236719
879 Ga0068868_100002586
880 Ga0068868_100119092
881 Ga0068868_101019959
882 Ga0068868_101707547
883 Ga0070660_100026588
884 Ga0070660_101228160
885 Ga0070691_10316057
886 Ga0070687_100587599
887 Ga0070687_101289589
888 Ga0070661_100165915
889 Ga0070692_10050908
890 Ga0070671_100221479
891 Ga0070671_100446260
892 Ga0070671_102104447
893 Ga0070673_100108132
894 Ga0070688_101659577
895 Ga0070659_100011184
896 Ga0070659_100336523
897 Ga0070659_100506418
898 Ga0070667_100206433
899 Ga0070703_10379099
900 Ga0070709_10209005
901 Ga0070709_10229906
902 Ga0070709_10356207
903 Ga0070709_10718330
904 Ga0070714_100065816
905 Ga0070714_100074431
906 Ga0070714_100216986
907 Ga0070714_100555530
908 Ga0070713_100071744
909 Ga0070713_100207009
910 Ga0070713_100597223
911 Ga0070713_100926324
912 Ga0070710_10034196
913 Ga0070710_10195077
914 Ga0070710_10222100
915 Ga0070710_10281248
916 Ga0070710_10878960
917 Ga0070710_11366826
918 Ga0070710_11410719
919 Ga0070701_10135789
920 Ga0070701_10235330
921 Ga0070711_100292426
922 Ga0070711_100490435
923 Ga0070711_100718028
924 Ga0070705_100176929
925 Ga0070694_100431887
926 Ga0070694_101069531
927 Ga0070708_100008382
928 Ga0070708_100063351
929 Ga0070708_100317354
930 Ga0070663_100140293
931 Ga0070663_100463937
932 Ga0070663_101219577
933 Ga0070663_101382515
934 Ga0070678_100244519
935 Ga0070678_101123257
936 Ga0070662_100370480
937 Ga0070662_100505967
938 Ga0070662_100517068
939 Ga0070681_10081404
940 Ga0070681_10113376
941 Ga0070681_10138489
942 Ga0070681_10411150
943 Ga0070681_10542078
944 Ga0070681_10711007
945 Ga0068867_101570444
946 Ga0070685_10106140
947 Ga0070706_100001286
948 Ga0070706_100007825
949 Ga0070706_100579750
950 Ga0070706_100763374
951 Ga0070707_100003579
952 Ga0070707_100098156
953 Ga0070707_100593788
954 Ga0070707_102265320
955 Ga0070698_100000708
956 Ga0070698_100012678
957 Ga0070699_100032606
958 Ga0070699_100761178
959 Ga0070699_101735310
960 Ga0070699_102043795
961 Ga0070679_100064495
962 Ga0070679_100456207
963 Ga0070684_100245303
964 Ga0070684_100387394
965 Ga0070684_101083132
966 Ga0070684_101645649
967 Ga0070697_100156043
968 Ga0070697_100264214
969 Ga0070672_100749502
970 Ga0070672_100935241
971 Ga0070672_101163035
972 Ga0070686_100204825
973 Ga0070686_101849252
974 Ga0070695_100003301
975 Ga0070695_100545171
976 Ga0070696_100661072
977 Ga0070696_101497488
978 Ga0070693_100052191
979 Ga0070704_101189689
980 Ga0068855_100545117
981 Ga0068855_101102324
982 Ga0070664_101740452
983 Ga0068854_100159129
984 Ga0068854_100294949
985 Ga0068856_100007194
986 Ga0068856_100207945
987 Ga0068856_100252304
988 Ga0070702_100128761
989 Ga0070702_100598829
990 Ga0068852_100157871
991 Ga0068852_100275696
992 Ga0068852_100663025
993 Ga0068852_100685412
994 Ga0068859_100526513
995 Ga0068864_100120012
996 Ga0068851_10275166
997 Ga0068870_10154772
998 Ga0068863_100885665
999 Ga0068858_100006881
1000 Ga0068858_101610547
1001 Ga0068860_100365280
1002 Ga0068862_100904580
1003 Ga0081455_10000145
1004 Ga0081455_10011497
1005 Ga0081540_1001295
1006 Ga0081540_1182012
1007 Ga0070717_10002692
1008 Ga0070717_10015080
1009 Ga0070717_10016256
1010 Ga0070717_10176294
1011 Ga0070717_10396373
1012 Ga0070715_10178809
1013 Ga0070715_11001783
1014 Ga0070716_100010438
1015 Ga0070716_100389398
1016 Ga0070716_100660318
1017 Ga0070712_100006790
1018 Ga0070712_100187861
1019 Ga0070712_100453876
1020 Ga0097621_100327168
1021 Ga0097621_100866705
1022 Ga0068871_100319558
1023 Ga0075433_10035948
1024 Ga0075433_10320754
1025 Ga0075433_10486888
1026 Ga0075433_11144014
1027 Ga0075434_100003275
1028 Ga0075434_100096072
1029 Ga0075434_100358461
1030 Ga0075436_100175019
1031 Ga0075436_100590630
1032 Ga0075436_101279773
1033 Ga0097620_100526432
1034 Ga0075435_100001051
1035 Ga0075435_100012800
1036 Ga0075435_101767789
1037 Ga0105251_10076228
1038 Ga0105240_10104411
1039 Ga0105240_10201017
1040 Ga0105240_10616470
1041 Ga0111539_10484233
1042 Ga0111539_10545617
1043 Ga0105245_10006987
1044 Ga0105245_10010010
1045 Ga0105245_10353620
1046 Ga0105245_10361146
1047 Ga0105245_10390295
1048 Ga0105245_10438091
1049 Ga0105245_10571091
1050 Ga0105245_11506016
1051 Ga0105247_10115306
1052 Ga0105247_10329566
1053 Ga0114129_10070147
1054 Ga0114129_10361422
1055 Ga0105243_10058922
1056 Ga0105243_10092116
1057 Ga0105243_10209765
1058 Ga0105243_12715448
1059 Ga0105241_10168043
1060 Ga0105241_10638958
1061 Ga0105241_12176839
1062 Ga0105242_10245858
1063 Ga0105242_10288727
1064 Ga0105248_10215406
1065 Ga0105248_10223091
1066 Ga0105248_10259759
1067 Ga0105248_12385743
1068 Ga0105248_12480757
1069 Ga0105237_10011266
1070 Ga0105237_10032523
1071 Ga0105237_10266799
1072 Ga0105237_11368353
1073 Ga0105237_11450575
1074 Ga0105238_10012335
1075 Ga0105238_10337797
1076 Ga0105238_10428271
1077 Ga0105238_11290256
1078 Ga0105238_11987079
1079 Ga0105238_12563881
1080 Ga0105249_10241621
1081 Ga0105249_10289554
1082 Ga0105249_10686032
1083 Ga0105249_13364313
1084 Ga0105239_10134812
1085 Ga0105239_10397514
1086 Ga0105239_10918754
1087 Ga0105239_11056673
1088 Ga0105239_11346329
1089 Ga0105239_12019287
1090 Ga0105246_10015061
1091 Ga0105246_10229911
1092 Ga0105246_10431253
1093 Ga0157336_1001942
1094 Ga0157329_1021328
1095 Ga0157339_1051189
1096 Ga0157342_1004931
1097 Ga0157373_10170630
1098 Ga0157373_10852139
1099 Ga0157371_10029530
1100 Ga0157371_10974204
1101 Ga0157370_10569853
1102 Ga0157370_11028633
1103 Ga0157370_11135323
1104 Ga0157369_10234855
1105 Ga0157369_10351309
1106 Ga0157369_10794913
1107 Ga0157369_10996465
1108 Ga0157374_10010845
1109 Ga0157374_10047741
1110 Ga0157374_12876414
1111 Ga0157378_10515440
1112 Ga0157378_10667476
1113 Ga0163162_10146691
1114 Ga0163162_10184829
1115 Ga0163162_10286856
1116 Ga0163162_10313686
1117 Ga0163162_10701792
1118 Ga0163162_11374792
1119 Ga0163162_11776452
1120 Ga0157372_10012067
1121 Ga0157372_10014787
1122 Ga0157372_10143994
1123 Ga0157372_10214220
1124 Ga0157372_10363273
1125 Ga0157372_10607346
1126 Ga0157372_11457840
1127 Ga0157372_11481981
1128 Ga0157372_11658563
1129 Ga0157372_12969373
1130 Ga0157375_10057488
1131 Ga0157375_10281850
1132 Ga0157375_10424272
1133 Ga0157375_10643849
1134 Ga0157375_11077918
1135 Ga0157375_11246758
1136 Ga0157375_13776836
1137 Ga0163163_10033673
1138 Ga0163163_10120652
1139 Ga0163163_10372930
1140 Ga0163163_10436168
1141 Ga0163163_10642249
1142 Ga0157380_10252770
1143 Ga0157377_10021661
1144 Ga0157377_10035718
1145 Ga0157377_10231336
1146 Ga0157377_10758303
1147 Ga0157377_11149401
1148 Ga0157379_10025657
1149 Ga0157379_10045059
1150 Ga0157379_10336369
1151 Ga0157379_11009806
1152 Ga0157376_10004340
1153 Ga0157376_10265451
1154 Ga0157376_10865592
1155 Ga0163161_10075486
1156 Ga0163161_10643686
1157 Ga0163161_11882688
1158 Ga0206353_10179416
1159 Ga0206353_11362772
1160 Ga0206353_12070973
1161 Ga0213873_10089231
1162 Ga0207713_1086827
1163 Ga0207653_10387942
1164 Ga0207692_10041692
1165 Ga0207692_10046554
1166 Ga0207692_10131230
1167 Ga0207692_10173129
1168 Ga0207710_10260482
1169 Ga0207710_10410689
1170 Ga0207688_10002447
1171 Ga0207685_10251572
1172 Ga0207699_10007103
1173 Ga0207699_10055321
1174 Ga0207699_10389818
1175 Ga0207699_10394489
1176 Ga0207645_10311357
1177 Ga0207645_11114332
1178 Ga0207643_10085466
1179 Ga0207684_10001357
1180 Ga0207684_10001846
1181 Ga0207684_10005848
1182 Ga0207684_10161681
1183 Ga0207684_10333281
1184 Ga0207684_10461660
1185 Ga0207654_10063300
1186 Ga0207654_10637050
1187 Ga0207707_10582047
1188 Ga0207707_10674732
1189 Ga0207707_10714627
1190 Ga0207695_10106395
1191 Ga0207695_10514165
1192 Ga0207671_10099273
1193 Ga0207671_10413053
1194 Ga0207693_10011846
1195 Ga0207693_10022242
1196 Ga0207693_10096553
1197 Ga0207663_10222824
1198 Ga0207663_10247102
1199 Ga0207663_10271787
1200 Ga0207660_10392243
1201 Ga0207657_10002845
1202 Ga0207657_10015127
1203 Ga0207649_10960638
1204 Ga0207652_10497668
1205 Ga0207646_10001416
1206 Ga0207646_10008894
1207 Ga0207646_10336328
1208 Ga0207646_10538526
1209 Ga0207646_11296703
1210 Ga0207681_10565652
1211 Ga0207694_10016140
1212 Ga0207694_10401588
1213 Ga0207650_11764712
1214 Ga0207659_10434871
1215 Ga0207687_10000711
1216 Ga0207687_10181347
1217 Ga0207700_10106229
1218 Ga0207700_10124301
1219 Ga0207700_10172703
1220 Ga0207700_10206201
1221 Ga0207700_10298111
1222 Ga0207700_10558853
1223 Ga0207664_10010860
1224 Ga0207664_10013341
1225 Ga0207664_10037551
1226 Ga0207664_10065779
1227 Ga0207664_10172047
1228 Ga0207664_10214135
1229 Ga0207664_10496796
1230 Ga0207644_10213145
1231 Ga0207690_10287705
1232 Ga0207690_10354643
1233 Ga0207706_10450943
1234 Ga0207706_10970610
1235 Ga0207686_10040376
1236 Ga0207709_10020394
1237 Ga0207709_10124021
1238 Ga0207709_10458377
1239 Ga0207670_11526919
1240 Ga0207704_11496572
1241 Ga0207665_10030553
1242 Ga0207665_10074146
1243 Ga0207691_10634707
1244 Ga0207691_11300047
1245 Ga0207691_11729841
1246 Ga0207711_10351808
1247 Ga0207711_10418379
1248 Ga0207711_10514303
1249 Ga0207711_11607444
1250 Ga0207689_10045020
1251 Ga0207689_10306282
1252 Ga0207661_10400137
1253 Ga0207661_10477361
1254 Ga0207661_10509172
1255 Ga0207661_10919663
1256 Ga0207667_10017784
1257 Ga0207667_10855683
1258 Ga0207667_10911036
1259 Ga0207651_10112116
1260 Ga0207712_10080504
1261 Ga0207712_10166169
1262 Ga0207668_10104245
1263 Ga0207668_10619818
1264 Ga0207640_10111678
1265 Ga0207640_10682247
1266 Ga0207640_11821814
1267 Ga0207658_10528293
1268 Ga0207658_11533783
1269 Ga0207677_10437402
1270 Ga0207703_10024083
1271 Ga0207703_10340079
1272 Ga0207639_10305924
1273 Ga0207639_10544007
1274 Ga0207639_11336484
1275 Ga0207678_10227655
1276 Ga0207678_11331955
1277 Ga0207708_11340404
1278 Ga0207702_10016249
1279 Ga0207702_11087727
1280 Ga0207702_12502408
1281 Ga0207648_10293209
1282 Ga0207648_11015645
1283 Ga0207676_11608569
1284 Ga0207676_12107176
1285 Ga0207674_10505324
1286 Ga0207675_100177172
1287 Ga0207675_100562643
1288 Ga0207683_10056092
1289 Ga0207698_10444210
1290 Ga0207698_10547262
1291 Ga0207698_10896162
1292 Ga0207698_12377291
1293 Ga0268266_10827460
1294 Ga0268264_10622401
1295 Ga0268264_10630310
1296 Ga0265760_10053399
1297 Ga0373948_0044226
1298 Ga0373950_0044001
1299 Ga0373958_0042643
1300 Ga0373926_0000190
1301 Ga0373926_0145794
1302 Ga0373929_0043193
1303 Ga0373934_0051168
1304 Ga0373940_0020119
1305 Ga0373940_0360418
1306 Ga0373944_0002379
1307 Ga0373944_0080483
1308 Ga0373944_0371059
1309 Ga0373949_0177313
1310 Ga0373923_0000224
1311 Ga0373923_0013512
1312 Ga0373932_0012798
1313 Ga0373936_0000374
1314 Ga0373936_0221840
1315 Ga0373936_0305750
1316 Ga0373939_0029486
1317 Ga0373941_0050243
1318 Ga0373945_0001007
1319 Ga0373953_0000462
1320 Ga0373953_0023598
1321 Ga0373953_0110289
1322 Ga0373954_0000725
1323 Ga0373954_0084506
1324 Ga0373956_0002808
1325 Ga0373956_0040506
1326 Ga0373956_0198054
1327 Ga0373956_0520965
1328 Ga0373957_0001454
1329 Ga0373957_0011975
1330 Ga0373957_0018411
1331 Ga0373943_0000279
1332 Ga0373943_0099749
1333 Ga0373943_0283431
1334 Ga0373946_0079946
1335 Ga0373946_0122265
1336 Ga0373946_0189714
1337 Ga0373946_0555499
1338 Ga0373955_0001286
1339 Ga0373955_0009059
1340 Ga0373955_0495627
1341 Ga0373942_0123107
1342 Ga0373942_0308578
1343 Ga0373962_0086958
1344 Ga0373924_0003085
1345 Ga0373924_0026213
1346 Ga0373924_0148613
1347 Ga0373924_0211646
1348 Ga0373931_0157991
1349 Ga0373931_0300691
1350 Ga0373931_0681103
1351 Ga0373931_1127581
1352 Ga0373935_0006058
1353 Ga0373935_0681089
1354 Ga0373927_0000787
1355 Ga0373927_0295056
1356 Ga0373927_0353577
1357 Ga0373927_0558596
1358 Ga0373927_1015007
1359 Ga0373933_0004280
1360 Ga0373933_0063472
1361 Ga0373933_0407276
1362 Ga0373933_0520669
1363 Ga0373947_0092837
1364 Ga0373947_0189775
1365 Ga0373947_0661736
1366 Ga0373937_0022313
1367 Ga0373937_0482459
1368 Ga0373937_0484791
1369 Ga0373937_0923840
1370 Ga0373937_0943851
1371 Ga0372808_018662
1372 Ga0373925_0017114
1373 Ga0373925_0081826
1374 Ga0373925_0137590
1375 Ga0373925_0161454
1376 Ga0373925_0380331
1377 Ga0373925_0600476
1378 Ga0373925_0908376
1379 Ga0395898_0415826
1380 Ga0436364_0702615
1381 Ga0395901_0334182
1382 Ga0242420_137572
1383 Ga0436361_1023671
1384 Ga0436363_1362369
1385 Ga0436362_0119803
1386 Ga0436362_0459129
1387 Ga0436362_0574285
1388 Ga0451833_0364065
1389 Ga0451839_0127947
1390 Ga0451843_0322056
1391 Ga0451853_1391916
1392 Ga0451853_2994508
1393 Ga0451853_3831011
1394 Ga0450888_012043
1395 Ga0439435_0308826
1396 Ga0466961_0519733
1397 Ga0466963_0143853
1398 Ga0466963_0152475
1399 Ga0466963_0709867
1400 Ga0466964_0016818
1401 Ga0466964_0044528
1402 Ga0466964_0068139
1403 Ga0466964_0834515
1404 Ga0466957_0986798
1405 Ga0466960_1028914
1406 Ga0466960_1054432
1407 Ga0466958_0706889
1408 Ga0466967_0184373
1409 Ga0466967_0360482
1410 Ga0466967_1100981
1411 Ga0466967_1771226
1412 Ga0466967_2237718
1413 Ga0495592_0015135
1414 Ga0495592_0019409
1415 Ga0495592_0130471
1416 Ga0495592_0154108
1417 Ga0495592_0239594
1418 Ga0495603_0012040
1419 Ga0495603_0056113
1420 Ga0495603_0095684
1421 Ga0495603_0330615
1422 Ga0495629_0000229
1423 Ga0495629_0002198
1424 Ga0495629_0008917
1425 Ga0495629_0068145
1426 Ga0495641_0001628
1427 Ga0495641_0006898
1428 Ga0495641_0035629
1429 Ga0495641_0182371
1430 Ga0495651_0017178
1431 Ga0495651_0110380
1432 Ga0495651_0131833
1433 Ga0495651_0153770
1434 Ga0495653_0030039
1435 Ga0495653_0036742
1436 Ga0495653_0044255
1437 Ga0495653_0151853
1438 Ga0495653_0159666
1439 Ga0495653_0259276
1440 Ga0495653_0869343
1441 Ga0495580_0013431
1442 Ga0495580_0148774
1443 Ga0495582_0012920
1444 Ga0495582_0034326
1445 Ga0495582_0132191
1446 Ga0495582_0165727
1447 Ga0495639_0000347
1448 Ga0495639_0024477
1449 Ga0495639_0091716
1450 Ga0495662_0000350
1451 Ga0495662_0104758
1452 Ga0495664_0002744
1453 Ga0495664_0044436
1454 Ga0495664_0066909
1455 Ga0495664_0075452
1456 Ga0495664_0139670
1457 Ga0495664_0257457
1458 Ga0495594_0060355
1459 Ga0495594_0264797
1460 Ga0495594_0554705
1461 Ga0495608_0020627
1462 Ga0495608_0043080
1463 Ga0495608_0133857
1464 Ga0495618_0008326
1465 Ga0495618_0014658
1466 Ga0495618_0018376
1467 Ga0495618_0165652
1468 Ga0495618_0187279
1469 Ga0495618_0520112
1470 Ga0495628_0013693
1471 Ga0495628_0039965
1472 Ga0495628_0052026
1473 Ga0495628_0334794
1474 Ga0495628_0375102
1475 Ga0495630_0008052
1476 Ga0495630_0009109
1477 Ga0495630_0082589
1478 Ga0495630_0088749
1479 Ga0495666_0004835
1480 Ga0495666_0033541
1481 Ga0495652_0001732
1482 Ga0495652_0004765
1483 Ga0495652_0042415
1484 Ga0495652_0627846
1485 Ga0495665_0001140
1486 Ga0495665_0005038
1487 Ga0495665_0219484
1488 Ga0495640_0005487
1489 Ga0495640_0008952
1490 Ga0495640_0009794
1491 Ga0495640_0015987
1492 Ga0495640_0040345
1493 Ga0495586_0009551
1494 Ga0495586_0014453
1495 Ga0495586_0018702
1496 Ga0495587_0009033
1497 Ga0495587_0021344
1498 Ga0495587_0024241
1499 Ga0495587_0143090
1500 Ga0495645_0027300
1501 Ga0495645_0130456
1502 Ga0495645_0295319
1503 Ga0495645_0421133
1504 Ga0495622_0262686
1505 Ga0495667_0019524
1506 Ga0495667_0055864
1507 Ga0495667_0355325
1508 Ga0495667_0441659
1509 Ga0495634_0002674
1510 Ga0495634_0044123
1511 Ga0495634_0048975
1512 Ga0495634_0550053
1513 Ga0495635_0013700
1514 Ga0495635_0032547
1515 Ga0495635_0048739
1516 Ga0495635_0096684
1517 Ga0495588_0208433
1518 Ga0495657_0075227
1519 Ga0495657_0185580
1520 Ga0495657_0309630
1521 Ga0495657_0884170
1522 Ga0495599_0002017
1523 Ga0495599_0007619
1524 Ga0495599_0036598
1525 Ga0495599_0074739
1526 Ga0495599_0228177
1527 Ga0495623_0002796
1528 Ga0495623_0048263
1529 Ga0495623_0134372
1530 Ga0495646_0000774
1531 Ga0495646_0024467
1532 Ga0495647_0020669
1533 Ga0495647_0141082
1534 Ga0495658_0039400
1535 Ga0495658_0070987
1536 Ga0495658_0330906
1537 Ga0495613_0033416
1538 Ga0495613_0054307
1539 Ga0495613_0080210
1540 Ga0495624_0017598
1541 Ga0495624_0115502
1542 Ga0495624_0214171
1543 Ga0495600_0001143
1544 Ga0495600_0062315
1545 Ga0495600_0386816
1546 Ga0495600_0599621
1547 Ga0495581_0007390
1548 Ga0495581_0091224
1549 Ga0495581_0401148
1550 Ga0495581_0570005
1551 Ga0495604_0003357
1552 Ga0495604_0061852
1553 Ga0495604_0118552
1554 Ga0495674_0001819
1555 Ga0495674_0004281
1556 Ga0495674_0008850
1557 Ga0495674_0014580
1558 Ga0495674_0021848
1559 Ga0495674_0060755
1560 Ga0495674_0414121
1561 Ga0495676_0026905
1562 Ga0495676_0079281
1563 Ga0495676_0323700
1564 Ga0495676_0748381
1565 Ga0495676_0802143
1566 Ga0495676_0948041
1567 Ga0495680_0003483
1568 Ga0495680_0004400
1569 Ga0495680_0025738
1570 Ga0495680_0244425
1571 Ga0495675_0002634
1572 Ga0495675_0007699
1573 Ga0495684_0002597
1574 Ga0495684_0004492
1575 Ga0495684_0004498
1576 Ga0495684_0100883
1577 Ga0495684_0235469
1578 Ga0495684_0530892
1579 Ga0495593_0002363
1580 Ga0495593_0005458
1581 Ga0495593_0086972
1582 Ga0495593_0397531
1583 Ga0495602_0009228
1584 Ga0495602_0044146
1585 Ga0495602_0125276
1586 Ga0495602_0334578
1587 Ga0495602_0372009
1588 Ga0495614_0008901
1589 Ga0495614_0017954
1590 Ga0495614_0025484
1591 Ga0496100_0016808
1592 Ga0496100_0216584
1593 Ga0496100_0651445
1594 Ga0496100_0988605
1595 Ga0496100_1031401
1596 Ga0496101_0001184
1597 Ga0496101_0039357
1598 Ga0496101_0140636
1599 Ga0496101_0565873
1600 Ga0496101_0895748
1601 Ga0496101_0940303
1602 Ga0496102_0001014
1603 Ga0496102_0041753
1604 Ga0496102_0091832
1605 Ga0496102_0231283
1606 Ga0496102_0318193
1607 Ga0496103_0002279
1608 Ga0496103_0046934
1609 Ga0496103_0085359
1610 Ga0496104_0030236
1611 Ga0496104_0085241
1612 Ga0496104_0117423
1613 Ga0496104_0268271
1614 Ga0496104_0418916
1615 Ga0496105_0006723
1616 Ga0496105_0024359
1617 Ga0496105_0076184
1618 Ga0496105_0105427
1619 Ga0496105_0285912
1620 Ga0496106_0002365
1621 Ga0496106_0055589
1622 Ga0496106_0125083
1623 Ga0496106_0380996
1624 Ga0496106_0554407
1625 Ga0496106_0781317
1626 Ga0496107_0000576
1627 Ga0496107_0041102
1628 Ga0496107_0219699
1629 Ga0496107_1087170
1630 Ga0496107_1222197
1631 Ga0496108_0000504
1632 Ga0496108_0128242
1633 Ga0496108_0190235
1634 Ga0496108_0210112
1635 Ga0496108_0463329
1636 Ga0496108_0463874
1637 Ga0496108_0552459
1638 Ga0496108_0642840
1639 Ga0496108_0742470
1640 Ga0496109_0029002
1641 Ga0496109_0270646
1642 Ga0496109_0402278
1643 Ga0496109_0423470
1644 Ga0496109_0490369
1645 Ga0496109_0612163
1646 Ga0496109_0976989
1647 Ga0496110_0086911
1648 Ga0496110_0215355
1649 Ga0496110_1615840
1650 Ga0496111_0000431
1651 Ga0496111_0017497
1652 Ga0496111_0054250
1653 Ga0496111_0070323
1654 Ga0496111_0233649
1655 Ga0496111_0512989
1656 Ga0496112_0005214
1657 Ga0496112_0007209
1658 Ga0496112_0120968
1659 Ga0496112_0267092
1660 Ga0496113_0000873
1661 Ga0496113_0282109
1662 Ga0496113_0797305
1663 Ga0496114_0018554
1664 Ga0496114_0024253
1665 Ga0496114_0123933
1666 Ga0496114_0147399
1667 Ga0496114_0148786
1668 Ga0496114_0158188
1669 Ga0496115_0004906
1670 Ga0496115_0012001
1671 Ga0496115_0050872
1672 Ga0496115_0201534
1673 Ga0496126_1255975
1674 Ga0501067_0257109
1675 Ga0501069_0452593
1676 nmdc:mga05p37_16060_c1
1677 nmdc:mga05p37_542127_c1
1678 nmdc:mga08y16_78757_c1
1679 nmdc:mga0n895_1967966_c1
1680 nmdc:mga0n895_22503_c1
1681 nmdc:mga0n895_28839_c1
1682 nmdc:mga0n895_377725_c1
1683 nmdc:mga0n895_8474_c1
1684 nmdc:mga0n895_86365_c1
1685 nmdc:mga0rr50_223030_c1
1686 nmdc:mga0rr50_313401_c1
1687 nmdc:mga0rr50_318181_c1
1688 nmdc:mga0rr50_365699_c1
1689 nmdc:mga0rr50_40027_c1
1690 nmdc:mga0rr50_801_c1
1691 nmdc:mga08x19_123117_c1
1692 nmdc:mga08x19_20127_c1
1693 nmdc:mga08x19_388912_c1
1694 nmdc:mga08x19_652214_c1
1695 nmdc:mga08x19_85585_c1
1696 nmdc:mga08x19_948926_c1
1697 nmdc:mga0a205_139810_c1
1698 nmdc:mga0a205_217219_c1
1699 nmdc:mga0a205_346791_c1
1700 Ga0495601_0037304
1701 Ga0495601_0051846
1702 Ga0495601_0073150
1703 Ga0495601_0096372
1704 Ga0495601_0143786
1705 Ga0495601_0477036
1706 Ga0495612_0004948
1707 Ga0495612_0315939
1708 Ga0495655_0101895
1709 Ga0495595_0007539
1710 Ga0495595_0013829
1711 Ga0495595_0034344
1712 Ga0495595_0060976
1713 Ga0495595_0427637
1714 Ga0495619_0001069
1715 Ga0495619_0006015
1716 Ga0495619_0108646
1717 Ga0495619_0199649
1718 Ga0495619_0266086
1719 Ga0495619_0378637
1720 Ga0466962_0073235

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

31

80

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

33

79

0.97

PF12802

MarR_2

MarR family

38

86

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9434 2 73
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.8929 2 87
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.8888 2 87
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8864 4 79
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8844 4 76
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9219 2 80 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9064 2 79 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9057 2 79 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8929 2 87 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8889 10 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A367B945-F1-model_v4 ArsR family transcriptional regulator 0.9665 3 102 GO:0003700
AF-A0A7K0CVW1-F1-model_v4 HTH arsR-type domain-containing protein 0.9643 2 97 GO:0003700
AF-A0A0F0LQT0-F1-model_v4 Transcriptional repressor SdpR 0.9614 2 104 GO:0003700
AF-A0A533VK57-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9583 1 102 GO:0003700
AF-A0A1W9Y3J5-F1-model_v4 deleted 0.9578 2 99

Map