F483751

General Info

Members Datasets Scaffolds Average Seq Length
858 301 1716 165

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0050210|Ga0501031_0050210_872_1453
Length 193
Sequence MSSLIEVSPGPGDRAGGSVRAMAEPGSASTDEREIMTWADFGVASRDVAQMVADDGYEPDMILAIARGGLLIGGALGYALSVKNVYTMNVEFYTGVDERLEVPRILPPAPDFVDLHDARILIADDVADTGHTLRSVQAFSEGKVGEVRTAVLYEKPHSVVRCDYMWKRTDRWINFPWSDQPPVAKREWAVRDA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
105 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
211 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.47
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 6.88
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0050210 3300049568 Bacteria 2718
2 ARcpr5yngRDRAFT_c004194 3300000043 Bacteria 1372
3 ARSoilOldRDRAFT_c007502 3300000044 Bacteria 908
4 ARCol0yngRDRAFT_1005975 3300000652 Bacteria 875
5 JGI24739J22299_10073024 3300001989 Bacteria 1065
6 JGI24735J21928_10068520 3300002067 Bacteria 1017
7 JGI24738J21930_10020222 3300002075 Bacteria 1384
8 JGI24744J21845_10032111 3300002077 Bacteria 1002
9 JGI25406J46586_10006321 3300003203 Bacteria 5463
10 Ga0070658_10108426 3300005327 Bacteria 2299
11 Ga0070658_10405169 3300005327 Bacteria 1172
12 Ga0070676_10089168 3300005328 Bacteria 1886
13 Ga0070683_100019525 3300005329 Bacteria 6021
14 Ga0070683_100061069 3300005329 Bacteria 3504
15 Ga0070683_100098358 3300005329 Bacteria 2754
16 Ga0070683_100130896 3300005329 Bacteria 2374
17 Ga0070683_100167137 3300005329 Bacteria 2087
18 Ga0070683_100338166 3300005329 Unclassified 1433
19 Ga0070683_100342157 3300005329 Bacteria 1424
20 Ga0070683_100366309 3300005329 Bacteria 1372
21 Ga0070683_100912398 3300005329 Bacteria 843
22 Ga0070683_100961962 3300005329 Bacteria 819
23 Ga0070690_100044785 3300005330 Bacteria 2810
24 Ga0070670_100027778 3300005331 Bacteria 4868
25 Ga0070670_100236867 3300005331 Bacteria 1589
26 Ga0070670_101090944 3300005331 Bacteria 728
27 Ga0068869_100323749 3300005334 Bacteria 1251
28 Ga0068869_101188934 3300005334 Bacteria 670
29 Ga0070680_100034670 3300005336 Bacteria 4070
30 Ga0070680_100121089 3300005336 Bacteria 2185
31 Ga0070680_100370515 3300005336 Bacteria 1219
32 Ga0070682_100001656 3300005337 Bacteria 12392
33 Ga0070682_100019378 3300005337 Bacteria 3991
34 Ga0070682_100100224 3300005337 Bacteria 1911
35 Ga0070682_100391227 3300005337 Bacteria 1049
36 Ga0068868_100020712 3300005338 Bacteria 4947
37 Ga0068868_100256618 3300005338 Bacteria 1473
38 Ga0068868_101985017 3300005338 Bacteria 552
39 Ga0070660_100004339 3300005339 Bacteria 9798
40 Ga0070660_100133008 3300005339 Bacteria 1992
41 Ga0070660_100348734 3300005339 Archaea 1219
42 Ga0070660_100411668 3300005339 Bacteria 1119
43 Ga0070660_100456974 3300005339 Bacteria 1060
44 Ga0070689_100009016 3300005340 Bacteria 7061
45 Ga0070689_100048258 3300005340 Bacteria 3284
46 Ga0070689_100582797 3300005340 Bacteria 967
47 Ga0070691_10001881 3300005341 Bacteria 9180
48 Ga0070691_10021601 3300005341 Bacteria 2978
49 Ga0070687_100053165 3300005343 Bacteria 2105
50 Ga0070661_100013355 3300005344 Bacteria 5765
51 Ga0070661_100021799 3300005344 Bacteria 4582
52 Ga0070661_100068934 3300005344 Bacteria 2600
53 Ga0070692_10001291 3300005345 Bacteria 8984
54 Ga0070692_10075965 3300005345 Bacteria 1800
55 Ga0070668_100189671 3300005347 Bacteria 1683
56 Ga0070668_100254557 3300005347 Archaea 1458
57 Ga0070668_100385827 3300005347 Bacteria 1193
58 Ga0070668_100811172 3300005347 Bacteria 832
59 Ga0070675_100012871 3300005354 Bacteria 6565
60 Ga0070675_100045454 3300005354 Bacteria 3593
61 Ga0070675_100217171 3300005354 Bacteria 1664
62 Ga0070675_101209475 3300005354 Bacteria 696
63 Ga0070671_100049330 3300005355 Unclassified 3502
64 Ga0070671_100146536 3300005355 Bacteria 1993
65 Ga0070671_100307107 3300005355 Bacteria 1351
66 Ga0070674_100003211 3300005356 Bacteria 9123
67 Ga0070674_100006449 3300005356 Bacteria 6848
68 Ga0070674_100068836 3300005356 Bacteria 2495
69 Ga0070674_100121656 3300005356 Unclassified 1933
70 Ga0070674_100219146 3300005356 Bacteria 1479
71 Ga0070674_100254739 3300005356 Bacteria 1380
72 Ga0070674_100336875 3300005356 Bacteria 1214
73 Ga0070673_100006650 3300005364 Bacteria 7538
74 Ga0070673_100275064 3300005364 Bacteria 1475
75 Ga0070673_100415747 3300005364 Bacteria 1205
76 Ga0070673_100432842 3300005364 Bacteria 1181
77 Ga0070659_100032365 3300005366 Bacteria 4055
78 Ga0070659_100054442 3300005366 Bacteria 3151
79 Ga0070659_100127687 3300005366 Bacteria 2064
80 Ga0070659_100270447 3300005366 Bacteria 1412
81 Ga0070667_100193653 3300005367 Bacteria 1802
82 Ga0070709_10217870 3300005434 Bacteria 1360
83 Ga0070714_100008050 3300005435 Bacteria 8215
84 Ga0070710_10537006 3300005437 Bacteria 806
85 Ga0070701_10079199 3300005438 Bacteria 1775
86 Ga0070705_100762628 3300005440 Bacteria 766
87 Ga0070700_100019888 3300005441 Bacteria 3880
88 Ga0070700_100034497 3300005441 Bacteria 3056
89 Ga0070700_100213832 3300005441 Bacteria 1362
90 Ga0070694_100404868 3300005444 Bacteria 1069
91 Ga0070694_100539322 3300005444 Bacteria 933
92 Ga0070708_100031077 3300005445 Bacteria 4619
93 Ga0070663_100226977 3300005455 Bacteria 1469
94 Ga0070663_100545327 3300005455 Archaea 969
95 Ga0070678_100016460 3300005456 Bacteria 4732
96 Ga0070678_100122170 3300005456 Bacteria 2055
97 Ga0070678_100168572 3300005456 Bacteria 1781
98 Ga0070662_100027113 3300005457 Bacteria 3974
99 Ga0070662_100088858 3300005457 Bacteria 2317
100 Ga0070662_100673467 3300005457 Bacteria 874
101 Ga0070681_10092989 3300005458 Bacteria 2964
102 Ga0070681_10260082 3300005458 Bacteria 1648
103 Ga0070681_10461439 3300005458 Bacteria 1182
104 Ga0068867_100005741 3300005459 Bacteria 8803
105 Ga0068867_100033616 3300005459 Unclassified 3715
106 Ga0068867_100055679 3300005459 Bacteria 2925
107 Ga0068867_100059303 3300005459 Bacteria 2837
108 Ga0070685_10161115 3300005466 Bacteria 1430
109 Ga0070685_10348257 3300005466 Bacteria 1012
110 Ga0070698_100387718 3300005471 Bacteria 1330
111 Ga0070698_100939893 3300005471 Bacteria 811
112 Ga0070698_100999818 3300005471 Bacteria 784
113 Ga0070679_100030815 3300005530 Bacteria 5299
114 Ga0070679_100070908 3300005530 Bacteria 3475
115 Ga0070679_100174154 3300005530 Bacteria 2124
116 Ga0070679_100388193 3300005530 Bacteria 1343
117 Ga0070684_100010040 3300005535 Bacteria 7484
118 Ga0070684_100080841 3300005535 Bacteria 2875
119 Ga0070684_100087258 3300005535 Bacteria 2770
120 Ga0070684_100301054 3300005535 Bacteria 1471
121 Ga0070684_100587762 3300005535 Bacteria 1035
122 Ga0070684_100631081 3300005535 Bacteria 997
123 Ga0070684_101280561 3300005535 Bacteria 690
124 Ga0068853_100001158 3300005539 Bacteria 18732
125 Ga0068853_101417953 3300005539 Bacteria 672
126 Ga0070672_100018975 3300005543 Bacteria 4983
127 Ga0070672_100022112 3300005543 Bacteria 4664
128 Ga0070672_100114144 3300005543 Bacteria 2205
129 Ga0070672_100916320 3300005543 Bacteria 775
130 Ga0070686_100007401 3300005544 Bacteria 6123
131 Ga0070686_100036787 3300005544 Bacteria 3033
132 Ga0070686_100427829 3300005544 Bacteria 1013
133 Ga0070696_100129504 3300005546 Archaea 1835
134 Ga0070693_100046799 3300005547 Bacteria 2458
135 Ga0070693_100051517 3300005547 Bacteria 2358
136 Ga0070693_100122616 3300005547 Bacteria 1614
137 Ga0070665_100076591 3300005548 Unclassified 3352
138 Ga0070665_100890586 3300005548 Bacteria 903
139 Ga0070704_100006183 3300005549 Bacteria 7036
140 Ga0070704_100429154 3300005549 Archaea 1133
141 Ga0070704_100887781 3300005549 Bacteria 801
142 Ga0068855_100091284 3300005563 Bacteria 3513
143 Ga0070664_100003209 3300005564 Bacteria 13214
144 Ga0070664_100022698 3300005564 Bacteria 5175
145 Ga0070664_100332346 3300005564 Bacteria 1379
146 Ga0068857_100032115 3300005577 Bacteria 4642
147 Ga0068857_100080327 3300005577 Bacteria 2912
148 Ga0068854_100035553 3300005578 Bacteria 3487
149 Ga0068854_100408794 3300005578 Bacteria 1125
150 Ga0068854_100911881 3300005578 Bacteria 773
151 Ga0068856_100088306 3300005614 Bacteria 3082
152 Ga0068856_100111686 3300005614 Bacteria 2730
153 Ga0070702_100021001 3300005615 Bacteria 3429
154 Ga0070702_100028314 3300005615 Bacteria 3036
155 Ga0068852_100009136 3300005616 Bacteria 7341
156 Ga0068852_100078353 3300005616 Unclassified 2923
157 Ga0068852_100249843 3300005616 Bacteria 1699
158 Ga0068852_100444799 3300005616 Bacteria 1282
159 Ga0068852_100483272 3300005616 Bacteria 1231
160 Ga0068852_101224815 3300005616 Bacteria 772
161 Ga0068852_101468392 3300005616 Bacteria 704
162 Ga0068859_100034931 3300005617 Bacteria 5043
163 Ga0068859_100547343 3300005617 Bacteria 1252
164 Ga0068859_101813421 3300005617 Bacteria 674
165 Ga0068864_100292554 3300005618 Bacteria 1523
166 Ga0068864_100938785 3300005618 Bacteria 856
167 Ga0068866_10009925 3300005718 Bacteria 4061
168 Ga0068866_10087624 3300005718 Bacteria 1688
169 Ga0068866_10087829 3300005718 Bacteria 1686
170 Ga0068866_10171181 3300005718 Bacteria 1275
171 Ga0068866_10436220 3300005718 Bacteria 853
172 Ga0068861_100095417 3300005719 Bacteria 2355
173 Ga0068861_100496034 3300005719 Bacteria 1103
174 Ga0068861_100896258 3300005719 Bacteria 840
175 Ga0068861_100968570 3300005719 Bacteria 810
176 Ga0068851_10005547 3300005834 Bacteria 5719
177 Ga0068851_10066553 3300005834 Bacteria 1857
178 Ga0068870_10005839 3300005840 Bacteria 5402
179 Ga0068870_10021453 3300005840 Unclassified 3159
180 Ga0068870_10105176 3300005840 Bacteria 1602
181 Ga0068870_10680169 3300005840 Bacteria 708
182 Ga0068863_100040239 3300005841 Bacteria 4445
183 Ga0068863_100286721 3300005841 Bacteria 1596
184 Ga0068863_101079546 3300005841 Bacteria 807
185 Ga0068860_100014056 3300005843 Bacteria 7852
186 Ga0068860_100067117 3300005843 Bacteria 3409
187 Ga0068860_100409342 3300005843 Bacteria 1343
188 Ga0068862_100289955 3300005844 Bacteria 1502
189 Ga0068862_100417203 3300005844 Bacteria 1259
190 Ga0081455_10066739 3300005937 Bacteria 3002
191 Ga0081455_10068683 3300005937 Bacteria 2949
192 Ga0081455_10076178 3300005937 Bacteria 2764
193 Ga0081455_10086831 3300005937 Bacteria 2547
194 Ga0081455_10117928 3300005937 Bacteria 2097
195 Ga0081455_10138055 3300005937 Bacteria 1897
196 Ga0081539_10003144 3300005985 Bacteria 20994
197 Ga0075365_10020966 3300006038 Bacteria 4066
198 Ga0075365_10175631 3300006038 Bacteria 1496
199 Ga0075365_10603190 3300006038 Bacteria 776
200 Ga0075363_100115793 3300006048 Bacteria 1493
201 Ga0075363_100118507 3300006048 Bacteria 1476
202 Ga0075363_100386593 3300006048 Bacteria 821
203 Ga0075363_100546901 3300006048 Bacteria 690
204 Ga0075364_10004524 3300006051 Bacteria 8010
205 Ga0075364_10011335 3300006051 Bacteria 5416
206 Ga0075364_10081372 3300006051 Bacteria 2141
207 Ga0075364_10099108 3300006051 Bacteria 1939
208 Ga0075364_10102402 3300006051 Bacteria 1906
209 Ga0075432_10000663 3300006058 Bacteria 10543
210 Ga0075362_10020831 3300006177 Bacteria 2743
211 Ga0075367_10049352 3300006178 Bacteria 2481
212 Ga0075367_10107145 3300006178 Bacteria 1713
213 Ga0097621_100438309 3300006237 Bacteria 1175
214 Ga0097621_101109803 3300006237 Bacteria 743
215 Ga0075370_10509195 3300006353 Bacteria 727
216 Ga0068871_100031001 3300006358 Bacteria 4214
217 Ga0068871_100174792 3300006358 Bacteria 1843
218 Ga0075428_100018323 3300006844 Bacteria 7741
219 Ga0075428_100049764 3300006844 Bacteria 4598
220 Ga0075428_100069330 3300006844 Bacteria 3856
221 Ga0075428_101417900 3300006844 Bacteria 729
222 Ga0075431_100293444 3300006847 Bacteria 1644
223 Ga0075433_10023212 3300006852 Bacteria 5218
224 Ga0075433_10237544 3300006852 Bacteria 1618
225 Ga0075433_11216195 3300006852 Bacteria 654
226 Ga0075434_100016009 3300006871 Bacteria 7206
227 Ga0075434_100212383 3300006871 Bacteria 1955
228 Ga0075434_101151849 3300006871 Bacteria 788
229 Ga0075429_100001007 3300006880 Bacteria 22430
230 Ga0075429_100274006 3300006880 Bacteria 1478
231 Ga0068865_100013823 3300006881 Bacteria 5117
232 Ga0068865_100016124 3300006881 Bacteria 4774
233 Ga0068865_100036008 3300006881 Bacteria 3333
234 Ga0068865_100036416 3300006881 Bacteria 3317
235 Ga0068865_100480872 3300006881 Bacteria 1032
236 Ga0097620_100034930 3300006931 Bacteria 5043
237 Ga0097620_100547388 3300006931 Bacteria 1252
238 Ga0097620_101813710 3300006931 Bacteria 674
239 Ga0075435_100119679 3300007076 Bacteria 2197
240 Ga0111539_10043204 3300009094 Bacteria 5404
241 Ga0111539_10103180 3300009094 Bacteria 3347
242 Ga0111539_10186183 3300009094 Bacteria 2424
243 Ga0111539_10210975 3300009094 Bacteria 2263
244 Ga0111539_11200615 3300009094 Bacteria 881
245 Ga0105245_10020177 3300009098 Bacteria 5841
246 Ga0105245_10023575 3300009098 Bacteria 5402
247 Ga0105245_10038814 3300009098 Bacteria 4237
248 Ga0105245_10038911 3300009098 Bacteria 4232
249 Ga0105245_10132391 3300009098 Bacteria 2340
250 Ga0105245_10138888 3300009098 Bacteria 2287
251 Ga0105245_10265015 3300009098 Bacteria 1673
252 Ga0105245_10359724 3300009098 Bacteria 1444
253 Ga0105245_12124198 3300009098 Bacteria 615
254 Ga0105247_10017877 3300009101 Bacteria 4253
255 Ga0105247_10737088 3300009101 Bacteria 745
256 Ga0114129_10086696 3300009147 Bacteria 4342
257 Ga0114129_10185255 3300009147 Bacteria 2830
258 Ga0114129_10214690 3300009147 Bacteria 2598
259 Ga0114129_11066619 3300009147 Bacteria 1013
260 Ga0114129_11432560 3300009147 Bacteria 851
261 Ga0105243_10003343 3300009148 Bacteria 13014
262 Ga0105243_10004107 3300009148 Bacteria 11572
263 Ga0105243_10007376 3300009148 Bacteria 8455
264 Ga0105243_10015679 3300009148 Bacteria 5730
265 Ga0105243_10051640 3300009148 Bacteria 3252
266 Ga0105243_10102279 3300009148 Bacteria 2380
267 Ga0105243_10171365 3300009148 Bacteria 1880
268 Ga0105243_10745802 3300009148 Bacteria 959
269 Ga0105243_12652155 3300009148 Bacteria 541
270 Ga0105241_10723155 3300009174 Bacteria 911
271 Ga0105241_11166864 3300009174 Bacteria 728
272 Ga0105242_10023982 3300009176 Bacteria 4815
273 Ga0105242_10028074 3300009176 Bacteria 4477
274 Ga0105242_10064921 3300009176 Bacteria 3010
275 Ga0105242_10074238 3300009176 Bacteria 2829
276 Ga0105242_10158163 3300009176 Bacteria 1981
277 Ga0105242_12240029 3300009176 Bacteria 592
278 Ga0105248_10011786 3300009177 Bacteria 9646
279 Ga0105248_10082864 3300009177 Bacteria 3608
280 Ga0105248_10114561 3300009177 Bacteria 3041
281 Ga0105248_10726339 3300009177 Bacteria 1121
282 Ga0105248_11455082 3300009177 Bacteria 775
283 Ga0105237_10782946 3300009545 Bacteria 960
284 Ga0105238_10076697 3300009551 Bacteria 3334
285 Ga0105238_10672031 3300009551 Bacteria 1047
286 Ga0105238_11903556 3300009551 Bacteria 628
287 Ga0105249_10063171 3300009553 Bacteria 3401
288 Ga0105249_10081060 3300009553 Bacteria 3016
289 Ga0105249_10255582 3300009553 Bacteria 1739
290 Ga0105249_10362632 3300009553 Bacteria 1471
291 Ga0105249_11231285 3300009553 Bacteria 820
292 Ga0105249_11331117 3300009553 Bacteria 790
293 Ga0105249_11594177 3300009553 Bacteria 725
294 Ga0105239_10017418 3300010375 Bacteria 7945
295 Ga0105239_10030090 3300010375 Bacteria 5970
296 Ga0105239_10039955 3300010375 Bacteria 5139
297 Ga0105239_10083369 3300010375 Bacteria 3521
298 Ga0105239_10579324 3300010375 Bacteria 1279
299 Ga0105239_10752166 3300010375 Bacteria 1116
300 Ga0105239_10820408 3300010375 Bacteria 1066
301 Ga0105246_10013723 3300011119 Bacteria 5082
302 Ga0105246_10053364 3300011119 Bacteria 2781
303 Ga0105246_10066581 3300011119 Bacteria 2522
304 Ga0105246_10091621 3300011119 Bacteria 2192
305 Ga0105246_10142039 3300011119 Bacteria 1806
306 Ga0105246_10370836 3300011119 Bacteria 1179
307 Ga0157347_1036741 3300012502 Bacteria 634
308 Ga0157342_1002468 3300012507 Archaea 1504
309 Ga0157371_10010488 3300013102 Bacteria 7209
310 Ga0157371_11059054 3300013102 Bacteria 621
311 Ga0157370_10117158 3300013104 Bacteria 2488
312 Ga0157369_10032397 3300013105 Bacteria 5749
313 Ga0157369_10596707 3300013105 Bacteria 1140
314 Ga0157369_12066499 3300013105 Bacteria 578
315 Ga0157374_10243014 3300013296 Bacteria 1771
316 Ga0157374_10548291 3300013296 Bacteria 1164
317 Ga0157374_10859438 3300013296 Bacteria 924
318 Ga0157378_10046340 3300013297 Bacteria 3865
319 Ga0157378_10170354 3300013297 Bacteria 2042
320 Ga0157378_10445347 3300013297 Bacteria 1284
321 Ga0157378_10485228 3300013297 Archaea 1232
322 Ga0157378_10595525 3300013297 Bacteria 1116
323 Ga0163162_10130230 3300013306 Bacteria 2624
324 Ga0163162_10251551 3300013306 Bacteria 1899
325 Ga0163162_10660522 3300013306 Archaea 1169
326 Ga0163162_10990092 3300013306 Bacteria 950
327 Ga0157372_10071796 3300013307 Bacteria 3900
328 Ga0157372_10238054 3300013307 Bacteria 2112
329 Ga0157375_10002165 3300013308 Bacteria 16979
330 Ga0157375_10027063 3300013308 Bacteria 5355
331 Ga0157375_10367538 3300013308 Bacteria 1605
332 Ga0157375_10426569 3300013308 Unclassified 1492
333 Ga0157375_10718753 3300013308 Bacteria 1152
334 Ga0157375_10741806 3300013308 Bacteria 1134
335 Ga0157375_10747477 3300013308 Bacteria 1129
336 Ga0157375_12304336 3300013308 Bacteria 642
337 Ga0163163_10064824 3300014325 Bacteria 3625
338 Ga0163163_10113758 3300014325 Bacteria 2736
339 Ga0163163_10138616 3300014325 Bacteria 2474
340 Ga0163163_10607486 3300014325 Bacteria 1157
341 Ga0163163_10638173 3300014325 Bacteria 1128
342 Ga0163163_11513702 3300014325 Bacteria 732
343 Ga0163163_11813315 3300014325 Bacteria 670
344 Ga0163163_12789849 3300014325 Bacteria 545
345 Ga0157380_10008513 3300014326 Bacteria 7330
346 Ga0157380_10028134 3300014326 Bacteria 4282
347 Ga0157380_10246827 3300014326 Bacteria 1613
348 Ga0157377_10001235 3300014745 Bacteria 10929
349 Ga0157377_10008647 3300014745 Bacteria 4971
350 Ga0157377_10020655 3300014745 Bacteria 3453
351 Ga0157377_10053563 3300014745 Bacteria 2282
352 Ga0157377_10758533 3300014745 Bacteria 711
353 Ga0157379_10855885 3300014968 Bacteria 861
354 Ga0157379_10935176 3300014968 Bacteria 824
355 Ga0157376_10005752 3300014969 Bacteria 8685
356 Ga0157376_10138478 3300014969 Bacteria 2181
357 Ga0157376_10287232 3300014969 Archaea 1552
358 Ga0157376_11943188 3300014969 Bacteria 626
359 Ga0163161_10073592 3300017792 Bacteria 2504
360 Ga0206356_11529424 3300020070 Bacteria 1433
361 Ga0206353_10307701 3300020082 Bacteria 1644
362 Ga0206353_10737415 3300020082 Bacteria 2026
363 Ga0224712_10188912 3300022467 Bacteria 932
364 Ga0207666_1001722 3300025271 Bacteria 2599
365 Ga0207656_10012839 3300025321 Bacteria 3190
366 Ga0207656_10035384 3300025321 Bacteria 2091
367 Ga0207642_10014690 3300025899 Bacteria 2897
368 Ga0207642_10016492 3300025899 Bacteria 2784
369 Ga0207642_10341959 3300025899 Bacteria 880
370 Ga0207642_10766201 3300025899 Bacteria 612
371 Ga0207710_10025054 3300025900 Bacteria 2573
372 Ga0207688_10014920 3300025901 Bacteria 4215
373 Ga0207688_10015965 3300025901 Bacteria 4071
374 Ga0207688_10026471 3300025901 Bacteria 3189
375 Ga0207688_10332437 3300025901 Bacteria 934
376 Ga0207688_10349667 3300025901 Bacteria 911
377 Ga0207688_10375582 3300025901 Bacteria 879
378 Ga0207647_10149743 3300025904 Bacteria 1364
379 Ga0207645_10017379 3300025907 Bacteria 4748
380 Ga0207645_10087541 3300025907 Bacteria 2001
381 Ga0207643_10007702 3300025908 Bacteria 5784
382 Ga0207643_10025329 3300025908 Bacteria 3278
383 Ga0207643_10028548 3300025908 Bacteria 3099
384 Ga0207643_10034666 3300025908 Unclassified 2829
385 Ga0207707_10096495 3300025912 Bacteria 2583
386 Ga0207707_10147290 3300025912 Bacteria 2058
387 Ga0207707_10553943 3300025912 Bacteria 977
388 Ga0207671_10397594 3300025914 Bacteria 1096
389 Ga0207660_10042237 3300025917 Bacteria 3199
390 Ga0207660_10131764 3300025917 Bacteria 1903
391 Ga0207662_10142464 3300025918 Bacteria 1519
392 Ga0207662_10151909 3300025918 Bacteria 1473
393 Ga0207657_10002032 3300025919 Bacteria 21869
394 Ga0207657_10041022 3300025919 Bacteria 4095
395 Ga0207657_10342715 3300025919 Bacteria 1179
396 Ga0207657_10365997 3300025919 Bacteria 1136
397 Ga0207657_10749899 3300025919 Bacteria 756
398 Ga0207649_10160751 3300025920 Bacteria 1556
399 Ga0207652_10915154 3300025921 Bacteria 774
400 Ga0207646_10024838 3300025922 Bacteria 5484
401 Ga0207694_10045263 3300025924 Bacteria 3399
402 Ga0207694_10452265 3300025924 Bacteria 1072
403 Ga0207694_10654537 3300025924 Bacteria 885
404 Ga0207650_10026167 3300025925 Bacteria 4159
405 Ga0207650_10226809 3300025925 Bacteria 1505
406 Ga0207650_11592983 3300025925 Bacteria 554
407 Ga0207659_10024638 3300025926 Bacteria 4035
408 Ga0207659_10276543 3300025926 Bacteria 1371
409 Ga0207659_11070951 3300025926 Bacteria 694
410 Ga0207687_10185513 3300025927 Bacteria 1615
411 Ga0207687_11042136 3300025927 Bacteria 702
412 Ga0207664_10034673 3300025929 Bacteria 3888
413 Ga0207644_10145838 3300025931 Bacteria 1827
414 Ga0207644_10804010 3300025931 Bacteria 786
415 Ga0207690_10051286 3300025932 Bacteria 2759
416 Ga0207690_10092388 3300025932 Bacteria 2141
417 Ga0207690_10169675 3300025932 Bacteria 1634
418 Ga0207690_10224388 3300025932 Bacteria 1439
419 Ga0207690_10546090 3300025932 Bacteria 942
420 Ga0207706_10029680 3300025933 Bacteria 4880
421 Ga0207706_10053254 3300025933 Bacteria 3573
422 Ga0207706_10651214 3300025933 Bacteria 902
423 Ga0207686_10014367 3300025934 Bacteria 4405
424 Ga0207686_10021569 3300025934 Bacteria 3699
425 Ga0207686_10168637 3300025934 Bacteria 1542
426 Ga0207709_10004958 3300025935 Bacteria 7619
427 Ga0207709_10008720 3300025935 Bacteria 5595
428 Ga0207709_10031073 3300025935 Bacteria 3114
429 Ga0207709_10068214 3300025935 Unclassified 2247
430 Ga0207709_10100921 3300025935 Bacteria 1908
431 Ga0207670_10057889 3300025936 Bacteria 2630
432 Ga0207669_10009257 3300025937 Bacteria 4679
433 Ga0207669_10042539 3300025937 Bacteria 2653
434 Ga0207669_10137791 3300025937 Bacteria 1689
435 Ga0207669_10173823 3300025937 Bacteria 1536
436 Ga0207669_10606363 3300025937 Bacteria 890
437 Ga0207704_10012739 3300025938 Bacteria 4180
438 Ga0207704_10014165 3300025938 Bacteria 4019
439 Ga0207704_10032864 3300025938 Bacteria 2943
440 Ga0207704_10207394 3300025938 Bacteria 1439
441 Ga0207704_10275087 3300025938 Bacteria 1277
442 Ga0207704_10386372 3300025938 Bacteria 1100
443 Ga0207704_10494236 3300025938 Bacteria 985
444 Ga0207665_10117595 3300025939 Bacteria 1875
445 Ga0207665_10602549 3300025939 Bacteria 858
446 Ga0207691_10002465 3300025940 Bacteria 18090
447 Ga0207691_10024360 3300025940 Bacteria 5693
448 Ga0207691_10120498 3300025940 Bacteria 2326
449 Ga0207711_10043787 3300025941 Bacteria 3820
450 Ga0207711_10069767 3300025941 Bacteria 3047
451 Ga0207711_10564125 3300025941 Bacteria 1062
452 Ga0207689_10030863 3300025942 Bacteria 4465
453 Ga0207689_10041140 3300025942 Bacteria 3824
454 Ga0207689_10189183 3300025942 Bacteria 1698
455 Ga0207689_10970284 3300025942 Bacteria 717
456 Ga0207661_10000378 3300025944 Bacteria 28636
457 Ga0207661_10010797 3300025944 Bacteria 6586
458 Ga0207661_10054833 3300025944 Bacteria 3195
459 Ga0207661_10081462 3300025944 Bacteria 2673
460 Ga0207661_10242197 3300025944 Bacteria 1601
461 Ga0207661_10743751 3300025944 Bacteria 902
462 Ga0207661_11156631 3300025944 Bacteria 712
463 Ga0207679_10071292 3300025945 Bacteria 2621
464 Ga0207679_10092949 3300025945 Bacteria 2338
465 Ga0207679_10363544 3300025945 Bacteria 1264
466 Ga0207679_11067529 3300025945 Bacteria 741
467 Ga0207667_10123392 3300025949 Bacteria 2669
468 Ga0207651_10057048 3300025960 Bacteria 2691
469 Ga0207651_10097383 3300025960 Bacteria 2172
470 Ga0207651_10206644 3300025960 Bacteria 1578
471 Ga0207651_10292168 3300025960 Bacteria 1352
472 Ga0207651_10390515 3300025960 Bacteria 1182
473 Ga0207651_11084931 3300025960 Bacteria 717
474 Ga0207712_10115267 3300025961 Bacteria 2023
475 Ga0207712_10212624 3300025961 Bacteria 1541
476 Ga0207712_10925487 3300025961 Bacteria 771
477 Ga0207668_10209887 3300025972 Bacteria 1557
478 Ga0207668_10437488 3300025972 Bacteria 1113
479 Ga0207640_10069396 3300025981 Bacteria 2366
480 Ga0207640_10159037 3300025981 Bacteria 1669
481 Ga0207640_10330135 3300025981 Bacteria 1218
482 Ga0207658_10092272 3300025986 Bacteria 2352
483 Ga0207658_10152410 3300025986 Bacteria 1885
484 Ga0207677_10296956 3300026023 Bacteria 1333
485 Ga0207677_10641197 3300026023 Bacteria 937
486 Ga0207703_10450011 3300026035 Bacteria 1203
487 Ga0207639_10014042 3300026041 Bacteria 5621
488 Ga0207639_11103999 3300026041 Bacteria 744
489 Ga0207678_10028410 3300026067 Bacteria 4883
490 Ga0207678_10070871 3300026067 Bacteria 2988
491 Ga0207678_10249338 3300026067 Bacteria 1521
492 Ga0207678_10795903 3300026067 Bacteria 834
493 Ga0207708_10015159 3300026075 Bacteria 5776
494 Ga0207708_10073454 3300026075 Bacteria 2621
495 Ga0207708_10443317 3300026075 Bacteria 1080
496 Ga0207702_10028090 3300026078 Bacteria 4674
497 Ga0207702_10109883 3300026078 Bacteria 2449
498 Ga0207702_10128299 3300026078 Bacteria 2279
499 Ga0207702_10482014 3300026078 Bacteria 1207
500 Ga0207641_10799569 3300026088 Bacteria 933
501 Ga0207641_10804325 3300026088 Bacteria 930
502 Ga0207641_11314454 3300026088 Bacteria 724
503 Ga0207648_10004479 3300026089 Bacteria 14336
504 Ga0207648_10005402 3300026089 Bacteria 12881
505 Ga0207648_10044853 3300026089 Bacteria 3879
506 Ga0207648_10070326 3300026089 Unclassified 3051
507 Ga0207648_10089667 3300026089 Bacteria 2687
508 Ga0207648_10138915 3300026089 Bacteria 2141
509 Ga0207676_10027093 3300026095 Bacteria 4265
510 Ga0207676_10282473 3300026095 Bacteria 1508
511 Ga0207676_10559123 3300026095 Bacteria 1094
512 Ga0207676_11489294 3300026095 Bacteria 674
513 Ga0207676_11734861 3300026095 Bacteria 623
514 Ga0207674_10020231 3300026116 Bacteria 7196
515 Ga0207674_10041482 3300026116 Bacteria 4760
516 Ga0207674_10071727 3300026116 Bacteria 3480
517 Ga0207674_10073728 3300026116 Bacteria 3426
518 Ga0207674_10092018 3300026116 Bacteria 3022
519 Ga0207675_100114595 3300026118 Bacteria 2546
520 Ga0207675_100938304 3300026118 Bacteria 882
521 Ga0207683_10048494 3300026121 Bacteria 3719
522 Ga0207683_10086501 3300026121 Bacteria 2787
523 Ga0207683_11379573 3300026121 Bacteria 652
524 Ga0207698_10027887 3300026142 Unclassified 4017
525 Ga0207698_10080794 3300026142 Bacteria 2621
526 Ga0207698_10261060 3300026142 Bacteria 1591
527 Ga0207698_10419712 3300026142 Bacteria 1283
528 Ga0207428_10003934 3300027907 Bacteria 14244
529 Ga0207428_10013309 3300027907 Bacteria 7193
530 Ga0207428_10840643 3300027907 Bacteria 651
531 Ga0268265_10188033 3300028380 Bacteria 1781
532 Ga0268265_10214888 3300028380 Bacteria 1678
533 Ga0268265_10444858 3300028380 Bacteria 1209
534 Ga0268264_10090462 3300028381 Bacteria 2638
535 Ga0268264_10615834 3300028381 Bacteria 1071
536 Ga0307517_10075195 3300028786 Bacteria 2966
537 Ga0265327_10218988 3300031251 Bacteria 856
538 Ga0316579_10141955 3300031691 Bacteria 1158
539 Ga0316576_10004097 3300031727 Bacteria 8687
540 Ga0316576_10053716 3300031727 Bacteria 2936
541 Ga0316576_10068248 3300031727 Bacteria 2619
542 Ga0316576_10068570 3300031727 Bacteria 2613
543 Ga0316576_10217688 3300031727 Bacteria 1437
544 Ga0316576_10239819 3300031727 Bacteria 1362
545 Ga0316576_10409141 3300031727 Bacteria 1005
546 Ga0316578_10014764 3300031728 Bacteria 4184
547 Ga0316578_10022238 3300031728 Bacteria 3532
548 Ga0316578_10287098 3300031728 Bacteria 985
549 Ga0316577_10361797 3300031733 Bacteria 824
550 Ga0307412_10950081 3300031911 Bacteria 756
551 Ga0307409_100586049 3300031995 Bacteria 1100
552 Ga0373930_0012494 3300034816 Archaea 1550
553 Ga0373940_0081211 3300035088 Bacteria 959
554 Ga0373949_0005705 3300035090 Bacteria 2771
555 Ga0373939_0030717 3300035114 Bacteria 1547
556 Ga0373941_0023333 3300035115 Bacteria 1765
557 Ga0373961_0027291 3300035241 Bacteria 1566
558 Ga0373962_0014367 3300035242 Bacteria 2017
559 Ga0316574_0009159 3300035398 Bacteria 5533
560 Ga0316574_0021454 3300035398 Bacteria 3836
561 Ga0316574_0047793 3300035398 Bacteria 2657
562 Ga0316574_0073546 3300035398 Bacteria 2161
563 Ga0316574_0082819 3300035398 Bacteria 2039
564 Ga0316574_0178828 3300035398 Bacteria 1365
565 Ga0373931_0037629 3300035691 Bacteria 2526
566 Ga0373931_0313736 3300035691 Bacteria 972
567 Ga0373931_0336147 3300035691 Bacteria 942
568 Ga0316582_0044864 3300036647 Bacteria 2781
569 Ga0316582_0075414 3300036647 Bacteria 2191
570 Ga0316584_0004980 3300036712 Bacteria 8845
571 Ga0316584_0075168 3300036712 Bacteria 2532
572 Ga0316584_0356630 3300036712 Bacteria 1049
573 Ga0395900_0740367 3300037418 Bacteria 914
574 Ga0395900_0915109 3300037418 Bacteria 800
575 Ga0395898_0526138 3300037466 Bacteria 1124
576 Ga0395898_0873440 3300037466 Bacteria 838
577 Ga0395905_0718479 3300037471 Bacteria 901
578 Ga0395901_0362642 3300038443 Bacteria 1494
579 Ga0395901_0454422 3300038443 Bacteria 1310
580 Ga0395901_0540962 3300038443 Bacteria 1181
581 Ga0395901_0848003 3300038443 Bacteria 899
582 Ga0451791_0065273 3300041451 Bacteria 1257
583 Ga0451798_0707378 3300041458 Bacteria 840
584 Ga0451800_0183764 3300041459 Bacteria 667
585 Ga0451800_1445029 3300041459 Bacteria 575
586 Ga0451835_0611616 3300041492 Bacteria 1035
587 Ga0451849_0209613 3300041505 Bacteria 770
588 Ga0451849_1379231 3300041505 Bacteria 813
589 Ga0451843_1034437 3300041509 Bacteria 1277
590 Ga0451853_0623808 3300041512 Bacteria 1564
591 Ga0439457_025326 3300042014 Bacteria 1313
592 Ga0450914_002668 3300042118 Bacteria 1298
593 Ga0450906_008237 3300042145 Bacteria 2024
594 Ga0439458_0027362 3300042157 Bacteria 1345
595 Ga0439458_0061832 3300042157 Bacteria 936
596 Ga0450908_046858 3300042184 Bacteria 751
597 Ga0451577_0001086 3300042876 Bacteria 38933
598 Ga0466964_0006266 3300044706 Bacteria 4432
599 Ga0466964_0239412 3300044706 Bacteria 889
600 Ga0453684_0048034 3300044712 Bacteria 5651
601 Ga0466970_0216714 3300044765 Bacteria 1068
602 Ga0466967_0039849 3300045976 Bacteria 4042
603 Ga0466967_0263163 3300045976 Bacteria 1650
604 Ga0466967_0422556 3300045976 Bacteria 1299
605 Ga0466967_0927293 3300045976 Bacteria 866
606 Ga0466967_1353149 3300045976 Bacteria 709
607 Ga0466967_1886199 3300045976 Bacteria 594
608 Ga0495603_0016372 3300046455 Unclassified 4485
609 Ga0495603_0126248 3300046455 Bacteria 1491
610 Ga0495603_0535964 3300046455 Bacteria 670
611 Ga0495582_0186350 3300046473 Bacteria 1183
612 Ga0495605_0092737 3300046474 Bacteria 1398
613 Ga0495584_0348948 3300046491 Bacteria 752
614 Ga0495594_0058065 3300046499 Bacteria 2137
615 Ga0495596_0059383 3300046500 Bacteria 1491
616 Ga0495630_0697486 3300046517 Bacteria 777
617 Ga0495631_0276814 3300046518 Bacteria 715
618 Ga0495644_0026028 3300046523 Bacteria 2221
619 Ga0495656_0009724 3300046615 Bacteria 3469
620 Ga0495634_0538734 3300046642 Bacteria 681
621 Ga0495670_0068170 3300046691 Bacteria 1797
622 Ga0495670_0092946 3300046691 Bacteria 1546
623 Ga0495581_0062076 3300047315 Bacteria 2159
624 Ga0495680_1094348 3300047322 Bacteria 504
625 Ga0495677_0273952 3300047445 Bacteria 662
626 Ga0496100_0989942 3300048903 Bacteria 661
627 Ga0496101_0627861 3300048904 Bacteria 849
628 Ga0496102_0061595 3300048905 Bacteria 3434
629 Ga0496102_0170958 3300048905 Bacteria 2046
630 Ga0496102_0908656 3300048905 Bacteria 802
631 Ga0496102_1371266 3300048905 Bacteria 626
632 Ga0496103_0059348 3300048906 Bacteria 2377
633 Ga0496104_0036015 3300048907 Bacteria 4623
634 Ga0496104_0651383 3300048907 Bacteria 962
635 Ga0496104_0655959 3300048907 Bacteria 958
636 Ga0496104_0760075 3300048907 Bacteria 876
637 Ga0496105_0141982 3300048908 Bacteria 1977
638 Ga0496105_0347749 3300048908 Bacteria 1185
639 Ga0496106_0033241 3300048909 Bacteria 3848
640 Ga0496106_0097246 3300048909 Bacteria 2279
641 Ga0496107_0093471 3300048910 Bacteria 2199
642 Ga0496108_0003917 3300048911 Bacteria 11956
643 Ga0496108_0013508 3300048911 Bacteria 6663
644 Ga0496108_0194725 3300048911 Bacteria 1758
645 Ga0496108_0200650 3300048911 Bacteria 1731
646 Ga0496108_0302858 3300048911 Bacteria 1392
647 Ga0496108_0324664 3300048911 Bacteria 1342
648 Ga0496108_0412580 3300048911 Bacteria 1179
649 Ga0496109_0010715 3300048912 Bacteria 7844
650 Ga0496109_0081565 3300048912 Bacteria 2980
651 Ga0496109_0081793 3300048912 Bacteria 2976
652 Ga0496109_0132222 3300048912 Bacteria 2329
653 Ga0496109_0184506 3300048912 Bacteria 1960
654 Ga0496109_0194354 3300048912 Bacteria 1907
655 Ga0496109_0217510 3300048912 Bacteria 1797
656 Ga0496109_0286863 3300048912 Bacteria 1551
657 Ga0496109_1291518 3300048912 Bacteria 666
658 Ga0496110_0000458 3300048913 Bacteria 27729
659 Ga0496110_0012007 3300048913 Bacteria 7116
660 Ga0496110_0037061 3300048913 Bacteria 4237
661 Ga0496110_0084104 3300048913 Bacteria 2840
662 Ga0496110_0423809 3300048913 Bacteria 1213
663 Ga0496111_0000956 3300048914 Bacteria 15811
664 Ga0496111_0003627 3300048914 Bacteria 9572
665 Ga0496111_0018458 3300048914 Bacteria 4834
666 Ga0496111_0030739 3300048914 Bacteria 3820
667 Ga0496111_0324084 3300048914 Bacteria 1141
668 Ga0496112_0138442 3300048915 Bacteria 2404
669 Ga0496112_0246390 3300048915 Bacteria 1739
670 Ga0496112_1373562 3300048915 Bacteria 621
671 Ga0496113_0026032 3300048916 Bacteria 4179
672 Ga0496114_0009771 3300048917 Bacteria 7621
673 Ga0496114_0028778 3300048917 Bacteria 4562
674 Ga0496114_0061816 3300048917 Bacteria 3134
675 Ga0496114_0073741 3300048917 Bacteria 2873
676 Ga0496114_0235138 3300048917 Bacteria 1610
677 Ga0496114_0334667 3300048917 Bacteria 1338
678 Ga0496114_0833213 3300048917 Bacteria 802
679 Ga0496114_0893434 3300048917 Bacteria 769
680 Ga0496114_1234734 3300048917 Bacteria 634
681 Ga0501031_0094532 3300049568 Bacteria 1950
682 Ga0501031_0258755 3300049568 Bacteria 1131
683 Ga0501032_0042269 3300049569 Bacteria 3092
684 Ga0501033_0084889 3300049570 Bacteria 2320
685 Ga0501034_0004464 3300049571 Bacteria 15560
686 Ga0501036_0055383 3300049572 Bacteria 3359
687 Ga0501036_0068908 3300049572 Bacteria 2993
688 Ga0501036_0345509 3300049572 Bacteria 1243
689 Ga0501036_1219536 3300049572 Bacteria 613
690 Ga0501037_0087513 3300049573 Bacteria 2255
691 Ga0501037_0102137 3300049573 Bacteria 2068
692 Ga0501038_0025542 3300049574 Bacteria 5264
693 Ga0501038_0105267 3300049574 Bacteria 2344
694 Ga0501038_0242458 3300049574 Bacteria 1431
695 Ga0501038_0372254 3300049574 Bacteria 1109
696 Ga0501038_0859116 3300049574 Bacteria 672
697 Ga0501039_0020755 3300049575 Bacteria 5034
698 Ga0501039_0023675 3300049575 Bacteria 4714
699 Ga0501039_0184542 3300049575 Bacteria 1640
700 Ga0501039_0314059 3300049575 Bacteria 1232
701 Ga0501039_0649476 3300049575 Bacteria 826
702 Ga0501040_0019808 3300049576 Bacteria 4477
703 Ga0501040_0079076 3300049576 Bacteria 2276
704 Ga0501040_0095225 3300049576 Bacteria 2072
705 Ga0501040_1050927 3300049576 Bacteria 590
706 Ga0501041_0038056 3300049577 Bacteria 2916
707 Ga0501041_0082858 3300049577 Bacteria 1976
708 Ga0501041_0134741 3300049577 Bacteria 1539
709 Ga0501041_0159301 3300049577 Bacteria 1411
710 Ga0501041_0793289 3300049577 Bacteria 607
711 Ga0501042_0008331 3300049578 Bacteria 6836
712 Ga0501042_0020864 3300049578 Bacteria 4561
713 Ga0501042_0060157 3300049578 Bacteria 2713
714 Ga0501042_0218369 3300049578 Bacteria 1375
715 Ga0501042_0430078 3300049578 Bacteria 957
716 Ga0501043_0058256 3300049579 Bacteria 3032
717 Ga0501046_0015057 3300049580 Bacteria 6503
718 Ga0501046_0059031 3300049580 Bacteria 3006
719 Ga0501046_0698777 3300049580 Bacteria 715
720 Ga0501048_0008074 3300049582 Bacteria 7967
721 Ga0501048_0124155 3300049582 Bacteria 1825
722 Ga0501048_0152144 3300049582 Bacteria 1637
723 Ga0501048_0206452 3300049582 Bacteria 1393
724 Ga0501048_0405200 3300049582 Bacteria 975
725 Ga0501067_0004221 3300049583 Bacteria 7927
726 Ga0501067_0087300 3300049583 Bacteria 1731
727 Ga0501067_0136347 3300049583 Bacteria 1367
728 Ga0501068_0007031 3300049584 Bacteria 6227
729 Ga0501068_0081490 3300049584 Bacteria 1987
730 Ga0501068_0334819 3300049584 Bacteria 971
731 Ga0501068_0461888 3300049584 Bacteria 822
732 Ga0501069_0033380 3300049585 Bacteria 2835
733 Ga0501069_0117636 3300049585 Bacteria 1516
734 Ga0501069_0196652 3300049585 Bacteria 1168
735 Ga0501069_0629214 3300049585 Bacteria 645
736 Ga0501070_0021964 3300049586 Bacteria 5346
737 Ga0501070_0070329 3300049586 Bacteria 2898
738 Ga0501070_0456339 3300049586 Bacteria 1030
739 Ga0501071_0012620 3300049587 Bacteria 5738
740 Ga0501071_0016611 3300049587 Bacteria 5063
741 Ga0501071_0021251 3300049587 Bacteria 4517
742 Ga0501071_0093646 3300049587 Bacteria 2209
743 Ga0501071_0120478 3300049587 Bacteria 1945
744 Ga0501071_0146088 3300049587 Bacteria 1763
745 Ga0501071_0639913 3300049587 Bacteria 818
746 Ga0501072_0007554 3300049588 Bacteria 8251
747 Ga0501072_0029993 3300049588 Bacteria 4250
748 Ga0501072_0071202 3300049588 Bacteria 2747
749 Ga0501072_0298758 3300049588 Bacteria 1280
750 Ga0501072_0303035 3300049588 Bacteria 1270
751 Ga0501072_0446815 3300049588 Bacteria 1024
752 Ga0501073_0025695 3300049589 Bacteria 4220
753 Ga0501073_0378261 3300049589 Bacteria 978
754 Ga0501074_0017542 3300049590 Bacteria 5196
755 Ga0501074_0045835 3300049590 Bacteria 3162
756 Ga0501074_0151005 3300049590 Bacteria 1661
757 Ga0501075_0022002 3300049591 Bacteria 4655
758 Ga0501075_0024164 3300049591 Bacteria 4452
759 Ga0501075_0024588 3300049591 Bacteria 4420
760 Ga0501075_0085160 3300049591 Bacteria 2394
761 Ga0501075_0124703 3300049591 Bacteria 1960
762 Ga0501075_0525909 3300049591 Bacteria 903
763 Ga0501076_0070718 3300049592 Bacteria 2790
764 Ga0501076_0082897 3300049592 Bacteria 2574
765 Ga0501076_0205341 3300049592 Bacteria 1609
766 Ga0501076_0383584 3300049592 Bacteria 1155
767 Ga0501076_0617414 3300049592 Bacteria 894
768 Ga0501076_0826036 3300049592 Bacteria 764
769 Ga0501077_0012656 3300049593 Bacteria 5283
770 Ga0501077_0015180 3300049593 Bacteria 4844
771 Ga0501077_0058318 3300049593 Bacteria 2451
772 Ga0501077_0090342 3300049593 Bacteria 1941
773 Ga0501077_0478552 3300049593 Bacteria 798
774 Ga0501079_0012750 3300049741 Bacteria 6420
775 Ga0501079_0018270 3300049741 Bacteria 5357
776 Ga0501079_0074606 3300049741 Bacteria 2622
777 Ga0501079_0185712 3300049741 Bacteria 1623
778 Ga0501079_0307163 3300049741 Bacteria 1241
779 Ga0501079_0673891 3300049741 Bacteria 814
780 Ga0501080_0001056 3300049742 Bacteria 22640
781 Ga0501080_0014436 3300049742 Bacteria 7276
782 Ga0501081_0007772 3300049743 Bacteria 6952
783 Ga0501081_0091601 3300049743 Bacteria 2138
784 Ga0501081_0240593 3300049743 Bacteria 1320
785 Ga0501081_0402299 3300049743 Bacteria 1014
786 Ga0501081_0522410 3300049743 Bacteria 885
787 Ga0501081_0667881 3300049743 Bacteria 779
788 Ga0501083_0044846 3300049744 Bacteria 2993
789 Ga0501083_0679372 3300049744 Bacteria 670
790 Ga0501083_0689554 3300049744 Bacteria 664
791 Ga0501035_0014199 3300049822 Bacteria 7351
792 Ga0501044_0224933 3300049823 Bacteria 1826
793 Ga0501044_0244395 3300049823 Bacteria 1738
794 Ga0501045_0007043 3300049824 Bacteria 7795
795 Ga0501045_0014822 3300049824 Bacteria 5529
796 Ga0501045_0036736 3300049824 Bacteria 3558
797 Ga0501045_0081118 3300049824 Bacteria 2392
798 Ga0501045_0084614 3300049824 Bacteria 2340
799 Ga0501045_0145524 3300049824 Bacteria 1763
800 Ga0501045_0420889 3300049824 Bacteria 994
801 nmdc:mga03683_43895_c1 3300050489 Bacteria 1846
802 nmdc:mga03n38_239521_c1 3300050490 Bacteria 954
803 nmdc:mga00v17_674009_c1 3300050491 Bacteria 664
804 nmdc:mga0yw44_242221_c1 3300050492 Bacteria 1199
805 nmdc:mga0yw44_24759_c1 3300050492 Bacteria 3402
806 nmdc:mga0yw44_450757_c1 3300050492 Bacteria 872
807 nmdc:mga0yw44_535651_c1 3300050492 Bacteria 795
808 nmdc:mga0yw44_805473_c1 3300050492 Bacteria 638
809 nmdc:mga06z11_200666_c1 3300050494 Bacteria 1158
810 nmdc:mga06z11_853795_c1 3300050494 Bacteria 555
811 nmdc:mga05p37_280887_c1 3300050507 Bacteria 1986
812 nmdc:mga05p37_286787_c1 3300050507 Bacteria 1961
813 nmdc:mga09592_1249985_c1 3300050508 Bacteria 612
814 nmdc:mga09592_1673_c1 3300050508 Bacteria 17864
815 nmdc:mga09592_955061_c1 3300050508 Bacteria 718
816 nmdc:mga06r32_141249_c1 3300050510 Bacteria 2384
817 nmdc:mga08y16_10044_c1 3300050511 Bacteria 9934
818 nmdc:mga08y16_101635_c1 3300050511 Bacteria 2993
819 nmdc:mga08y16_145482_c1 3300050511 Bacteria 2464
820 nmdc:mga08y16_166074_c1 3300050511 Bacteria 2293
821 nmdc:mga08y16_7890_c1 3300050511 Bacteria 11140
822 nmdc:mga0n895_1047166_c1 3300050512 Bacteria 795
823 nmdc:mga0n895_2010662_c1 3300050512 Bacteria 535
824 nmdc:mga0n895_31482_c1 3300050512 Bacteria 5080
825 nmdc:mga0rr50_102781_c1 3300050513 Bacteria 2248
826 nmdc:mga08x19_328399_c1 3300050514 Bacteria 1065
827 nmdc:mga0a205_33992_c1 3300050515 Bacteria 4891
828 nmdc:mga0a205_3573_c1 3300050515 Bacteria 13922
829 nmdc:mga0a205_62290_c1 3300050515 Bacteria 3604
830 nmdc:mga0sz30_91878_c1 3300050516 Bacteria 1321
831 Ga0500628_150923 3300053129 Bacteria 650
832 Ga0500568_0020573 3300053139 Bacteria 2852
833 Ga0500616_0000190 3300053153 Bacteria 100836
834 Ga0501084_0010572 3300054114 Bacteria 7636
835 Ga0501084_0014036 3300054114 Bacteria 6634
836 Ga0501084_0044524 3300054114 Bacteria 3715
837 Ga0501084_0083553 3300054114 Bacteria 2680
838 Ga0501084_0205614 3300054114 Bacteria 1661
839 Ga0501084_0207758 3300054114 Bacteria 1652
840 Ga0501084_0417381 3300054114 Bacteria 1134
841 Ga0501084_0484658 3300054114 Bacteria 1045
842 Ga0501084_0720686 3300054114 Bacteria 841
843 Ga0501082_0015579 3300060353 Bacteria 6545
844 Ga0501082_0040062 3300060353 Bacteria 4042
845 Ga0501082_0140580 3300060353 Bacteria 2095
846 Ga0501082_0143011 3300060353 Bacteria 2076
847 Ga0501082_0172757 3300060353 Bacteria 1879
848 Ga0501082_0351926 3300060353 Bacteria 1284
849 Ga0530510_0039641 3300061734 Bacteria 3400
850 Ga0530510_0044133 3300061734 Bacteria 3221
851 Ga0530510_0095000 3300061734 Bacteria 2177
852 Ga0530510_0098461 3300061734 Bacteria 2138
853 Ga0530510_0128807 3300061734 Bacteria 1861
854 Ga0530510_0132578 3300061734 Bacteria 1834
855 Ga0530510_0134398 3300061734 Bacteria 1820
856 Ga0530510_0373849 3300061734 Bacteria 1072
857 Ga0530510_1163505 3300061734 Bacteria 591
858 2919449746 2919446982 Bacteria 3994487
859 Ga0501031_0050210
860 ARcpr5yngRDRAFT_c004194
861 ARSoilOldRDRAFT_c007502
862 ARCol0yngRDRAFT_1005975
863 JGI24739J22299_10073024
864 JGI24735J21928_10068520
865 JGI24738J21930_10020222
866 JGI24744J21845_10032111
867 JGI25406J46586_10006321
868 Ga0070658_10108426
869 Ga0070658_10405169
870 Ga0070676_10089168
871 Ga0070683_100019525
872 Ga0070683_100061069
873 Ga0070683_100098358
874 Ga0070683_100130896
875 Ga0070683_100167137
876 Ga0070683_100338166
877 Ga0070683_100342157
878 Ga0070683_100366309
879 Ga0070683_100912398
880 Ga0070683_100961962
881 Ga0070690_100044785
882 Ga0070670_100027778
883 Ga0070670_100236867
884 Ga0070670_101090944
885 Ga0068869_100323749
886 Ga0068869_101188934
887 Ga0070680_100034670
888 Ga0070680_100121089
889 Ga0070680_100370515
890 Ga0070682_100001656
891 Ga0070682_100019378
892 Ga0070682_100100224
893 Ga0070682_100391227
894 Ga0068868_100020712
895 Ga0068868_100256618
896 Ga0068868_101985017
897 Ga0070660_100004339
898 Ga0070660_100133008
899 Ga0070660_100348734
900 Ga0070660_100411668
901 Ga0070660_100456974
902 Ga0070689_100009016
903 Ga0070689_100048258
904 Ga0070689_100582797
905 Ga0070691_10001881
906 Ga0070691_10021601
907 Ga0070687_100053165
908 Ga0070661_100013355
909 Ga0070661_100021799
910 Ga0070661_100068934
911 Ga0070692_10001291
912 Ga0070692_10075965
913 Ga0070668_100189671
914 Ga0070668_100254557
915 Ga0070668_100385827
916 Ga0070668_100811172
917 Ga0070675_100012871
918 Ga0070675_100045454
919 Ga0070675_100217171
920 Ga0070675_101209475
921 Ga0070671_100049330
922 Ga0070671_100146536
923 Ga0070671_100307107
924 Ga0070674_100003211
925 Ga0070674_100006449
926 Ga0070674_100068836
927 Ga0070674_100121656
928 Ga0070674_100219146
929 Ga0070674_100254739
930 Ga0070674_100336875
931 Ga0070673_100006650
932 Ga0070673_100275064
933 Ga0070673_100415747
934 Ga0070673_100432842
935 Ga0070659_100032365
936 Ga0070659_100054442
937 Ga0070659_100127687
938 Ga0070659_100270447
939 Ga0070667_100193653
940 Ga0070709_10217870
941 Ga0070714_100008050
942 Ga0070710_10537006
943 Ga0070701_10079199
944 Ga0070705_100762628
945 Ga0070700_100019888
946 Ga0070700_100034497
947 Ga0070700_100213832
948 Ga0070694_100404868
949 Ga0070694_100539322
950 Ga0070708_100031077
951 Ga0070663_100226977
952 Ga0070663_100545327
953 Ga0070678_100016460
954 Ga0070678_100122170
955 Ga0070678_100168572
956 Ga0070662_100027113
957 Ga0070662_100088858
958 Ga0070662_100673467
959 Ga0070681_10092989
960 Ga0070681_10260082
961 Ga0070681_10461439
962 Ga0068867_100005741
963 Ga0068867_100033616
964 Ga0068867_100055679
965 Ga0068867_100059303
966 Ga0070685_10161115
967 Ga0070685_10348257
968 Ga0070698_100387718
969 Ga0070698_100939893
970 Ga0070698_100999818
971 Ga0070679_100030815
972 Ga0070679_100070908
973 Ga0070679_100174154
974 Ga0070679_100388193
975 Ga0070684_100010040
976 Ga0070684_100080841
977 Ga0070684_100087258
978 Ga0070684_100301054
979 Ga0070684_100587762
980 Ga0070684_100631081
981 Ga0070684_101280561
982 Ga0068853_100001158
983 Ga0068853_101417953
984 Ga0070672_100018975
985 Ga0070672_100022112
986 Ga0070672_100114144
987 Ga0070672_100916320
988 Ga0070686_100007401
989 Ga0070686_100036787
990 Ga0070686_100427829
991 Ga0070696_100129504
992 Ga0070693_100046799
993 Ga0070693_100051517
994 Ga0070693_100122616
995 Ga0070665_100076591
996 Ga0070665_100890586
997 Ga0070704_100006183
998 Ga0070704_100429154
999 Ga0070704_100887781
1000 Ga0068855_100091284
1001 Ga0070664_100003209
1002 Ga0070664_100022698
1003 Ga0070664_100332346
1004 Ga0068857_100032115
1005 Ga0068857_100080327
1006 Ga0068854_100035553
1007 Ga0068854_100408794
1008 Ga0068854_100911881
1009 Ga0068856_100088306
1010 Ga0068856_100111686
1011 Ga0070702_100021001
1012 Ga0070702_100028314
1013 Ga0068852_100009136
1014 Ga0068852_100078353
1015 Ga0068852_100249843
1016 Ga0068852_100444799
1017 Ga0068852_100483272
1018 Ga0068852_101224815
1019 Ga0068852_101468392
1020 Ga0068859_100034931
1021 Ga0068859_100547343
1022 Ga0068859_101813421
1023 Ga0068864_100292554
1024 Ga0068864_100938785
1025 Ga0068866_10009925
1026 Ga0068866_10087624
1027 Ga0068866_10087829
1028 Ga0068866_10171181
1029 Ga0068866_10436220
1030 Ga0068861_100095417
1031 Ga0068861_100496034
1032 Ga0068861_100896258
1033 Ga0068861_100968570
1034 Ga0068851_10005547
1035 Ga0068851_10066553
1036 Ga0068870_10005839
1037 Ga0068870_10021453
1038 Ga0068870_10105176
1039 Ga0068870_10680169
1040 Ga0068863_100040239
1041 Ga0068863_100286721
1042 Ga0068863_101079546
1043 Ga0068860_100014056
1044 Ga0068860_100067117
1045 Ga0068860_100409342
1046 Ga0068862_100289955
1047 Ga0068862_100417203
1048 Ga0081455_10066739
1049 Ga0081455_10068683
1050 Ga0081455_10076178
1051 Ga0081455_10086831
1052 Ga0081455_10117928
1053 Ga0081455_10138055
1054 Ga0081539_10003144
1055 Ga0075365_10020966
1056 Ga0075365_10175631
1057 Ga0075365_10603190
1058 Ga0075363_100115793
1059 Ga0075363_100118507
1060 Ga0075363_100386593
1061 Ga0075363_100546901
1062 Ga0075364_10004524
1063 Ga0075364_10011335
1064 Ga0075364_10081372
1065 Ga0075364_10099108
1066 Ga0075364_10102402
1067 Ga0075432_10000663
1068 Ga0075362_10020831
1069 Ga0075367_10049352
1070 Ga0075367_10107145
1071 Ga0097621_100438309
1072 Ga0097621_101109803
1073 Ga0075370_10509195
1074 Ga0068871_100031001
1075 Ga0068871_100174792
1076 Ga0075428_100018323
1077 Ga0075428_100049764
1078 Ga0075428_100069330
1079 Ga0075428_101417900
1080 Ga0075431_100293444
1081 Ga0075433_10023212
1082 Ga0075433_10237544
1083 Ga0075433_11216195
1084 Ga0075434_100016009
1085 Ga0075434_100212383
1086 Ga0075434_101151849
1087 Ga0075429_100001007
1088 Ga0075429_100274006
1089 Ga0068865_100013823
1090 Ga0068865_100016124
1091 Ga0068865_100036008
1092 Ga0068865_100036416
1093 Ga0068865_100480872
1094 Ga0097620_100034930
1095 Ga0097620_100547388
1096 Ga0097620_101813710
1097 Ga0075435_100119679
1098 Ga0111539_10043204
1099 Ga0111539_10103180
1100 Ga0111539_10186183
1101 Ga0111539_10210975
1102 Ga0111539_11200615
1103 Ga0105245_10020177
1104 Ga0105245_10023575
1105 Ga0105245_10038814
1106 Ga0105245_10038911
1107 Ga0105245_10132391
1108 Ga0105245_10138888
1109 Ga0105245_10265015
1110 Ga0105245_10359724
1111 Ga0105245_12124198
1112 Ga0105247_10017877
1113 Ga0105247_10737088
1114 Ga0114129_10086696
1115 Ga0114129_10185255
1116 Ga0114129_10214690
1117 Ga0114129_11066619
1118 Ga0114129_11432560
1119 Ga0105243_10003343
1120 Ga0105243_10004107
1121 Ga0105243_10007376
1122 Ga0105243_10015679
1123 Ga0105243_10051640
1124 Ga0105243_10102279
1125 Ga0105243_10171365
1126 Ga0105243_10745802
1127 Ga0105243_12652155
1128 Ga0105241_10723155
1129 Ga0105241_11166864
1130 Ga0105242_10023982
1131 Ga0105242_10028074
1132 Ga0105242_10064921
1133 Ga0105242_10074238
1134 Ga0105242_10158163
1135 Ga0105242_12240029
1136 Ga0105248_10011786
1137 Ga0105248_10082864
1138 Ga0105248_10114561
1139 Ga0105248_10726339
1140 Ga0105248_11455082
1141 Ga0105237_10782946
1142 Ga0105238_10076697
1143 Ga0105238_10672031
1144 Ga0105238_11903556
1145 Ga0105249_10063171
1146 Ga0105249_10081060
1147 Ga0105249_10255582
1148 Ga0105249_10362632
1149 Ga0105249_11231285
1150 Ga0105249_11331117
1151 Ga0105249_11594177
1152 Ga0105239_10017418
1153 Ga0105239_10030090
1154 Ga0105239_10039955
1155 Ga0105239_10083369
1156 Ga0105239_10579324
1157 Ga0105239_10752166
1158 Ga0105239_10820408
1159 Ga0105246_10013723
1160 Ga0105246_10053364
1161 Ga0105246_10066581
1162 Ga0105246_10091621
1163 Ga0105246_10142039
1164 Ga0105246_10370836
1165 Ga0157347_1036741
1166 Ga0157342_1002468
1167 Ga0157371_10010488
1168 Ga0157371_11059054
1169 Ga0157370_10117158
1170 Ga0157369_10032397
1171 Ga0157369_10596707
1172 Ga0157369_12066499
1173 Ga0157374_10243014
1174 Ga0157374_10548291
1175 Ga0157374_10859438
1176 Ga0157378_10046340
1177 Ga0157378_10170354
1178 Ga0157378_10445347
1179 Ga0157378_10485228
1180 Ga0157378_10595525
1181 Ga0163162_10130230
1182 Ga0163162_10251551
1183 Ga0163162_10660522
1184 Ga0163162_10990092
1185 Ga0157372_10071796
1186 Ga0157372_10238054
1187 Ga0157375_10002165
1188 Ga0157375_10027063
1189 Ga0157375_10367538
1190 Ga0157375_10426569
1191 Ga0157375_10718753
1192 Ga0157375_10741806
1193 Ga0157375_10747477
1194 Ga0157375_12304336
1195 Ga0163163_10064824
1196 Ga0163163_10113758
1197 Ga0163163_10138616
1198 Ga0163163_10607486
1199 Ga0163163_10638173
1200 Ga0163163_11513702
1201 Ga0163163_11813315
1202 Ga0163163_12789849
1203 Ga0157380_10008513
1204 Ga0157380_10028134
1205 Ga0157380_10246827
1206 Ga0157377_10001235
1207 Ga0157377_10008647
1208 Ga0157377_10020655
1209 Ga0157377_10053563
1210 Ga0157377_10758533
1211 Ga0157379_10855885
1212 Ga0157379_10935176
1213 Ga0157376_10005752
1214 Ga0157376_10138478
1215 Ga0157376_10287232
1216 Ga0157376_11943188
1217 Ga0163161_10073592
1218 Ga0206356_11529424
1219 Ga0206353_10307701
1220 Ga0206353_10737415
1221 Ga0224712_10188912
1222 Ga0207666_1001722
1223 Ga0207656_10012839
1224 Ga0207656_10035384
1225 Ga0207642_10014690
1226 Ga0207642_10016492
1227 Ga0207642_10341959
1228 Ga0207642_10766201
1229 Ga0207710_10025054
1230 Ga0207688_10014920
1231 Ga0207688_10015965
1232 Ga0207688_10026471
1233 Ga0207688_10332437
1234 Ga0207688_10349667
1235 Ga0207688_10375582
1236 Ga0207647_10149743
1237 Ga0207645_10017379
1238 Ga0207645_10087541
1239 Ga0207643_10007702
1240 Ga0207643_10025329
1241 Ga0207643_10028548
1242 Ga0207643_10034666
1243 Ga0207707_10096495
1244 Ga0207707_10147290
1245 Ga0207707_10553943
1246 Ga0207671_10397594
1247 Ga0207660_10042237
1248 Ga0207660_10131764
1249 Ga0207662_10142464
1250 Ga0207662_10151909
1251 Ga0207657_10002032
1252 Ga0207657_10041022
1253 Ga0207657_10342715
1254 Ga0207657_10365997
1255 Ga0207657_10749899
1256 Ga0207649_10160751
1257 Ga0207652_10915154
1258 Ga0207646_10024838
1259 Ga0207694_10045263
1260 Ga0207694_10452265
1261 Ga0207694_10654537
1262 Ga0207650_10026167
1263 Ga0207650_10226809
1264 Ga0207650_11592983
1265 Ga0207659_10024638
1266 Ga0207659_10276543
1267 Ga0207659_11070951
1268 Ga0207687_10185513
1269 Ga0207687_11042136
1270 Ga0207664_10034673
1271 Ga0207644_10145838
1272 Ga0207644_10804010
1273 Ga0207690_10051286
1274 Ga0207690_10092388
1275 Ga0207690_10169675
1276 Ga0207690_10224388
1277 Ga0207690_10546090
1278 Ga0207706_10029680
1279 Ga0207706_10053254
1280 Ga0207706_10651214
1281 Ga0207686_10014367
1282 Ga0207686_10021569
1283 Ga0207686_10168637
1284 Ga0207709_10004958
1285 Ga0207709_10008720
1286 Ga0207709_10031073
1287 Ga0207709_10068214
1288 Ga0207709_10100921
1289 Ga0207670_10057889
1290 Ga0207669_10009257
1291 Ga0207669_10042539
1292 Ga0207669_10137791
1293 Ga0207669_10173823
1294 Ga0207669_10606363
1295 Ga0207704_10012739
1296 Ga0207704_10014165
1297 Ga0207704_10032864
1298 Ga0207704_10207394
1299 Ga0207704_10275087
1300 Ga0207704_10386372
1301 Ga0207704_10494236
1302 Ga0207665_10117595
1303 Ga0207665_10602549
1304 Ga0207691_10002465
1305 Ga0207691_10024360
1306 Ga0207691_10120498
1307 Ga0207711_10043787
1308 Ga0207711_10069767
1309 Ga0207711_10564125
1310 Ga0207689_10030863
1311 Ga0207689_10041140
1312 Ga0207689_10189183
1313 Ga0207689_10970284
1314 Ga0207661_10000378
1315 Ga0207661_10010797
1316 Ga0207661_10054833
1317 Ga0207661_10081462
1318 Ga0207661_10242197
1319 Ga0207661_10743751
1320 Ga0207661_11156631
1321 Ga0207679_10071292
1322 Ga0207679_10092949
1323 Ga0207679_10363544
1324 Ga0207679_11067529
1325 Ga0207667_10123392
1326 Ga0207651_10057048
1327 Ga0207651_10097383
1328 Ga0207651_10206644
1329 Ga0207651_10292168
1330 Ga0207651_10390515
1331 Ga0207651_11084931
1332 Ga0207712_10115267
1333 Ga0207712_10212624
1334 Ga0207712_10925487
1335 Ga0207668_10209887
1336 Ga0207668_10437488
1337 Ga0207640_10069396
1338 Ga0207640_10159037
1339 Ga0207640_10330135
1340 Ga0207658_10092272
1341 Ga0207658_10152410
1342 Ga0207677_10296956
1343 Ga0207677_10641197
1344 Ga0207703_10450011
1345 Ga0207639_10014042
1346 Ga0207639_11103999
1347 Ga0207678_10028410
1348 Ga0207678_10070871
1349 Ga0207678_10249338
1350 Ga0207678_10795903
1351 Ga0207708_10015159
1352 Ga0207708_10073454
1353 Ga0207708_10443317
1354 Ga0207702_10028090
1355 Ga0207702_10109883
1356 Ga0207702_10128299
1357 Ga0207702_10482014
1358 Ga0207641_10799569
1359 Ga0207641_10804325
1360 Ga0207641_11314454
1361 Ga0207648_10004479
1362 Ga0207648_10005402
1363 Ga0207648_10044853
1364 Ga0207648_10070326
1365 Ga0207648_10089667
1366 Ga0207648_10138915
1367 Ga0207676_10027093
1368 Ga0207676_10282473
1369 Ga0207676_10559123
1370 Ga0207676_11489294
1371 Ga0207676_11734861
1372 Ga0207674_10020231
1373 Ga0207674_10041482
1374 Ga0207674_10071727
1375 Ga0207674_10073728
1376 Ga0207674_10092018
1377 Ga0207675_100114595
1378 Ga0207675_100938304
1379 Ga0207683_10048494
1380 Ga0207683_10086501
1381 Ga0207683_11379573
1382 Ga0207698_10027887
1383 Ga0207698_10080794
1384 Ga0207698_10261060
1385 Ga0207698_10419712
1386 Ga0207428_10003934
1387 Ga0207428_10013309
1388 Ga0207428_10840643
1389 Ga0268265_10188033
1390 Ga0268265_10214888
1391 Ga0268265_10444858
1392 Ga0268264_10090462
1393 Ga0268264_10615834
1394 Ga0307517_10075195
1395 Ga0265327_10218988
1396 Ga0316579_10141955
1397 Ga0316576_10004097
1398 Ga0316576_10053716
1399 Ga0316576_10068248
1400 Ga0316576_10068570
1401 Ga0316576_10217688
1402 Ga0316576_10239819
1403 Ga0316576_10409141
1404 Ga0316578_10014764
1405 Ga0316578_10022238
1406 Ga0316578_10287098
1407 Ga0316577_10361797
1408 Ga0307412_10950081
1409 Ga0307409_100586049
1410 Ga0373930_0012494
1411 Ga0373940_0081211
1412 Ga0373949_0005705
1413 Ga0373939_0030717
1414 Ga0373941_0023333
1415 Ga0373961_0027291
1416 Ga0373962_0014367
1417 Ga0316574_0009159
1418 Ga0316574_0021454
1419 Ga0316574_0047793
1420 Ga0316574_0073546
1421 Ga0316574_0082819
1422 Ga0316574_0178828
1423 Ga0373931_0037629
1424 Ga0373931_0313736
1425 Ga0373931_0336147
1426 Ga0316582_0044864
1427 Ga0316582_0075414
1428 Ga0316584_0004980
1429 Ga0316584_0075168
1430 Ga0316584_0356630
1431 Ga0395900_0740367
1432 Ga0395900_0915109
1433 Ga0395898_0526138
1434 Ga0395898_0873440
1435 Ga0395905_0718479
1436 Ga0395901_0362642
1437 Ga0395901_0454422
1438 Ga0395901_0540962
1439 Ga0395901_0848003
1440 Ga0451791_0065273
1441 Ga0451798_0707378
1442 Ga0451800_0183764
1443 Ga0451800_1445029
1444 Ga0451835_0611616
1445 Ga0451849_0209613
1446 Ga0451849_1379231
1447 Ga0451843_1034437
1448 Ga0451853_0623808
1449 Ga0439457_025326
1450 Ga0450914_002668
1451 Ga0450906_008237
1452 Ga0439458_0027362
1453 Ga0439458_0061832
1454 Ga0450908_046858
1455 Ga0451577_0001086
1456 Ga0466964_0006266
1457 Ga0466964_0239412
1458 Ga0453684_0048034
1459 Ga0466970_0216714
1460 Ga0466967_0039849
1461 Ga0466967_0263163
1462 Ga0466967_0422556
1463 Ga0466967_0927293
1464 Ga0466967_1353149
1465 Ga0466967_1886199
1466 Ga0495603_0016372
1467 Ga0495603_0126248
1468 Ga0495603_0535964
1469 Ga0495582_0186350
1470 Ga0495605_0092737
1471 Ga0495584_0348948
1472 Ga0495594_0058065
1473 Ga0495596_0059383
1474 Ga0495630_0697486
1475 Ga0495631_0276814
1476 Ga0495644_0026028
1477 Ga0495656_0009724
1478 Ga0495634_0538734
1479 Ga0495670_0068170
1480 Ga0495670_0092946
1481 Ga0495581_0062076
1482 Ga0495680_1094348
1483 Ga0495677_0273952
1484 Ga0496100_0989942
1485 Ga0496101_0627861
1486 Ga0496102_0061595
1487 Ga0496102_0170958
1488 Ga0496102_0908656
1489 Ga0496102_1371266
1490 Ga0496103_0059348
1491 Ga0496104_0036015
1492 Ga0496104_0651383
1493 Ga0496104_0655959
1494 Ga0496104_0760075
1495 Ga0496105_0141982
1496 Ga0496105_0347749
1497 Ga0496106_0033241
1498 Ga0496106_0097246
1499 Ga0496107_0093471
1500 Ga0496108_0003917
1501 Ga0496108_0013508
1502 Ga0496108_0194725
1503 Ga0496108_0200650
1504 Ga0496108_0302858
1505 Ga0496108_0324664
1506 Ga0496108_0412580
1507 Ga0496109_0010715
1508 Ga0496109_0081565
1509 Ga0496109_0081793
1510 Ga0496109_0132222
1511 Ga0496109_0184506
1512 Ga0496109_0194354
1513 Ga0496109_0217510
1514 Ga0496109_0286863
1515 Ga0496109_1291518
1516 Ga0496110_0000458
1517 Ga0496110_0012007
1518 Ga0496110_0037061
1519 Ga0496110_0084104
1520 Ga0496110_0423809
1521 Ga0496111_0000956
1522 Ga0496111_0003627
1523 Ga0496111_0018458
1524 Ga0496111_0030739
1525 Ga0496111_0324084
1526 Ga0496112_0138442
1527 Ga0496112_0246390
1528 Ga0496112_1373562
1529 Ga0496113_0026032
1530 Ga0496114_0009771
1531 Ga0496114_0028778
1532 Ga0496114_0061816
1533 Ga0496114_0073741
1534 Ga0496114_0235138
1535 Ga0496114_0334667
1536 Ga0496114_0833213
1537 Ga0496114_0893434
1538 Ga0496114_1234734
1539 Ga0501031_0094532
1540 Ga0501031_0258755
1541 Ga0501032_0042269
1542 Ga0501033_0084889
1543 Ga0501034_0004464
1544 Ga0501036_0055383
1545 Ga0501036_0068908
1546 Ga0501036_0345509
1547 Ga0501036_1219536
1548 Ga0501037_0087513
1549 Ga0501037_0102137
1550 Ga0501038_0025542
1551 Ga0501038_0105267
1552 Ga0501038_0242458
1553 Ga0501038_0372254
1554 Ga0501038_0859116
1555 Ga0501039_0020755
1556 Ga0501039_0023675
1557 Ga0501039_0184542
1558 Ga0501039_0314059
1559 Ga0501039_0649476
1560 Ga0501040_0019808
1561 Ga0501040_0079076
1562 Ga0501040_0095225
1563 Ga0501040_1050927
1564 Ga0501041_0038056
1565 Ga0501041_0082858
1566 Ga0501041_0134741
1567 Ga0501041_0159301
1568 Ga0501041_0793289
1569 Ga0501042_0008331
1570 Ga0501042_0020864
1571 Ga0501042_0060157
1572 Ga0501042_0218369
1573 Ga0501042_0430078
1574 Ga0501043_0058256
1575 Ga0501046_0015057
1576 Ga0501046_0059031
1577 Ga0501046_0698777
1578 Ga0501048_0008074
1579 Ga0501048_0124155
1580 Ga0501048_0152144
1581 Ga0501048_0206452
1582 Ga0501048_0405200
1583 Ga0501067_0004221
1584 Ga0501067_0087300
1585 Ga0501067_0136347
1586 Ga0501068_0007031
1587 Ga0501068_0081490
1588 Ga0501068_0334819
1589 Ga0501068_0461888
1590 Ga0501069_0033380
1591 Ga0501069_0117636
1592 Ga0501069_0196652
1593 Ga0501069_0629214
1594 Ga0501070_0021964
1595 Ga0501070_0070329
1596 Ga0501070_0456339
1597 Ga0501071_0012620
1598 Ga0501071_0016611
1599 Ga0501071_0021251
1600 Ga0501071_0093646
1601 Ga0501071_0120478
1602 Ga0501071_0146088
1603 Ga0501071_0639913
1604 Ga0501072_0007554
1605 Ga0501072_0029993
1606 Ga0501072_0071202
1607 Ga0501072_0298758
1608 Ga0501072_0303035
1609 Ga0501072_0446815
1610 Ga0501073_0025695
1611 Ga0501073_0378261
1612 Ga0501074_0017542
1613 Ga0501074_0045835
1614 Ga0501074_0151005
1615 Ga0501075_0022002
1616 Ga0501075_0024164
1617 Ga0501075_0024588
1618 Ga0501075_0085160
1619 Ga0501075_0124703
1620 Ga0501075_0525909
1621 Ga0501076_0070718
1622 Ga0501076_0082897
1623 Ga0501076_0205341
1624 Ga0501076_0383584
1625 Ga0501076_0617414
1626 Ga0501076_0826036
1627 Ga0501077_0012656
1628 Ga0501077_0015180
1629 Ga0501077_0058318
1630 Ga0501077_0090342
1631 Ga0501077_0478552
1632 Ga0501079_0012750
1633 Ga0501079_0018270
1634 Ga0501079_0074606
1635 Ga0501079_0185712
1636 Ga0501079_0307163
1637 Ga0501079_0673891
1638 Ga0501080_0001056
1639 Ga0501080_0014436
1640 Ga0501081_0007772
1641 Ga0501081_0091601
1642 Ga0501081_0240593
1643 Ga0501081_0402299
1644 Ga0501081_0522410
1645 Ga0501081_0667881
1646 Ga0501083_0044846
1647 Ga0501083_0679372
1648 Ga0501083_0689554
1649 Ga0501035_0014199
1650 Ga0501044_0224933
1651 Ga0501044_0244395
1652 Ga0501045_0007043
1653 Ga0501045_0014822
1654 Ga0501045_0036736
1655 Ga0501045_0081118
1656 Ga0501045_0084614
1657 Ga0501045_0145524
1658 Ga0501045_0420889
1659 nmdc:mga03683_43895_c1
1660 nmdc:mga03n38_239521_c1
1661 nmdc:mga00v17_674009_c1
1662 nmdc:mga0yw44_242221_c1
1663 nmdc:mga0yw44_24759_c1
1664 nmdc:mga0yw44_450757_c1
1665 nmdc:mga0yw44_535651_c1
1666 nmdc:mga0yw44_805473_c1
1667 nmdc:mga06z11_200666_c1
1668 nmdc:mga06z11_853795_c1
1669 nmdc:mga05p37_280887_c1
1670 nmdc:mga05p37_286787_c1
1671 nmdc:mga09592_1249985_c1
1672 nmdc:mga09592_1673_c1
1673 nmdc:mga09592_955061_c1
1674 nmdc:mga06r32_141249_c1
1675 nmdc:mga08y16_10044_c1
1676 nmdc:mga08y16_101635_c1
1677 nmdc:mga08y16_145482_c1
1678 nmdc:mga08y16_166074_c1
1679 nmdc:mga08y16_7890_c1
1680 nmdc:mga0n895_1047166_c1
1681 nmdc:mga0n895_2010662_c1
1682 nmdc:mga0n895_31482_c1
1683 nmdc:mga0rr50_102781_c1
1684 nmdc:mga08x19_328399_c1
1685 nmdc:mga0a205_33992_c1
1686 nmdc:mga0a205_3573_c1
1687 nmdc:mga0a205_62290_c1
1688 nmdc:mga0sz30_91878_c1
1689 Ga0500628_150923
1690 Ga0500568_0020573
1691 Ga0500616_0000190
1692 Ga0501084_0010572
1693 Ga0501084_0014036
1694 Ga0501084_0044524
1695 Ga0501084_0083553
1696 Ga0501084_0205614
1697 Ga0501084_0207758
1698 Ga0501084_0417381
1699 Ga0501084_0484658
1700 Ga0501084_0720686
1701 Ga0501082_0015579
1702 Ga0501082_0040062
1703 Ga0501082_0140580
1704 Ga0501082_0143011
1705 Ga0501082_0172757
1706 Ga0501082_0351926
1707 Ga0530510_0039641
1708 Ga0530510_0044133
1709 Ga0530510_0095000
1710 Ga0530510_0098461
1711 Ga0530510_0128807
1712 Ga0530510_0132578
1713 Ga0530510_0134398
1714 Ga0530510_0373849
1715 Ga0530510_1163505
1716 2919449746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

33

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bqo-assembly2.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site. 0.9012 6 154
5bqo-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site. 0.8871 5 154
4z1o-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (prpp) and magnesium 0.8819 7 154
5bqp-assembly1.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site 0.878 6 152
5bqp-assembly1.cif.gz_B hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site 0.8667 1 152
ID Description Score Start End Superfamily
af_Q86D20_38_251_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8215 15 60 3.40.50.1240
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8203 6 160 3.40.50.2020
4zfnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8055 5 158 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8002 6 160 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7929 12 144 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3E0VW64-F1-model_v4 Phosphoribosyltransferase 0.9022 1 160 GO:0016757
AF-A0A4Y9QWY5-F1-model_v4 Phosphoribosyltransferase 0.9 1 160 GO:0016757
AF-A0A0K1JGW6-F1-model_v4 Phosphoribosyltransferase 0.8961 1 159 GO:0016757
AF-A0A1X0GMQ8-F1-model_v4 deleted 0.893 5 156
AF-Q6ADC4-F1-model_v4 Xanthine-guanine phosphoribosyltransferase 0.8926 3 161 GO:0016757

Map