F483665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 856 | 326 | 855 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0104151|Ga0373937_0104151_402_1082 |
| Length | 226 |
| Sequence | LIHVSICDWIWFRSRDGNARAPGRKNDNDKAASHSREELMSEIERRALMKGAALSALAFSVGGAEVLLSPKQARAQSIPFRALSLEQIATLEAMGETLVPGAKAAGISHFVDQQLSVPHSEALLEARILNVRPPYANFYRAALGAVDKASAALNGGRNFGQLNDGERNSFVDLMRQNKIEGWQGPGGPFVYLILRSDAVDVVYGTMEGYAALGIPYMPHIAPEKRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 109 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.04 |
| Nodule | 0 |
| Rhizoplane | 12.97 |
| Rhizosphere | 83.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10705429 | 3300005328 | Bacteria | 737 |
| 2 | Ga0070670_100020187 | 3300005331 | Bacteria | 5725 |
| 3 | Ga0070670_100046488 | 3300005331 | Bacteria | 3733 |
| 4 | Ga0070666_10462467 | 3300005335 | Bacteria | 917 |
| 5 | Ga0070666_10792587 | 3300005335 | Bacteria | 698 |
| 6 | Ga0070682_100033603 | 3300005337 | Bacteria | 3118 |
| 7 | Ga0068868_100019798 | 3300005338 | Bacteria | 5048 |
| 8 | Ga0068868_100725929 | 3300005338 | Bacteria | 891 |
| 9 | Ga0070660_100321379 | 3300005339 | Unclassified | 1271 |
| 10 | Ga0070660_100716073 | 3300005339 | Bacteria | 840 |
| 11 | Ga0070689_100703468 | 3300005340 | Bacteria | 882 |
| 12 | Ga0070689_101141972 | 3300005340 | Bacteria | 698 |
| 13 | Ga0070661_100766765 | 3300005344 | Unclassified | 790 |
| 14 | Ga0070661_100964028 | 3300005344 | Bacteria | 706 |
| 15 | Ga0070692_10052338 | 3300005345 | Unclassified | 2127 |
| 16 | Ga0070668_100134085 | 3300005347 | Bacteria | 1990 |
| 17 | Ga0070668_100873432 | 3300005347 | Unclassified | 802 |
| 18 | Ga0070669_100254905 | 3300005353 | Bacteria | 1398 |
| 19 | Ga0070669_100569986 | 3300005353 | Unclassified | 946 |
| 20 | Ga0070675_100439931 | 3300005354 | Bacteria | 1168 |
| 21 | Ga0070675_100675562 | 3300005354 | Bacteria | 940 |
| 22 | Ga0070671_100114803 | 3300005355 | Bacteria | 2264 |
| 23 | Ga0070671_100509088 | 3300005355 | Bacteria | 1036 |
| 24 | Ga0070674_100059554 | 3300005356 | Bacteria | 2658 |
| 25 | Ga0070674_100249883 | 3300005356 | Bacteria | 1392 |
| 26 | Ga0070673_100812572 | 3300005364 | Bacteria | 864 |
| 27 | Ga0070673_100908507 | 3300005364 | Bacteria | 817 |
| 28 | Ga0070673_101462324 | 3300005364 | Bacteria | 644 |
| 29 | Ga0070667_100287209 | 3300005367 | Bacteria | 1478 |
| 30 | Ga0070667_100420876 | 3300005367 | Bacteria | 1218 |
| 31 | Ga0070709_10089244 | 3300005434 | Unclassified | 2029 |
| 32 | Ga0070709_10089991 | 3300005434 | Bacteria | 2022 |
| 33 | Ga0070709_10234526 | 3300005434 | Bacteria | 1314 |
| 34 | Ga0070709_10249432 | 3300005434 | Bacteria | 1278 |
| 35 | Ga0070714_100326704 | 3300005435 | Bacteria | 1436 |
| 36 | Ga0070714_100373999 | 3300005435 | Bacteria | 1342 |
| 37 | Ga0070714_100555765 | 3300005435 | Bacteria | 1099 |
| 38 | Ga0070713_100004064 | 3300005436 | Bacteria | 9739 |
| 39 | Ga0070713_100195432 | 3300005436 | Unclassified | 1825 |
| 40 | Ga0070713_100305932 | 3300005436 | Unclassified | 1465 |
| 41 | Ga0070713_100332559 | 3300005436 | Unclassified | 1405 |
| 42 | Ga0070713_100742548 | 3300005436 | Bacteria | 939 |
| 43 | Ga0070710_10120056 | 3300005437 | Bacteria | 1590 |
| 44 | Ga0070710_10200926 | 3300005437 | Bacteria | 1259 |
| 45 | Ga0070711_100017996 | 3300005439 | Bacteria | 4505 |
| 46 | Ga0070711_100048110 | 3300005439 | Bacteria | 2914 |
| 47 | Ga0070711_100071681 | 3300005439 | Unclassified | 2443 |
| 48 | Ga0070711_100075515 | 3300005439 | Bacteria | 2386 |
| 49 | Ga0070711_100175835 | 3300005439 | Bacteria | 1635 |
| 50 | Ga0070711_100643802 | 3300005439 | Bacteria | 888 |
| 51 | Ga0070700_100145393 | 3300005441 | Bacteria | 1615 |
| 52 | Ga0070694_100169977 | 3300005444 | Bacteria | 1605 |
| 53 | Ga0070708_100363369 | 3300005445 | Bacteria | 1364 |
| 54 | Ga0070663_100131674 | 3300005455 | Unclassified | 1900 |
| 55 | Ga0070663_100137635 | 3300005455 | Bacteria | 1861 |
| 56 | Ga0070663_100144408 | 3300005455 | Bacteria | 1819 |
| 57 | Ga0070678_100010560 | 3300005456 | Bacteria | 5649 |
| 58 | Ga0070678_100119432 | 3300005456 | Unclassified | 2076 |
| 59 | Ga0070662_100341685 | 3300005457 | Bacteria | 1225 |
| 60 | Ga0070681_10039956 | 3300005458 | Bacteria | 4703 |
| 61 | Ga0070681_10207284 | 3300005458 | Bacteria | 1877 |
| 62 | Ga0068867_100142961 | 3300005459 | Bacteria | 1872 |
| 63 | Ga0070685_10019770 | 3300005466 | Bacteria | 3638 |
| 64 | Ga0070685_10306691 | 3300005466 | Bacteria | 1071 |
| 65 | Ga0070707_100200256 | 3300005468 | Bacteria | 1946 |
| 66 | Ga0070707_100299047 | 3300005468 | Bacteria | 1564 |
| 67 | Ga0070698_100356072 | 3300005471 | Bacteria | 1395 |
| 68 | Ga0070699_100010939 | 3300005518 | Bacteria | 7849 |
| 69 | Ga0070699_100048006 | 3300005518 | Bacteria | 3694 |
| 70 | Ga0070699_100296518 | 3300005518 | Bacteria | 1450 |
| 71 | Ga0070679_100612914 | 3300005530 | Bacteria | 1032 |
| 72 | Ga0070684_100268760 | 3300005535 | Bacteria | 1560 |
| 73 | Ga0070697_100003357 | 3300005536 | Bacteria | 12299 |
| 74 | Ga0070697_100644915 | 3300005536 | Bacteria | 932 |
| 75 | Ga0070697_100733443 | 3300005536 | Bacteria | 873 |
| 76 | Ga0070672_100217215 | 3300005543 | Bacteria | 1603 |
| 77 | Ga0070686_100255020 | 3300005544 | Bacteria | 1283 |
| 78 | Ga0070693_100038951 | 3300005547 | Bacteria | 2660 |
| 79 | Ga0070693_100630332 | 3300005547 | Bacteria | 777 |
| 80 | Ga0070665_100022395 | 3300005548 | Bacteria | 6358 |
| 81 | Ga0070665_100257971 | 3300005548 | Bacteria | 1744 |
| 82 | Ga0070704_100171589 | 3300005549 | Bacteria | 1726 |
| 83 | Ga0070704_100279334 | 3300005549 | Bacteria | 1383 |
| 84 | Ga0070704_100566641 | 3300005549 | Bacteria | 994 |
| 85 | Ga0068855_100372247 | 3300005563 | Unclassified | 1570 |
| 86 | Ga0070664_100037789 | 3300005564 | Bacteria | 4060 |
| 87 | Ga0068857_100220077 | 3300005577 | Bacteria | 1734 |
| 88 | Ga0068856_100074034 | 3300005614 | Bacteria | 3372 |
| 89 | Ga0068856_100804499 | 3300005614 | Bacteria | 960 |
| 90 | Ga0070702_100053473 | 3300005615 | Bacteria | 2320 |
| 91 | Ga0070702_100172200 | 3300005615 | Bacteria | 1409 |
| 92 | Ga0068859_100031624 | 3300005617 | Bacteria | 5314 |
| 93 | Ga0068859_100879067 | 3300005617 | Bacteria | 982 |
| 94 | Ga0068859_102049897 | 3300005617 | Unclassified | 632 |
| 95 | Ga0068864_100136555 | 3300005618 | Bacteria | 2208 |
| 96 | Ga0068864_100282053 | 3300005618 | Bacteria | 1551 |
| 97 | Ga0068866_10005758 | 3300005718 | Bacteria | 5135 |
| 98 | Ga0068866_10354438 | 3300005718 | Bacteria | 933 |
| 99 | Ga0068866_10571138 | 3300005718 | Unclassified | 759 |
| 100 | Ga0068861_100254363 | 3300005719 | Unclassified | 1500 |
| 101 | Ga0068870_10020749 | 3300005840 | Bacteria | 3205 |
| 102 | Ga0068863_100231265 | 3300005841 | Bacteria | 1783 |
| 103 | Ga0068863_100319960 | 3300005841 | Bacteria | 1507 |
| 104 | Ga0068858_100178310 | 3300005842 | Bacteria | 2005 |
| 105 | Ga0068860_100077192 | 3300005843 | Unclassified | 3167 |
| 106 | Ga0068860_100324302 | 3300005843 | Bacteria | 1512 |
| 107 | Ga0068860_100464631 | 3300005843 | Bacteria | 1259 |
| 108 | Ga0068862_101310603 | 3300005844 | Unclassified | 726 |
| 109 | Ga0068862_101328062 | 3300005844 | Unclassified | 721 |
| 110 | Ga0081455_10000369 | 3300005937 | Bacteria | 59441 |
| 111 | Ga0081455_10025395 | 3300005937 | Bacteria | 5470 |
| 112 | Ga0081455_10027696 | 3300005937 | Bacteria | 5190 |
| 113 | Ga0081455_10502183 | 3300005937 | Bacteria | 814 |
| 114 | Ga0081455_10626011 | 3300005937 | Unclassified | 697 |
| 115 | Ga0081540_1001030 | 3300005983 | Bacteria | 24972 |
| 116 | Ga0081540_1003967 | 3300005983 | Bacteria | 11499 |
| 117 | Ga0070717_10044387 | 3300006028 | Bacteria | 3629 |
| 118 | Ga0070717_10085937 | 3300006028 | Bacteria | 2648 |
| 119 | Ga0070717_10199114 | 3300006028 | Bacteria | 1754 |
| 120 | Ga0070717_11158431 | 3300006028 | Bacteria | 704 |
| 121 | Ga0075365_10043223 | 3300006038 | Bacteria | 2950 |
| 122 | Ga0075365_10065984 | 3300006038 | Bacteria | 2427 |
| 123 | Ga0075368_10125951 | 3300006042 | Unclassified | 1063 |
| 124 | Ga0075364_10145467 | 3300006051 | Bacteria | 1596 |
| 125 | Ga0075432_10092256 | 3300006058 | Bacteria | 1110 |
| 126 | Ga0070715_10063356 | 3300006163 | Bacteria | 1630 |
| 127 | Ga0070716_100025208 | 3300006173 | Bacteria | 3171 |
| 128 | Ga0070716_100509906 | 3300006173 | Bacteria | 889 |
| 129 | Ga0070712_100001051 | 3300006175 | Bacteria | 16665 |
| 130 | Ga0070712_100007738 | 3300006175 | Bacteria | 6724 |
| 131 | Ga0070712_100518095 | 3300006175 | Bacteria | 1001 |
| 132 | Ga0075362_10078152 | 3300006177 | Bacteria | 1522 |
| 133 | Ga0075367_10196243 | 3300006178 | Bacteria | 1260 |
| 134 | Ga0097621_100250240 | 3300006237 | Bacteria | 1551 |
| 135 | Ga0097621_100444288 | 3300006237 | Bacteria | 1167 |
| 136 | Ga0097621_100515682 | 3300006237 | Bacteria | 1084 |
| 137 | Ga0068871_100015941 | 3300006358 | Bacteria | 5644 |
| 138 | Ga0075428_100021266 | 3300006844 | Bacteria | 7184 |
| 139 | Ga0075428_100065454 | 3300006844 | Bacteria | 3980 |
| 140 | Ga0075428_100098943 | 3300006844 | Bacteria | 3180 |
| 141 | Ga0075428_100298068 | 3300006844 | Bacteria | 1734 |
| 142 | Ga0075428_100521767 | 3300006844 | Bacteria | 1271 |
| 143 | Ga0075430_100040521 | 3300006846 | Bacteria | 3942 |
| 144 | Ga0075431_100054123 | 3300006847 | Bacteria | 4138 |
| 145 | Ga0075431_100072487 | 3300006847 | Bacteria | 3554 |
| 146 | Ga0075431_100137660 | 3300006847 | Bacteria | 2517 |
| 147 | Ga0075431_100274988 | 3300006847 | Unclassified | 1706 |
| 148 | Ga0075431_100471779 | 3300006847 | Bacteria | 1249 |
| 149 | Ga0075433_10041187 | 3300006852 | Bacteria | 4001 |
| 150 | Ga0075433_10108487 | 3300006852 | Bacteria | 2462 |
| 151 | Ga0075434_100057057 | 3300006871 | Bacteria | 3881 |
| 152 | Ga0075434_100094195 | 3300006871 | Bacteria | 2999 |
| 153 | Ga0075434_100130149 | 3300006871 | Bacteria | 2535 |
| 154 | Ga0075434_100153131 | 3300006871 | Bacteria | 2326 |
| 155 | Ga0075434_100208202 | 3300006871 | Bacteria | 1976 |
| 156 | Ga0075434_100280879 | 3300006871 | Bacteria | 1685 |
| 157 | Ga0075434_100396164 | 3300006871 | Bacteria | 1402 |
| 158 | Ga0075434_100747784 | 3300006871 | Bacteria | 995 |
| 159 | Ga0075429_100049636 | 3300006880 | Bacteria | 3649 |
| 160 | Ga0075429_100242670 | 3300006880 | Bacteria | 1578 |
| 161 | Ga0068865_100179016 | 3300006881 | Bacteria | 1631 |
| 162 | Ga0068865_100312179 | 3300006881 | Bacteria | 1262 |
| 163 | Ga0068865_100373856 | 3300006881 | Bacteria | 1161 |
| 164 | Ga0075436_100033605 | 3300006914 | Bacteria | 3536 |
| 165 | Ga0075436_100236140 | 3300006914 | Bacteria | 1299 |
| 166 | Ga0075436_100499748 | 3300006914 | Bacteria | 889 |
| 167 | Ga0097620_100031624 | 3300006931 | Bacteria | 5314 |
| 168 | Ga0097620_100879053 | 3300006931 | Bacteria | 982 |
| 169 | Ga0075435_100084778 | 3300007076 | Bacteria | 2607 |
| 170 | Ga0075435_100310268 | 3300007076 | Bacteria | 1350 |
| 171 | Ga0075435_100499013 | 3300007076 | Bacteria | 1052 |
| 172 | Ga0099794_10031603 | 3300007265 | Bacteria | 2480 |
| 173 | Ga0099795_10001014 | 3300007788 | Bacteria | 5775 |
| 174 | Ga0099795_10008229 | 3300007788 | Bacteria | 2962 |
| 175 | Ga0105251_10086785 | 3300009011 | Bacteria | 1441 |
| 176 | Ga0105250_10089889 | 3300009092 | Bacteria | 1248 |
| 177 | Ga0105240_11375095 | 3300009093 | Bacteria | 743 |
| 178 | Ga0111539_10011327 | 3300009094 | Bacteria | 11200 |
| 179 | Ga0111539_10057982 | 3300009094 | Bacteria | 4596 |
| 180 | Ga0111539_10486097 | 3300009094 | Bacteria | 1438 |
| 181 | Ga0111539_10926368 | 3300009094 | Bacteria | 1013 |
| 182 | Ga0105245_10069966 | 3300009098 | Bacteria | 3183 |
| 183 | Ga0105245_10209838 | 3300009098 | Bacteria | 1874 |
| 184 | Ga0105245_10346909 | 3300009098 | Unclassified | 1470 |
| 185 | Ga0105247_10016260 | 3300009101 | Bacteria | 4457 |
| 186 | Ga0105247_10061346 | 3300009101 | Bacteria | 2331 |
| 187 | Ga0105247_10135926 | 3300009101 | Unclassified | 1606 |
| 188 | Ga0105247_10645487 | 3300009101 | Bacteria | 790 |
| 189 | Ga0114129_10035252 | 3300009147 | Bacteria | 7069 |
| 190 | Ga0114129_10047462 | 3300009147 | Bacteria | 6033 |
| 191 | Ga0114129_10051163 | 3300009147 | Bacteria | 5801 |
| 192 | Ga0114129_10126590 | 3300009147 | Bacteria | 3512 |
| 193 | Ga0114129_10225891 | 3300009147 | Bacteria | 2523 |
| 194 | Ga0114129_10723089 | 3300009147 | Bacteria | 1277 |
| 195 | Ga0114129_10962283 | 3300009147 | Bacteria | 1078 |
| 196 | Ga0105243_10299969 | 3300009148 | Bacteria | 1456 |
| 197 | Ga0105242_10008956 | 3300009176 | Bacteria | 7682 |
| 198 | Ga0105242_10120223 | 3300009176 | Bacteria | 2253 |
| 199 | Ga0105242_10403603 | 3300009176 | Bacteria | 1276 |
| 200 | Ga0105242_10413060 | 3300009176 | Bacteria | 1262 |
| 201 | Ga0105248_10004776 | 3300009177 | Bacteria | 14994 |
| 202 | Ga0105248_10030452 | 3300009177 | Bacteria | 6024 |
| 203 | Ga0105248_10033903 | 3300009177 | Bacteria | 5705 |
| 204 | Ga0105248_10268358 | 3300009177 | Bacteria | 1921 |
| 205 | Ga0105237_10237172 | 3300009545 | Bacteria | 1825 |
| 206 | Ga0105237_10481968 | 3300009545 | Unclassified | 1247 |
| 207 | Ga0105237_10591465 | 3300009545 | Bacteria | 1117 |
| 208 | Ga0105249_10571350 | 3300009553 | Bacteria | 1183 |
| 209 | Ga0099796_10063043 | 3300010159 | Bacteria | 1319 |
| 210 | Ga0105239_10122001 | 3300010375 | Bacteria | 2895 |
| 211 | Ga0105239_11305336 | 3300010375 | Bacteria | 837 |
| 212 | Ga0105239_11394527 | 3300010375 | Bacteria | 809 |
| 213 | Ga0105246_10041041 | 3300011119 | Bacteria | 3126 |
| 214 | Ga0105246_10059375 | 3300011119 | Bacteria | 2653 |
| 215 | Ga0105246_10594586 | 3300011119 | Bacteria | 955 |
| 216 | Ga0157369_11268499 | 3300013105 | Bacteria | 751 |
| 217 | Ga0157374_10065165 | 3300013296 | Bacteria | 3421 |
| 218 | Ga0157374_10247517 | 3300013296 | Bacteria | 1754 |
| 219 | Ga0157374_10363596 | 3300013296 | Bacteria | 1439 |
| 220 | Ga0157374_11086336 | 3300013296 | Bacteria | 820 |
| 221 | Ga0157378_10127112 | 3300013297 | Bacteria | 2356 |
| 222 | Ga0157378_10455034 | 3300013297 | Bacteria | 1271 |
| 223 | Ga0157378_11316623 | 3300013297 | Bacteria | 764 |
| 224 | Ga0163162_10234402 | 3300013306 | Bacteria | 1966 |
| 225 | Ga0163162_10418364 | 3300013306 | Bacteria | 1472 |
| 226 | Ga0163162_10452082 | 3300013306 | Bacteria | 1416 |
| 227 | Ga0163162_10786228 | 3300013306 | Bacteria | 1070 |
| 228 | Ga0157372_10107145 | 3300013307 | Bacteria | 3197 |
| 229 | Ga0157375_10056268 | 3300013308 | Bacteria | 3883 |
| 230 | Ga0157375_10245014 | 3300013308 | Bacteria | 1952 |
| 231 | Ga0163163_10012789 | 3300014325 | Bacteria | 7659 |
| 232 | Ga0163163_10082133 | 3300014325 | Bacteria | 3226 |
| 233 | Ga0163163_10199769 | 3300014325 | Bacteria | 2048 |
| 234 | Ga0163163_10898951 | 3300014325 | Bacteria | 949 |
| 235 | Ga0157380_10387475 | 3300014326 | Unclassified | 1321 |
| 236 | Ga0157379_10036120 | 3300014968 | Bacteria | 4406 |
| 237 | Ga0157379_11471424 | 3300014968 | Bacteria | 662 |
| 238 | Ga0157376_10030575 | 3300014969 | Bacteria | 4301 |
| 239 | Ga0157376_10144459 | 3300014969 | Bacteria | 2138 |
| 240 | Ga0157376_10440628 | 3300014969 | Bacteria | 1268 |
| 241 | Ga0163161_10180794 | 3300017792 | Bacteria | 1617 |
| 242 | Ga0224572_1006794 | 3300024225 | Bacteria | 2078 |
| 243 | Ga0228598_1017655 | 3300024227 | Bacteria | 1408 |
| 244 | Ga0207692_10017719 | 3300025898 | Bacteria | 3181 |
| 245 | Ga0207692_10133377 | 3300025898 | Bacteria | 1405 |
| 246 | Ga0207692_10226249 | 3300025898 | Bacteria | 1111 |
| 247 | Ga0207642_10042651 | 3300025899 | Bacteria | 1995 |
| 248 | Ga0207710_10007860 | 3300025900 | Bacteria | 4514 |
| 249 | Ga0207688_10637509 | 3300025901 | Unclassified | 672 |
| 250 | Ga0207680_10083989 | 3300025903 | Bacteria | 2008 |
| 251 | Ga0207680_10416178 | 3300025903 | Bacteria | 951 |
| 252 | Ga0207647_10272587 | 3300025904 | Bacteria | 967 |
| 253 | Ga0207685_10009105 | 3300025905 | Bacteria | 2868 |
| 254 | Ga0207699_10102070 | 3300025906 | Bacteria | 1822 |
| 255 | Ga0207699_10208258 | 3300025906 | Bacteria | 1329 |
| 256 | Ga0207699_10935188 | 3300025906 | Bacteria | 640 |
| 257 | Ga0207645_10019349 | 3300025907 | Bacteria | 4464 |
| 258 | Ga0207645_10129460 | 3300025907 | Bacteria | 1642 |
| 259 | Ga0207684_10065109 | 3300025910 | Bacteria | 3095 |
| 260 | Ga0207707_10031910 | 3300025912 | Bacteria | 4611 |
| 261 | Ga0207671_10245467 | 3300025914 | Bacteria | 1407 |
| 262 | Ga0207693_10002798 | 3300025915 | Bacteria | 15117 |
| 263 | Ga0207693_10010575 | 3300025915 | Bacteria | 7486 |
| 264 | Ga0207693_10044059 | 3300025915 | Bacteria | 3507 |
| 265 | Ga0207693_10145853 | 3300025915 | Bacteria | 1861 |
| 266 | Ga0207693_10214584 | 3300025915 | Bacteria | 1512 |
| 267 | Ga0207663_10034645 | 3300025916 | Bacteria | 3022 |
| 268 | Ga0207663_10037618 | 3300025916 | Bacteria | 2919 |
| 269 | Ga0207663_10055738 | 3300025916 | Unclassified | 2482 |
| 270 | Ga0207662_10159341 | 3300025918 | Bacteria | 1441 |
| 271 | Ga0207649_10062796 | 3300025920 | Bacteria | 2343 |
| 272 | Ga0207646_10041572 | 3300025922 | Bacteria | 4133 |
| 273 | Ga0207694_10233327 | 3300025924 | Bacteria | 1503 |
| 274 | Ga0207650_10006118 | 3300025925 | Bacteria | 8199 |
| 275 | Ga0207659_10136810 | 3300025926 | Bacteria | 1897 |
| 276 | Ga0207687_10006865 | 3300025927 | Bacteria | 7498 |
| 277 | Ga0207687_10157687 | 3300025927 | Bacteria | 1738 |
| 278 | Ga0207687_10592098 | 3300025927 | Bacteria | 934 |
| 279 | Ga0207700_10043966 | 3300025928 | Bacteria | 3285 |
| 280 | Ga0207700_10370204 | 3300025928 | Unclassified | 1251 |
| 281 | Ga0207700_10715841 | 3300025928 | Unclassified | 894 |
| 282 | Ga0207700_10719528 | 3300025928 | Bacteria | 892 |
| 283 | Ga0207664_10275014 | 3300025929 | Bacteria | 1476 |
| 284 | Ga0207644_10020189 | 3300025931 | Unclassified | 4527 |
| 285 | Ga0207644_10184309 | 3300025931 | Bacteria | 1638 |
| 286 | Ga0207644_10457265 | 3300025931 | Bacteria | 1049 |
| 287 | Ga0207706_10036765 | 3300025933 | Bacteria | 4349 |
| 288 | Ga0207706_10084917 | 3300025933 | Unclassified | 2783 |
| 289 | Ga0207686_10110954 | 3300025934 | Bacteria | 1850 |
| 290 | Ga0207686_10151105 | 3300025934 | Bacteria | 1617 |
| 291 | Ga0207686_10742644 | 3300025934 | Bacteria | 783 |
| 292 | Ga0207709_10266630 | 3300025935 | Bacteria | 1258 |
| 293 | Ga0207709_10964180 | 3300025935 | Unclassified | 696 |
| 294 | Ga0207670_10203842 | 3300025936 | Bacteria | 1504 |
| 295 | Ga0207669_11053424 | 3300025937 | Unclassified | 685 |
| 296 | Ga0207704_10103113 | 3300025938 | Bacteria | 1907 |
| 297 | Ga0207665_10018755 | 3300025939 | Bacteria | 4547 |
| 298 | Ga0207665_10159069 | 3300025939 | Bacteria | 1624 |
| 299 | Ga0207665_10309797 | 3300025939 | Bacteria | 1182 |
| 300 | Ga0207665_10356586 | 3300025939 | Bacteria | 1105 |
| 301 | Ga0207691_10015870 | 3300025940 | Bacteria | 7158 |
| 302 | Ga0207711_10008135 | 3300025941 | Bacteria | 8778 |
| 303 | Ga0207711_10022249 | 3300025941 | Bacteria | 5301 |
| 304 | Ga0207711_11066813 | 3300025941 | Unclassified | 748 |
| 305 | Ga0207689_10022880 | 3300025942 | Bacteria | 5249 |
| 306 | Ga0207689_10297973 | 3300025942 | Bacteria | 1336 |
| 307 | Ga0207679_10155666 | 3300025945 | Bacteria | 1866 |
| 308 | Ga0207679_10652996 | 3300025945 | Unclassified | 952 |
| 309 | Ga0207679_11168754 | 3300025945 | Unclassified | 706 |
| 310 | Ga0207651_10127635 | 3300025960 | Bacteria | 1941 |
| 311 | Ga0207651_10544820 | 3300025960 | Bacteria | 1008 |
| 312 | Ga0207651_10649667 | 3300025960 | Bacteria | 926 |
| 313 | Ga0207651_10750614 | 3300025960 | Bacteria | 862 |
| 314 | Ga0207640_10320631 | 3300025981 | Bacteria | 1234 |
| 315 | Ga0207640_10478614 | 3300025981 | Unclassified | 1032 |
| 316 | Ga0207658_10045484 | 3300025986 | Bacteria | 3200 |
| 317 | Ga0207658_10086337 | 3300025986 | Bacteria | 2420 |
| 318 | Ga0207677_10615656 | 3300026023 | Bacteria | 954 |
| 319 | Ga0207703_10356636 | 3300026035 | Unclassified | 1348 |
| 320 | Ga0207703_10446307 | 3300026035 | Bacteria | 1208 |
| 321 | Ga0207703_10664502 | 3300026035 | Unclassified | 989 |
| 322 | Ga0207678_10011265 | 3300026067 | Bacteria | 7850 |
| 323 | Ga0207678_10014350 | 3300026067 | Bacteria | 6967 |
| 324 | Ga0207678_10166576 | 3300026067 | Bacteria | 1882 |
| 325 | Ga0207708_10051435 | 3300026075 | Bacteria | 3136 |
| 326 | Ga0207702_10230700 | 3300026078 | Bacteria | 1730 |
| 327 | Ga0207702_10869053 | 3300026078 | Bacteria | 893 |
| 328 | Ga0207641_10093274 | 3300026088 | Bacteria | 2639 |
| 329 | Ga0207641_10405488 | 3300026088 | Bacteria | 1310 |
| 330 | Ga0207676_10236149 | 3300026095 | Bacteria | 1637 |
| 331 | Ga0207675_100006797 | 3300026118 | Bacteria | 10827 |
| 332 | Ga0207675_100127492 | 3300026118 | Bacteria | 2411 |
| 333 | Ga0207683_10004571 | 3300026121 | Bacteria | 11921 |
| 334 | Ga0207683_10005533 | 3300026121 | Bacteria | 10828 |
| 335 | Ga0207683_10338071 | 3300026121 | Bacteria | 1381 |
| 336 | Ga0207683_11089095 | 3300026121 | Bacteria | 741 |
| 337 | Ga0209179_1004415 | 3300027512 | Bacteria | 2121 |
| 338 | Ga0209813_10077399 | 3300027866 | Unclassified | 1093 |
| 339 | Ga0207428_10223975 | 3300027907 | Bacteria | 1409 |
| 340 | Ga0268266_10005703 | 3300028379 | Bacteria | 11544 |
| 341 | Ga0268266_10284203 | 3300028379 | Unclassified | 1539 |
| 342 | Ga0268265_11299873 | 3300028380 | Unclassified | 727 |
| 343 | Ga0268264_10185841 | 3300028381 | Unclassified | 1891 |
| 344 | Ga0268264_10284093 | 3300028381 | Bacteria | 1551 |
| 345 | Ga0265338_10083691 | 3300028800 | Bacteria | 2667 |
| 346 | Ga0265773_1006684 | 3300031018 | Bacteria | 879 |
| 347 | Ga0265760_10089398 | 3300031090 | Bacteria | 962 |
| 348 | Ga0265330_10083913 | 3300031235 | Bacteria | 1371 |
| 349 | Ga0265332_10003584 | 3300031238 | Bacteria | 7447 |
| 350 | Ga0265328_10218071 | 3300031239 | Bacteria | 726 |
| 351 | Ga0265325_10014844 | 3300031241 | Bacteria | 4392 |
| 352 | Ga0265325_10050885 | 3300031241 | Bacteria | 2131 |
| 353 | Ga0265329_10166233 | 3300031242 | Bacteria | 718 |
| 354 | Ga0265340_10000757 | 3300031247 | Bacteria | 18368 |
| 355 | Ga0265339_10000077 | 3300031249 | Bacteria | 84288 |
| 356 | Ga0265339_10001098 | 3300031249 | Bacteria | 20530 |
| 357 | Ga0265339_10204696 | 3300031249 | Unclassified | 972 |
| 358 | Ga0265313_10001170 | 3300031595 | Bacteria | 25104 |
| 359 | Ga0265314_10004866 | 3300031711 | Bacteria | 12275 |
| 360 | Ga0265314_10075050 | 3300031711 | Bacteria | 2250 |
| 361 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 362 | Ga0307507_10106153 | 3300033179 | Bacteria | 2321 |
| 363 | Ga0307507_10385298 | 3300033179 | Unclassified | 805 |
| 364 | Ga0373958_0017676 | 3300034819 | Bacteria | 1285 |
| 365 | Ga0373959_0018494 | 3300034820 | Bacteria | 1312 |
| 366 | Ga0373926_0002409 | 3300035083 | Bacteria | 5927 |
| 367 | Ga0373926_0011990 | 3300035083 | Bacteria | 2926 |
| 368 | Ga0373928_0009042 | 3300035084 | Unclassified | 1944 |
| 369 | Ga0373929_0006323 | 3300035085 | Bacteria | 2141 |
| 370 | Ga0373929_0018370 | 3300035085 | Bacteria | 1389 |
| 371 | Ga0373934_0005641 | 3300035086 | Bacteria | 4637 |
| 372 | Ga0373934_0087177 | 3300035086 | Bacteria | 1256 |
| 373 | Ga0373934_0135815 | 3300035086 | Unclassified | 1004 |
| 374 | Ga0373944_0027529 | 3300035089 | Bacteria | 1686 |
| 375 | Ga0373944_0030232 | 3300035089 | Bacteria | 1624 |
| 376 | Ga0373944_0299189 | 3300035089 | Bacteria | 604 |
| 377 | Ga0373949_0055680 | 3300035090 | Bacteria | 1007 |
| 378 | Ga0373951_0080294 | 3300035091 | Bacteria | 843 |
| 379 | Ga0373952_0007885 | 3300035092 | Unclassified | 2007 |
| 380 | Ga0373952_0009694 | 3300035092 | Bacteria | 1850 |
| 381 | Ga0373923_0002741 | 3300035111 | Bacteria | 5498 |
| 382 | Ga0373923_0111806 | 3300035111 | Bacteria | 1213 |
| 383 | Ga0373923_0245344 | 3300035111 | Bacteria | 837 |
| 384 | Ga0373932_0031617 | 3300035112 | Bacteria | 1476 |
| 385 | Ga0373936_0135689 | 3300035113 | Bacteria | 1060 |
| 386 | Ga0373936_0397703 | 3300035113 | Unclassified | 632 |
| 387 | Ga0373939_0027092 | 3300035114 | Bacteria | 1621 |
| 388 | Ga0373941_0008648 | 3300035115 | Bacteria | 2537 |
| 389 | Ga0373941_0095849 | 3300035115 | Unclassified | 1025 |
| 390 | Ga0373945_0005807 | 3300035116 | Bacteria | 3962 |
| 391 | Ga0373945_0007853 | 3300035116 | Bacteria | 3461 |
| 392 | Ga0373945_0022810 | 3300035116 | Bacteria | 2159 |
| 393 | Ga0373945_0140116 | 3300035116 | Bacteria | 975 |
| 394 | Ga0373953_0000877 | 3300035117 | Bacteria | 8439 |
| 395 | Ga0373953_0041124 | 3300035117 | Bacteria | 1838 |
| 396 | Ga0373954_0000582 | 3300035118 | Bacteria | 13847 |
| 397 | Ga0373954_0007523 | 3300035118 | Bacteria | 4767 |
| 398 | Ga0373954_0011839 | 3300035118 | Bacteria | 3873 |
| 399 | Ga0373954_0184958 | 3300035118 | Bacteria | 1022 |
| 400 | Ga0373954_0218434 | 3300035118 | Bacteria | 937 |
| 401 | Ga0373954_0222009 | 3300035118 | Unclassified | 929 |
| 402 | Ga0373956_0004515 | 3300035119 | Bacteria | 5558 |
| 403 | Ga0373956_0165348 | 3300035119 | Unclassified | 1043 |
| 404 | Ga0373956_0409182 | 3300035119 | Unclassified | 647 |
| 405 | Ga0373957_0002376 | 3300035120 | Bacteria | 5356 |
| 406 | Ga0373957_0047996 | 3300035120 | Bacteria | 1625 |
| 407 | Ga0373957_0105937 | 3300035120 | Bacteria | 1129 |
| 408 | Ga0373960_0140220 | 3300035121 | Bacteria | 818 |
| 409 | Ga0373943_0026578 | 3300035170 | Unclassified | 2712 |
| 410 | Ga0373943_0101334 | 3300035170 | Bacteria | 1506 |
| 411 | Ga0373943_0126914 | 3300035170 | Bacteria | 1361 |
| 412 | Ga0373943_0321044 | 3300035170 | Unclassified | 883 |
| 413 | Ga0373946_0006713 | 3300035171 | Bacteria | 4183 |
| 414 | Ga0373946_0160036 | 3300035171 | Bacteria | 1056 |
| 415 | Ga0373946_0191745 | 3300035171 | Bacteria | 975 |
| 416 | Ga0373946_0205277 | 3300035171 | Bacteria | 945 |
| 417 | Ga0373955_0016702 | 3300035172 | Bacteria | 3616 |
| 418 | Ga0373955_0066670 | 3300035172 | Bacteria | 2001 |
| 419 | Ga0373955_0078167 | 3300035172 | Bacteria | 1864 |
| 420 | Ga0373955_0346178 | 3300035172 | Bacteria | 900 |
| 421 | Ga0373955_0424577 | 3300035172 | Unclassified | 809 |
| 422 | Ga0373955_0490218 | 3300035172 | Bacteria | 750 |
| 423 | Ga0373942_0031774 | 3300035207 | Bacteria | 1399 |
| 424 | Ga0373942_0041529 | 3300035207 | Bacteria | 1258 |
| 425 | Ga0373961_0072089 | 3300035241 | Unclassified | 1070 |
| 426 | Ga0373962_0029486 | 3300035242 | Bacteria | 1496 |
| 427 | Ga0373924_0002954 | 3300035410 | Bacteria | 5774 |
| 428 | Ga0373924_0009379 | 3300035410 | Bacteria | 3583 |
| 429 | Ga0373924_0028068 | 3300035410 | Bacteria | 2241 |
| 430 | Ga0373924_0254874 | 3300035410 | Unclassified | 777 |
| 431 | Ga0373931_0003361 | 3300035691 | Bacteria | 7169 |
| 432 | Ga0373931_0004763 | 3300035691 | Bacteria | 6222 |
| 433 | Ga0373931_0013244 | 3300035691 | Bacteria | 4013 |
| 434 | Ga0373931_0179451 | 3300035691 | Bacteria | 1253 |
| 435 | Ga0373935_0012670 | 3300035692 | Bacteria | 5073 |
| 436 | Ga0373935_0021389 | 3300035692 | Bacteria | 3960 |
| 437 | Ga0373935_0086510 | 3300035692 | Bacteria | 2045 |
| 438 | Ga0373935_0100346 | 3300035692 | Bacteria | 1907 |
| 439 | Ga0373935_0180597 | 3300035692 | Bacteria | 1449 |
| 440 | Ga0373935_0313162 | 3300035692 | Unclassified | 1112 |
| 441 | Ga0373935_0352447 | 3300035692 | Bacteria | 1049 |
| 442 | Ga0373927_0021247 | 3300035695 | Bacteria | 4253 |
| 443 | Ga0373927_0234731 | 3300035695 | Bacteria | 1205 |
| 444 | Ga0373927_0236388 | 3300035695 | Bacteria | 1200 |
| 445 | Ga0373927_0238926 | 3300035695 | Bacteria | 1194 |
| 446 | Ga0373933_0001118 | 3300035724 | Bacteria | 15965 |
| 447 | Ga0373933_0046663 | 3300035724 | Unclassified | 2573 |
| 448 | Ga0373933_0230141 | 3300035724 | Bacteria | 1190 |
| 449 | Ga0373947_0007475 | 3300035725 | Bacteria | 6324 |
| 450 | Ga0373947_0029051 | 3300035725 | Bacteria | 3242 |
| 451 | Ga0373947_0044707 | 3300035725 | Bacteria | 2648 |
| 452 | Ga0373947_0162168 | 3300035725 | Bacteria | 1446 |
| 453 | Ga0373937_0018721 | 3300036401 | Bacteria | 6188 |
| 454 | Ga0373937_0040421 | 3300036401 | Bacteria | 4251 |
| 455 | Ga0373937_0104151 | 3300036401 | Bacteria | 2636 |
| 456 | Ga0373937_0266076 | 3300036401 | Bacteria | 1617 |
| 457 | Ga0373937_0679630 | 3300036401 | Unclassified | 975 |
| 458 | Ga0373937_0823228 | 3300036401 | Unclassified | 876 |
| 459 | Ga0373925_0015033 | 3300037068 | Bacteria | 5595 |
| 460 | Ga0373925_0110678 | 3300037068 | Bacteria | 2121 |
| 461 | Ga0373925_0156408 | 3300037068 | Bacteria | 1793 |
| 462 | Ga0373925_0220536 | 3300037068 | Bacteria | 1513 |
| 463 | Ga0373925_0248228 | 3300037068 | Bacteria | 1427 |
| 464 | Ga0373925_0360162 | 3300037068 | Bacteria | 1182 |
| 465 | Ga0373925_0405734 | 3300037068 | Bacteria | 1112 |
| 466 | Ga0373925_0513087 | 3300037068 | Bacteria | 984 |
| 467 | Ga0373925_0892732 | 3300037068 | Bacteria | 732 |
| 468 | Ga0395898_0089739 | 3300037466 | Bacteria | 2958 |
| 469 | Ga0436364_0855834 | 3300037853 | Bacteria | 1090 |
| 470 | Ga0436364_0877934 | 3300037853 | Unclassified | 814 |
| 471 | Ga0395901_0266843 | 3300038443 | Bacteria | 1781 |
| 472 | Ga0436365_1155159 | 3300039437 | Bacteria | 915 |
| 473 | Ga0436361_0095794 | 3300039447 | Bacteria | 775 |
| 474 | Ga0436361_0443883 | 3300039447 | Bacteria | 4113 |
| 475 | Ga0436361_0924848 | 3300039447 | Unclassified | 1081 |
| 476 | Ga0436363_0094947 | 3300039450 | Bacteria | 670 |
| 477 | Ga0436363_0595633 | 3300039450 | Unclassified | 1464 |
| 478 | Ga0436362_0005602 | 3300039453 | Bacteria | 1117 |
| 479 | Ga0451851_0045297 | 3300041507 | Bacteria | 937 |
| 480 | Ga0466971_0315003 | 3300044719 | Unclassified | 753 |
| 481 | Ga0466957_0382873 | 3300044842 | Bacteria | 960 |
| 482 | Ga0466967_1056169 | 3300045976 | Unclassified | 809 |
| 483 | Ga0495617_139348 | 3300046452 | Bacteria | 775 |
| 484 | Ga0495592_0008473 | 3300046454 | Bacteria | 7716 |
| 485 | Ga0495592_0012848 | 3300046454 | Bacteria | 6367 |
| 486 | Ga0495592_0016333 | 3300046454 | Bacteria | 5632 |
| 487 | Ga0495592_0088050 | 3300046454 | Bacteria | 2232 |
| 488 | Ga0495603_0043755 | 3300046455 | Bacteria | 2673 |
| 489 | Ga0495603_0104575 | 3300046455 | Bacteria | 1652 |
| 490 | Ga0495603_0128429 | 3300046455 | Bacteria | 1476 |
| 491 | Ga0495603_0191434 | 3300046455 | Bacteria | 1183 |
| 492 | Ga0495603_0199770 | 3300046455 | Bacteria | 1155 |
| 493 | Ga0495629_0005405 | 3300046459 | Bacteria | 9525 |
| 494 | Ga0495629_0056166 | 3300046459 | Bacteria | 2753 |
| 495 | Ga0495629_0106030 | 3300046459 | Bacteria | 1960 |
| 496 | Ga0495629_0269628 | 3300046459 | Bacteria | 1169 |
| 497 | Ga0495638_0147456 | 3300046460 | Bacteria | 1367 |
| 498 | Ga0495641_0011540 | 3300046461 | Bacteria | 5022 |
| 499 | Ga0495641_0017369 | 3300046461 | Plasmid | 3751 |
| 500 | Ga0495641_0049119 | 3300046461 | Bacteria | 1933 |
| 501 | Ga0495641_0124583 | 3300046461 | Bacteria | 1150 |
| 502 | Ga0495641_0151858 | 3300046461 | Bacteria | 1035 |
| 503 | Ga0495651_0002600 | 3300046462 | Bacteria | 13955 |
| 504 | Ga0495651_0129777 | 3300046462 | Bacteria | 1841 |
| 505 | Ga0495651_0487605 | 3300046462 | Bacteria | 791 |
| 506 | Ga0495653_0001047 | 3300046463 | Bacteria | 21277 |
| 507 | Ga0495653_0041639 | 3300046463 | Bacteria | 3584 |
| 508 | Ga0495653_0175829 | 3300046463 | Bacteria | 1473 |
| 509 | Ga0495653_0303915 | 3300046463 | Bacteria | 1039 |
| 510 | Ga0495580_0073254 | 3300046472 | Bacteria | 2391 |
| 511 | Ga0495580_0081932 | 3300046472 | Bacteria | 2249 |
| 512 | Ga0495580_0172853 | 3300046472 | Bacteria | 1493 |
| 513 | Ga0495580_0186826 | 3300046472 | Bacteria | 1430 |
| 514 | Ga0495580_0530027 | 3300046472 | Bacteria | 784 |
| 515 | Ga0495582_0040009 | 3300046473 | Plasmid | 2581 |
| 516 | Ga0495605_0149375 | 3300046474 | Bacteria | 1044 |
| 517 | Ga0495639_0014761 | 3300046475 | Bacteria | 3384 |
| 518 | Ga0495639_0165819 | 3300046475 | Bacteria | 1071 |
| 519 | Ga0495639_0292109 | 3300046475 | Bacteria | 812 |
| 520 | Ga0495662_0023840 | 3300046476 | Bacteria | 2955 |
| 521 | Ga0495662_0038805 | 3300046476 | Bacteria | 2301 |
| 522 | Ga0495662_0171134 | 3300046476 | Unclassified | 1070 |
| 523 | Ga0495662_0260180 | 3300046476 | Bacteria | 854 |
| 524 | Ga0495664_0066334 | 3300046477 | Unclassified | 2152 |
| 525 | Ga0495664_0118522 | 3300046477 | Bacteria | 1600 |
| 526 | Ga0495664_0189536 | 3300046477 | Unclassified | 1247 |
| 527 | Ga0495664_0219559 | 3300046477 | Bacteria | 1151 |
| 528 | Ga0495664_0317050 | 3300046477 | Unclassified | 940 |
| 529 | Ga0495664_0480163 | 3300046477 | Unclassified | 743 |
| 530 | Ga0495584_0120627 | 3300046491 | Bacteria | 1328 |
| 531 | Ga0495584_0163952 | 3300046491 | Bacteria | 1130 |
| 532 | Ga0495584_0446595 | 3300046491 | Bacteria | 658 |
| 533 | Ga0495585_0171153 | 3300046492 | Bacteria | 1122 |
| 534 | Ga0495594_0015676 | 3300046499 | Bacteria | 3984 |
| 535 | Ga0495594_0061996 | 3300046499 | Bacteria | 2070 |
| 536 | Ga0495594_0076130 | 3300046499 | Bacteria | 1871 |
| 537 | Ga0495594_0157511 | 3300046499 | Bacteria | 1290 |
| 538 | Ga0495594_0220951 | 3300046499 | Bacteria | 1080 |
| 539 | Ga0495594_0256296 | 3300046499 | Bacteria | 996 |
| 540 | Ga0495607_0040819 | 3300046501 | Bacteria | 2760 |
| 541 | Ga0495608_0002112 | 3300046511 | Bacteria | 14313 |
| 542 | Ga0495608_0019463 | 3300046511 | Bacteria | 4670 |
| 543 | Ga0495608_0172435 | 3300046511 | Bacteria | 1371 |
| 544 | Ga0495616_0137536 | 3300046513 | Unclassified | 1115 |
| 545 | Ga0495618_0005758 | 3300046514 | Bacteria | 7528 |
| 546 | Ga0495618_0123351 | 3300046514 | Unclassified | 1659 |
| 547 | Ga0495618_0353085 | 3300046514 | Bacteria | 906 |
| 548 | Ga0495618_0400653 | 3300046514 | Unclassified | 839 |
| 549 | Ga0495618_0436267 | 3300046514 | Unclassified | 796 |
| 550 | Ga0495618_0598020 | 3300046514 | Unclassified | 656 |
| 551 | Ga0495628_0003957 | 3300046516 | Bacteria | 13192 |
| 552 | Ga0495628_0004724 | 3300046516 | Bacteria | 12012 |
| 553 | Ga0495628_0019722 | 3300046516 | Bacteria | 5570 |
| 554 | Ga0495628_0033958 | 3300046516 | Bacteria | 4106 |
| 555 | Ga0495628_0160779 | 3300046516 | Bacteria | 1707 |
| 556 | Ga0495630_0016483 | 3300046517 | Bacteria | 5401 |
| 557 | Ga0495630_0216081 | 3300046517 | Bacteria | 1463 |
| 558 | Ga0495630_0385510 | 3300046517 | Unclassified | 1073 |
| 559 | Ga0495644_0370438 | 3300046523 | Unclassified | 565 |
| 560 | Ga0495666_0010416 | 3300046526 | Bacteria | 4636 |
| 561 | Ga0495652_0003317 | 3300046529 | Bacteria | 15979 |
| 562 | Ga0495652_0028740 | 3300046529 | Bacteria | 4889 |
| 563 | Ga0495652_0046364 | 3300046529 | Bacteria | 3732 |
| 564 | Ga0495652_0063428 | 3300046529 | Bacteria | 3111 |
| 565 | Ga0495652_0201615 | 3300046529 | Bacteria | 1509 |
| 566 | Ga0495652_0236075 | 3300046529 | Bacteria | 1364 |
| 567 | Ga0495652_0285065 | 3300046529 | Bacteria | 1208 |
| 568 | Ga0495652_0368774 | 3300046529 | Unclassified | 1024 |
| 569 | Ga0495665_0006593 | 3300046531 | Bacteria | 6271 |
| 570 | Ga0495665_0037035 | 3300046531 | Bacteria | 2604 |
| 571 | Ga0495665_0063490 | 3300046531 | Bacteria | 1949 |
| 572 | Ga0495640_0015437 | 3300046533 | Bacteria | 5747 |
| 573 | Ga0495640_0031547 | 3300046533 | Bacteria | 3780 |
| 574 | Ga0495640_0066207 | 3300046533 | Unclassified | 2437 |
| 575 | Ga0495640_0151938 | 3300046533 | Unclassified | 1487 |
| 576 | Ga0495640_0324340 | 3300046533 | Unclassified | 953 |
| 577 | Ga0495586_0003837 | 3300046535 | Bacteria | 8055 |
| 578 | Ga0495586_0099383 | 3300046535 | Bacteria | 1614 |
| 579 | Ga0495586_0286701 | 3300046535 | Unclassified | 942 |
| 580 | Ga0495587_0000701 | 3300046536 | Bacteria | 22458 |
| 581 | Ga0495587_0012557 | 3300046536 | Bacteria | 5326 |
| 582 | Ga0495587_0046379 | 3300046536 | Bacteria | 2580 |
| 583 | Ga0495587_0079111 | 3300046536 | Bacteria | 1907 |
| 584 | Ga0495587_0330773 | 3300046536 | Unclassified | 850 |
| 585 | Ga0495645_0000166 | 3300046543 | Bacteria | 45739 |
| 586 | Ga0495645_0002582 | 3300046543 | Bacteria | 12310 |
| 587 | Ga0495622_0199928 | 3300046557 | Unclassified | 891 |
| 588 | Ga0495667_0011101 | 3300046559 | Bacteria | 6092 |
| 589 | Ga0495667_0026841 | 3300046559 | Bacteria | 3880 |
| 590 | Ga0495667_0103554 | 3300046559 | Bacteria | 1841 |
| 591 | Ga0495667_0158415 | 3300046559 | Bacteria | 1456 |
| 592 | Ga0495667_0179943 | 3300046559 | Bacteria | 1357 |
| 593 | Ga0495667_0193654 | 3300046559 | Bacteria | 1302 |
| 594 | Ga0495667_0244087 | 3300046559 | Unclassified | 1143 |
| 595 | Ga0495656_0046474 | 3300046615 | Bacteria | 1837 |
| 596 | Ga0495656_0077236 | 3300046615 | Bacteria | 1494 |
| 597 | Ga0495634_0020611 | 3300046642 | Bacteria | 4672 |
| 598 | Ga0495634_0103259 | 3300046642 | Bacteria | 1840 |
| 599 | Ga0495634_0135864 | 3300046642 | Bacteria | 1564 |
| 600 | Ga0495635_0011643 | 3300046663 | Bacteria | 6164 |
| 601 | Ga0495635_0032494 | 3300046663 | Bacteria | 3620 |
| 602 | Ga0495635_0046775 | 3300046663 | Bacteria | 2984 |
| 603 | Ga0495635_0206973 | 3300046663 | Bacteria | 1329 |
| 604 | Ga0495659_0042965 | 3300046664 | Bacteria | 1620 |
| 605 | Ga0495659_0063075 | 3300046664 | Bacteria | 1373 |
| 606 | Ga0495661_0267137 | 3300046665 | Bacteria | 867 |
| 607 | Ga0495588_0060823 | 3300046674 | Bacteria | 1955 |
| 608 | Ga0495657_0009262 | 3300046675 | Bacteria | 7474 |
| 609 | Ga0495657_0081830 | 3300046675 | Bacteria | 2087 |
| 610 | Ga0495599_0019880 | 3300046678 | Bacteria | 4182 |
| 611 | Ga0495599_0021570 | 3300046678 | Bacteria | 4019 |
| 612 | Ga0495599_0052165 | 3300046678 | Bacteria | 2562 |
| 613 | Ga0495599_0291073 | 3300046678 | Bacteria | 987 |
| 614 | Ga0495623_0001363 | 3300046679 | Bacteria | 16553 |
| 615 | Ga0495646_0012104 | 3300046680 | Bacteria | 5485 |
| 616 | Ga0495646_0231663 | 3300046680 | Bacteria | 995 |
| 617 | Ga0495647_0008403 | 3300046681 | Bacteria | 3470 |
| 618 | Ga0495647_0013399 | 3300046681 | Bacteria | 2840 |
| 619 | Ga0495647_0096635 | 3300046681 | Bacteria | 1218 |
| 620 | Ga0495647_0155707 | 3300046681 | Bacteria | 982 |
| 621 | Ga0495658_0001737 | 3300046683 | Bacteria | 11280 |
| 622 | Ga0495658_0016443 | 3300046683 | Plasmid | 3807 |
| 623 | Ga0495658_0036939 | 3300046683 | Bacteria | 2698 |
| 624 | Ga0495658_0180523 | 3300046683 | Unclassified | 1309 |
| 625 | Ga0495658_0317198 | 3300046683 | Bacteria | 987 |
| 626 | Ga0495658_0477464 | 3300046683 | Bacteria | 797 |
| 627 | Ga0495613_0055710 | 3300046689 | Bacteria | 2904 |
| 628 | Ga0495613_0066277 | 3300046689 | Bacteria | 2637 |
| 629 | Ga0495613_0074672 | 3300046689 | Bacteria | 2469 |
| 630 | Ga0495613_0089888 | 3300046689 | Bacteria | 2225 |
| 631 | Ga0495613_0569223 | 3300046689 | Bacteria | 756 |
| 632 | Ga0495613_0709702 | 3300046689 | Unclassified | 661 |
| 633 | Ga0495624_0024085 | 3300046690 | Bacteria | 4007 |
| 634 | Ga0495624_0033353 | 3300046690 | Bacteria | 3334 |
| 635 | Ga0495624_0054156 | 3300046690 | Bacteria | 2530 |
| 636 | Ga0495624_0060864 | 3300046690 | Bacteria | 2367 |
| 637 | Ga0495624_0120750 | 3300046690 | Bacteria | 1609 |
| 638 | Ga0495671_0185293 | 3300046692 | Bacteria | 1011 |
| 639 | Ga0495600_0014977 | 3300046809 | Bacteria | 4896 |
| 640 | Ga0495600_0039724 | 3300046809 | Plasmid | 3064 |
| 641 | Ga0495600_0509136 | 3300046809 | Unclassified | 739 |
| 642 | Ga0495604_0002172 | 3300047317 | Bacteria | 15754 |
| 643 | Ga0495604_0053030 | 3300047317 | Bacteria | 3137 |
| 644 | Ga0495604_0095679 | 3300047317 | Bacteria | 2193 |
| 645 | Ga0495604_0117751 | 3300047317 | Unclassified | 1926 |
| 646 | Ga0495604_0126855 | 3300047317 | Bacteria | 1839 |
| 647 | Ga0495604_0299950 | 3300047317 | Unclassified | 1079 |
| 648 | Ga0495674_0006376 | 3300047319 | Bacteria | 11310 |
| 649 | Ga0495674_0085854 | 3300047319 | Bacteria | 2695 |
| 650 | Ga0495674_0086887 | 3300047319 | Bacteria | 2677 |
| 651 | Ga0495674_0180036 | 3300047319 | Bacteria | 1760 |
| 652 | Ga0495674_0195572 | 3300047319 | Unclassified | 1679 |
| 653 | Ga0495674_0477048 | 3300047319 | Bacteria | 1000 |
| 654 | Ga0495676_0039162 | 3300047321 | Bacteria | 3929 |
| 655 | Ga0495676_0188253 | 3300047321 | Bacteria | 1441 |
| 656 | Ga0495680_0016420 | 3300047322 | Bacteria | 6359 |
| 657 | Ga0495680_0062248 | 3300047322 | Plasmid | 2869 |
| 658 | Ga0495680_0247449 | 3300047322 | Unclassified | 1264 |
| 659 | Ga0495680_0257097 | 3300047322 | Unclassified | 1236 |
| 660 | Ga0495675_0000485 | 3300047444 | Bacteria | 25814 |
| 661 | Ga0495675_0038763 | 3300047444 | Bacteria | 3034 |
| 662 | Ga0495684_0023838 | 3300047471 | Plasmid | 4705 |
| 663 | Ga0495684_0041612 | 3300047471 | Bacteria | 3521 |
| 664 | Ga0495684_0124080 | 3300047471 | Bacteria | 1943 |
| 665 | Ga0495684_0234473 | 3300047471 | Unclassified | 1341 |
| 666 | Ga0495684_0337517 | 3300047471 | Unclassified | 1073 |
| 667 | Ga0495593_0027342 | 3300047673 | Bacteria | 3141 |
| 668 | Ga0495593_0043250 | 3300047673 | Bacteria | 2414 |
| 669 | Ga0495593_0090815 | 3300047673 | Bacteria | 1573 |
| 670 | Ga0495593_0208179 | 3300047673 | Bacteria | 982 |
| 671 | Ga0495593_0271638 | 3300047673 | Bacteria | 848 |
| 672 | Ga0495602_0042301 | 3300048088 | Bacteria | 4152 |
| 673 | Ga0495602_0132769 | 3300048088 | Bacteria | 1983 |
| 674 | Ga0495602_0189350 | 3300048088 | Unclassified | 1579 |
| 675 | Ga0495614_0011763 | 3300048089 | Unclassified | 3847 |
| 676 | Ga0495614_0112153 | 3300048089 | Bacteria | 1198 |
| 677 | Ga0496100_0009014 | 3300048903 | Bacteria | 5588 |
| 678 | Ga0496100_0014007 | 3300048903 | Unclassified | 4644 |
| 679 | Ga0496100_0132474 | 3300048903 | Bacteria | 1757 |
| 680 | Ga0496100_0135792 | 3300048903 | Bacteria | 1737 |
| 681 | Ga0496100_0302255 | 3300048903 | Bacteria | 1198 |
| 682 | Ga0496100_0305326 | 3300048903 | Bacteria | 1192 |
| 683 | Ga0496100_0328021 | 3300048903 | Bacteria | 1151 |
| 684 | Ga0496100_0450678 | 3300048903 | Bacteria | 986 |
| 685 | Ga0496100_1121228 | 3300048903 | Bacteria | 620 |
| 686 | Ga0496101_0006290 | 3300048904 | Bacteria | 7646 |
| 687 | Ga0496101_0010596 | 3300048904 | Bacteria | 6089 |
| 688 | Ga0496101_0063235 | 3300048904 | Bacteria | 2693 |
| 689 | Ga0496101_0071333 | 3300048904 | Bacteria | 2546 |
| 690 | Ga0496101_0149083 | 3300048904 | Bacteria | 1788 |
| 691 | Ga0496101_0346278 | 3300048904 | Bacteria | 1167 |
| 692 | Ga0496102_0003862 | 3300048905 | Bacteria | 12690 |
| 693 | Ga0496102_0040023 | 3300048905 | Bacteria | 4238 |
| 694 | Ga0496102_0067474 | 3300048905 | Bacteria | 3281 |
| 695 | Ga0496102_0220350 | 3300048905 | Bacteria | 1788 |
| 696 | Ga0496102_0317253 | 3300048905 | Bacteria | 1468 |
| 697 | Ga0496103_0003140 | 3300048906 | Bacteria | 10159 |
| 698 | Ga0496103_0019470 | 3300048906 | Bacteria | 4077 |
| 699 | Ga0496103_0038956 | 3300048906 | Bacteria | 2919 |
| 700 | Ga0496103_0313922 | 3300048906 | Bacteria | 1008 |
| 701 | Ga0496104_0004241 | 3300048907 | Bacteria | 12452 |
| 702 | Ga0496104_0004499 | 3300048907 | Bacteria | 12145 |
| 703 | Ga0496104_0008656 | 3300048907 | Bacteria | 9053 |
| 704 | Ga0496104_0025001 | 3300048907 | Bacteria | 5502 |
| 705 | Ga0496104_0085508 | 3300048907 | Unclassified | 3010 |
| 706 | Ga0496104_0097622 | 3300048907 | Bacteria | 2812 |
| 707 | Ga0496104_0170432 | 3300048907 | Bacteria | 2087 |
| 708 | Ga0496104_0291156 | 3300048907 | Unclassified | 1545 |
| 709 | Ga0496105_0005805 | 3300048908 | Bacteria | 9412 |
| 710 | Ga0496105_0015465 | 3300048908 | Bacteria | 6082 |
| 711 | Ga0496105_0028022 | 3300048908 | Bacteria | 4606 |
| 712 | Ga0496105_0045480 | 3300048908 | Bacteria | 3622 |
| 713 | Ga0496105_0099222 | 3300048908 | Unclassified | 2405 |
| 714 | Ga0496105_0104617 | 3300048908 | Bacteria | 2337 |
| 715 | Ga0496105_0127661 | 3300048908 | Bacteria | 2096 |
| 716 | Ga0496105_0143866 | 3300048908 | Bacteria | 1961 |
| 717 | Ga0496105_0155492 | 3300048908 | Unclassified | 1878 |
| 718 | Ga0496105_0212767 | 3300048908 | Bacteria | 1575 |
| 719 | Ga0496106_0004037 | 3300048909 | Bacteria | 10964 |
| 720 | Ga0496106_0016268 | 3300048909 | Bacteria | 5504 |
| 721 | Ga0496106_0027103 | 3300048909 | Bacteria | 4268 |
| 722 | Ga0496106_0031959 | 3300048909 | Bacteria | 3922 |
| 723 | Ga0496106_0071005 | 3300048909 | Bacteria | 2660 |
| 724 | Ga0496106_0116033 | 3300048909 | Bacteria | 2088 |
| 725 | Ga0496106_0149352 | 3300048909 | Bacteria | 1843 |
| 726 | Ga0496106_0208523 | 3300048909 | Bacteria | 1556 |
| 727 | Ga0496106_0539947 | 3300048909 | Unclassified | 936 |
| 728 | Ga0496106_0967921 | 3300048909 | Bacteria | 670 |
| 729 | Ga0496107_0019167 | 3300048910 | Bacteria | 4826 |
| 730 | Ga0496107_0029015 | 3300048910 | Bacteria | 3934 |
| 731 | Ga0496107_0065999 | 3300048910 | Bacteria | 2623 |
| 732 | Ga0496107_0092882 | 3300048910 | Bacteria | 2206 |
| 733 | Ga0496107_0128845 | 3300048910 | Bacteria | 1867 |
| 734 | Ga0496108_0000692 | 3300048911 | Bacteria | 26098 |
| 735 | Ga0496108_0019990 | 3300048911 | Bacteria | 5502 |
| 736 | Ga0496108_0035668 | 3300048911 | Bacteria | 4135 |
| 737 | Ga0496108_0093826 | 3300048911 | Bacteria | 2554 |
| 738 | Ga0496108_0319071 | 3300048911 | Unclassified | 1355 |
| 739 | Ga0496108_0610112 | 3300048911 | Bacteria | 950 |
| 740 | Ga0496108_1438320 | 3300048911 | Unclassified | 575 |
| 741 | Ga0496109_0000624 | 3300048912 | Bacteria | 29488 |
| 742 | Ga0496109_0005168 | 3300048912 | Bacteria | 10894 |
| 743 | Ga0496109_0012275 | 3300048912 | Bacteria | 7395 |
| 744 | Ga0496109_0033526 | 3300048912 | Bacteria | 4620 |
| 745 | Ga0496109_0118303 | 3300048912 | Unclassified | 2467 |
| 746 | Ga0496109_0133973 | 3300048912 | Bacteria | 2314 |
| 747 | Ga0496109_0750877 | 3300048912 | Unclassified | 913 |
| 748 | Ga0496110_0001274 | 3300048913 | Bacteria | 18027 |
| 749 | Ga0496110_0010628 | 3300048913 | Bacteria | 7494 |
| 750 | Ga0496110_0017893 | 3300048913 | Bacteria | 5933 |
| 751 | Ga0496110_0026013 | 3300048913 | Bacteria | 5004 |
| 752 | Ga0496110_0029618 | 3300048913 | Bacteria | 4714 |
| 753 | Ga0496110_0173689 | 3300048913 | Bacteria | 1955 |
| 754 | Ga0496110_0209950 | 3300048913 | Unclassified | 1770 |
| 755 | Ga0496111_0000696 | 3300048914 | Bacteria | 17753 |
| 756 | Ga0496111_0013239 | 3300048914 | Bacteria | 5607 |
| 757 | Ga0496111_0028621 | 3300048914 | Bacteria | 3950 |
| 758 | Ga0496111_0093684 | 3300048914 | Bacteria | 2202 |
| 759 | Ga0496111_0700804 | 3300048914 | Bacteria | 736 |
| 760 | Ga0496112_0000601 | 3300048915 | Bacteria | 24800 |
| 761 | Ga0496112_0006054 | 3300048915 | Bacteria | 10565 |
| 762 | Ga0496112_0114946 | 3300048915 | Bacteria | 2661 |
| 763 | Ga0496112_0139822 | 3300048915 | Unclassified | 2391 |
| 764 | Ga0496112_0178662 | 3300048915 | Bacteria | 2086 |
| 765 | Ga0496112_0257387 | 3300048915 | Bacteria | 1695 |
| 766 | Ga0496112_0324476 | 3300048915 | Bacteria | 1484 |
| 767 | Ga0496112_0578973 | 3300048915 | Unclassified | 1055 |
| 768 | Ga0496113_0003449 | 3300048916 | Bacteria | 9465 |
| 769 | Ga0496113_0017621 | 3300048916 | Bacteria | 4963 |
| 770 | Ga0496113_0065771 | 3300048916 | Bacteria | 2745 |
| 771 | Ga0496113_0137222 | 3300048916 | Unclassified | 1922 |
| 772 | Ga0496113_0295804 | 3300048916 | Unclassified | 1296 |
| 773 | Ga0496114_0005349 | 3300048917 | Bacteria | 10034 |
| 774 | Ga0496114_0065534 | 3300048917 | Bacteria | 3043 |
| 775 | Ga0496114_0076662 | 3300048917 | Bacteria | 2817 |
| 776 | Ga0496114_0126187 | 3300048917 | Bacteria | 2206 |
| 777 | Ga0496114_0449878 | 3300048917 | Bacteria | 1141 |
| 778 | Ga0496114_0700168 | 3300048917 | Bacteria | 888 |
| 779 | Ga0496114_1015401 | 3300048917 | Bacteria | 713 |
| 780 | Ga0496115_0013680 | 3300048918 | Bacteria | 6144 |
| 781 | Ga0496115_0178028 | 3300048918 | Bacteria | 1758 |
| 782 | Ga0496115_0190974 | 3300048918 | Bacteria | 1692 |
| 783 | Ga0496115_0242957 | 3300048918 | Bacteria | 1484 |
| 784 | Ga0496115_0293772 | 3300048918 | Bacteria | 1332 |
| 785 | Ga0496115_0315304 | 3300048918 | Unclassified | 1280 |
| 786 | Ga0496115_0438064 | 3300048918 | Bacteria | 1057 |
| 787 | Ga0496115_0545337 | 3300048918 | Unclassified | 927 |
| 788 | Ga0501040_0316676 | 3300049576 | Bacteria | 1116 |
| 789 | nmdc:mga03683_97057_c1 | 3300050489 | Bacteria | 1291 |
| 790 | nmdc:mga03n38_434049_c1 | 3300050490 | Unclassified | 728 |
| 791 | nmdc:mga00v17_271058_c1 | 3300050491 | Bacteria | 1101 |
| 792 | nmdc:mga0yw44_1439_c2 | 3300050492 | Bacteria | 8322 |
| 793 | nmdc:mga0yw44_3517_c1 | 3300050492 | Bacteria | 6976 |
| 794 | nmdc:mga0yw44_446405_c1 | 3300050492 | Unclassified | 876 |
| 795 | nmdc:mga0yw44_54640_c1 | 3300050492 | Bacteria | 2428 |
| 796 | nmdc:mga06z11_126406_c1 | 3300050494 | Bacteria | 1431 |
| 797 | nmdc:mga05p37_11335_c1 | 3300050507 | Bacteria | 10605 |
| 798 | nmdc:mga05p37_119370_c1 | 3300050507 | Bacteria | 3240 |
| 799 | nmdc:mga05p37_26391_c1 | 3300050507 | Bacteria | 7064 |
| 800 | nmdc:mga05p37_272693_c1 | 3300050507 | Bacteria | 2021 |
| 801 | nmdc:mga05p37_291971_c1 | 3300050507 | Bacteria | 1940 |
| 802 | nmdc:mga05p37_64107_c1 | 3300050507 | Bacteria | 4522 |
| 803 | nmdc:mga09592_40107_c1 | 3300050508 | Bacteria | 3934 |
| 804 | nmdc:mga0qj67_4_c1 | 3300050509 | Bacteria | 176711 |
| 805 | nmdc:mga06r32_105758_c1 | 3300050510 | Bacteria | 2765 |
| 806 | nmdc:mga06r32_183936_c1 | 3300050510 | Bacteria | 2076 |
| 807 | nmdc:mga06r32_67523_c1 | 3300050510 | Bacteria | 3452 |
| 808 | nmdc:mga06r32_89123_c1 | 3300050510 | Bacteria | 3012 |
| 809 | nmdc:mga08y16_1435524_c1 | 3300050511 | Bacteria | 652 |
| 810 | nmdc:mga08y16_144754_c1 | 3300050511 | Bacteria | 2470 |
| 811 | nmdc:mga0n895_298942_c1 | 3300050512 | Bacteria | 1632 |
| 812 | nmdc:mga0n895_549058_c1 | 3300050512 | Unclassified | 1161 |
| 813 | nmdc:mga0n895_87260_c1 | 3300050512 | Bacteria | 3117 |
| 814 | nmdc:mga0rr50_120985_c1 | 3300050513 | Unclassified | 2084 |
| 815 | nmdc:mga0rr50_502155_c1 | 3300050513 | Bacteria | 1031 |
| 816 | nmdc:mga0rr50_539319_c1 | 3300050513 | Bacteria | 993 |
| 817 | nmdc:mga08x19_529604_c1 | 3300050514 | Bacteria | 833 |
| 818 | nmdc:mga0a205_286808_c1 | 3300050515 | Bacteria | 1521 |
| 819 | nmdc:mga0a205_35703_c1 | 3300050515 | Bacteria | 4774 |
| 820 | Ga0495601_0004131 | 3300053077 | Bacteria | 8365 |
| 821 | Ga0495601_0004957 | 3300053077 | Bacteria | 7724 |
| 822 | Ga0495601_0008342 | 3300053077 | Bacteria | 6119 |
| 823 | Ga0495601_0017589 | 3300053077 | Bacteria | 4342 |
| 824 | Ga0495601_0026436 | 3300053077 | Bacteria | 3584 |
| 825 | Ga0495601_0109883 | 3300053077 | Bacteria | 1785 |
| 826 | Ga0495601_0339750 | 3300053077 | Bacteria | 977 |
| 827 | Ga0495601_0464485 | 3300053077 | Bacteria | 818 |
| 828 | Ga0495612_0004798 | 3300053078 | Bacteria | 5597 |
| 829 | Ga0495612_0005266 | 3300053078 | Bacteria | 5343 |
| 830 | Ga0495612_0021164 | 3300053078 | Bacteria | 2609 |
| 831 | Ga0495655_0082980 | 3300053083 | Bacteria | 920 |
| 832 | Ga0495595_0005513 | 3300053084 | Bacteria | 5125 |
| 833 | Ga0495595_0007484 | 3300053084 | Bacteria | 4473 |
| 834 | Ga0495595_0010073 | 3300053084 | Bacteria | 3923 |
| 835 | Ga0495595_0142049 | 3300053084 | Bacteria | 1178 |
| 836 | Ga0495619_0000149 | 3300053085 | Bacteria | 51751 |
| 837 | Ga0495619_0001954 | 3300053085 | Bacteria | 13749 |
| 838 | Ga0495619_0007106 | 3300053085 | Bacteria | 7087 |
| 839 | Ga0495619_0007508 | 3300053085 | Bacteria | 6905 |
| 840 | Ga0495619_0058657 | 3300053085 | Bacteria | 2555 |
| 841 | Ga0495619_0289850 | 3300053085 | Bacteria | 1134 |
| 842 | Ga0495619_0406400 | 3300053085 | Bacteria | 940 |
| 843 | Ga0495619_0540158 | 3300053085 | Unclassified | 800 |
| 844 | Ga0500643_005326 | 3300053087 | Bacteria | 5563 |
| 845 | Ga0500644_0001263 | 3300053088 | Bacteria | 6906 |
| 846 | Ga0500651_0036588 | 3300053093 | Bacteria | 3093 |
| 847 | Ga0500566_0294925 | 3300053094 | Unclassified | 766 |
| 848 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 849 | Ga0500595_013460 | 3300053119 | Bacteria | 3132 |
| 850 | Ga0500652_006592 | 3300053131 | Bacteria | 3749 |
| 851 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 852 | Ga0500616_0176801 | 3300053153 | Unclassified | 964 |
| 853 | Ga0500637_0071204 | 3300053178 | Bacteria | 2000 |
| 854 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 855 | Ga0501082_0807635 | 3300060353 | Bacteria | 821 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035086 | Ga0373934_0135815 | Ga0373934_0135815_37_525 | 162 |
| 2 | 3300035118 | Ga0373954_0222009 | Ga0373954_0222009_172_669 | 165 |
| 3 | 3300035120 | Ga0373957_0105937 | Ga0373957_0105937_142_639 | 165 |
| 4 | 3300035410 | Ga0373924_0254874 | Ga0373924_0254874_186_683 | 165 |
| 5 | 3300035724 | Ga0373933_0230141 | Ga0373933_0230141_217_714 | 165 |
| 6 | 3300046514 | Ga0495618_0123351 | Ga0495618_0123351_22_519 | 165 |
| 7 | 3300046559 | Ga0495667_0158415 | Ga0495667_0158415_304_801 | 165 |
| 8 | 3300039450 | Ga0436363_0094947 | Ga0436363_0094947_127_645 | 172 |
| 9 | 3300025918 | Ga0207662_10159341 | Ga0207662_101593412 | 177 |
| 10 | 3300035118 | Ga0373954_0000582 | Ga0373954_0000582_11148_11681 | 177 |
| 11 | 3300046523 | Ga0495644_0370438 | Ga0495644_0370438_10_543 | 177 |
| 12 | 3300048911 | Ga0496108_1438320 | Ga0496108_1438320_23_556 | 177 |
| 13 | 3300046516 | Ga0495628_0033958 | Ga0495628_0033958_3549_4085 | 178 |
| 14 | 3300037853 | Ga0436364_0855834 | Ga0436364_0855834_215_781 | 179 |
| 15 | 3300005536 | Ga0070697_100003357 | Ga0070697_1000033571 | 184 |
| 16 | 3300007265 | Ga0099794_10031603 | Ga0099794_100316032 | 184 |
| 17 | 3300007788 | Ga0099795_10001014 | Ga0099795_100010144 | 184 |
| 18 | 3300027512 | Ga0209179_1004415 | Ga0209179_10044153 | 184 |
| 19 | 3300005439 | Ga0070711_100071681 | Ga0070711_1000716812 | 185 |
| 20 | 3300006175 | Ga0070712_100007738 | Ga0070712_1000077382 | 185 |
| 21 | 3300025915 | Ga0207693_10010575 | Ga0207693_100105753 | 185 |
| 22 | 3300025916 | Ga0207663_10055738 | Ga0207663_100557382 | 185 |
| 23 | 3300031238 | Ga0265332_10003584 | Ga0265332_100035843 | 185 |
| 24 | 3300031239 | Ga0265328_10218071 | Ga0265328_102180712 | 185 |
| 25 | 3300031242 | Ga0265329_10166233 | Ga0265329_101662332 | 185 |
| 26 | 3300031247 | Ga0265340_10000757 | Ga0265340_100007578 | 185 |
| 27 | 3300031249 | Ga0265339_10001098 | Ga0265339_100010987 | 185 |
| 28 | 3300031712 | Ga0265342_10000092 | Ga0265342_1000009230 | 185 |
| 29 | 3300039447 | Ga0436361_0924848 | Ga0436361_0924848_75_632 | 185 |
| 30 | 3300005331 | Ga0070670_100046488 | Ga0070670_1000464883 | 186 |
| 31 | 3300005338 | Ga0068868_100019798 | Ga0068868_1000197985 | 186 |
| 32 | 3300005338 | Ga0068868_100725929 | Ga0068868_1007259292 | 186 |
| 33 | 3300005339 | Ga0070660_100716073 | Ga0070660_1007160732 | 186 |
| 34 | 3300005340 | Ga0070689_100703468 | Ga0070689_1007034682 | 186 |
| 35 | 3300005344 | Ga0070661_100766765 | Ga0070661_1007667652 | 186 |
| 36 | 3300005344 | Ga0070661_100964028 | Ga0070661_1009640281 | 186 |
| 37 | 3300005345 | Ga0070692_10052338 | Ga0070692_100523382 | 186 |
| 38 | 3300005347 | Ga0070668_100873432 | Ga0070668_1008734321 | 186 |
| 39 | 3300005353 | Ga0070669_100254905 | Ga0070669_1002549051 | 186 |
| 40 | 3300005353 | Ga0070669_100569986 | Ga0070669_1005699862 | 186 |
| 41 | 3300005355 | Ga0070671_100114803 | Ga0070671_1001148032 | 186 |
| 42 | 3300005356 | Ga0070674_100249883 | Ga0070674_1002498832 | 186 |
| 43 | 3300005434 | Ga0070709_10249432 | Ga0070709_102494322 | 186 |
| 44 | 3300005435 | Ga0070714_100555765 | Ga0070714_1005557651 | 186 |
| 45 | 3300005436 | Ga0070713_100195432 | Ga0070713_1001954321 | 186 |
| 46 | 3300005439 | Ga0070711_100075515 | Ga0070711_1000755153 | 186 |
| 47 | 3300005439 | Ga0070711_100643802 | Ga0070711_1006438021 | 186 |
| 48 | 3300005441 | Ga0070700_100145393 | Ga0070700_1001453932 | 186 |
| 49 | 3300005455 | Ga0070663_100131674 | Ga0070663_1001316741 | 186 |
| 50 | 3300005458 | Ga0070681_10207284 | Ga0070681_102072841 | 186 |
| 51 | 3300005459 | Ga0068867_100142961 | Ga0068867_1001429611 | 186 |
| 52 | 3300005466 | Ga0070685_10306691 | Ga0070685_103066911 | 186 |
| 53 | 3300005543 | Ga0070672_100217215 | Ga0070672_1002172151 | 186 |
| 54 | 3300005547 | Ga0070693_100630332 | Ga0070693_1006303321 | 186 |
| 55 | 3300005548 | Ga0070665_100257971 | Ga0070665_1002579712 | 186 |
| 56 | 3300005549 | Ga0070704_100279334 | Ga0070704_1002793341 | 186 |
| 57 | 3300005577 | Ga0068857_100220077 | Ga0068857_1002200772 | 186 |
| 58 | 3300005615 | Ga0070702_100053473 | Ga0070702_1000534732 | 186 |
| 59 | 3300005615 | Ga0070702_100172200 | Ga0070702_1001722002 | 186 |
| 60 | 3300005617 | Ga0068859_100031624 | Ga0068859_1000316242 | 186 |
| 61 | 3300005618 | Ga0068864_100136555 | Ga0068864_1001365552 | 186 |
| 62 | 3300005718 | Ga0068866_10005758 | Ga0068866_100057583 | 186 |
| 63 | 3300005718 | Ga0068866_10354438 | Ga0068866_103544382 | 186 |
| 64 | 3300005718 | Ga0068866_10571138 | Ga0068866_105711381 | 186 |
| 65 | 3300005719 | Ga0068861_100254363 | Ga0068861_1002543631 | 186 |
| 66 | 3300005840 | Ga0068870_10020749 | Ga0068870_100207493 | 186 |
| 67 | 3300005841 | Ga0068863_100231265 | Ga0068863_1002312652 | 186 |
| 68 | 3300005841 | Ga0068863_100319960 | Ga0068863_1003199602 | 186 |
| 69 | 3300005842 | Ga0068858_100178310 | Ga0068858_1001783101 | 186 |
| 70 | 3300005843 | Ga0068860_100077192 | Ga0068860_1000771923 | 186 |
| 71 | 3300005843 | Ga0068860_100324302 | Ga0068860_1003243022 | 186 |
| 72 | 3300005844 | Ga0068862_101310603 | Ga0068862_1013106031 | 186 |
| 73 | 3300005983 | Ga0081540_1001030 | Ga0081540_100103015 | 186 |
| 74 | 3300006028 | Ga0070717_11158431 | Ga0070717_111584311 | 186 |
| 75 | 3300006038 | Ga0075365_10043223 | Ga0075365_100432232 | 186 |
| 76 | 3300006177 | Ga0075362_10078152 | Ga0075362_100781522 | 186 |
| 77 | 3300006178 | Ga0075367_10196243 | Ga0075367_101962432 | 186 |
| 78 | 3300006237 | Ga0097621_100444288 | Ga0097621_1004442881 | 186 |
| 79 | 3300006844 | Ga0075428_100021266 | Ga0075428_1000212666 | 186 |
| 80 | 3300006846 | Ga0075430_100040521 | Ga0075430_1000405213 | 186 |
| 81 | 3300006852 | Ga0075433_10041187 | Ga0075433_100411873 | 186 |
| 82 | 3300006871 | Ga0075434_100280879 | Ga0075434_1002808792 | 186 |
| 83 | 3300006871 | Ga0075434_100396164 | Ga0075434_1003961642 | 186 |
| 84 | 3300006880 | Ga0075429_100242670 | Ga0075429_1002426702 | 186 |
| 85 | 3300006881 | Ga0068865_100179016 | Ga0068865_1001790162 | 186 |
| 86 | 3300006914 | Ga0075436_100033605 | Ga0075436_1000336052 | 186 |
| 87 | 3300006931 | Ga0097620_100031624 | Ga0097620_1000316245 | 186 |
| 88 | 3300007076 | Ga0075435_100499013 | Ga0075435_1004990132 | 186 |
| 89 | 3300009011 | Ga0105251_10086785 | Ga0105251_100867852 | 186 |
| 90 | 3300009092 | Ga0105250_10089889 | Ga0105250_100898892 | 186 |
| 91 | 3300009094 | Ga0111539_10057982 | Ga0111539_100579822 | 186 |
| 92 | 3300009094 | Ga0111539_10486097 | Ga0111539_104860972 | 186 |
| 93 | 3300009098 | Ga0105245_10346909 | Ga0105245_103469091 | 186 |
| 94 | 3300009101 | Ga0105247_10061346 | Ga0105247_100613462 | 186 |
| 95 | 3300009147 | Ga0114129_10035252 | Ga0114129_100352525 | 186 |
| 96 | 3300009176 | Ga0105242_10120223 | Ga0105242_101202232 | 186 |
| 97 | 3300009176 | Ga0105242_10403603 | Ga0105242_104036033 | 186 |
| 98 | 3300009177 | Ga0105248_10004776 | Ga0105248_1000477615 | 186 |
| 99 | 3300009177 | Ga0105248_10268358 | Ga0105248_102683582 | 186 |
| 100 | 3300010375 | Ga0105239_11394527 | Ga0105239_113945271 | 186 |
| 101 | 3300013296 | Ga0157374_10065165 | Ga0157374_100651652 | 186 |
| 102 | 3300013297 | Ga0157378_11316623 | Ga0157378_113166232 | 186 |
| 103 | 3300013306 | Ga0163162_10418364 | Ga0163162_104183642 | 186 |
| 104 | 3300013306 | Ga0163162_10452082 | Ga0163162_104520822 | 186 |
| 105 | 3300014325 | Ga0163163_10012789 | Ga0163163_100127892 | 186 |
| 106 | 3300014969 | Ga0157376_10144459 | Ga0157376_101444592 | 186 |
| 107 | 3300024225 | Ga0224572_1006794 | Ga0224572_10067942 | 186 |
| 108 | 3300025899 | Ga0207642_10042651 | Ga0207642_100426512 | 186 |
| 109 | 3300025901 | Ga0207688_10637509 | Ga0207688_106375091 | 186 |
| 110 | 3300025904 | Ga0207647_10272587 | Ga0207647_102725872 | 186 |
| 111 | 3300025905 | Ga0207685_10009105 | Ga0207685_100091052 | 186 |
| 112 | 3300025906 | Ga0207699_10208258 | Ga0207699_102082582 | 186 |
| 113 | 3300025906 | Ga0207699_10935188 | Ga0207699_109351881 | 186 |
| 114 | 3300025907 | Ga0207645_10019349 | Ga0207645_100193491 | 186 |
| 115 | 3300025927 | Ga0207687_10592098 | Ga0207687_105920982 | 186 |
| 116 | 3300025933 | Ga0207706_10084917 | Ga0207706_100849173 | 186 |
| 117 | 3300025934 | Ga0207686_10110954 | Ga0207686_101109542 | 186 |
| 118 | 3300025934 | Ga0207686_10151105 | Ga0207686_101511052 | 186 |
| 119 | 3300025935 | Ga0207709_10964180 | Ga0207709_109641802 | 186 |
| 120 | 3300025936 | Ga0207670_10203842 | Ga0207670_102038421 | 186 |
| 121 | 3300025937 | Ga0207669_11053424 | Ga0207669_110534241 | 186 |
| 122 | 3300025939 | Ga0207665_10356586 | Ga0207665_103565862 | 186 |
| 123 | 3300025940 | Ga0207691_10015870 | Ga0207691_100158702 | 186 |
| 124 | 3300025941 | Ga0207711_10022249 | Ga0207711_100222494 | 186 |
| 125 | 3300025941 | Ga0207711_11066813 | Ga0207711_110668131 | 186 |
| 126 | 3300025942 | Ga0207689_10022880 | Ga0207689_100228803 | 186 |
| 127 | 3300025945 | Ga0207679_11168754 | Ga0207679_111687542 | 186 |
| 128 | 3300025960 | Ga0207651_10127635 | Ga0207651_101276353 | 186 |
| 129 | 3300025981 | Ga0207640_10478614 | Ga0207640_104786142 | 186 |
| 130 | 3300025986 | Ga0207658_10086337 | Ga0207658_100863372 | 186 |
| 131 | 3300026023 | Ga0207677_10615656 | Ga0207677_106156561 | 186 |
| 132 | 3300026035 | Ga0207703_10446307 | Ga0207703_104463071 | 186 |
| 133 | 3300026035 | Ga0207703_10664502 | Ga0207703_106645021 | 186 |
| 134 | 3300026067 | Ga0207678_10011265 | Ga0207678_100112656 | 186 |
| 135 | 3300026075 | Ga0207708_10051435 | Ga0207708_100514353 | 186 |
| 136 | 3300026088 | Ga0207641_10405488 | Ga0207641_104054882 | 186 |
| 137 | 3300026118 | Ga0207675_100006797 | Ga0207675_10000679713 | 186 |
| 138 | 3300026121 | Ga0207683_10005533 | Ga0207683_100055334 | 186 |
| 139 | 3300026121 | Ga0207683_11089095 | Ga0207683_110890951 | 186 |
| 140 | 3300028379 | Ga0268266_10284203 | Ga0268266_102842032 | 186 |
| 141 | 3300028381 | Ga0268264_10185841 | Ga0268264_101858411 | 186 |
| 142 | 3300028381 | Ga0268264_10284093 | Ga0268264_102840932 | 186 |
| 143 | 3300028800 | Ga0265338_10083691 | Ga0265338_100836912 | 186 |
| 144 | 3300031018 | Ga0265773_1006684 | Ga0265773_10066842 | 186 |
| 145 | 3300031090 | Ga0265760_10089398 | Ga0265760_100893982 | 186 |
| 146 | 3300031241 | Ga0265325_10050885 | Ga0265325_100508851 | 186 |
| 147 | 3300031249 | Ga0265339_10000077 | Ga0265339_1000007768 | 186 |
| 148 | 3300031595 | Ga0265313_10001170 | Ga0265313_1000117021 | 186 |
| 149 | 3300033179 | Ga0307507_10106153 | Ga0307507_101061532 | 186 |
| 150 | 3300033179 | Ga0307507_10385298 | Ga0307507_103852981 | 186 |
| 151 | 3300035084 | Ga0373928_0009042 | Ga0373928_0009042_1135_1695 | 186 |
| 152 | 3300035085 | Ga0373929_0006323 | Ga0373929_0006323_712_1308 | 186 |
| 153 | 3300035086 | Ga0373934_0087177 | Ga0373934_0087177_129_689 | 186 |
| 154 | 3300035089 | Ga0373944_0299189 | Ga0373944_0299189_27_587 | 186 |
| 155 | 3300035092 | Ga0373952_0007885 | Ga0373952_0007885_26_586 | 186 |
| 156 | 3300035092 | Ga0373952_0009694 | Ga0373952_0009694_136_732 | 186 |
| 157 | 3300035111 | Ga0373923_0002741 | Ga0373923_0002741_214_774 | 186 |
| 158 | 3300035113 | Ga0373936_0135689 | Ga0373936_0135689_354_914 | 186 |
| 159 | 3300035115 | Ga0373941_0095849 | Ga0373941_0095849_370_930 | 186 |
| 160 | 3300035116 | Ga0373945_0007853 | Ga0373945_0007853_2775_3362 | 186 |
| 161 | 3300035116 | Ga0373945_0140116 | Ga0373945_0140116_317_877 | 186 |
| 162 | 3300035117 | Ga0373953_0041124 | Ga0373953_0041124_656_1216 | 186 |
| 163 | 3300035118 | Ga0373954_0007523 | Ga0373954_0007523_133_693 | 186 |
| 164 | 3300035118 | Ga0373954_0218434 | Ga0373954_0218434_278_838 | 186 |
| 165 | 3300035119 | Ga0373956_0004515 | Ga0373956_0004515_708_1268 | 186 |
| 166 | 3300035120 | Ga0373957_0047996 | Ga0373957_0047996_701_1261 | 186 |
| 167 | 3300035170 | Ga0373943_0101334 | Ga0373943_0101334_552_1139 | 186 |
| 168 | 3300035170 | Ga0373943_0321044 | Ga0373943_0321044_43_603 | 186 |
| 169 | 3300035171 | Ga0373946_0160036 | Ga0373946_0160036_198_758 | 186 |
| 170 | 3300035171 | Ga0373946_0191745 | Ga0373946_0191745_62_658 | 186 |
| 171 | 3300035172 | Ga0373955_0066670 | Ga0373955_0066670_262_822 | 186 |
| 172 | 3300035172 | Ga0373955_0346178 | Ga0373955_0346178_206_766 | 186 |
| 173 | 3300035207 | Ga0373942_0041529 | Ga0373942_0041529_474_1034 | 186 |
| 174 | 3300035241 | Ga0373961_0072089 | Ga0373961_0072089_30_590 | 186 |
| 175 | 3300035410 | Ga0373924_0002954 | Ga0373924_0002954_3928_4488 | 186 |
| 176 | 3300035691 | Ga0373931_0003361 | Ga0373931_0003361_2994_3554 | 186 |
| 177 | 3300035691 | Ga0373931_0004763 | Ga0373931_0004763_1592_2188 | 186 |
| 178 | 3300035692 | Ga0373935_0021389 | Ga0373935_0021389_711_1271 | 186 |
| 179 | 3300035692 | Ga0373935_0180597 | Ga0373935_0180597_512_1111 | 186 |
| 180 | 3300035695 | Ga0373927_0021247 | Ga0373927_0021247_3656_4216 | 186 |
| 181 | 3300035695 | Ga0373927_0234731 | Ga0373927_0234731_302_862 | 186 |
| 182 | 3300035724 | Ga0373933_0046663 | Ga0373933_0046663_1778_2338 | 186 |
| 183 | 3300035725 | Ga0373947_0044707 | Ga0373947_0044707_672_1232 | 186 |
| 184 | 3300036401 | Ga0373937_0679630 | Ga0373937_0679630_262_822 | 186 |
| 185 | 3300036401 | Ga0373937_0823228 | Ga0373937_0823228_55_615 | 186 |
| 186 | 3300037068 | Ga0373925_0015033 | Ga0373925_0015033_1158_1718 | 186 |
| 187 | 3300037068 | Ga0373925_0156408 | Ga0373925_0156408_549_1136 | 186 |
| 188 | 3300037068 | Ga0373925_0248228 | Ga0373925_0248228_710_1270 | 186 |
| 189 | 3300037068 | Ga0373925_0405734 | Ga0373925_0405734_24_584 | 186 |
| 190 | 3300039447 | Ga0436361_0095794 | Ga0436361_0095794_154_714 | 186 |
| 191 | 3300045976 | Ga0466967_1056169 | Ga0466967_1056169_146_706 | 186 |
| 192 | 3300046454 | Ga0495592_0008473 | Ga0495592_0008473_1024_1584 | 186 |
| 193 | 3300046454 | Ga0495592_0088050 | Ga0495592_0088050_1380_1940 | 186 |
| 194 | 3300046455 | Ga0495603_0191434 | Ga0495603_0191434_285_845 | 186 |
| 195 | 3300046455 | Ga0495603_0199770 | Ga0495603_0199770_135_722 | 186 |
| 196 | 3300046461 | Ga0495641_0011540 | Ga0495641_0011540_4375_4935 | 186 |
| 197 | 3300046461 | Ga0495641_0049119 | Ga0495641_0049119_958_1518 | 186 |
| 198 | 3300046462 | Ga0495651_0487605 | Ga0495651_0487605_71_631 | 186 |
| 199 | 3300046463 | Ga0495653_0303915 | Ga0495653_0303915_355_915 | 186 |
| 200 | 3300046472 | Ga0495580_0073254 | Ga0495580_0073254_1721_2281 | 186 |
| 201 | 3300046472 | Ga0495580_0081932 | Ga0495580_0081932_563_1150 | 186 |
| 202 | 3300046472 | Ga0495580_0530027 | Ga0495580_0530027_51_611 | 186 |
| 203 | 3300046474 | Ga0495605_0149375 | Ga0495605_0149375_10_570 | 186 |
| 204 | 3300046475 | Ga0495639_0292109 | Ga0495639_0292109_149_709 | 186 |
| 205 | 3300046476 | Ga0495662_0023840 | Ga0495662_0023840_1940_2500 | 186 |
| 206 | 3300046477 | Ga0495664_0189536 | Ga0495664_0189536_154_714 | 186 |
| 207 | 3300046477 | Ga0495664_0219559 | Ga0495664_0219559_478_1038 | 186 |
| 208 | 3300046477 | Ga0495664_0317050 | Ga0495664_0317050_241_801 | 186 |
| 209 | 3300046477 | Ga0495664_0480163 | Ga0495664_0480163_129_689 | 186 |
| 210 | 3300046491 | Ga0495584_0163952 | Ga0495584_0163952_121_681 | 186 |
| 211 | 3300046491 | Ga0495584_0446595 | Ga0495584_0446595_51_611 | 186 |
| 212 | 3300046492 | Ga0495585_0171153 | Ga0495585_0171153_461_1021 | 186 |
| 213 | 3300046499 | Ga0495594_0015676 | Ga0495594_0015676_560_1120 | 186 |
| 214 | 3300046499 | Ga0495594_0076130 | Ga0495594_0076130_754_1341 | 186 |
| 215 | 3300046499 | Ga0495594_0256296 | Ga0495594_0256296_375_935 | 186 |
| 216 | 3300046501 | Ga0495607_0040819 | Ga0495607_0040819_1242_1802 | 186 |
| 217 | 3300046511 | Ga0495608_0019463 | Ga0495608_0019463_2314_2874 | 186 |
| 218 | 3300046513 | Ga0495616_0137536 | Ga0495616_0137536_338_898 | 186 |
| 219 | 3300046514 | Ga0495618_0436267 | Ga0495618_0436267_55_615 | 186 |
| 220 | 3300046514 | Ga0495618_0598020 | Ga0495618_0598020_33_593 | 186 |
| 221 | 3300046516 | Ga0495628_0004724 | Ga0495628_0004724_753_1313 | 186 |
| 222 | 3300046516 | Ga0495628_0019722 | Ga0495628_0019722_4002_4562 | 186 |
| 223 | 3300046516 | Ga0495628_0160779 | Ga0495628_0160779_546_1106 | 186 |
| 224 | 3300046517 | Ga0495630_0016483 | Ga0495630_0016483_3365_3925 | 186 |
| 225 | 3300046517 | Ga0495630_0385510 | Ga0495630_0385510_262_822 | 186 |
| 226 | 3300046529 | Ga0495652_0028740 | Ga0495652_0028740_4028_4588 | 186 |
| 227 | 3300046529 | Ga0495652_0046364 | Ga0495652_0046364_285_845 | 186 |
| 228 | 3300046529 | Ga0495652_0236075 | Ga0495652_0236075_654_1214 | 186 |
| 229 | 3300046531 | Ga0495665_0037035 | Ga0495665_0037035_738_1298 | 186 |
| 230 | 3300046533 | Ga0495640_0031547 | Ga0495640_0031547_355_915 | 186 |
| 231 | 3300046533 | Ga0495640_0324340 | Ga0495640_0324340_171_731 | 186 |
| 232 | 3300046535 | Ga0495586_0099383 | Ga0495586_0099383_697_1257 | 186 |
| 233 | 3300046535 | Ga0495586_0286701 | Ga0495586_0286701_30_590 | 186 |
| 234 | 3300046536 | Ga0495587_0012557 | Ga0495587_0012557_423_983 | 186 |
| 235 | 3300046536 | Ga0495587_0079111 | Ga0495587_0079111_768_1328 | 186 |
| 236 | 3300046536 | Ga0495587_0330773 | Ga0495587_0330773_107_667 | 186 |
| 237 | 3300046543 | Ga0495645_0000166 | Ga0495645_0000166_18411_18971 | 186 |
| 238 | 3300046557 | Ga0495622_0199928 | Ga0495622_0199928_156_716 | 186 |
| 239 | 3300046559 | Ga0495667_0193654 | Ga0495667_0193654_101_664 | 186 |
| 240 | 3300046559 | Ga0495667_0244087 | Ga0495667_0244087_304_864 | 186 |
| 241 | 3300046642 | Ga0495634_0135864 | Ga0495634_0135864_355_915 | 186 |
| 242 | 3300046663 | Ga0495635_0032494 | Ga0495635_0032494_900_1460 | 186 |
| 243 | 3300046665 | Ga0495661_0267137 | Ga0495661_0267137_249_809 | 186 |
| 244 | 3300046674 | Ga0495588_0060823 | Ga0495588_0060823_506_1093 | 186 |
| 245 | 3300046675 | Ga0495657_0081830 | Ga0495657_0081830_657_1217 | 186 |
| 246 | 3300046678 | Ga0495599_0019880 | Ga0495599_0019880_1565_2125 | 186 |
| 247 | 3300046678 | Ga0495599_0052165 | Ga0495599_0052165_1889_2449 | 186 |
| 248 | 3300046681 | Ga0495647_0013399 | Ga0495647_0013399_261_821 | 186 |
| 249 | 3300046683 | Ga0495658_0180523 | Ga0495658_0180523_284_844 | 186 |
| 250 | 3300046683 | Ga0495658_0317198 | Ga0495658_0317198_365_925 | 186 |
| 251 | 3300046689 | Ga0495613_0089888 | Ga0495613_0089888_1080_1640 | 186 |
| 252 | 3300046689 | Ga0495613_0709702 | Ga0495613_0709702_20_580 | 186 |
| 253 | 3300046690 | Ga0495624_0033353 | Ga0495624_0033353_1251_1838 | 186 |
| 254 | 3300046690 | Ga0495624_0054156 | Ga0495624_0054156_1164_1724 | 186 |
| 255 | 3300046692 | Ga0495671_0185293 | Ga0495671_0185293_206_766 | 186 |
| 256 | 3300046809 | Ga0495600_0509136 | Ga0495600_0509136_133_693 | 186 |
| 257 | 3300047317 | Ga0495604_0117751 | Ga0495604_0117751_1038_1598 | 186 |
| 258 | 3300047317 | Ga0495604_0299950 | Ga0495604_0299950_449_1009 | 186 |
| 259 | 3300047319 | Ga0495674_0006376 | Ga0495674_0006376_5784_6344 | 186 |
| 260 | 3300047321 | Ga0495676_0188253 | Ga0495676_0188253_830_1390 | 186 |
| 261 | 3300047322 | Ga0495680_0247449 | Ga0495680_0247449_55_615 | 186 |
| 262 | 3300047444 | Ga0495675_0038763 | Ga0495675_0038763_2392_2952 | 186 |
| 263 | 3300047471 | Ga0495684_0041612 | Ga0495684_0041612_2339_2899 | 186 |
| 264 | 3300047471 | Ga0495684_0337517 | Ga0495684_0337517_385_945 | 186 |
| 265 | 3300047673 | Ga0495593_0090815 | Ga0495593_0090815_981_1541 | 186 |
| 266 | 3300048088 | Ga0495602_0132769 | Ga0495602_0132769_458_1018 | 186 |
| 267 | 3300048903 | Ga0496100_0135792 | Ga0496100_0135792_755_1351 | 186 |
| 268 | 3300048903 | Ga0496100_0305326 | Ga0496100_0305326_540_1112 | 186 |
| 269 | 3300048903 | Ga0496100_0450678 | Ga0496100_0450678_176_736 | 186 |
| 270 | 3300048904 | Ga0496101_0010596 | Ga0496101_0010596_26_586 | 186 |
| 271 | 3300048904 | Ga0496101_0071333 | Ga0496101_0071333_570_1166 | 186 |
| 272 | 3300048905 | Ga0496102_0220350 | Ga0496102_0220350_177_737 | 186 |
| 273 | 3300048906 | Ga0496103_0019470 | Ga0496103_0019470_81_641 | 186 |
| 274 | 3300048907 | Ga0496104_0025001 | Ga0496104_0025001_4212_4808 | 186 |
| 275 | 3300048908 | Ga0496105_0005805 | Ga0496105_0005805_152_712 | 186 |
| 276 | 3300048908 | Ga0496105_0045480 | Ga0496105_0045480_1419_1979 | 186 |
| 277 | 3300048908 | Ga0496105_0155492 | Ga0496105_0155492_861_1421 | 186 |
| 278 | 3300048908 | Ga0496105_0212767 | Ga0496105_0212767_884_1480 | 186 |
| 279 | 3300048909 | Ga0496106_0027103 | Ga0496106_0027103_177_737 | 186 |
| 280 | 3300048909 | Ga0496106_0116033 | Ga0496106_0116033_432_992 | 186 |
| 281 | 3300048909 | Ga0496106_0539947 | Ga0496106_0539947_227_787 | 186 |
| 282 | 3300048910 | Ga0496107_0029015 | Ga0496107_0029015_422_1018 | 186 |
| 283 | 3300048910 | Ga0496107_0128845 | Ga0496107_0128845_103_663 | 186 |
| 284 | 3300048911 | Ga0496108_0019990 | Ga0496108_0019990_503_1099 | 186 |
| 285 | 3300048912 | Ga0496109_0012275 | Ga0496109_0012275_103_663 | 186 |
| 286 | 3300048912 | Ga0496109_0133973 | Ga0496109_0133973_451_1047 | 186 |
| 287 | 3300048913 | Ga0496110_0026013 | Ga0496110_0026013_436_1032 | 186 |
| 288 | 3300048913 | Ga0496110_0173689 | Ga0496110_0173689_66_626 | 186 |
| 289 | 3300048913 | Ga0496110_0209950 | Ga0496110_0209950_68_628 | 186 |
| 290 | 3300048914 | Ga0496111_0093684 | Ga0496111_0093684_1114_1710 | 186 |
| 291 | 3300048915 | Ga0496112_0257387 | Ga0496112_0257387_76_636 | 186 |
| 292 | 3300048916 | Ga0496113_0065771 | Ga0496113_0065771_204_800 | 186 |
| 293 | 3300048917 | Ga0496114_0005349 | Ga0496114_0005349_9152_9712 | 186 |
| 294 | 3300048917 | Ga0496114_0065534 | Ga0496114_0065534_422_1018 | 186 |
| 295 | 3300048918 | Ga0496115_0178028 | Ga0496115_0178028_757_1317 | 186 |
| 296 | 3300048918 | Ga0496115_0190974 | Ga0496115_0190974_464_1117 | 186 |
| 297 | 3300048918 | Ga0496115_0438064 | Ga0496115_0438064_198_758 | 186 |
| 298 | 3300049576 | Ga0501040_0316676 | Ga0501040_0316676_335_922 | 186 |
| 299 | 3300050489 | nmdc:mga03683_97057_c1 | nmdc:mga03683_97057_c1_514_1074 | 186 |
| 300 | 3300050490 | nmdc:mga03n38_434049_c1 | nmdc:mga03n38_434049_c1_84_644 | 186 |
| 301 | 3300050491 | nmdc:mga00v17_271058_c1 | nmdc:mga00v17_271058_c1_511_1071 | 186 |
| 302 | 3300050492 | nmdc:mga0yw44_446405_c1 | nmdc:mga0yw44_446405_c1_199_759 | 186 |
| 303 | 3300050492 | nmdc:mga0yw44_54640_c1 | nmdc:mga0yw44_54640_c1_1743_2303 | 186 |
| 304 | 3300050494 | nmdc:mga06z11_126406_c1 | nmdc:mga06z11_126406_c1_426_986 | 186 |
| 305 | 3300050507 | nmdc:mga05p37_26391_c1 | nmdc:mga05p37_26391_c1_4246_4806 | 186 |
| 306 | 3300050509 | nmdc:mga0qj67_4_c1 | nmdc:mga0qj67_4_c1_53224_53784 | 186 |
| 307 | 3300050511 | nmdc:mga08y16_144754_c1 | nmdc:mga08y16_144754_c1_735_1295 | 186 |
| 308 | 3300050512 | nmdc:mga0n895_549058_c1 | nmdc:mga0n895_549058_c1_389_985 | 186 |
| 309 | 3300050512 | nmdc:mga0n895_87260_c1 | nmdc:mga0n895_87260_c1_1866_2426 | 186 |
| 310 | 3300050513 | nmdc:mga0rr50_502155_c1 | nmdc:mga0rr50_502155_c1_136_696 | 186 |
| 311 | 3300053077 | Ga0495601_0008342 | Ga0495601_0008342_1009_1569 | 186 |
| 312 | 3300053077 | Ga0495601_0026436 | Ga0495601_0026436_1664_2224 | 186 |
| 313 | 3300053077 | Ga0495601_0109883 | Ga0495601_0109883_1139_1699 | 186 |
| 314 | 3300053077 | Ga0495601_0339750 | Ga0495601_0339750_168_728 | 186 |
| 315 | 3300053083 | Ga0495655_0082980 | Ga0495655_0082980_123_710 | 186 |
| 316 | 3300053084 | Ga0495595_0005513 | Ga0495595_0005513_4101_4661 | 186 |
| 317 | 3300053085 | Ga0495619_0406400 | Ga0495619_0406400_309_869 | 186 |
| 318 | 3300053085 | Ga0495619_0540158 | Ga0495619_0540158_134_694 | 186 |
| 319 | 3300053178 | Ga0500637_0071204 | Ga0500637_0071204_136_768 | 186 |
| 320 | 3300005328 | Ga0070676_10705429 | Ga0070676_107054291 | 187 |
| 321 | 3300005331 | Ga0070670_100020187 | Ga0070670_1000201872 | 187 |
| 322 | 3300005335 | Ga0070666_10462467 | Ga0070666_104624672 | 187 |
| 323 | 3300005335 | Ga0070666_10792587 | Ga0070666_107925871 | 187 |
| 324 | 3300005337 | Ga0070682_100033603 | Ga0070682_1000336032 | 187 |
| 325 | 3300005339 | Ga0070660_100321379 | Ga0070660_1003213791 | 187 |
| 326 | 3300005340 | Ga0070689_101141972 | Ga0070689_1011419721 | 187 |
| 327 | 3300005347 | Ga0070668_100134085 | Ga0070668_1001340852 | 187 |
| 328 | 3300005354 | Ga0070675_100439931 | Ga0070675_1004399312 | 187 |
| 329 | 3300005354 | Ga0070675_100675562 | Ga0070675_1006755621 | 187 |
| 330 | 3300005355 | Ga0070671_100509088 | Ga0070671_1005090882 | 187 |
| 331 | 3300005356 | Ga0070674_100059554 | Ga0070674_1000595542 | 187 |
| 332 | 3300005364 | Ga0070673_100812572 | Ga0070673_1008125721 | 187 |
| 333 | 3300005364 | Ga0070673_100908507 | Ga0070673_1009085071 | 187 |
| 334 | 3300005364 | Ga0070673_101462324 | Ga0070673_1014623241 | 187 |
| 335 | 3300005367 | Ga0070667_100287209 | Ga0070667_1002872092 | 187 |
| 336 | 3300005367 | Ga0070667_100420876 | Ga0070667_1004208762 | 187 |
| 337 | 3300005434 | Ga0070709_10089244 | Ga0070709_100892442 | 187 |
| 338 | 3300005434 | Ga0070709_10089991 | Ga0070709_100899912 | 187 |
| 339 | 3300005434 | Ga0070709_10234526 | Ga0070709_102345262 | 187 |
| 340 | 3300005435 | Ga0070714_100326704 | Ga0070714_1003267042 | 187 |
| 341 | 3300005435 | Ga0070714_100373999 | Ga0070714_1003739992 | 187 |
| 342 | 3300005436 | Ga0070713_100004064 | Ga0070713_1000040644 | 187 |
| 343 | 3300005436 | Ga0070713_100305932 | Ga0070713_1003059321 | 187 |
| 344 | 3300005436 | Ga0070713_100332559 | Ga0070713_1003325592 | 187 |
| 345 | 3300005436 | Ga0070713_100742548 | Ga0070713_1007425481 | 187 |
| 346 | 3300005437 | Ga0070710_10120056 | Ga0070710_101200562 | 187 |
| 347 | 3300005437 | Ga0070710_10200926 | Ga0070710_102009262 | 187 |
| 348 | 3300005439 | Ga0070711_100017996 | Ga0070711_1000179962 | 187 |
| 349 | 3300005439 | Ga0070711_100048110 | Ga0070711_1000481102 | 187 |
| 350 | 3300005439 | Ga0070711_100175835 | Ga0070711_1001758352 | 187 |
| 351 | 3300005444 | Ga0070694_100169977 | Ga0070694_1001699772 | 187 |
| 352 | 3300005445 | Ga0070708_100363369 | Ga0070708_1003633692 | 187 |
| 353 | 3300005455 | Ga0070663_100137635 | Ga0070663_1001376352 | 187 |
| 354 | 3300005455 | Ga0070663_100144408 | Ga0070663_1001444081 | 187 |
| 355 | 3300005456 | Ga0070678_100010560 | Ga0070678_1000105601 | 187 |
| 356 | 3300005456 | Ga0070678_100119432 | Ga0070678_1001194321 | 187 |
| 357 | 3300005457 | Ga0070662_100341685 | Ga0070662_1003416852 | 187 |
| 358 | 3300005458 | Ga0070681_10039956 | Ga0070681_100399563 | 187 |
| 359 | 3300005466 | Ga0070685_10019770 | Ga0070685_100197702 | 187 |
| 360 | 3300005468 | Ga0070707_100200256 | Ga0070707_1002002562 | 187 |
| 361 | 3300005468 | Ga0070707_100299047 | Ga0070707_1002990472 | 187 |
| 362 | 3300005471 | Ga0070698_100356072 | Ga0070698_1003560722 | 187 |
| 363 | 3300005518 | Ga0070699_100010939 | Ga0070699_1000109394 | 187 |
| 364 | 3300005518 | Ga0070699_100048006 | Ga0070699_1000480062 | 187 |
| 365 | 3300005518 | Ga0070699_100296518 | Ga0070699_1002965181 | 187 |
| 366 | 3300005530 | Ga0070679_100612914 | Ga0070679_1006129142 | 187 |
| 367 | 3300005535 | Ga0070684_100268760 | Ga0070684_1002687602 | 187 |
| 368 | 3300005536 | Ga0070697_100644915 | Ga0070697_1006449152 | 187 |
| 369 | 3300005536 | Ga0070697_100733443 | Ga0070697_1007334432 | 187 |
| 370 | 3300005544 | Ga0070686_100255020 | Ga0070686_1002550201 | 187 |
| 371 | 3300005547 | Ga0070693_100038951 | Ga0070693_1000389512 | 187 |
| 372 | 3300005548 | Ga0070665_100022395 | Ga0070665_1000223953 | 187 |
| 373 | 3300005549 | Ga0070704_100171589 | Ga0070704_1001715892 | 187 |
| 374 | 3300005549 | Ga0070704_100566641 | Ga0070704_1005666412 | 187 |
| 375 | 3300005563 | Ga0068855_100372247 | Ga0068855_1003722471 | 187 |
| 376 | 3300005564 | Ga0070664_100037789 | Ga0070664_1000377891 | 187 |
| 377 | 3300005614 | Ga0068856_100074034 | Ga0068856_1000740343 | 187 |
| 378 | 3300005614 | Ga0068856_100804499 | Ga0068856_1008044992 | 187 |
| 379 | 3300005617 | Ga0068859_100879067 | Ga0068859_1008790671 | 187 |
| 380 | 3300005617 | Ga0068859_102049897 | Ga0068859_1020498971 | 187 |
| 381 | 3300005618 | Ga0068864_100282053 | Ga0068864_1002820533 | 187 |
| 382 | 3300005843 | Ga0068860_100464631 | Ga0068860_1004646312 | 187 |
| 383 | 3300005844 | Ga0068862_101328062 | Ga0068862_1013280621 | 187 |
| 384 | 3300005937 | Ga0081455_10000369 | Ga0081455_1000036948 | 187 |
| 385 | 3300005937 | Ga0081455_10025395 | Ga0081455_100253952 | 187 |
| 386 | 3300005937 | Ga0081455_10027696 | Ga0081455_100276963 | 187 |
| 387 | 3300005937 | Ga0081455_10502183 | Ga0081455_105021832 | 187 |
| 388 | 3300005937 | Ga0081455_10626011 | Ga0081455_106260112 | 187 |
| 389 | 3300005983 | Ga0081540_1003967 | Ga0081540_10039672 | 187 |
| 390 | 3300006028 | Ga0070717_10044387 | Ga0070717_100443871 | 187 |
| 391 | 3300006028 | Ga0070717_10085937 | Ga0070717_100859372 | 187 |
| 392 | 3300006028 | Ga0070717_10199114 | Ga0070717_101991143 | 187 |
| 393 | 3300006038 | Ga0075365_10065984 | Ga0075365_100659842 | 187 |
| 394 | 3300006042 | Ga0075368_10125951 | Ga0075368_101259512 | 187 |
| 395 | 3300006051 | Ga0075364_10145467 | Ga0075364_101454671 | 187 |
| 396 | 3300006058 | Ga0075432_10092256 | Ga0075432_100922562 | 187 |
| 397 | 3300006163 | Ga0070715_10063356 | Ga0070715_100633562 | 187 |
| 398 | 3300006173 | Ga0070716_100025208 | Ga0070716_1000252082 | 187 |
| 399 | 3300006173 | Ga0070716_100509906 | Ga0070716_1005099061 | 187 |
| 400 | 3300006175 | Ga0070712_100001051 | Ga0070712_1000010512 | 187 |
| 401 | 3300006175 | Ga0070712_100518095 | Ga0070712_1005180952 | 187 |
| 402 | 3300006237 | Ga0097621_100250240 | Ga0097621_1002502402 | 187 |
| 403 | 3300006237 | Ga0097621_100515682 | Ga0097621_1005156822 | 187 |
| 404 | 3300006358 | Ga0068871_100015941 | Ga0068871_1000159415 | 187 |
| 405 | 3300006844 | Ga0075428_100065454 | Ga0075428_1000654542 | 187 |
| 406 | 3300006844 | Ga0075428_100098943 | Ga0075428_1000989433 | 187 |
| 407 | 3300006844 | Ga0075428_100298068 | Ga0075428_1002980682 | 187 |
| 408 | 3300006844 | Ga0075428_100521767 | Ga0075428_1005217672 | 187 |
| 409 | 3300006847 | Ga0075431_100054123 | Ga0075431_1000541234 | 187 |
| 410 | 3300006847 | Ga0075431_100072487 | Ga0075431_1000724872 | 187 |
| 411 | 3300006847 | Ga0075431_100137660 | Ga0075431_1001376602 | 187 |
| 412 | 3300006847 | Ga0075431_100274988 | Ga0075431_1002749882 | 187 |
| 413 | 3300006847 | Ga0075431_100471779 | Ga0075431_1004717792 | 187 |
| 414 | 3300006852 | Ga0075433_10108487 | Ga0075433_101084872 | 187 |
| 415 | 3300006871 | Ga0075434_100057057 | Ga0075434_1000570572 | 187 |
| 416 | 3300006871 | Ga0075434_100094195 | Ga0075434_1000941952 | 187 |
| 417 | 3300006871 | Ga0075434_100130149 | Ga0075434_1001301492 | 187 |
| 418 | 3300006871 | Ga0075434_100153131 | Ga0075434_1001531312 | 187 |
| 419 | 3300006871 | Ga0075434_100208202 | Ga0075434_1002082023 | 187 |
| 420 | 3300006871 | Ga0075434_100747784 | Ga0075434_1007477842 | 187 |
| 421 | 3300006880 | Ga0075429_100049636 | Ga0075429_1000496362 | 187 |
| 422 | 3300006881 | Ga0068865_100312179 | Ga0068865_1003121792 | 187 |
| 423 | 3300006881 | Ga0068865_100373856 | Ga0068865_1003738562 | 187 |
| 424 | 3300006914 | Ga0075436_100236140 | Ga0075436_1002361402 | 187 |
| 425 | 3300006914 | Ga0075436_100499748 | Ga0075436_1004997482 | 187 |
| 426 | 3300006931 | Ga0097620_100879053 | Ga0097620_1008790531 | 187 |
| 427 | 3300007076 | Ga0075435_100084778 | Ga0075435_1000847783 | 187 |
| 428 | 3300007076 | Ga0075435_100310268 | Ga0075435_1003102681 | 187 |
| 429 | 3300007788 | Ga0099795_10008229 | Ga0099795_100082294 | 187 |
| 430 | 3300009093 | Ga0105240_11375095 | Ga0105240_113750951 | 187 |
| 431 | 3300009094 | Ga0111539_10011327 | Ga0111539_100113276 | 187 |
| 432 | 3300009094 | Ga0111539_10926368 | Ga0111539_109263682 | 187 |
| 433 | 3300009098 | Ga0105245_10069966 | Ga0105245_100699662 | 187 |
| 434 | 3300009098 | Ga0105245_10209838 | Ga0105245_102098382 | 187 |
| 435 | 3300009101 | Ga0105247_10016260 | Ga0105247_100162603 | 187 |
| 436 | 3300009101 | Ga0105247_10135926 | Ga0105247_101359261 | 187 |
| 437 | 3300009101 | Ga0105247_10645487 | Ga0105247_106454871 | 187 |
| 438 | 3300009147 | Ga0114129_10047462 | Ga0114129_100474623 | 187 |
| 439 | 3300009147 | Ga0114129_10051163 | Ga0114129_100511635 | 187 |
| 440 | 3300009147 | Ga0114129_10126590 | Ga0114129_101265905 | 187 |
| 441 | 3300009147 | Ga0114129_10225891 | Ga0114129_102258912 | 187 |
| 442 | 3300009147 | Ga0114129_10723089 | Ga0114129_107230891 | 187 |
| 443 | 3300009147 | Ga0114129_10962283 | Ga0114129_109622832 | 187 |
| 444 | 3300009148 | Ga0105243_10299969 | Ga0105243_102999692 | 187 |
| 445 | 3300009176 | Ga0105242_10008956 | Ga0105242_100089564 | 187 |
| 446 | 3300009176 | Ga0105242_10413060 | Ga0105242_104130602 | 187 |
| 447 | 3300009177 | Ga0105248_10030452 | Ga0105248_100304523 | 187 |
| 448 | 3300009177 | Ga0105248_10033903 | Ga0105248_100339033 | 187 |
| 449 | 3300009545 | Ga0105237_10237172 | Ga0105237_102371721 | 187 |
| 450 | 3300009545 | Ga0105237_10481968 | Ga0105237_104819682 | 187 |
| 451 | 3300009545 | Ga0105237_10591465 | Ga0105237_105914651 | 187 |
| 452 | 3300009553 | Ga0105249_10571350 | Ga0105249_105713502 | 187 |
| 453 | 3300010159 | Ga0099796_10063043 | Ga0099796_100630432 | 187 |
| 454 | 3300010375 | Ga0105239_10122001 | Ga0105239_101220012 | 187 |
| 455 | 3300010375 | Ga0105239_11305336 | Ga0105239_113053361 | 187 |
| 456 | 3300011119 | Ga0105246_10041041 | Ga0105246_100410413 | 187 |
| 457 | 3300011119 | Ga0105246_10059375 | Ga0105246_100593752 | 187 |
| 458 | 3300011119 | Ga0105246_10594586 | Ga0105246_105945861 | 187 |
| 459 | 3300013105 | Ga0157369_11268499 | Ga0157369_112684991 | 187 |
| 460 | 3300013296 | Ga0157374_10247517 | Ga0157374_102475173 | 187 |
| 461 | 3300013296 | Ga0157374_10363596 | Ga0157374_103635962 | 187 |
| 462 | 3300013296 | Ga0157374_11086336 | Ga0157374_110863362 | 187 |
| 463 | 3300013297 | Ga0157378_10127112 | Ga0157378_101271122 | 187 |
| 464 | 3300013297 | Ga0157378_10455034 | Ga0157378_104550342 | 187 |
| 465 | 3300013306 | Ga0163162_10234402 | Ga0163162_102344022 | 187 |
| 466 | 3300013306 | Ga0163162_10786228 | Ga0163162_107862281 | 187 |
| 467 | 3300013307 | Ga0157372_10107145 | Ga0157372_101071453 | 187 |
| 468 | 3300013308 | Ga0157375_10056268 | Ga0157375_100562683 | 187 |
| 469 | 3300013308 | Ga0157375_10245014 | Ga0157375_102450142 | 187 |
| 470 | 3300014325 | Ga0163163_10082133 | Ga0163163_100821333 | 187 |
| 471 | 3300014325 | Ga0163163_10199769 | Ga0163163_101997691 | 187 |
| 472 | 3300014325 | Ga0163163_10898951 | Ga0163163_108989512 | 187 |
| 473 | 3300014326 | Ga0157380_10387475 | Ga0157380_103874752 | 187 |
| 474 | 3300014968 | Ga0157379_10036120 | Ga0157379_100361203 | 187 |
| 475 | 3300014968 | Ga0157379_11471424 | Ga0157379_114714241 | 187 |
| 476 | 3300014969 | Ga0157376_10030575 | Ga0157376_100305752 | 187 |
| 477 | 3300014969 | Ga0157376_10440628 | Ga0157376_104406282 | 187 |
| 478 | 3300017792 | Ga0163161_10180794 | Ga0163161_101807943 | 187 |
| 479 | 3300024227 | Ga0228598_1017655 | Ga0228598_10176552 | 187 |
| 480 | 3300025898 | Ga0207692_10017719 | Ga0207692_100177191 | 187 |
| 481 | 3300025898 | Ga0207692_10133377 | Ga0207692_101333772 | 187 |
| 482 | 3300025898 | Ga0207692_10226249 | Ga0207692_102262492 | 187 |
| 483 | 3300025900 | Ga0207710_10007860 | Ga0207710_100078605 | 187 |
| 484 | 3300025903 | Ga0207680_10083989 | Ga0207680_100839892 | 187 |
| 485 | 3300025903 | Ga0207680_10416178 | Ga0207680_104161781 | 187 |
| 486 | 3300025906 | Ga0207699_10102070 | Ga0207699_101020702 | 187 |
| 487 | 3300025907 | Ga0207645_10129460 | Ga0207645_101294603 | 187 |
| 488 | 3300025910 | Ga0207684_10065109 | Ga0207684_100651092 | 187 |
| 489 | 3300025912 | Ga0207707_10031910 | Ga0207707_100319103 | 187 |
| 490 | 3300025914 | Ga0207671_10245467 | Ga0207671_102454672 | 187 |
| 491 | 3300025915 | Ga0207693_10002798 | Ga0207693_100027983 | 187 |
| 492 | 3300025915 | Ga0207693_10044059 | Ga0207693_100440593 | 187 |
| 493 | 3300025915 | Ga0207693_10145853 | Ga0207693_101458532 | 187 |
| 494 | 3300025915 | Ga0207693_10214584 | Ga0207693_102145842 | 187 |
| 495 | 3300025916 | Ga0207663_10034645 | Ga0207663_100346452 | 187 |
| 496 | 3300025916 | Ga0207663_10037618 | Ga0207663_100376182 | 187 |
| 497 | 3300025920 | Ga0207649_10062796 | Ga0207649_100627962 | 187 |
| 498 | 3300025922 | Ga0207646_10041572 | Ga0207646_100415721 | 187 |
| 499 | 3300025924 | Ga0207694_10233327 | Ga0207694_102333272 | 187 |
| 500 | 3300025925 | Ga0207650_10006118 | Ga0207650_100061182 | 187 |
| 501 | 3300025926 | Ga0207659_10136810 | Ga0207659_101368102 | 187 |
| 502 | 3300025927 | Ga0207687_10006865 | Ga0207687_100068654 | 187 |
| 503 | 3300025927 | Ga0207687_10157687 | Ga0207687_101576872 | 187 |
| 504 | 3300025928 | Ga0207700_10043966 | Ga0207700_100439663 | 187 |
| 505 | 3300025928 | Ga0207700_10370204 | Ga0207700_103702042 | 187 |
| 506 | 3300025928 | Ga0207700_10715841 | Ga0207700_107158411 | 187 |
| 507 | 3300025928 | Ga0207700_10719528 | Ga0207700_107195282 | 187 |
| 508 | 3300025929 | Ga0207664_10275014 | Ga0207664_102750142 | 187 |
| 509 | 3300025931 | Ga0207644_10020189 | Ga0207644_100201894 | 187 |
| 510 | 3300025931 | Ga0207644_10184309 | Ga0207644_101843092 | 187 |
| 511 | 3300025931 | Ga0207644_10457265 | Ga0207644_104572652 | 187 |
| 512 | 3300025933 | Ga0207706_10036765 | Ga0207706_100367652 | 187 |
| 513 | 3300025934 | Ga0207686_10742644 | Ga0207686_107426441 | 187 |
| 514 | 3300025935 | Ga0207709_10266630 | Ga0207709_102666302 | 187 |
| 515 | 3300025938 | Ga0207704_10103113 | Ga0207704_101031133 | 187 |
| 516 | 3300025939 | Ga0207665_10018755 | Ga0207665_100187552 | 187 |
| 517 | 3300025939 | Ga0207665_10159069 | Ga0207665_101590692 | 187 |
| 518 | 3300025939 | Ga0207665_10309797 | Ga0207665_103097971 | 187 |
| 519 | 3300025941 | Ga0207711_10008135 | Ga0207711_100081354 | 187 |
| 520 | 3300025942 | Ga0207689_10297973 | Ga0207689_102979731 | 187 |
| 521 | 3300025945 | Ga0207679_10155666 | Ga0207679_101556662 | 187 |
| 522 | 3300025945 | Ga0207679_10652996 | Ga0207679_106529962 | 187 |
| 523 | 3300025960 | Ga0207651_10544820 | Ga0207651_105448201 | 187 |
| 524 | 3300025960 | Ga0207651_10649667 | Ga0207651_106496672 | 187 |
| 525 | 3300025960 | Ga0207651_10750614 | Ga0207651_107506142 | 187 |
| 526 | 3300025981 | Ga0207640_10320631 | Ga0207640_103206312 | 187 |
| 527 | 3300025986 | Ga0207658_10045484 | Ga0207658_100454843 | 187 |
| 528 | 3300026035 | Ga0207703_10356636 | Ga0207703_103566362 | 187 |
| 529 | 3300026067 | Ga0207678_10014350 | Ga0207678_100143502 | 187 |
| 530 | 3300026067 | Ga0207678_10166576 | Ga0207678_101665762 | 187 |
| 531 | 3300026078 | Ga0207702_10230700 | Ga0207702_102307002 | 187 |
| 532 | 3300026078 | Ga0207702_10869053 | Ga0207702_108690531 | 187 |
| 533 | 3300026088 | Ga0207641_10093274 | Ga0207641_100932742 | 187 |
| 534 | 3300026095 | Ga0207676_10236149 | Ga0207676_102361492 | 187 |
| 535 | 3300026118 | Ga0207675_100127492 | Ga0207675_1001274922 | 187 |
| 536 | 3300026121 | Ga0207683_10004571 | Ga0207683_100045712 | 187 |
| 537 | 3300026121 | Ga0207683_10338071 | Ga0207683_103380712 | 187 |
| 538 | 3300027866 | Ga0209813_10077399 | Ga0209813_100773992 | 187 |
| 539 | 3300027907 | Ga0207428_10223975 | Ga0207428_102239752 | 187 |
| 540 | 3300028379 | Ga0268266_10005703 | Ga0268266_100057033 | 187 |
| 541 | 3300028380 | Ga0268265_11299873 | Ga0268265_112998732 | 187 |
| 542 | 3300031235 | Ga0265330_10083913 | Ga0265330_100839132 | 187 |
| 543 | 3300031241 | Ga0265325_10014844 | Ga0265325_100148443 | 187 |
| 544 | 3300031249 | Ga0265339_10204696 | Ga0265339_102046962 | 187 |
| 545 | 3300031711 | Ga0265314_10004866 | Ga0265314_1000486613 | 187 |
| 546 | 3300031711 | Ga0265314_10075050 | Ga0265314_100750502 | 187 |
| 547 | 3300034819 | Ga0373958_0017676 | Ga0373958_0017676_683_1246 | 187 |
| 548 | 3300034820 | Ga0373959_0018494 | Ga0373959_0018494_183_746 | 187 |
| 549 | 3300035083 | Ga0373926_0002409 | Ga0373926_0002409_2246_2809 | 187 |
| 550 | 3300035083 | Ga0373926_0011990 | Ga0373926_0011990_1838_2401 | 187 |
| 551 | 3300035085 | Ga0373929_0018370 | Ga0373929_0018370_769_1332 | 187 |
| 552 | 3300035086 | Ga0373934_0005641 | Ga0373934_0005641_2470_3033 | 187 |
| 553 | 3300035089 | Ga0373944_0027529 | Ga0373944_0027529_1017_1580 | 187 |
| 554 | 3300035089 | Ga0373944_0030232 | Ga0373944_0030232_826_1389 | 187 |
| 555 | 3300035090 | Ga0373949_0055680 | Ga0373949_0055680_356_919 | 187 |
| 556 | 3300035091 | Ga0373951_0080294 | Ga0373951_0080294_258_821 | 187 |
| 557 | 3300035111 | Ga0373923_0111806 | Ga0373923_0111806_388_951 | 187 |
| 558 | 3300035111 | Ga0373923_0245344 | Ga0373923_0245344_156_719 | 187 |
| 559 | 3300035112 | Ga0373932_0031617 | Ga0373932_0031617_276_839 | 187 |
| 560 | 3300035113 | Ga0373936_0397703 | Ga0373936_0397703_24_587 | 187 |
| 561 | 3300035114 | Ga0373939_0027092 | Ga0373939_0027092_976_1539 | 187 |
| 562 | 3300035115 | Ga0373941_0008648 | Ga0373941_0008648_993_1556 | 187 |
| 563 | 3300035116 | Ga0373945_0005807 | Ga0373945_0005807_1819_2382 | 187 |
| 564 | 3300035116 | Ga0373945_0022810 | Ga0373945_0022810_251_814 | 187 |
| 565 | 3300035117 | Ga0373953_0000877 | Ga0373953_0000877_2700_3263 | 187 |
| 566 | 3300035118 | Ga0373954_0011839 | Ga0373954_0011839_571_1134 | 187 |
| 567 | 3300035118 | Ga0373954_0184958 | Ga0373954_0184958_263_826 | 187 |
| 568 | 3300035119 | Ga0373956_0165348 | Ga0373956_0165348_423_986 | 187 |
| 569 | 3300035119 | Ga0373956_0409182 | Ga0373956_0409182_50_613 | 187 |
| 570 | 3300035120 | Ga0373957_0002376 | Ga0373957_0002376_1221_1784 | 187 |
| 571 | 3300035121 | Ga0373960_0140220 | Ga0373960_0140220_49_612 | 187 |
| 572 | 3300035170 | Ga0373943_0026578 | Ga0373943_0026578_1788_2351 | 187 |
| 573 | 3300035170 | Ga0373943_0126914 | Ga0373943_0126914_84_647 | 187 |
| 574 | 3300035171 | Ga0373946_0006713 | Ga0373946_0006713_1641_2204 | 187 |
| 575 | 3300035171 | Ga0373946_0205277 | Ga0373946_0205277_219_782 | 187 |
| 576 | 3300035172 | Ga0373955_0016702 | Ga0373955_0016702_3011_3574 | 187 |
| 577 | 3300035172 | Ga0373955_0078167 | Ga0373955_0078167_1166_1729 | 187 |
| 578 | 3300035172 | Ga0373955_0424577 | Ga0373955_0424577_13_576 | 187 |
| 579 | 3300035172 | Ga0373955_0490218 | Ga0373955_0490218_75_638 | 187 |
| 580 | 3300035207 | Ga0373942_0031774 | Ga0373942_0031774_782_1345 | 187 |
| 581 | 3300035242 | Ga0373962_0029486 | Ga0373962_0029486_52_615 | 187 |
| 582 | 3300035410 | Ga0373924_0009379 | Ga0373924_0009379_2530_3093 | 187 |
| 583 | 3300035410 | Ga0373924_0028068 | Ga0373924_0028068_255_818 | 187 |
| 584 | 3300035691 | Ga0373931_0013244 | Ga0373931_0013244_3023_3586 | 187 |
| 585 | 3300035691 | Ga0373931_0179451 | Ga0373931_0179451_581_1144 | 187 |
| 586 | 3300035692 | Ga0373935_0012670 | Ga0373935_0012670_3104_3667 | 187 |
| 587 | 3300035692 | Ga0373935_0086510 | Ga0373935_0086510_883_1446 | 187 |
| 588 | 3300035692 | Ga0373935_0100346 | Ga0373935_0100346_680_1243 | 187 |
| 589 | 3300035692 | Ga0373935_0313162 | Ga0373935_0313162_236_799 | 187 |
| 590 | 3300035692 | Ga0373935_0352447 | Ga0373935_0352447_384_947 | 187 |
| 591 | 3300035695 | Ga0373927_0021247 | Ga0373927_0021247_1378_1941 | 187 |
| 592 | 3300035695 | Ga0373927_0236388 | Ga0373927_0236388_381_944 | 187 |
| 593 | 3300035695 | Ga0373927_0238926 | Ga0373927_0238926_261_824 | 187 |
| 594 | 3300035724 | Ga0373933_0001118 | Ga0373933_0001118_449_1012 | 187 |
| 595 | 3300035725 | Ga0373947_0007475 | Ga0373947_0007475_3791_4354 | 187 |
| 596 | 3300035725 | Ga0373947_0029051 | Ga0373947_0029051_564_1127 | 187 |
| 597 | 3300035725 | Ga0373947_0162168 | Ga0373947_0162168_20_583 | 187 |
| 598 | 3300036401 | Ga0373937_0018721 | Ga0373937_0018721_3774_4337 | 187 |
| 599 | 3300036401 | Ga0373937_0040421 | Ga0373937_0040421_271_834 | 187 |
| 600 | 3300036401 | Ga0373937_0104151 | Ga0373937_0104151_402_1082 | 187 |
| 601 | 3300036401 | Ga0373937_0266076 | Ga0373937_0266076_495_1058 | 187 |
| 602 | 3300037068 | Ga0373925_0110678 | Ga0373925_0110678_845_1408 | 187 |
| 603 | 3300037068 | Ga0373925_0220536 | Ga0373925_0220536_381_944 | 187 |
| 604 | 3300037068 | Ga0373925_0360162 | Ga0373925_0360162_20_583 | 187 |
| 605 | 3300037068 | Ga0373925_0513087 | Ga0373925_0513087_170_733 | 187 |
| 606 | 3300037068 | Ga0373925_0892732 | Ga0373925_0892732_104_667 | 187 |
| 607 | 3300037466 | Ga0395898_0089739 | Ga0395898_0089739_2076_2639 | 187 |
| 608 | 3300037853 | Ga0436364_0877934 | Ga0436364_0877934_237_800 | 187 |
| 609 | 3300038443 | Ga0395901_0266843 | Ga0395901_0266843_194_757 | 187 |
| 610 | 3300039437 | Ga0436365_1155159 | Ga0436365_1155159_181_744 | 187 |
| 611 | 3300039447 | Ga0436361_0443883 | Ga0436361_0443883_2614_3177 | 187 |
| 612 | 3300039450 | Ga0436363_0595633 | Ga0436363_0595633_730_1293 | 187 |
| 613 | 3300039453 | Ga0436362_0005602 | Ga0436362_0005602_104_667 | 187 |
| 614 | 3300041507 | Ga0451851_0045297 | Ga0451851_0045297_356_919 | 187 |
| 615 | 3300044719 | Ga0466971_0315003 | Ga0466971_0315003_124_687 | 187 |
| 616 | 3300044842 | Ga0466957_0382873 | Ga0466957_0382873_86_649 | 187 |
| 617 | 3300046452 | Ga0495617_139348 | Ga0495617_139348_94_657 | 187 |
| 618 | 3300046454 | Ga0495592_0012848 | Ga0495592_0012848_2607_3170 | 187 |
| 619 | 3300046454 | Ga0495592_0016333 | Ga0495592_0016333_3090_3653 | 187 |
| 620 | 3300046455 | Ga0495603_0043755 | Ga0495603_0043755_1941_2504 | 187 |
| 621 | 3300046455 | Ga0495603_0104575 | Ga0495603_0104575_718_1281 | 187 |
| 622 | 3300046455 | Ga0495603_0128429 | Ga0495603_0128429_597_1160 | 187 |
| 623 | 3300046459 | Ga0495629_0005405 | Ga0495629_0005405_6298_6861 | 187 |
| 624 | 3300046459 | Ga0495629_0056166 | Ga0495629_0056166_121_684 | 187 |
| 625 | 3300046459 | Ga0495629_0106030 | Ga0495629_0106030_344_907 | 187 |
| 626 | 3300046459 | Ga0495629_0269628 | Ga0495629_0269628_170_733 | 187 |
| 627 | 3300046460 | Ga0495638_0147456 | Ga0495638_0147456_660_1223 | 187 |
| 628 | 3300046461 | Ga0495641_0017369 | Ga0495641_0017369_1385_1948 | 187 |
| 629 | 3300046461 | Ga0495641_0124583 | Ga0495641_0124583_269_832 | 187 |
| 630 | 3300046461 | Ga0495641_0151858 | Ga0495641_0151858_422_985 | 187 |
| 631 | 3300046462 | Ga0495651_0002600 | Ga0495651_0002600_3159_3722 | 187 |
| 632 | 3300046462 | Ga0495651_0129777 | Ga0495651_0129777_932_1612 | 187 |
| 633 | 3300046463 | Ga0495653_0001047 | Ga0495653_0001047_5398_5961 | 187 |
| 634 | 3300046463 | Ga0495653_0041639 | Ga0495653_0041639_2638_3318 | 187 |
| 635 | 3300046463 | Ga0495653_0175829 | Ga0495653_0175829_646_1209 | 187 |
| 636 | 3300046472 | Ga0495580_0172853 | Ga0495580_0172853_761_1324 | 187 |
| 637 | 3300046472 | Ga0495580_0186826 | Ga0495580_0186826_643_1206 | 187 |
| 638 | 3300046473 | Ga0495582_0040009 | Ga0495582_0040009_271_834 | 187 |
| 639 | 3300046475 | Ga0495639_0014761 | Ga0495639_0014761_1019_1582 | 187 |
| 640 | 3300046475 | Ga0495639_0165819 | Ga0495639_0165819_404_967 | 187 |
| 641 | 3300046476 | Ga0495662_0038805 | Ga0495662_0038805_963_1526 | 187 |
| 642 | 3300046476 | Ga0495662_0171134 | Ga0495662_0171134_131_694 | 187 |
| 643 | 3300046476 | Ga0495662_0260180 | Ga0495662_0260180_78_641 | 187 |
| 644 | 3300046477 | Ga0495664_0066334 | Ga0495664_0066334_261_824 | 187 |
| 645 | 3300046477 | Ga0495664_0118522 | Ga0495664_0118522_31_594 | 187 |
| 646 | 3300046491 | Ga0495584_0120627 | Ga0495584_0120627_737_1300 | 187 |
| 647 | 3300046499 | Ga0495594_0061996 | Ga0495594_0061996_100_663 | 187 |
| 648 | 3300046499 | Ga0495594_0157511 | Ga0495594_0157511_122_685 | 187 |
| 649 | 3300046499 | Ga0495594_0220951 | Ga0495594_0220951_447_1010 | 187 |
| 650 | 3300046511 | Ga0495608_0002112 | Ga0495608_0002112_1573_2136 | 187 |
| 651 | 3300046511 | Ga0495608_0172435 | Ga0495608_0172435_569_1132 | 187 |
| 652 | 3300046514 | Ga0495618_0005758 | Ga0495618_0005758_3287_3850 | 187 |
| 653 | 3300046514 | Ga0495618_0353085 | Ga0495618_0353085_126_806 | 187 |
| 654 | 3300046514 | Ga0495618_0400653 | Ga0495618_0400653_84_647 | 187 |
| 655 | 3300046516 | Ga0495628_0003957 | Ga0495628_0003957_29_592 | 187 |
| 656 | 3300046517 | Ga0495630_0216081 | Ga0495630_0216081_372_935 | 187 |
| 657 | 3300046526 | Ga0495666_0010416 | Ga0495666_0010416_3522_4085 | 187 |
| 658 | 3300046529 | Ga0495652_0003317 | Ga0495652_0003317_3798_4361 | 187 |
| 659 | 3300046529 | Ga0495652_0063428 | Ga0495652_0063428_1663_2343 | 187 |
| 660 | 3300046529 | Ga0495652_0201615 | Ga0495652_0201615_428_991 | 187 |
| 661 | 3300046529 | Ga0495652_0285065 | Ga0495652_0285065_368_931 | 187 |
| 662 | 3300046529 | Ga0495652_0368774 | Ga0495652_0368774_245_922 | 187 |
| 663 | 3300046531 | Ga0495665_0006593 | Ga0495665_0006593_3097_3660 | 187 |
| 664 | 3300046531 | Ga0495665_0063490 | Ga0495665_0063490_1283_1846 | 187 |
| 665 | 3300046533 | Ga0495640_0015437 | Ga0495640_0015437_669_1232 | 187 |
| 666 | 3300046533 | Ga0495640_0066207 | Ga0495640_0066207_37_717 | 187 |
| 667 | 3300046533 | Ga0495640_0151938 | Ga0495640_0151938_864_1427 | 187 |
| 668 | 3300046535 | Ga0495586_0003837 | Ga0495586_0003837_4020_4583 | 187 |
| 669 | 3300046536 | Ga0495587_0000701 | Ga0495587_0000701_20030_20593 | 187 |
| 670 | 3300046536 | Ga0495587_0046379 | Ga0495587_0046379_1770_2333 | 187 |
| 671 | 3300046543 | Ga0495645_0002582 | Ga0495645_0002582_2581_3144 | 187 |
| 672 | 3300046559 | Ga0495667_0011101 | Ga0495667_0011101_1400_1963 | 187 |
| 673 | 3300046559 | Ga0495667_0026841 | Ga0495667_0026841_3106_3669 | 187 |
| 674 | 3300046559 | Ga0495667_0103554 | Ga0495667_0103554_733_1296 | 187 |
| 675 | 3300046559 | Ga0495667_0179943 | Ga0495667_0179943_194_874 | 187 |
| 676 | 3300046615 | Ga0495656_0046474 | Ga0495656_0046474_773_1336 | 187 |
| 677 | 3300046615 | Ga0495656_0077236 | Ga0495656_0077236_560_1123 | 187 |
| 678 | 3300046642 | Ga0495634_0020611 | Ga0495634_0020611_3540_4103 | 187 |
| 679 | 3300046642 | Ga0495634_0103259 | Ga0495634_0103259_242_922 | 187 |
| 680 | 3300046663 | Ga0495635_0011643 | Ga0495635_0011643_3622_4185 | 187 |
| 681 | 3300046663 | Ga0495635_0046775 | Ga0495635_0046775_1268_1831 | 187 |
| 682 | 3300046663 | Ga0495635_0206973 | Ga0495635_0206973_743_1306 | 187 |
| 683 | 3300046664 | Ga0495659_0042965 | Ga0495659_0042965_75_638 | 187 |
| 684 | 3300046664 | Ga0495659_0063075 | Ga0495659_0063075_251_814 | 187 |
| 685 | 3300046675 | Ga0495657_0009262 | Ga0495657_0009262_680_1243 | 187 |
| 686 | 3300046678 | Ga0495599_0021570 | Ga0495599_0021570_157_720 | 187 |
| 687 | 3300046678 | Ga0495599_0291073 | Ga0495599_0291073_24_587 | 187 |
| 688 | 3300046679 | Ga0495623_0001363 | Ga0495623_0001363_2977_3540 | 187 |
| 689 | 3300046680 | Ga0495646_0012104 | Ga0495646_0012104_2453_3016 | 187 |
| 690 | 3300046680 | Ga0495646_0231663 | Ga0495646_0231663_65_628 | 187 |
| 691 | 3300046681 | Ga0495647_0008403 | Ga0495647_0008403_2190_2753 | 187 |
| 692 | 3300046681 | Ga0495647_0096635 | Ga0495647_0096635_178_741 | 187 |
| 693 | 3300046681 | Ga0495647_0155707 | Ga0495647_0155707_364_927 | 187 |
| 694 | 3300046683 | Ga0495658_0001737 | Ga0495658_0001737_3354_3917 | 187 |
| 695 | 3300046683 | Ga0495658_0016443 | Ga0495658_0016443_2194_2757 | 187 |
| 696 | 3300046683 | Ga0495658_0036939 | Ga0495658_0036939_404_967 | 187 |
| 697 | 3300046683 | Ga0495658_0477464 | Ga0495658_0477464_137_700 | 187 |
| 698 | 3300046689 | Ga0495613_0055710 | Ga0495613_0055710_658_1221 | 187 |
| 699 | 3300046689 | Ga0495613_0066277 | Ga0495613_0066277_986_1549 | 187 |
| 700 | 3300046689 | Ga0495613_0074672 | Ga0495613_0074672_899_1462 | 187 |
| 701 | 3300046689 | Ga0495613_0569223 | Ga0495613_0569223_82_645 | 187 |
| 702 | 3300046690 | Ga0495624_0024085 | Ga0495624_0024085_2876_3439 | 187 |
| 703 | 3300046690 | Ga0495624_0060864 | Ga0495624_0060864_1599_2162 | 187 |
| 704 | 3300046690 | Ga0495624_0120750 | Ga0495624_0120750_899_1462 | 187 |
| 705 | 3300046809 | Ga0495600_0014977 | Ga0495600_0014977_3893_4456 | 187 |
| 706 | 3300046809 | Ga0495600_0039724 | Ga0495600_0039724_1091_1654 | 187 |
| 707 | 3300047317 | Ga0495604_0002172 | Ga0495604_0002172_1573_2136 | 187 |
| 708 | 3300047317 | Ga0495604_0053030 | Ga0495604_0053030_2284_2964 | 187 |
| 709 | 3300047317 | Ga0495604_0095679 | Ga0495604_0095679_509_1072 | 187 |
| 710 | 3300047317 | Ga0495604_0126855 | Ga0495604_0126855_821_1498 | 187 |
| 711 | 3300047319 | Ga0495674_0085854 | Ga0495674_0085854_120_683 | 187 |
| 712 | 3300047319 | Ga0495674_0086887 | Ga0495674_0086887_1410_1973 | 187 |
| 713 | 3300047319 | Ga0495674_0180036 | Ga0495674_0180036_444_1007 | 187 |
| 714 | 3300047319 | Ga0495674_0195572 | Ga0495674_0195572_736_1299 | 187 |
| 715 | 3300047319 | Ga0495674_0477048 | Ga0495674_0477048_344_907 | 187 |
| 716 | 3300047321 | Ga0495676_0039162 | Ga0495676_0039162_710_1273 | 187 |
| 717 | 3300047322 | Ga0495680_0016420 | Ga0495680_0016420_2497_3060 | 187 |
| 718 | 3300047322 | Ga0495680_0062248 | Ga0495680_0062248_1788_2351 | 187 |
| 719 | 3300047322 | Ga0495680_0257097 | Ga0495680_0257097_307_870 | 187 |
| 720 | 3300047444 | Ga0495675_0000485 | Ga0495675_0000485_23400_23963 | 187 |
| 721 | 3300047471 | Ga0495684_0023838 | Ga0495684_0023838_3003_3566 | 187 |
| 722 | 3300047471 | Ga0495684_0124080 | Ga0495684_0124080_755_1318 | 187 |
| 723 | 3300047471 | Ga0495684_0234473 | Ga0495684_0234473_438_1001 | 187 |
| 724 | 3300047673 | Ga0495593_0027342 | Ga0495593_0027342_337_900 | 187 |
| 725 | 3300047673 | Ga0495593_0043250 | Ga0495593_0043250_1050_1613 | 187 |
| 726 | 3300047673 | Ga0495593_0208179 | Ga0495593_0208179_90_653 | 187 |
| 727 | 3300047673 | Ga0495593_0271638 | Ga0495593_0271638_58_621 | 187 |
| 728 | 3300048088 | Ga0495602_0042301 | Ga0495602_0042301_1738_2301 | 187 |
| 729 | 3300048088 | Ga0495602_0189350 | Ga0495602_0189350_782_1462 | 187 |
| 730 | 3300048089 | Ga0495614_0011763 | Ga0495614_0011763_263_826 | 187 |
| 731 | 3300048089 | Ga0495614_0112153 | Ga0495614_0112153_617_1180 | 187 |
| 732 | 3300048903 | Ga0496100_0009014 | Ga0496100_0009014_3407_3970 | 187 |
| 733 | 3300048903 | Ga0496100_0014007 | Ga0496100_0014007_201_764 | 187 |
| 734 | 3300048903 | Ga0496100_0132474 | Ga0496100_0132474_1021_1584 | 187 |
| 735 | 3300048903 | Ga0496100_0302255 | Ga0496100_0302255_417_980 | 187 |
| 736 | 3300048903 | Ga0496100_0328021 | Ga0496100_0328021_571_1134 | 187 |
| 737 | 3300048903 | Ga0496100_1121228 | Ga0496100_1121228_21_584 | 187 |
| 738 | 3300048904 | Ga0496101_0006290 | Ga0496101_0006290_3192_3755 | 187 |
| 739 | 3300048904 | Ga0496101_0063235 | Ga0496101_0063235_925_1488 | 187 |
| 740 | 3300048904 | Ga0496101_0149083 | Ga0496101_0149083_494_1057 | 187 |
| 741 | 3300048904 | Ga0496101_0346278 | Ga0496101_0346278_62_625 | 187 |
| 742 | 3300048905 | Ga0496102_0003862 | Ga0496102_0003862_4183_4746 | 187 |
| 743 | 3300048905 | Ga0496102_0040023 | Ga0496102_0040023_2527_3090 | 187 |
| 744 | 3300048905 | Ga0496102_0067474 | Ga0496102_0067474_1909_2472 | 187 |
| 745 | 3300048905 | Ga0496102_0317253 | Ga0496102_0317253_455_1018 | 187 |
| 746 | 3300048906 | Ga0496103_0003140 | Ga0496103_0003140_2146_2709 | 187 |
| 747 | 3300048906 | Ga0496103_0038956 | Ga0496103_0038956_888_1451 | 187 |
| 748 | 3300048906 | Ga0496103_0313922 | Ga0496103_0313922_96_659 | 187 |
| 749 | 3300048907 | Ga0496104_0004241 | Ga0496104_0004241_5748_6311 | 187 |
| 750 | 3300048907 | Ga0496104_0004499 | Ga0496104_0004499_11458_12021 | 187 |
| 751 | 3300048907 | Ga0496104_0008656 | Ga0496104_0008656_2326_2889 | 187 |
| 752 | 3300048907 | Ga0496104_0085508 | Ga0496104_0085508_1793_2356 | 187 |
| 753 | 3300048907 | Ga0496104_0097622 | Ga0496104_0097622_850_1413 | 187 |
| 754 | 3300048907 | Ga0496104_0170432 | Ga0496104_0170432_1244_1807 | 187 |
| 755 | 3300048907 | Ga0496104_0291156 | Ga0496104_0291156_84_647 | 187 |
| 756 | 3300048908 | Ga0496105_0015465 | Ga0496105_0015465_1776_2339 | 187 |
| 757 | 3300048908 | Ga0496105_0028022 | Ga0496105_0028022_1346_1909 | 187 |
| 758 | 3300048908 | Ga0496105_0099222 | Ga0496105_0099222_1578_2141 | 187 |
| 759 | 3300048908 | Ga0496105_0104617 | Ga0496105_0104617_1751_2314 | 187 |
| 760 | 3300048908 | Ga0496105_0127661 | Ga0496105_0127661_1460_2023 | 187 |
| 761 | 3300048908 | Ga0496105_0143866 | Ga0496105_0143866_330_893 | 187 |
| 762 | 3300048909 | Ga0496106_0004037 | Ga0496106_0004037_1302_1865 | 187 |
| 763 | 3300048909 | Ga0496106_0016268 | Ga0496106_0016268_2407_2970 | 187 |
| 764 | 3300048909 | Ga0496106_0031959 | Ga0496106_0031959_2740_3303 | 187 |
| 765 | 3300048909 | Ga0496106_0071005 | Ga0496106_0071005_91_654 | 187 |
| 766 | 3300048909 | Ga0496106_0149352 | Ga0496106_0149352_664_1251 | 187 |
| 767 | 3300048909 | Ga0496106_0208523 | Ga0496106_0208523_181_744 | 187 |
| 768 | 3300048909 | Ga0496106_0967921 | Ga0496106_0967921_50_613 | 187 |
| 769 | 3300048910 | Ga0496107_0019167 | Ga0496107_0019167_129_692 | 187 |
| 770 | 3300048910 | Ga0496107_0065999 | Ga0496107_0065999_1302_1865 | 187 |
| 771 | 3300048910 | Ga0496107_0092882 | Ga0496107_0092882_337_900 | 187 |
| 772 | 3300048911 | Ga0496108_0000692 | Ga0496108_0000692_13368_13931 | 187 |
| 773 | 3300048911 | Ga0496108_0035668 | Ga0496108_0035668_1307_1870 | 187 |
| 774 | 3300048911 | Ga0496108_0093826 | Ga0496108_0093826_698_1261 | 187 |
| 775 | 3300048911 | Ga0496108_0319071 | Ga0496108_0319071_113_676 | 187 |
| 776 | 3300048911 | Ga0496108_0610112 | Ga0496108_0610112_172_735 | 187 |
| 777 | 3300048912 | Ga0496109_0000624 | Ga0496109_0000624_13333_13896 | 187 |
| 778 | 3300048912 | Ga0496109_0005168 | Ga0496109_0005168_1889_2452 | 187 |
| 779 | 3300048912 | Ga0496109_0033526 | Ga0496109_0033526_3884_4447 | 187 |
| 780 | 3300048912 | Ga0496109_0118303 | Ga0496109_0118303_253_816 | 187 |
| 781 | 3300048912 | Ga0496109_0750877 | Ga0496109_0750877_202_765 | 187 |
| 782 | 3300048913 | Ga0496110_0001274 | Ga0496110_0001274_12827_13390 | 187 |
| 783 | 3300048913 | Ga0496110_0010628 | Ga0496110_0010628_650_1213 | 187 |
| 784 | 3300048913 | Ga0496110_0017893 | Ga0496110_0017893_2094_2657 | 187 |
| 785 | 3300048913 | Ga0496110_0029618 | Ga0496110_0029618_1972_2535 | 187 |
| 786 | 3300048914 | Ga0496111_0000696 | Ga0496111_0000696_7702_8265 | 187 |
| 787 | 3300048914 | Ga0496111_0013239 | Ga0496111_0013239_2971_3534 | 187 |
| 788 | 3300048914 | Ga0496111_0028621 | Ga0496111_0028621_2564_3127 | 187 |
| 789 | 3300048914 | Ga0496111_0700804 | Ga0496111_0700804_25_588 | 187 |
| 790 | 3300048915 | Ga0496112_0000601 | Ga0496112_0000601_13379_13942 | 187 |
| 791 | 3300048915 | Ga0496112_0006054 | Ga0496112_0006054_2245_2808 | 187 |
| 792 | 3300048915 | Ga0496112_0114946 | Ga0496112_0114946_1895_2458 | 187 |
| 793 | 3300048915 | Ga0496112_0139822 | Ga0496112_0139822_152_715 | 187 |
| 794 | 3300048915 | Ga0496112_0178662 | Ga0496112_0178662_1308_1871 | 187 |
| 795 | 3300048915 | Ga0496112_0324476 | Ga0496112_0324476_105_668 | 187 |
| 796 | 3300048915 | Ga0496112_0578973 | Ga0496112_0578973_265_828 | 187 |
| 797 | 3300048916 | Ga0496113_0003449 | Ga0496113_0003449_2454_3017 | 187 |
| 798 | 3300048916 | Ga0496113_0017621 | Ga0496113_0017621_2878_3441 | 187 |
| 799 | 3300048916 | Ga0496113_0137222 | Ga0496113_0137222_681_1244 | 187 |
| 800 | 3300048916 | Ga0496113_0295804 | Ga0496113_0295804_563_1126 | 187 |
| 801 | 3300048917 | Ga0496114_0076662 | Ga0496114_0076662_548_1111 | 187 |
| 802 | 3300048917 | Ga0496114_0126187 | Ga0496114_0126187_975_1538 | 187 |
| 803 | 3300048917 | Ga0496114_0449878 | Ga0496114_0449878_398_961 | 187 |
| 804 | 3300048917 | Ga0496114_0700168 | Ga0496114_0700168_153_716 | 187 |
| 805 | 3300048917 | Ga0496114_1015401 | Ga0496114_1015401_55_618 | 187 |
| 806 | 3300048918 | Ga0496115_0013680 | Ga0496115_0013680_5090_5653 | 187 |
| 807 | 3300048918 | Ga0496115_0242957 | Ga0496115_0242957_74_637 | 187 |
| 808 | 3300048918 | Ga0496115_0293772 | Ga0496115_0293772_68_631 | 187 |
| 809 | 3300048918 | Ga0496115_0315304 | Ga0496115_0315304_229_792 | 187 |
| 810 | 3300048918 | Ga0496115_0545337 | Ga0496115_0545337_203_766 | 187 |
| 811 | 3300050492 | nmdc:mga0yw44_1439_c2 | nmdc:mga0yw44_1439_c2_5478_6041 | 187 |
| 812 | 3300050492 | nmdc:mga0yw44_3517_c1 | nmdc:mga0yw44_3517_c1_401_1081 | 187 |
| 813 | 3300050507 | nmdc:mga05p37_11335_c1 | nmdc:mga05p37_11335_c1_7033_7596 | 187 |
| 814 | 3300050507 | nmdc:mga05p37_119370_c1 | nmdc:mga05p37_119370_c1_1903_2466 | 187 |
| 815 | 3300050507 | nmdc:mga05p37_272693_c1 | nmdc:mga05p37_272693_c1_240_803 | 187 |
| 816 | 3300050507 | nmdc:mga05p37_291971_c1 | nmdc:mga05p37_291971_c1_356_919 | 187 |
| 817 | 3300050507 | nmdc:mga05p37_64107_c1 | nmdc:mga05p37_64107_c1_2528_3091 | 187 |
| 818 | 3300050508 | nmdc:mga09592_40107_c1 | nmdc:mga09592_40107_c1_1560_2123 | 187 |
| 819 | 3300050510 | nmdc:mga06r32_105758_c1 | nmdc:mga06r32_105758_c1_699_1262 | 187 |
| 820 | 3300050510 | nmdc:mga06r32_183936_c1 | nmdc:mga06r32_183936_c1_1237_1800 | 187 |
| 821 | 3300050510 | nmdc:mga06r32_67523_c1 | nmdc:mga06r32_67523_c1_2011_2691 | 187 |
| 822 | 3300050510 | nmdc:mga06r32_89123_c1 | nmdc:mga06r32_89123_c1_2224_2787 | 187 |
| 823 | 3300050511 | nmdc:mga08y16_1435524_c1 | nmdc:mga08y16_1435524_c1_11_574 | 187 |
| 824 | 3300050512 | nmdc:mga0n895_298942_c1 | nmdc:mga0n895_298942_c1_892_1455 | 187 |
| 825 | 3300050513 | nmdc:mga0rr50_120985_c1 | nmdc:mga0rr50_120985_c1_503_1066 | 187 |
| 826 | 3300050513 | nmdc:mga0rr50_539319_c1 | nmdc:mga0rr50_539319_c1_370_933 | 187 |
| 827 | 3300050514 | nmdc:mga08x19_529604_c1 | nmdc:mga08x19_529604_c1_227_790 | 187 |
| 828 | 3300050515 | nmdc:mga0a205_286808_c1 | nmdc:mga0a205_286808_c1_317_880 | 187 |
| 829 | 3300050515 | nmdc:mga0a205_35703_c1 | nmdc:mga0a205_35703_c1_1606_2169 | 187 |
| 830 | 3300053077 | Ga0495601_0004131 | Ga0495601_0004131_6402_6965 | 187 |
| 831 | 3300053077 | Ga0495601_0004957 | Ga0495601_0004957_2453_3016 | 187 |
| 832 | 3300053077 | Ga0495601_0017589 | Ga0495601_0017589_1788_2468 | 187 |
| 833 | 3300053077 | Ga0495601_0464485 | Ga0495601_0464485_116_796 | 187 |
| 834 | 3300053078 | Ga0495612_0004798 | Ga0495612_0004798_2582_3145 | 187 |
| 835 | 3300053078 | Ga0495612_0005266 | Ga0495612_0005266_1142_1705 | 187 |
| 836 | 3300053078 | Ga0495612_0021164 | Ga0495612_0021164_96_776 | 187 |
| 837 | 3300053084 | Ga0495595_0007484 | Ga0495595_0007484_3339_3902 | 187 |
| 838 | 3300053084 | Ga0495595_0010073 | Ga0495595_0010073_3327_3890 | 187 |
| 839 | 3300053084 | Ga0495595_0142049 | Ga0495595_0142049_551_1114 | 187 |
| 840 | 3300053085 | Ga0495619_0000149 | Ga0495619_0000149_38656_39336 | 187 |
| 841 | 3300053085 | Ga0495619_0001954 | Ga0495619_0001954_2251_2814 | 187 |
| 842 | 3300053085 | Ga0495619_0007106 | Ga0495619_0007106_4956_5519 | 187 |
| 843 | 3300053085 | Ga0495619_0007508 | Ga0495619_0007508_1819_2382 | 187 |
| 844 | 3300053085 | Ga0495619_0058657 | Ga0495619_0058657_444_1007 | 187 |
| 845 | 3300053085 | Ga0495619_0289850 | Ga0495619_0289850_423_986 | 187 |
| 846 | 3300053087 | Ga0500643_005326 | Ga0500643_005326_427_990 | 187 |
| 847 | 3300053088 | Ga0500644_0001263 | Ga0500644_0001263_1718_2281 | 187 |
| 848 | 3300053093 | Ga0500651_0036588 | Ga0500651_0036588_2328_2891 | 187 |
| 849 | 3300053094 | Ga0500566_0294925 | Ga0500566_0294925_72_635 | 187 |
| 850 | 3300053119 | Ga0500595_000016 | Ga0500595_000016_41832_42395 | 187 |
| 851 | 3300053119 | Ga0500595_013460 | Ga0500595_013460_1677_2240 | 187 |
| 852 | 3300053131 | Ga0500652_006592 | Ga0500652_006592_2442_3005 | 187 |
| 853 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_682149_682712 | 187 |
| 854 | 3300053153 | Ga0500616_0176801 | Ga0500616_0176801_177_740 | 187 |
| 855 | 3300053730 | Ga0500645_000033 | Ga0500645_000033_11832_12395 | 187 |
| 856 | 3300060353 | Ga0501082_0807635 | Ga0501082_0807635_19_582 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ldc-assembly1.cif.gz_A | high resolution open mthk pore structure crystallized in 100 mm k+ | 0.3718 | 94 | 175 |
| 3ldc-assembly1.cif.gz_A-3 | high resolution open mthk pore structure crystallized in 100 mm k+ | 0.3718 | 94 | 175 |
| 6u6h-assembly1.cif.gz_A | calcium-bound mthk open-inactivated state 3 | 0.3718 | 94 | 175 |
| 6u9p-assembly1.cif.gz_A | wild-type mthk pore in ~150 mm k+ | 0.3695 | 94 | 175 |
| 3ldc-assembly1.cif.gz_A | high resolution open mthk pore structure crystallized in 100 mm k+ | 0.3679 | 94 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9W581_654_778_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3819 | 123 | 178 | 1.10.287.70 |
| 3behB02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3804 | 101 | 174 | 1.10.287.70 |
| 3ldcA00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3718 | 94 | 175 | 1.10.287.70 |
| af_B0UYF4_307_417_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.3704 | 96 | 163 | 1.10.287.70 |
| af_O16158_2_183_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.3689 | 44 | 162 | 1.10.238.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536YJA9-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9444 | 41 | 187 |
|
| AF-A0A1Q7BYJ7-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9436 | 22 | 187 |
|
| AF-A0A6L8EJL0-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9414 | 17 | 187 |
|
| AF-A0A1Q7BYJ7-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9381 | 22 | 187 |
|
| AF-A0A536YJA9-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.9381 | 41 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar