F483665

General Info

Members Datasets Scaffolds Average Seq Length
856 326 855 188

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0104151|Ga0373937_0104151_402_1082
Length 226
Sequence LIHVSICDWIWFRSRDGNARAPGRKNDNDKAASHSREELMSEIERRALMKGAALSALAFSVGGAEVLLSPKQARAQSIPFRALSLEQIATLEAMGETLVPGAKAAGISHFVDQQLSVPHSEALLEARILNVRPPYANFYRAALGAVDKASAALNGGRNFGQLNDGERNSFVDLMRQNKIEGWQGPGGPFVYLILRSDAVDVVYGTMEGYAALGIPYMPHIAPEKRW

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0
Rhizoplane 12.97
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10705429 3300005328 Bacteria 737
2 Ga0070670_100020187 3300005331 Bacteria 5725
3 Ga0070670_100046488 3300005331 Bacteria 3733
4 Ga0070666_10462467 3300005335 Bacteria 917
5 Ga0070666_10792587 3300005335 Bacteria 698
6 Ga0070682_100033603 3300005337 Bacteria 3118
7 Ga0068868_100019798 3300005338 Bacteria 5048
8 Ga0068868_100725929 3300005338 Bacteria 891
9 Ga0070660_100321379 3300005339 Unclassified 1271
10 Ga0070660_100716073 3300005339 Bacteria 840
11 Ga0070689_100703468 3300005340 Bacteria 882
12 Ga0070689_101141972 3300005340 Bacteria 698
13 Ga0070661_100766765 3300005344 Unclassified 790
14 Ga0070661_100964028 3300005344 Bacteria 706
15 Ga0070692_10052338 3300005345 Unclassified 2127
16 Ga0070668_100134085 3300005347 Bacteria 1990
17 Ga0070668_100873432 3300005347 Unclassified 802
18 Ga0070669_100254905 3300005353 Bacteria 1398
19 Ga0070669_100569986 3300005353 Unclassified 946
20 Ga0070675_100439931 3300005354 Bacteria 1168
21 Ga0070675_100675562 3300005354 Bacteria 940
22 Ga0070671_100114803 3300005355 Bacteria 2264
23 Ga0070671_100509088 3300005355 Bacteria 1036
24 Ga0070674_100059554 3300005356 Bacteria 2658
25 Ga0070674_100249883 3300005356 Bacteria 1392
26 Ga0070673_100812572 3300005364 Bacteria 864
27 Ga0070673_100908507 3300005364 Bacteria 817
28 Ga0070673_101462324 3300005364 Bacteria 644
29 Ga0070667_100287209 3300005367 Bacteria 1478
30 Ga0070667_100420876 3300005367 Bacteria 1218
31 Ga0070709_10089244 3300005434 Unclassified 2029
32 Ga0070709_10089991 3300005434 Bacteria 2022
33 Ga0070709_10234526 3300005434 Bacteria 1314
34 Ga0070709_10249432 3300005434 Bacteria 1278
35 Ga0070714_100326704 3300005435 Bacteria 1436
36 Ga0070714_100373999 3300005435 Bacteria 1342
37 Ga0070714_100555765 3300005435 Bacteria 1099
38 Ga0070713_100004064 3300005436 Bacteria 9739
39 Ga0070713_100195432 3300005436 Unclassified 1825
40 Ga0070713_100305932 3300005436 Unclassified 1465
41 Ga0070713_100332559 3300005436 Unclassified 1405
42 Ga0070713_100742548 3300005436 Bacteria 939
43 Ga0070710_10120056 3300005437 Bacteria 1590
44 Ga0070710_10200926 3300005437 Bacteria 1259
45 Ga0070711_100017996 3300005439 Bacteria 4505
46 Ga0070711_100048110 3300005439 Bacteria 2914
47 Ga0070711_100071681 3300005439 Unclassified 2443
48 Ga0070711_100075515 3300005439 Bacteria 2386
49 Ga0070711_100175835 3300005439 Bacteria 1635
50 Ga0070711_100643802 3300005439 Bacteria 888
51 Ga0070700_100145393 3300005441 Bacteria 1615
52 Ga0070694_100169977 3300005444 Bacteria 1605
53 Ga0070708_100363369 3300005445 Bacteria 1364
54 Ga0070663_100131674 3300005455 Unclassified 1900
55 Ga0070663_100137635 3300005455 Bacteria 1861
56 Ga0070663_100144408 3300005455 Bacteria 1819
57 Ga0070678_100010560 3300005456 Bacteria 5649
58 Ga0070678_100119432 3300005456 Unclassified 2076
59 Ga0070662_100341685 3300005457 Bacteria 1225
60 Ga0070681_10039956 3300005458 Bacteria 4703
61 Ga0070681_10207284 3300005458 Bacteria 1877
62 Ga0068867_100142961 3300005459 Bacteria 1872
63 Ga0070685_10019770 3300005466 Bacteria 3638
64 Ga0070685_10306691 3300005466 Bacteria 1071
65 Ga0070707_100200256 3300005468 Bacteria 1946
66 Ga0070707_100299047 3300005468 Bacteria 1564
67 Ga0070698_100356072 3300005471 Bacteria 1395
68 Ga0070699_100010939 3300005518 Bacteria 7849
69 Ga0070699_100048006 3300005518 Bacteria 3694
70 Ga0070699_100296518 3300005518 Bacteria 1450
71 Ga0070679_100612914 3300005530 Bacteria 1032
72 Ga0070684_100268760 3300005535 Bacteria 1560
73 Ga0070697_100003357 3300005536 Bacteria 12299
74 Ga0070697_100644915 3300005536 Bacteria 932
75 Ga0070697_100733443 3300005536 Bacteria 873
76 Ga0070672_100217215 3300005543 Bacteria 1603
77 Ga0070686_100255020 3300005544 Bacteria 1283
78 Ga0070693_100038951 3300005547 Bacteria 2660
79 Ga0070693_100630332 3300005547 Bacteria 777
80 Ga0070665_100022395 3300005548 Bacteria 6358
81 Ga0070665_100257971 3300005548 Bacteria 1744
82 Ga0070704_100171589 3300005549 Bacteria 1726
83 Ga0070704_100279334 3300005549 Bacteria 1383
84 Ga0070704_100566641 3300005549 Bacteria 994
85 Ga0068855_100372247 3300005563 Unclassified 1570
86 Ga0070664_100037789 3300005564 Bacteria 4060
87 Ga0068857_100220077 3300005577 Bacteria 1734
88 Ga0068856_100074034 3300005614 Bacteria 3372
89 Ga0068856_100804499 3300005614 Bacteria 960
90 Ga0070702_100053473 3300005615 Bacteria 2320
91 Ga0070702_100172200 3300005615 Bacteria 1409
92 Ga0068859_100031624 3300005617 Bacteria 5314
93 Ga0068859_100879067 3300005617 Bacteria 982
94 Ga0068859_102049897 3300005617 Unclassified 632
95 Ga0068864_100136555 3300005618 Bacteria 2208
96 Ga0068864_100282053 3300005618 Bacteria 1551
97 Ga0068866_10005758 3300005718 Bacteria 5135
98 Ga0068866_10354438 3300005718 Bacteria 933
99 Ga0068866_10571138 3300005718 Unclassified 759
100 Ga0068861_100254363 3300005719 Unclassified 1500
101 Ga0068870_10020749 3300005840 Bacteria 3205
102 Ga0068863_100231265 3300005841 Bacteria 1783
103 Ga0068863_100319960 3300005841 Bacteria 1507
104 Ga0068858_100178310 3300005842 Bacteria 2005
105 Ga0068860_100077192 3300005843 Unclassified 3167
106 Ga0068860_100324302 3300005843 Bacteria 1512
107 Ga0068860_100464631 3300005843 Bacteria 1259
108 Ga0068862_101310603 3300005844 Unclassified 726
109 Ga0068862_101328062 3300005844 Unclassified 721
110 Ga0081455_10000369 3300005937 Bacteria 59441
111 Ga0081455_10025395 3300005937 Bacteria 5470
112 Ga0081455_10027696 3300005937 Bacteria 5190
113 Ga0081455_10502183 3300005937 Bacteria 814
114 Ga0081455_10626011 3300005937 Unclassified 697
115 Ga0081540_1001030 3300005983 Bacteria 24972
116 Ga0081540_1003967 3300005983 Bacteria 11499
117 Ga0070717_10044387 3300006028 Bacteria 3629
118 Ga0070717_10085937 3300006028 Bacteria 2648
119 Ga0070717_10199114 3300006028 Bacteria 1754
120 Ga0070717_11158431 3300006028 Bacteria 704
121 Ga0075365_10043223 3300006038 Bacteria 2950
122 Ga0075365_10065984 3300006038 Bacteria 2427
123 Ga0075368_10125951 3300006042 Unclassified 1063
124 Ga0075364_10145467 3300006051 Bacteria 1596
125 Ga0075432_10092256 3300006058 Bacteria 1110
126 Ga0070715_10063356 3300006163 Bacteria 1630
127 Ga0070716_100025208 3300006173 Bacteria 3171
128 Ga0070716_100509906 3300006173 Bacteria 889
129 Ga0070712_100001051 3300006175 Bacteria 16665
130 Ga0070712_100007738 3300006175 Bacteria 6724
131 Ga0070712_100518095 3300006175 Bacteria 1001
132 Ga0075362_10078152 3300006177 Bacteria 1522
133 Ga0075367_10196243 3300006178 Bacteria 1260
134 Ga0097621_100250240 3300006237 Bacteria 1551
135 Ga0097621_100444288 3300006237 Bacteria 1167
136 Ga0097621_100515682 3300006237 Bacteria 1084
137 Ga0068871_100015941 3300006358 Bacteria 5644
138 Ga0075428_100021266 3300006844 Bacteria 7184
139 Ga0075428_100065454 3300006844 Bacteria 3980
140 Ga0075428_100098943 3300006844 Bacteria 3180
141 Ga0075428_100298068 3300006844 Bacteria 1734
142 Ga0075428_100521767 3300006844 Bacteria 1271
143 Ga0075430_100040521 3300006846 Bacteria 3942
144 Ga0075431_100054123 3300006847 Bacteria 4138
145 Ga0075431_100072487 3300006847 Bacteria 3554
146 Ga0075431_100137660 3300006847 Bacteria 2517
147 Ga0075431_100274988 3300006847 Unclassified 1706
148 Ga0075431_100471779 3300006847 Bacteria 1249
149 Ga0075433_10041187 3300006852 Bacteria 4001
150 Ga0075433_10108487 3300006852 Bacteria 2462
151 Ga0075434_100057057 3300006871 Bacteria 3881
152 Ga0075434_100094195 3300006871 Bacteria 2999
153 Ga0075434_100130149 3300006871 Bacteria 2535
154 Ga0075434_100153131 3300006871 Bacteria 2326
155 Ga0075434_100208202 3300006871 Bacteria 1976
156 Ga0075434_100280879 3300006871 Bacteria 1685
157 Ga0075434_100396164 3300006871 Bacteria 1402
158 Ga0075434_100747784 3300006871 Bacteria 995
159 Ga0075429_100049636 3300006880 Bacteria 3649
160 Ga0075429_100242670 3300006880 Bacteria 1578
161 Ga0068865_100179016 3300006881 Bacteria 1631
162 Ga0068865_100312179 3300006881 Bacteria 1262
163 Ga0068865_100373856 3300006881 Bacteria 1161
164 Ga0075436_100033605 3300006914 Bacteria 3536
165 Ga0075436_100236140 3300006914 Bacteria 1299
166 Ga0075436_100499748 3300006914 Bacteria 889
167 Ga0097620_100031624 3300006931 Bacteria 5314
168 Ga0097620_100879053 3300006931 Bacteria 982
169 Ga0075435_100084778 3300007076 Bacteria 2607
170 Ga0075435_100310268 3300007076 Bacteria 1350
171 Ga0075435_100499013 3300007076 Bacteria 1052
172 Ga0099794_10031603 3300007265 Bacteria 2480
173 Ga0099795_10001014 3300007788 Bacteria 5775
174 Ga0099795_10008229 3300007788 Bacteria 2962
175 Ga0105251_10086785 3300009011 Bacteria 1441
176 Ga0105250_10089889 3300009092 Bacteria 1248
177 Ga0105240_11375095 3300009093 Bacteria 743
178 Ga0111539_10011327 3300009094 Bacteria 11200
179 Ga0111539_10057982 3300009094 Bacteria 4596
180 Ga0111539_10486097 3300009094 Bacteria 1438
181 Ga0111539_10926368 3300009094 Bacteria 1013
182 Ga0105245_10069966 3300009098 Bacteria 3183
183 Ga0105245_10209838 3300009098 Bacteria 1874
184 Ga0105245_10346909 3300009098 Unclassified 1470
185 Ga0105247_10016260 3300009101 Bacteria 4457
186 Ga0105247_10061346 3300009101 Bacteria 2331
187 Ga0105247_10135926 3300009101 Unclassified 1606
188 Ga0105247_10645487 3300009101 Bacteria 790
189 Ga0114129_10035252 3300009147 Bacteria 7069
190 Ga0114129_10047462 3300009147 Bacteria 6033
191 Ga0114129_10051163 3300009147 Bacteria 5801
192 Ga0114129_10126590 3300009147 Bacteria 3512
193 Ga0114129_10225891 3300009147 Bacteria 2523
194 Ga0114129_10723089 3300009147 Bacteria 1277
195 Ga0114129_10962283 3300009147 Bacteria 1078
196 Ga0105243_10299969 3300009148 Bacteria 1456
197 Ga0105242_10008956 3300009176 Bacteria 7682
198 Ga0105242_10120223 3300009176 Bacteria 2253
199 Ga0105242_10403603 3300009176 Bacteria 1276
200 Ga0105242_10413060 3300009176 Bacteria 1262
201 Ga0105248_10004776 3300009177 Bacteria 14994
202 Ga0105248_10030452 3300009177 Bacteria 6024
203 Ga0105248_10033903 3300009177 Bacteria 5705
204 Ga0105248_10268358 3300009177 Bacteria 1921
205 Ga0105237_10237172 3300009545 Bacteria 1825
206 Ga0105237_10481968 3300009545 Unclassified 1247
207 Ga0105237_10591465 3300009545 Bacteria 1117
208 Ga0105249_10571350 3300009553 Bacteria 1183
209 Ga0099796_10063043 3300010159 Bacteria 1319
210 Ga0105239_10122001 3300010375 Bacteria 2895
211 Ga0105239_11305336 3300010375 Bacteria 837
212 Ga0105239_11394527 3300010375 Bacteria 809
213 Ga0105246_10041041 3300011119 Bacteria 3126
214 Ga0105246_10059375 3300011119 Bacteria 2653
215 Ga0105246_10594586 3300011119 Bacteria 955
216 Ga0157369_11268499 3300013105 Bacteria 751
217 Ga0157374_10065165 3300013296 Bacteria 3421
218 Ga0157374_10247517 3300013296 Bacteria 1754
219 Ga0157374_10363596 3300013296 Bacteria 1439
220 Ga0157374_11086336 3300013296 Bacteria 820
221 Ga0157378_10127112 3300013297 Bacteria 2356
222 Ga0157378_10455034 3300013297 Bacteria 1271
223 Ga0157378_11316623 3300013297 Bacteria 764
224 Ga0163162_10234402 3300013306 Bacteria 1966
225 Ga0163162_10418364 3300013306 Bacteria 1472
226 Ga0163162_10452082 3300013306 Bacteria 1416
227 Ga0163162_10786228 3300013306 Bacteria 1070
228 Ga0157372_10107145 3300013307 Bacteria 3197
229 Ga0157375_10056268 3300013308 Bacteria 3883
230 Ga0157375_10245014 3300013308 Bacteria 1952
231 Ga0163163_10012789 3300014325 Bacteria 7659
232 Ga0163163_10082133 3300014325 Bacteria 3226
233 Ga0163163_10199769 3300014325 Bacteria 2048
234 Ga0163163_10898951 3300014325 Bacteria 949
235 Ga0157380_10387475 3300014326 Unclassified 1321
236 Ga0157379_10036120 3300014968 Bacteria 4406
237 Ga0157379_11471424 3300014968 Bacteria 662
238 Ga0157376_10030575 3300014969 Bacteria 4301
239 Ga0157376_10144459 3300014969 Bacteria 2138
240 Ga0157376_10440628 3300014969 Bacteria 1268
241 Ga0163161_10180794 3300017792 Bacteria 1617
242 Ga0224572_1006794 3300024225 Bacteria 2078
243 Ga0228598_1017655 3300024227 Bacteria 1408
244 Ga0207692_10017719 3300025898 Bacteria 3181
245 Ga0207692_10133377 3300025898 Bacteria 1405
246 Ga0207692_10226249 3300025898 Bacteria 1111
247 Ga0207642_10042651 3300025899 Bacteria 1995
248 Ga0207710_10007860 3300025900 Bacteria 4514
249 Ga0207688_10637509 3300025901 Unclassified 672
250 Ga0207680_10083989 3300025903 Bacteria 2008
251 Ga0207680_10416178 3300025903 Bacteria 951
252 Ga0207647_10272587 3300025904 Bacteria 967
253 Ga0207685_10009105 3300025905 Bacteria 2868
254 Ga0207699_10102070 3300025906 Bacteria 1822
255 Ga0207699_10208258 3300025906 Bacteria 1329
256 Ga0207699_10935188 3300025906 Bacteria 640
257 Ga0207645_10019349 3300025907 Bacteria 4464
258 Ga0207645_10129460 3300025907 Bacteria 1642
259 Ga0207684_10065109 3300025910 Bacteria 3095
260 Ga0207707_10031910 3300025912 Bacteria 4611
261 Ga0207671_10245467 3300025914 Bacteria 1407
262 Ga0207693_10002798 3300025915 Bacteria 15117
263 Ga0207693_10010575 3300025915 Bacteria 7486
264 Ga0207693_10044059 3300025915 Bacteria 3507
265 Ga0207693_10145853 3300025915 Bacteria 1861
266 Ga0207693_10214584 3300025915 Bacteria 1512
267 Ga0207663_10034645 3300025916 Bacteria 3022
268 Ga0207663_10037618 3300025916 Bacteria 2919
269 Ga0207663_10055738 3300025916 Unclassified 2482
270 Ga0207662_10159341 3300025918 Bacteria 1441
271 Ga0207649_10062796 3300025920 Bacteria 2343
272 Ga0207646_10041572 3300025922 Bacteria 4133
273 Ga0207694_10233327 3300025924 Bacteria 1503
274 Ga0207650_10006118 3300025925 Bacteria 8199
275 Ga0207659_10136810 3300025926 Bacteria 1897
276 Ga0207687_10006865 3300025927 Bacteria 7498
277 Ga0207687_10157687 3300025927 Bacteria 1738
278 Ga0207687_10592098 3300025927 Bacteria 934
279 Ga0207700_10043966 3300025928 Bacteria 3285
280 Ga0207700_10370204 3300025928 Unclassified 1251
281 Ga0207700_10715841 3300025928 Unclassified 894
282 Ga0207700_10719528 3300025928 Bacteria 892
283 Ga0207664_10275014 3300025929 Bacteria 1476
284 Ga0207644_10020189 3300025931 Unclassified 4527
285 Ga0207644_10184309 3300025931 Bacteria 1638
286 Ga0207644_10457265 3300025931 Bacteria 1049
287 Ga0207706_10036765 3300025933 Bacteria 4349
288 Ga0207706_10084917 3300025933 Unclassified 2783
289 Ga0207686_10110954 3300025934 Bacteria 1850
290 Ga0207686_10151105 3300025934 Bacteria 1617
291 Ga0207686_10742644 3300025934 Bacteria 783
292 Ga0207709_10266630 3300025935 Bacteria 1258
293 Ga0207709_10964180 3300025935 Unclassified 696
294 Ga0207670_10203842 3300025936 Bacteria 1504
295 Ga0207669_11053424 3300025937 Unclassified 685
296 Ga0207704_10103113 3300025938 Bacteria 1907
297 Ga0207665_10018755 3300025939 Bacteria 4547
298 Ga0207665_10159069 3300025939 Bacteria 1624
299 Ga0207665_10309797 3300025939 Bacteria 1182
300 Ga0207665_10356586 3300025939 Bacteria 1105
301 Ga0207691_10015870 3300025940 Bacteria 7158
302 Ga0207711_10008135 3300025941 Bacteria 8778
303 Ga0207711_10022249 3300025941 Bacteria 5301
304 Ga0207711_11066813 3300025941 Unclassified 748
305 Ga0207689_10022880 3300025942 Bacteria 5249
306 Ga0207689_10297973 3300025942 Bacteria 1336
307 Ga0207679_10155666 3300025945 Bacteria 1866
308 Ga0207679_10652996 3300025945 Unclassified 952
309 Ga0207679_11168754 3300025945 Unclassified 706
310 Ga0207651_10127635 3300025960 Bacteria 1941
311 Ga0207651_10544820 3300025960 Bacteria 1008
312 Ga0207651_10649667 3300025960 Bacteria 926
313 Ga0207651_10750614 3300025960 Bacteria 862
314 Ga0207640_10320631 3300025981 Bacteria 1234
315 Ga0207640_10478614 3300025981 Unclassified 1032
316 Ga0207658_10045484 3300025986 Bacteria 3200
317 Ga0207658_10086337 3300025986 Bacteria 2420
318 Ga0207677_10615656 3300026023 Bacteria 954
319 Ga0207703_10356636 3300026035 Unclassified 1348
320 Ga0207703_10446307 3300026035 Bacteria 1208
321 Ga0207703_10664502 3300026035 Unclassified 989
322 Ga0207678_10011265 3300026067 Bacteria 7850
323 Ga0207678_10014350 3300026067 Bacteria 6967
324 Ga0207678_10166576 3300026067 Bacteria 1882
325 Ga0207708_10051435 3300026075 Bacteria 3136
326 Ga0207702_10230700 3300026078 Bacteria 1730
327 Ga0207702_10869053 3300026078 Bacteria 893
328 Ga0207641_10093274 3300026088 Bacteria 2639
329 Ga0207641_10405488 3300026088 Bacteria 1310
330 Ga0207676_10236149 3300026095 Bacteria 1637
331 Ga0207675_100006797 3300026118 Bacteria 10827
332 Ga0207675_100127492 3300026118 Bacteria 2411
333 Ga0207683_10004571 3300026121 Bacteria 11921
334 Ga0207683_10005533 3300026121 Bacteria 10828
335 Ga0207683_10338071 3300026121 Bacteria 1381
336 Ga0207683_11089095 3300026121 Bacteria 741
337 Ga0209179_1004415 3300027512 Bacteria 2121
338 Ga0209813_10077399 3300027866 Unclassified 1093
339 Ga0207428_10223975 3300027907 Bacteria 1409
340 Ga0268266_10005703 3300028379 Bacteria 11544
341 Ga0268266_10284203 3300028379 Unclassified 1539
342 Ga0268265_11299873 3300028380 Unclassified 727
343 Ga0268264_10185841 3300028381 Unclassified 1891
344 Ga0268264_10284093 3300028381 Bacteria 1551
345 Ga0265338_10083691 3300028800 Bacteria 2667
346 Ga0265773_1006684 3300031018 Bacteria 879
347 Ga0265760_10089398 3300031090 Bacteria 962
348 Ga0265330_10083913 3300031235 Bacteria 1371
349 Ga0265332_10003584 3300031238 Bacteria 7447
350 Ga0265328_10218071 3300031239 Bacteria 726
351 Ga0265325_10014844 3300031241 Bacteria 4392
352 Ga0265325_10050885 3300031241 Bacteria 2131
353 Ga0265329_10166233 3300031242 Bacteria 718
354 Ga0265340_10000757 3300031247 Bacteria 18368
355 Ga0265339_10000077 3300031249 Bacteria 84288
356 Ga0265339_10001098 3300031249 Bacteria 20530
357 Ga0265339_10204696 3300031249 Unclassified 972
358 Ga0265313_10001170 3300031595 Bacteria 25104
359 Ga0265314_10004866 3300031711 Bacteria 12275
360 Ga0265314_10075050 3300031711 Bacteria 2250
361 Ga0265342_10000092 3300031712 Bacteria 99040
362 Ga0307507_10106153 3300033179 Bacteria 2321
363 Ga0307507_10385298 3300033179 Unclassified 805
364 Ga0373958_0017676 3300034819 Bacteria 1285
365 Ga0373959_0018494 3300034820 Bacteria 1312
366 Ga0373926_0002409 3300035083 Bacteria 5927
367 Ga0373926_0011990 3300035083 Bacteria 2926
368 Ga0373928_0009042 3300035084 Unclassified 1944
369 Ga0373929_0006323 3300035085 Bacteria 2141
370 Ga0373929_0018370 3300035085 Bacteria 1389
371 Ga0373934_0005641 3300035086 Bacteria 4637
372 Ga0373934_0087177 3300035086 Bacteria 1256
373 Ga0373934_0135815 3300035086 Unclassified 1004
374 Ga0373944_0027529 3300035089 Bacteria 1686
375 Ga0373944_0030232 3300035089 Bacteria 1624
376 Ga0373944_0299189 3300035089 Bacteria 604
377 Ga0373949_0055680 3300035090 Bacteria 1007
378 Ga0373951_0080294 3300035091 Bacteria 843
379 Ga0373952_0007885 3300035092 Unclassified 2007
380 Ga0373952_0009694 3300035092 Bacteria 1850
381 Ga0373923_0002741 3300035111 Bacteria 5498
382 Ga0373923_0111806 3300035111 Bacteria 1213
383 Ga0373923_0245344 3300035111 Bacteria 837
384 Ga0373932_0031617 3300035112 Bacteria 1476
385 Ga0373936_0135689 3300035113 Bacteria 1060
386 Ga0373936_0397703 3300035113 Unclassified 632
387 Ga0373939_0027092 3300035114 Bacteria 1621
388 Ga0373941_0008648 3300035115 Bacteria 2537
389 Ga0373941_0095849 3300035115 Unclassified 1025
390 Ga0373945_0005807 3300035116 Bacteria 3962
391 Ga0373945_0007853 3300035116 Bacteria 3461
392 Ga0373945_0022810 3300035116 Bacteria 2159
393 Ga0373945_0140116 3300035116 Bacteria 975
394 Ga0373953_0000877 3300035117 Bacteria 8439
395 Ga0373953_0041124 3300035117 Bacteria 1838
396 Ga0373954_0000582 3300035118 Bacteria 13847
397 Ga0373954_0007523 3300035118 Bacteria 4767
398 Ga0373954_0011839 3300035118 Bacteria 3873
399 Ga0373954_0184958 3300035118 Bacteria 1022
400 Ga0373954_0218434 3300035118 Bacteria 937
401 Ga0373954_0222009 3300035118 Unclassified 929
402 Ga0373956_0004515 3300035119 Bacteria 5558
403 Ga0373956_0165348 3300035119 Unclassified 1043
404 Ga0373956_0409182 3300035119 Unclassified 647
405 Ga0373957_0002376 3300035120 Bacteria 5356
406 Ga0373957_0047996 3300035120 Bacteria 1625
407 Ga0373957_0105937 3300035120 Bacteria 1129
408 Ga0373960_0140220 3300035121 Bacteria 818
409 Ga0373943_0026578 3300035170 Unclassified 2712
410 Ga0373943_0101334 3300035170 Bacteria 1506
411 Ga0373943_0126914 3300035170 Bacteria 1361
412 Ga0373943_0321044 3300035170 Unclassified 883
413 Ga0373946_0006713 3300035171 Bacteria 4183
414 Ga0373946_0160036 3300035171 Bacteria 1056
415 Ga0373946_0191745 3300035171 Bacteria 975
416 Ga0373946_0205277 3300035171 Bacteria 945
417 Ga0373955_0016702 3300035172 Bacteria 3616
418 Ga0373955_0066670 3300035172 Bacteria 2001
419 Ga0373955_0078167 3300035172 Bacteria 1864
420 Ga0373955_0346178 3300035172 Bacteria 900
421 Ga0373955_0424577 3300035172 Unclassified 809
422 Ga0373955_0490218 3300035172 Bacteria 750
423 Ga0373942_0031774 3300035207 Bacteria 1399
424 Ga0373942_0041529 3300035207 Bacteria 1258
425 Ga0373961_0072089 3300035241 Unclassified 1070
426 Ga0373962_0029486 3300035242 Bacteria 1496
427 Ga0373924_0002954 3300035410 Bacteria 5774
428 Ga0373924_0009379 3300035410 Bacteria 3583
429 Ga0373924_0028068 3300035410 Bacteria 2241
430 Ga0373924_0254874 3300035410 Unclassified 777
431 Ga0373931_0003361 3300035691 Bacteria 7169
432 Ga0373931_0004763 3300035691 Bacteria 6222
433 Ga0373931_0013244 3300035691 Bacteria 4013
434 Ga0373931_0179451 3300035691 Bacteria 1253
435 Ga0373935_0012670 3300035692 Bacteria 5073
436 Ga0373935_0021389 3300035692 Bacteria 3960
437 Ga0373935_0086510 3300035692 Bacteria 2045
438 Ga0373935_0100346 3300035692 Bacteria 1907
439 Ga0373935_0180597 3300035692 Bacteria 1449
440 Ga0373935_0313162 3300035692 Unclassified 1112
441 Ga0373935_0352447 3300035692 Bacteria 1049
442 Ga0373927_0021247 3300035695 Bacteria 4253
443 Ga0373927_0234731 3300035695 Bacteria 1205
444 Ga0373927_0236388 3300035695 Bacteria 1200
445 Ga0373927_0238926 3300035695 Bacteria 1194
446 Ga0373933_0001118 3300035724 Bacteria 15965
447 Ga0373933_0046663 3300035724 Unclassified 2573
448 Ga0373933_0230141 3300035724 Bacteria 1190
449 Ga0373947_0007475 3300035725 Bacteria 6324
450 Ga0373947_0029051 3300035725 Bacteria 3242
451 Ga0373947_0044707 3300035725 Bacteria 2648
452 Ga0373947_0162168 3300035725 Bacteria 1446
453 Ga0373937_0018721 3300036401 Bacteria 6188
454 Ga0373937_0040421 3300036401 Bacteria 4251
455 Ga0373937_0104151 3300036401 Bacteria 2636
456 Ga0373937_0266076 3300036401 Bacteria 1617
457 Ga0373937_0679630 3300036401 Unclassified 975
458 Ga0373937_0823228 3300036401 Unclassified 876
459 Ga0373925_0015033 3300037068 Bacteria 5595
460 Ga0373925_0110678 3300037068 Bacteria 2121
461 Ga0373925_0156408 3300037068 Bacteria 1793
462 Ga0373925_0220536 3300037068 Bacteria 1513
463 Ga0373925_0248228 3300037068 Bacteria 1427
464 Ga0373925_0360162 3300037068 Bacteria 1182
465 Ga0373925_0405734 3300037068 Bacteria 1112
466 Ga0373925_0513087 3300037068 Bacteria 984
467 Ga0373925_0892732 3300037068 Bacteria 732
468 Ga0395898_0089739 3300037466 Bacteria 2958
469 Ga0436364_0855834 3300037853 Bacteria 1090
470 Ga0436364_0877934 3300037853 Unclassified 814
471 Ga0395901_0266843 3300038443 Bacteria 1781
472 Ga0436365_1155159 3300039437 Bacteria 915
473 Ga0436361_0095794 3300039447 Bacteria 775
474 Ga0436361_0443883 3300039447 Bacteria 4113
475 Ga0436361_0924848 3300039447 Unclassified 1081
476 Ga0436363_0094947 3300039450 Bacteria 670
477 Ga0436363_0595633 3300039450 Unclassified 1464
478 Ga0436362_0005602 3300039453 Bacteria 1117
479 Ga0451851_0045297 3300041507 Bacteria 937
480 Ga0466971_0315003 3300044719 Unclassified 753
481 Ga0466957_0382873 3300044842 Bacteria 960
482 Ga0466967_1056169 3300045976 Unclassified 809
483 Ga0495617_139348 3300046452 Bacteria 775
484 Ga0495592_0008473 3300046454 Bacteria 7716
485 Ga0495592_0012848 3300046454 Bacteria 6367
486 Ga0495592_0016333 3300046454 Bacteria 5632
487 Ga0495592_0088050 3300046454 Bacteria 2232
488 Ga0495603_0043755 3300046455 Bacteria 2673
489 Ga0495603_0104575 3300046455 Bacteria 1652
490 Ga0495603_0128429 3300046455 Bacteria 1476
491 Ga0495603_0191434 3300046455 Bacteria 1183
492 Ga0495603_0199770 3300046455 Bacteria 1155
493 Ga0495629_0005405 3300046459 Bacteria 9525
494 Ga0495629_0056166 3300046459 Bacteria 2753
495 Ga0495629_0106030 3300046459 Bacteria 1960
496 Ga0495629_0269628 3300046459 Bacteria 1169
497 Ga0495638_0147456 3300046460 Bacteria 1367
498 Ga0495641_0011540 3300046461 Bacteria 5022
499 Ga0495641_0017369 3300046461 Plasmid 3751
500 Ga0495641_0049119 3300046461 Bacteria 1933
501 Ga0495641_0124583 3300046461 Bacteria 1150
502 Ga0495641_0151858 3300046461 Bacteria 1035
503 Ga0495651_0002600 3300046462 Bacteria 13955
504 Ga0495651_0129777 3300046462 Bacteria 1841
505 Ga0495651_0487605 3300046462 Bacteria 791
506 Ga0495653_0001047 3300046463 Bacteria 21277
507 Ga0495653_0041639 3300046463 Bacteria 3584
508 Ga0495653_0175829 3300046463 Bacteria 1473
509 Ga0495653_0303915 3300046463 Bacteria 1039
510 Ga0495580_0073254 3300046472 Bacteria 2391
511 Ga0495580_0081932 3300046472 Bacteria 2249
512 Ga0495580_0172853 3300046472 Bacteria 1493
513 Ga0495580_0186826 3300046472 Bacteria 1430
514 Ga0495580_0530027 3300046472 Bacteria 784
515 Ga0495582_0040009 3300046473 Plasmid 2581
516 Ga0495605_0149375 3300046474 Bacteria 1044
517 Ga0495639_0014761 3300046475 Bacteria 3384
518 Ga0495639_0165819 3300046475 Bacteria 1071
519 Ga0495639_0292109 3300046475 Bacteria 812
520 Ga0495662_0023840 3300046476 Bacteria 2955
521 Ga0495662_0038805 3300046476 Bacteria 2301
522 Ga0495662_0171134 3300046476 Unclassified 1070
523 Ga0495662_0260180 3300046476 Bacteria 854
524 Ga0495664_0066334 3300046477 Unclassified 2152
525 Ga0495664_0118522 3300046477 Bacteria 1600
526 Ga0495664_0189536 3300046477 Unclassified 1247
527 Ga0495664_0219559 3300046477 Bacteria 1151
528 Ga0495664_0317050 3300046477 Unclassified 940
529 Ga0495664_0480163 3300046477 Unclassified 743
530 Ga0495584_0120627 3300046491 Bacteria 1328
531 Ga0495584_0163952 3300046491 Bacteria 1130
532 Ga0495584_0446595 3300046491 Bacteria 658
533 Ga0495585_0171153 3300046492 Bacteria 1122
534 Ga0495594_0015676 3300046499 Bacteria 3984
535 Ga0495594_0061996 3300046499 Bacteria 2070
536 Ga0495594_0076130 3300046499 Bacteria 1871
537 Ga0495594_0157511 3300046499 Bacteria 1290
538 Ga0495594_0220951 3300046499 Bacteria 1080
539 Ga0495594_0256296 3300046499 Bacteria 996
540 Ga0495607_0040819 3300046501 Bacteria 2760
541 Ga0495608_0002112 3300046511 Bacteria 14313
542 Ga0495608_0019463 3300046511 Bacteria 4670
543 Ga0495608_0172435 3300046511 Bacteria 1371
544 Ga0495616_0137536 3300046513 Unclassified 1115
545 Ga0495618_0005758 3300046514 Bacteria 7528
546 Ga0495618_0123351 3300046514 Unclassified 1659
547 Ga0495618_0353085 3300046514 Bacteria 906
548 Ga0495618_0400653 3300046514 Unclassified 839
549 Ga0495618_0436267 3300046514 Unclassified 796
550 Ga0495618_0598020 3300046514 Unclassified 656
551 Ga0495628_0003957 3300046516 Bacteria 13192
552 Ga0495628_0004724 3300046516 Bacteria 12012
553 Ga0495628_0019722 3300046516 Bacteria 5570
554 Ga0495628_0033958 3300046516 Bacteria 4106
555 Ga0495628_0160779 3300046516 Bacteria 1707
556 Ga0495630_0016483 3300046517 Bacteria 5401
557 Ga0495630_0216081 3300046517 Bacteria 1463
558 Ga0495630_0385510 3300046517 Unclassified 1073
559 Ga0495644_0370438 3300046523 Unclassified 565
560 Ga0495666_0010416 3300046526 Bacteria 4636
561 Ga0495652_0003317 3300046529 Bacteria 15979
562 Ga0495652_0028740 3300046529 Bacteria 4889
563 Ga0495652_0046364 3300046529 Bacteria 3732
564 Ga0495652_0063428 3300046529 Bacteria 3111
565 Ga0495652_0201615 3300046529 Bacteria 1509
566 Ga0495652_0236075 3300046529 Bacteria 1364
567 Ga0495652_0285065 3300046529 Bacteria 1208
568 Ga0495652_0368774 3300046529 Unclassified 1024
569 Ga0495665_0006593 3300046531 Bacteria 6271
570 Ga0495665_0037035 3300046531 Bacteria 2604
571 Ga0495665_0063490 3300046531 Bacteria 1949
572 Ga0495640_0015437 3300046533 Bacteria 5747
573 Ga0495640_0031547 3300046533 Bacteria 3780
574 Ga0495640_0066207 3300046533 Unclassified 2437
575 Ga0495640_0151938 3300046533 Unclassified 1487
576 Ga0495640_0324340 3300046533 Unclassified 953
577 Ga0495586_0003837 3300046535 Bacteria 8055
578 Ga0495586_0099383 3300046535 Bacteria 1614
579 Ga0495586_0286701 3300046535 Unclassified 942
580 Ga0495587_0000701 3300046536 Bacteria 22458
581 Ga0495587_0012557 3300046536 Bacteria 5326
582 Ga0495587_0046379 3300046536 Bacteria 2580
583 Ga0495587_0079111 3300046536 Bacteria 1907
584 Ga0495587_0330773 3300046536 Unclassified 850
585 Ga0495645_0000166 3300046543 Bacteria 45739
586 Ga0495645_0002582 3300046543 Bacteria 12310
587 Ga0495622_0199928 3300046557 Unclassified 891
588 Ga0495667_0011101 3300046559 Bacteria 6092
589 Ga0495667_0026841 3300046559 Bacteria 3880
590 Ga0495667_0103554 3300046559 Bacteria 1841
591 Ga0495667_0158415 3300046559 Bacteria 1456
592 Ga0495667_0179943 3300046559 Bacteria 1357
593 Ga0495667_0193654 3300046559 Bacteria 1302
594 Ga0495667_0244087 3300046559 Unclassified 1143
595 Ga0495656_0046474 3300046615 Bacteria 1837
596 Ga0495656_0077236 3300046615 Bacteria 1494
597 Ga0495634_0020611 3300046642 Bacteria 4672
598 Ga0495634_0103259 3300046642 Bacteria 1840
599 Ga0495634_0135864 3300046642 Bacteria 1564
600 Ga0495635_0011643 3300046663 Bacteria 6164
601 Ga0495635_0032494 3300046663 Bacteria 3620
602 Ga0495635_0046775 3300046663 Bacteria 2984
603 Ga0495635_0206973 3300046663 Bacteria 1329
604 Ga0495659_0042965 3300046664 Bacteria 1620
605 Ga0495659_0063075 3300046664 Bacteria 1373
606 Ga0495661_0267137 3300046665 Bacteria 867
607 Ga0495588_0060823 3300046674 Bacteria 1955
608 Ga0495657_0009262 3300046675 Bacteria 7474
609 Ga0495657_0081830 3300046675 Bacteria 2087
610 Ga0495599_0019880 3300046678 Bacteria 4182
611 Ga0495599_0021570 3300046678 Bacteria 4019
612 Ga0495599_0052165 3300046678 Bacteria 2562
613 Ga0495599_0291073 3300046678 Bacteria 987
614 Ga0495623_0001363 3300046679 Bacteria 16553
615 Ga0495646_0012104 3300046680 Bacteria 5485
616 Ga0495646_0231663 3300046680 Bacteria 995
617 Ga0495647_0008403 3300046681 Bacteria 3470
618 Ga0495647_0013399 3300046681 Bacteria 2840
619 Ga0495647_0096635 3300046681 Bacteria 1218
620 Ga0495647_0155707 3300046681 Bacteria 982
621 Ga0495658_0001737 3300046683 Bacteria 11280
622 Ga0495658_0016443 3300046683 Plasmid 3807
623 Ga0495658_0036939 3300046683 Bacteria 2698
624 Ga0495658_0180523 3300046683 Unclassified 1309
625 Ga0495658_0317198 3300046683 Bacteria 987
626 Ga0495658_0477464 3300046683 Bacteria 797
627 Ga0495613_0055710 3300046689 Bacteria 2904
628 Ga0495613_0066277 3300046689 Bacteria 2637
629 Ga0495613_0074672 3300046689 Bacteria 2469
630 Ga0495613_0089888 3300046689 Bacteria 2225
631 Ga0495613_0569223 3300046689 Bacteria 756
632 Ga0495613_0709702 3300046689 Unclassified 661
633 Ga0495624_0024085 3300046690 Bacteria 4007
634 Ga0495624_0033353 3300046690 Bacteria 3334
635 Ga0495624_0054156 3300046690 Bacteria 2530
636 Ga0495624_0060864 3300046690 Bacteria 2367
637 Ga0495624_0120750 3300046690 Bacteria 1609
638 Ga0495671_0185293 3300046692 Bacteria 1011
639 Ga0495600_0014977 3300046809 Bacteria 4896
640 Ga0495600_0039724 3300046809 Plasmid 3064
641 Ga0495600_0509136 3300046809 Unclassified 739
642 Ga0495604_0002172 3300047317 Bacteria 15754
643 Ga0495604_0053030 3300047317 Bacteria 3137
644 Ga0495604_0095679 3300047317 Bacteria 2193
645 Ga0495604_0117751 3300047317 Unclassified 1926
646 Ga0495604_0126855 3300047317 Bacteria 1839
647 Ga0495604_0299950 3300047317 Unclassified 1079
648 Ga0495674_0006376 3300047319 Bacteria 11310
649 Ga0495674_0085854 3300047319 Bacteria 2695
650 Ga0495674_0086887 3300047319 Bacteria 2677
651 Ga0495674_0180036 3300047319 Bacteria 1760
652 Ga0495674_0195572 3300047319 Unclassified 1679
653 Ga0495674_0477048 3300047319 Bacteria 1000
654 Ga0495676_0039162 3300047321 Bacteria 3929
655 Ga0495676_0188253 3300047321 Bacteria 1441
656 Ga0495680_0016420 3300047322 Bacteria 6359
657 Ga0495680_0062248 3300047322 Plasmid 2869
658 Ga0495680_0247449 3300047322 Unclassified 1264
659 Ga0495680_0257097 3300047322 Unclassified 1236
660 Ga0495675_0000485 3300047444 Bacteria 25814
661 Ga0495675_0038763 3300047444 Bacteria 3034
662 Ga0495684_0023838 3300047471 Plasmid 4705
663 Ga0495684_0041612 3300047471 Bacteria 3521
664 Ga0495684_0124080 3300047471 Bacteria 1943
665 Ga0495684_0234473 3300047471 Unclassified 1341
666 Ga0495684_0337517 3300047471 Unclassified 1073
667 Ga0495593_0027342 3300047673 Bacteria 3141
668 Ga0495593_0043250 3300047673 Bacteria 2414
669 Ga0495593_0090815 3300047673 Bacteria 1573
670 Ga0495593_0208179 3300047673 Bacteria 982
671 Ga0495593_0271638 3300047673 Bacteria 848
672 Ga0495602_0042301 3300048088 Bacteria 4152
673 Ga0495602_0132769 3300048088 Bacteria 1983
674 Ga0495602_0189350 3300048088 Unclassified 1579
675 Ga0495614_0011763 3300048089 Unclassified 3847
676 Ga0495614_0112153 3300048089 Bacteria 1198
677 Ga0496100_0009014 3300048903 Bacteria 5588
678 Ga0496100_0014007 3300048903 Unclassified 4644
679 Ga0496100_0132474 3300048903 Bacteria 1757
680 Ga0496100_0135792 3300048903 Bacteria 1737
681 Ga0496100_0302255 3300048903 Bacteria 1198
682 Ga0496100_0305326 3300048903 Bacteria 1192
683 Ga0496100_0328021 3300048903 Bacteria 1151
684 Ga0496100_0450678 3300048903 Bacteria 986
685 Ga0496100_1121228 3300048903 Bacteria 620
686 Ga0496101_0006290 3300048904 Bacteria 7646
687 Ga0496101_0010596 3300048904 Bacteria 6089
688 Ga0496101_0063235 3300048904 Bacteria 2693
689 Ga0496101_0071333 3300048904 Bacteria 2546
690 Ga0496101_0149083 3300048904 Bacteria 1788
691 Ga0496101_0346278 3300048904 Bacteria 1167
692 Ga0496102_0003862 3300048905 Bacteria 12690
693 Ga0496102_0040023 3300048905 Bacteria 4238
694 Ga0496102_0067474 3300048905 Bacteria 3281
695 Ga0496102_0220350 3300048905 Bacteria 1788
696 Ga0496102_0317253 3300048905 Bacteria 1468
697 Ga0496103_0003140 3300048906 Bacteria 10159
698 Ga0496103_0019470 3300048906 Bacteria 4077
699 Ga0496103_0038956 3300048906 Bacteria 2919
700 Ga0496103_0313922 3300048906 Bacteria 1008
701 Ga0496104_0004241 3300048907 Bacteria 12452
702 Ga0496104_0004499 3300048907 Bacteria 12145
703 Ga0496104_0008656 3300048907 Bacteria 9053
704 Ga0496104_0025001 3300048907 Bacteria 5502
705 Ga0496104_0085508 3300048907 Unclassified 3010
706 Ga0496104_0097622 3300048907 Bacteria 2812
707 Ga0496104_0170432 3300048907 Bacteria 2087
708 Ga0496104_0291156 3300048907 Unclassified 1545
709 Ga0496105_0005805 3300048908 Bacteria 9412
710 Ga0496105_0015465 3300048908 Bacteria 6082
711 Ga0496105_0028022 3300048908 Bacteria 4606
712 Ga0496105_0045480 3300048908 Bacteria 3622
713 Ga0496105_0099222 3300048908 Unclassified 2405
714 Ga0496105_0104617 3300048908 Bacteria 2337
715 Ga0496105_0127661 3300048908 Bacteria 2096
716 Ga0496105_0143866 3300048908 Bacteria 1961
717 Ga0496105_0155492 3300048908 Unclassified 1878
718 Ga0496105_0212767 3300048908 Bacteria 1575
719 Ga0496106_0004037 3300048909 Bacteria 10964
720 Ga0496106_0016268 3300048909 Bacteria 5504
721 Ga0496106_0027103 3300048909 Bacteria 4268
722 Ga0496106_0031959 3300048909 Bacteria 3922
723 Ga0496106_0071005 3300048909 Bacteria 2660
724 Ga0496106_0116033 3300048909 Bacteria 2088
725 Ga0496106_0149352 3300048909 Bacteria 1843
726 Ga0496106_0208523 3300048909 Bacteria 1556
727 Ga0496106_0539947 3300048909 Unclassified 936
728 Ga0496106_0967921 3300048909 Bacteria 670
729 Ga0496107_0019167 3300048910 Bacteria 4826
730 Ga0496107_0029015 3300048910 Bacteria 3934
731 Ga0496107_0065999 3300048910 Bacteria 2623
732 Ga0496107_0092882 3300048910 Bacteria 2206
733 Ga0496107_0128845 3300048910 Bacteria 1867
734 Ga0496108_0000692 3300048911 Bacteria 26098
735 Ga0496108_0019990 3300048911 Bacteria 5502
736 Ga0496108_0035668 3300048911 Bacteria 4135
737 Ga0496108_0093826 3300048911 Bacteria 2554
738 Ga0496108_0319071 3300048911 Unclassified 1355
739 Ga0496108_0610112 3300048911 Bacteria 950
740 Ga0496108_1438320 3300048911 Unclassified 575
741 Ga0496109_0000624 3300048912 Bacteria 29488
742 Ga0496109_0005168 3300048912 Bacteria 10894
743 Ga0496109_0012275 3300048912 Bacteria 7395
744 Ga0496109_0033526 3300048912 Bacteria 4620
745 Ga0496109_0118303 3300048912 Unclassified 2467
746 Ga0496109_0133973 3300048912 Bacteria 2314
747 Ga0496109_0750877 3300048912 Unclassified 913
748 Ga0496110_0001274 3300048913 Bacteria 18027
749 Ga0496110_0010628 3300048913 Bacteria 7494
750 Ga0496110_0017893 3300048913 Bacteria 5933
751 Ga0496110_0026013 3300048913 Bacteria 5004
752 Ga0496110_0029618 3300048913 Bacteria 4714
753 Ga0496110_0173689 3300048913 Bacteria 1955
754 Ga0496110_0209950 3300048913 Unclassified 1770
755 Ga0496111_0000696 3300048914 Bacteria 17753
756 Ga0496111_0013239 3300048914 Bacteria 5607
757 Ga0496111_0028621 3300048914 Bacteria 3950
758 Ga0496111_0093684 3300048914 Bacteria 2202
759 Ga0496111_0700804 3300048914 Bacteria 736
760 Ga0496112_0000601 3300048915 Bacteria 24800
761 Ga0496112_0006054 3300048915 Bacteria 10565
762 Ga0496112_0114946 3300048915 Bacteria 2661
763 Ga0496112_0139822 3300048915 Unclassified 2391
764 Ga0496112_0178662 3300048915 Bacteria 2086
765 Ga0496112_0257387 3300048915 Bacteria 1695
766 Ga0496112_0324476 3300048915 Bacteria 1484
767 Ga0496112_0578973 3300048915 Unclassified 1055
768 Ga0496113_0003449 3300048916 Bacteria 9465
769 Ga0496113_0017621 3300048916 Bacteria 4963
770 Ga0496113_0065771 3300048916 Bacteria 2745
771 Ga0496113_0137222 3300048916 Unclassified 1922
772 Ga0496113_0295804 3300048916 Unclassified 1296
773 Ga0496114_0005349 3300048917 Bacteria 10034
774 Ga0496114_0065534 3300048917 Bacteria 3043
775 Ga0496114_0076662 3300048917 Bacteria 2817
776 Ga0496114_0126187 3300048917 Bacteria 2206
777 Ga0496114_0449878 3300048917 Bacteria 1141
778 Ga0496114_0700168 3300048917 Bacteria 888
779 Ga0496114_1015401 3300048917 Bacteria 713
780 Ga0496115_0013680 3300048918 Bacteria 6144
781 Ga0496115_0178028 3300048918 Bacteria 1758
782 Ga0496115_0190974 3300048918 Bacteria 1692
783 Ga0496115_0242957 3300048918 Bacteria 1484
784 Ga0496115_0293772 3300048918 Bacteria 1332
785 Ga0496115_0315304 3300048918 Unclassified 1280
786 Ga0496115_0438064 3300048918 Bacteria 1057
787 Ga0496115_0545337 3300048918 Unclassified 927
788 Ga0501040_0316676 3300049576 Bacteria 1116
789 nmdc:mga03683_97057_c1 3300050489 Bacteria 1291
790 nmdc:mga03n38_434049_c1 3300050490 Unclassified 728
791 nmdc:mga00v17_271058_c1 3300050491 Bacteria 1101
792 nmdc:mga0yw44_1439_c2 3300050492 Bacteria 8322
793 nmdc:mga0yw44_3517_c1 3300050492 Bacteria 6976
794 nmdc:mga0yw44_446405_c1 3300050492 Unclassified 876
795 nmdc:mga0yw44_54640_c1 3300050492 Bacteria 2428
796 nmdc:mga06z11_126406_c1 3300050494 Bacteria 1431
797 nmdc:mga05p37_11335_c1 3300050507 Bacteria 10605
798 nmdc:mga05p37_119370_c1 3300050507 Bacteria 3240
799 nmdc:mga05p37_26391_c1 3300050507 Bacteria 7064
800 nmdc:mga05p37_272693_c1 3300050507 Bacteria 2021
801 nmdc:mga05p37_291971_c1 3300050507 Bacteria 1940
802 nmdc:mga05p37_64107_c1 3300050507 Bacteria 4522
803 nmdc:mga09592_40107_c1 3300050508 Bacteria 3934
804 nmdc:mga0qj67_4_c1 3300050509 Bacteria 176711
805 nmdc:mga06r32_105758_c1 3300050510 Bacteria 2765
806 nmdc:mga06r32_183936_c1 3300050510 Bacteria 2076
807 nmdc:mga06r32_67523_c1 3300050510 Bacteria 3452
808 nmdc:mga06r32_89123_c1 3300050510 Bacteria 3012
809 nmdc:mga08y16_1435524_c1 3300050511 Bacteria 652
810 nmdc:mga08y16_144754_c1 3300050511 Bacteria 2470
811 nmdc:mga0n895_298942_c1 3300050512 Bacteria 1632
812 nmdc:mga0n895_549058_c1 3300050512 Unclassified 1161
813 nmdc:mga0n895_87260_c1 3300050512 Bacteria 3117
814 nmdc:mga0rr50_120985_c1 3300050513 Unclassified 2084
815 nmdc:mga0rr50_502155_c1 3300050513 Bacteria 1031
816 nmdc:mga0rr50_539319_c1 3300050513 Bacteria 993
817 nmdc:mga08x19_529604_c1 3300050514 Bacteria 833
818 nmdc:mga0a205_286808_c1 3300050515 Bacteria 1521
819 nmdc:mga0a205_35703_c1 3300050515 Bacteria 4774
820 Ga0495601_0004131 3300053077 Bacteria 8365
821 Ga0495601_0004957 3300053077 Bacteria 7724
822 Ga0495601_0008342 3300053077 Bacteria 6119
823 Ga0495601_0017589 3300053077 Bacteria 4342
824 Ga0495601_0026436 3300053077 Bacteria 3584
825 Ga0495601_0109883 3300053077 Bacteria 1785
826 Ga0495601_0339750 3300053077 Bacteria 977
827 Ga0495601_0464485 3300053077 Bacteria 818
828 Ga0495612_0004798 3300053078 Bacteria 5597
829 Ga0495612_0005266 3300053078 Bacteria 5343
830 Ga0495612_0021164 3300053078 Bacteria 2609
831 Ga0495655_0082980 3300053083 Bacteria 920
832 Ga0495595_0005513 3300053084 Bacteria 5125
833 Ga0495595_0007484 3300053084 Bacteria 4473
834 Ga0495595_0010073 3300053084 Bacteria 3923
835 Ga0495595_0142049 3300053084 Bacteria 1178
836 Ga0495619_0000149 3300053085 Bacteria 51751
837 Ga0495619_0001954 3300053085 Bacteria 13749
838 Ga0495619_0007106 3300053085 Bacteria 7087
839 Ga0495619_0007508 3300053085 Bacteria 6905
840 Ga0495619_0058657 3300053085 Bacteria 2555
841 Ga0495619_0289850 3300053085 Bacteria 1134
842 Ga0495619_0406400 3300053085 Bacteria 940
843 Ga0495619_0540158 3300053085 Unclassified 800
844 Ga0500643_005326 3300053087 Bacteria 5563
845 Ga0500644_0001263 3300053088 Bacteria 6906
846 Ga0500651_0036588 3300053093 Bacteria 3093
847 Ga0500566_0294925 3300053094 Unclassified 766
848 Ga0500595_000016 3300053119 Bacteria 211397
849 Ga0500595_013460 3300053119 Bacteria 3132
850 Ga0500652_006592 3300053131 Bacteria 3749
851 Ga0500616_0000006 3300053153 Bacteria 944738
852 Ga0500616_0176801 3300053153 Unclassified 964
853 Ga0500637_0071204 3300053178 Bacteria 2000
854 Ga0500645_000033 3300053730 Bacteria 119279
855 Ga0501082_0807635 3300060353 Bacteria 821

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0135815 Ga0373934_0135815_37_525 162
2 3300035118 Ga0373954_0222009 Ga0373954_0222009_172_669 165
3 3300035120 Ga0373957_0105937 Ga0373957_0105937_142_639 165
4 3300035410 Ga0373924_0254874 Ga0373924_0254874_186_683 165
5 3300035724 Ga0373933_0230141 Ga0373933_0230141_217_714 165
6 3300046514 Ga0495618_0123351 Ga0495618_0123351_22_519 165
7 3300046559 Ga0495667_0158415 Ga0495667_0158415_304_801 165
8 3300039450 Ga0436363_0094947 Ga0436363_0094947_127_645 172
9 3300025918 Ga0207662_10159341 Ga0207662_101593412 177
10 3300035118 Ga0373954_0000582 Ga0373954_0000582_11148_11681 177
11 3300046523 Ga0495644_0370438 Ga0495644_0370438_10_543 177
12 3300048911 Ga0496108_1438320 Ga0496108_1438320_23_556 177
13 3300046516 Ga0495628_0033958 Ga0495628_0033958_3549_4085 178
14 3300037853 Ga0436364_0855834 Ga0436364_0855834_215_781 179
15 3300005536 Ga0070697_100003357 Ga0070697_1000033571 184
16 3300007265 Ga0099794_10031603 Ga0099794_100316032 184
17 3300007788 Ga0099795_10001014 Ga0099795_100010144 184
18 3300027512 Ga0209179_1004415 Ga0209179_10044153 184
19 3300005439 Ga0070711_100071681 Ga0070711_1000716812 185
20 3300006175 Ga0070712_100007738 Ga0070712_1000077382 185
21 3300025915 Ga0207693_10010575 Ga0207693_100105753 185
22 3300025916 Ga0207663_10055738 Ga0207663_100557382 185
23 3300031238 Ga0265332_10003584 Ga0265332_100035843 185
24 3300031239 Ga0265328_10218071 Ga0265328_102180712 185
25 3300031242 Ga0265329_10166233 Ga0265329_101662332 185
26 3300031247 Ga0265340_10000757 Ga0265340_100007578 185
27 3300031249 Ga0265339_10001098 Ga0265339_100010987 185
28 3300031712 Ga0265342_10000092 Ga0265342_1000009230 185
29 3300039447 Ga0436361_0924848 Ga0436361_0924848_75_632 185
30 3300005331 Ga0070670_100046488 Ga0070670_1000464883 186
31 3300005338 Ga0068868_100019798 Ga0068868_1000197985 186
32 3300005338 Ga0068868_100725929 Ga0068868_1007259292 186
33 3300005339 Ga0070660_100716073 Ga0070660_1007160732 186
34 3300005340 Ga0070689_100703468 Ga0070689_1007034682 186
35 3300005344 Ga0070661_100766765 Ga0070661_1007667652 186
36 3300005344 Ga0070661_100964028 Ga0070661_1009640281 186
37 3300005345 Ga0070692_10052338 Ga0070692_100523382 186
38 3300005347 Ga0070668_100873432 Ga0070668_1008734321 186
39 3300005353 Ga0070669_100254905 Ga0070669_1002549051 186
40 3300005353 Ga0070669_100569986 Ga0070669_1005699862 186
41 3300005355 Ga0070671_100114803 Ga0070671_1001148032 186
42 3300005356 Ga0070674_100249883 Ga0070674_1002498832 186
43 3300005434 Ga0070709_10249432 Ga0070709_102494322 186
44 3300005435 Ga0070714_100555765 Ga0070714_1005557651 186
45 3300005436 Ga0070713_100195432 Ga0070713_1001954321 186
46 3300005439 Ga0070711_100075515 Ga0070711_1000755153 186
47 3300005439 Ga0070711_100643802 Ga0070711_1006438021 186
48 3300005441 Ga0070700_100145393 Ga0070700_1001453932 186
49 3300005455 Ga0070663_100131674 Ga0070663_1001316741 186
50 3300005458 Ga0070681_10207284 Ga0070681_102072841 186
51 3300005459 Ga0068867_100142961 Ga0068867_1001429611 186
52 3300005466 Ga0070685_10306691 Ga0070685_103066911 186
53 3300005543 Ga0070672_100217215 Ga0070672_1002172151 186
54 3300005547 Ga0070693_100630332 Ga0070693_1006303321 186
55 3300005548 Ga0070665_100257971 Ga0070665_1002579712 186
56 3300005549 Ga0070704_100279334 Ga0070704_1002793341 186
57 3300005577 Ga0068857_100220077 Ga0068857_1002200772 186
58 3300005615 Ga0070702_100053473 Ga0070702_1000534732 186
59 3300005615 Ga0070702_100172200 Ga0070702_1001722002 186
60 3300005617 Ga0068859_100031624 Ga0068859_1000316242 186
61 3300005618 Ga0068864_100136555 Ga0068864_1001365552 186
62 3300005718 Ga0068866_10005758 Ga0068866_100057583 186
63 3300005718 Ga0068866_10354438 Ga0068866_103544382 186
64 3300005718 Ga0068866_10571138 Ga0068866_105711381 186
65 3300005719 Ga0068861_100254363 Ga0068861_1002543631 186
66 3300005840 Ga0068870_10020749 Ga0068870_100207493 186
67 3300005841 Ga0068863_100231265 Ga0068863_1002312652 186
68 3300005841 Ga0068863_100319960 Ga0068863_1003199602 186
69 3300005842 Ga0068858_100178310 Ga0068858_1001783101 186
70 3300005843 Ga0068860_100077192 Ga0068860_1000771923 186
71 3300005843 Ga0068860_100324302 Ga0068860_1003243022 186
72 3300005844 Ga0068862_101310603 Ga0068862_1013106031 186
73 3300005983 Ga0081540_1001030 Ga0081540_100103015 186
74 3300006028 Ga0070717_11158431 Ga0070717_111584311 186
75 3300006038 Ga0075365_10043223 Ga0075365_100432232 186
76 3300006177 Ga0075362_10078152 Ga0075362_100781522 186
77 3300006178 Ga0075367_10196243 Ga0075367_101962432 186
78 3300006237 Ga0097621_100444288 Ga0097621_1004442881 186
79 3300006844 Ga0075428_100021266 Ga0075428_1000212666 186
80 3300006846 Ga0075430_100040521 Ga0075430_1000405213 186
81 3300006852 Ga0075433_10041187 Ga0075433_100411873 186
82 3300006871 Ga0075434_100280879 Ga0075434_1002808792 186
83 3300006871 Ga0075434_100396164 Ga0075434_1003961642 186
84 3300006880 Ga0075429_100242670 Ga0075429_1002426702 186
85 3300006881 Ga0068865_100179016 Ga0068865_1001790162 186
86 3300006914 Ga0075436_100033605 Ga0075436_1000336052 186
87 3300006931 Ga0097620_100031624 Ga0097620_1000316245 186
88 3300007076 Ga0075435_100499013 Ga0075435_1004990132 186
89 3300009011 Ga0105251_10086785 Ga0105251_100867852 186
90 3300009092 Ga0105250_10089889 Ga0105250_100898892 186
91 3300009094 Ga0111539_10057982 Ga0111539_100579822 186
92 3300009094 Ga0111539_10486097 Ga0111539_104860972 186
93 3300009098 Ga0105245_10346909 Ga0105245_103469091 186
94 3300009101 Ga0105247_10061346 Ga0105247_100613462 186
95 3300009147 Ga0114129_10035252 Ga0114129_100352525 186
96 3300009176 Ga0105242_10120223 Ga0105242_101202232 186
97 3300009176 Ga0105242_10403603 Ga0105242_104036033 186
98 3300009177 Ga0105248_10004776 Ga0105248_1000477615 186
99 3300009177 Ga0105248_10268358 Ga0105248_102683582 186
100 3300010375 Ga0105239_11394527 Ga0105239_113945271 186
101 3300013296 Ga0157374_10065165 Ga0157374_100651652 186
102 3300013297 Ga0157378_11316623 Ga0157378_113166232 186
103 3300013306 Ga0163162_10418364 Ga0163162_104183642 186
104 3300013306 Ga0163162_10452082 Ga0163162_104520822 186
105 3300014325 Ga0163163_10012789 Ga0163163_100127892 186
106 3300014969 Ga0157376_10144459 Ga0157376_101444592 186
107 3300024225 Ga0224572_1006794 Ga0224572_10067942 186
108 3300025899 Ga0207642_10042651 Ga0207642_100426512 186
109 3300025901 Ga0207688_10637509 Ga0207688_106375091 186
110 3300025904 Ga0207647_10272587 Ga0207647_102725872 186
111 3300025905 Ga0207685_10009105 Ga0207685_100091052 186
112 3300025906 Ga0207699_10208258 Ga0207699_102082582 186
113 3300025906 Ga0207699_10935188 Ga0207699_109351881 186
114 3300025907 Ga0207645_10019349 Ga0207645_100193491 186
115 3300025927 Ga0207687_10592098 Ga0207687_105920982 186
116 3300025933 Ga0207706_10084917 Ga0207706_100849173 186
117 3300025934 Ga0207686_10110954 Ga0207686_101109542 186
118 3300025934 Ga0207686_10151105 Ga0207686_101511052 186
119 3300025935 Ga0207709_10964180 Ga0207709_109641802 186
120 3300025936 Ga0207670_10203842 Ga0207670_102038421 186
121 3300025937 Ga0207669_11053424 Ga0207669_110534241 186
122 3300025939 Ga0207665_10356586 Ga0207665_103565862 186
123 3300025940 Ga0207691_10015870 Ga0207691_100158702 186
124 3300025941 Ga0207711_10022249 Ga0207711_100222494 186
125 3300025941 Ga0207711_11066813 Ga0207711_110668131 186
126 3300025942 Ga0207689_10022880 Ga0207689_100228803 186
127 3300025945 Ga0207679_11168754 Ga0207679_111687542 186
128 3300025960 Ga0207651_10127635 Ga0207651_101276353 186
129 3300025981 Ga0207640_10478614 Ga0207640_104786142 186
130 3300025986 Ga0207658_10086337 Ga0207658_100863372 186
131 3300026023 Ga0207677_10615656 Ga0207677_106156561 186
132 3300026035 Ga0207703_10446307 Ga0207703_104463071 186
133 3300026035 Ga0207703_10664502 Ga0207703_106645021 186
134 3300026067 Ga0207678_10011265 Ga0207678_100112656 186
135 3300026075 Ga0207708_10051435 Ga0207708_100514353 186
136 3300026088 Ga0207641_10405488 Ga0207641_104054882 186
137 3300026118 Ga0207675_100006797 Ga0207675_10000679713 186
138 3300026121 Ga0207683_10005533 Ga0207683_100055334 186
139 3300026121 Ga0207683_11089095 Ga0207683_110890951 186
140 3300028379 Ga0268266_10284203 Ga0268266_102842032 186
141 3300028381 Ga0268264_10185841 Ga0268264_101858411 186
142 3300028381 Ga0268264_10284093 Ga0268264_102840932 186
143 3300028800 Ga0265338_10083691 Ga0265338_100836912 186
144 3300031018 Ga0265773_1006684 Ga0265773_10066842 186
145 3300031090 Ga0265760_10089398 Ga0265760_100893982 186
146 3300031241 Ga0265325_10050885 Ga0265325_100508851 186
147 3300031249 Ga0265339_10000077 Ga0265339_1000007768 186
148 3300031595 Ga0265313_10001170 Ga0265313_1000117021 186
149 3300033179 Ga0307507_10106153 Ga0307507_101061532 186
150 3300033179 Ga0307507_10385298 Ga0307507_103852981 186
151 3300035084 Ga0373928_0009042 Ga0373928_0009042_1135_1695 186
152 3300035085 Ga0373929_0006323 Ga0373929_0006323_712_1308 186
153 3300035086 Ga0373934_0087177 Ga0373934_0087177_129_689 186
154 3300035089 Ga0373944_0299189 Ga0373944_0299189_27_587 186
155 3300035092 Ga0373952_0007885 Ga0373952_0007885_26_586 186
156 3300035092 Ga0373952_0009694 Ga0373952_0009694_136_732 186
157 3300035111 Ga0373923_0002741 Ga0373923_0002741_214_774 186
158 3300035113 Ga0373936_0135689 Ga0373936_0135689_354_914 186
159 3300035115 Ga0373941_0095849 Ga0373941_0095849_370_930 186
160 3300035116 Ga0373945_0007853 Ga0373945_0007853_2775_3362 186
161 3300035116 Ga0373945_0140116 Ga0373945_0140116_317_877 186
162 3300035117 Ga0373953_0041124 Ga0373953_0041124_656_1216 186
163 3300035118 Ga0373954_0007523 Ga0373954_0007523_133_693 186
164 3300035118 Ga0373954_0218434 Ga0373954_0218434_278_838 186
165 3300035119 Ga0373956_0004515 Ga0373956_0004515_708_1268 186
166 3300035120 Ga0373957_0047996 Ga0373957_0047996_701_1261 186
167 3300035170 Ga0373943_0101334 Ga0373943_0101334_552_1139 186
168 3300035170 Ga0373943_0321044 Ga0373943_0321044_43_603 186
169 3300035171 Ga0373946_0160036 Ga0373946_0160036_198_758 186
170 3300035171 Ga0373946_0191745 Ga0373946_0191745_62_658 186
171 3300035172 Ga0373955_0066670 Ga0373955_0066670_262_822 186
172 3300035172 Ga0373955_0346178 Ga0373955_0346178_206_766 186
173 3300035207 Ga0373942_0041529 Ga0373942_0041529_474_1034 186
174 3300035241 Ga0373961_0072089 Ga0373961_0072089_30_590 186
175 3300035410 Ga0373924_0002954 Ga0373924_0002954_3928_4488 186
176 3300035691 Ga0373931_0003361 Ga0373931_0003361_2994_3554 186
177 3300035691 Ga0373931_0004763 Ga0373931_0004763_1592_2188 186
178 3300035692 Ga0373935_0021389 Ga0373935_0021389_711_1271 186
179 3300035692 Ga0373935_0180597 Ga0373935_0180597_512_1111 186
180 3300035695 Ga0373927_0021247 Ga0373927_0021247_3656_4216 186
181 3300035695 Ga0373927_0234731 Ga0373927_0234731_302_862 186
182 3300035724 Ga0373933_0046663 Ga0373933_0046663_1778_2338 186
183 3300035725 Ga0373947_0044707 Ga0373947_0044707_672_1232 186
184 3300036401 Ga0373937_0679630 Ga0373937_0679630_262_822 186
185 3300036401 Ga0373937_0823228 Ga0373937_0823228_55_615 186
186 3300037068 Ga0373925_0015033 Ga0373925_0015033_1158_1718 186
187 3300037068 Ga0373925_0156408 Ga0373925_0156408_549_1136 186
188 3300037068 Ga0373925_0248228 Ga0373925_0248228_710_1270 186
189 3300037068 Ga0373925_0405734 Ga0373925_0405734_24_584 186
190 3300039447 Ga0436361_0095794 Ga0436361_0095794_154_714 186
191 3300045976 Ga0466967_1056169 Ga0466967_1056169_146_706 186
192 3300046454 Ga0495592_0008473 Ga0495592_0008473_1024_1584 186
193 3300046454 Ga0495592_0088050 Ga0495592_0088050_1380_1940 186
194 3300046455 Ga0495603_0191434 Ga0495603_0191434_285_845 186
195 3300046455 Ga0495603_0199770 Ga0495603_0199770_135_722 186
196 3300046461 Ga0495641_0011540 Ga0495641_0011540_4375_4935 186
197 3300046461 Ga0495641_0049119 Ga0495641_0049119_958_1518 186
198 3300046462 Ga0495651_0487605 Ga0495651_0487605_71_631 186
199 3300046463 Ga0495653_0303915 Ga0495653_0303915_355_915 186
200 3300046472 Ga0495580_0073254 Ga0495580_0073254_1721_2281 186
201 3300046472 Ga0495580_0081932 Ga0495580_0081932_563_1150 186
202 3300046472 Ga0495580_0530027 Ga0495580_0530027_51_611 186
203 3300046474 Ga0495605_0149375 Ga0495605_0149375_10_570 186
204 3300046475 Ga0495639_0292109 Ga0495639_0292109_149_709 186
205 3300046476 Ga0495662_0023840 Ga0495662_0023840_1940_2500 186
206 3300046477 Ga0495664_0189536 Ga0495664_0189536_154_714 186
207 3300046477 Ga0495664_0219559 Ga0495664_0219559_478_1038 186
208 3300046477 Ga0495664_0317050 Ga0495664_0317050_241_801 186
209 3300046477 Ga0495664_0480163 Ga0495664_0480163_129_689 186
210 3300046491 Ga0495584_0163952 Ga0495584_0163952_121_681 186
211 3300046491 Ga0495584_0446595 Ga0495584_0446595_51_611 186
212 3300046492 Ga0495585_0171153 Ga0495585_0171153_461_1021 186
213 3300046499 Ga0495594_0015676 Ga0495594_0015676_560_1120 186
214 3300046499 Ga0495594_0076130 Ga0495594_0076130_754_1341 186
215 3300046499 Ga0495594_0256296 Ga0495594_0256296_375_935 186
216 3300046501 Ga0495607_0040819 Ga0495607_0040819_1242_1802 186
217 3300046511 Ga0495608_0019463 Ga0495608_0019463_2314_2874 186
218 3300046513 Ga0495616_0137536 Ga0495616_0137536_338_898 186
219 3300046514 Ga0495618_0436267 Ga0495618_0436267_55_615 186
220 3300046514 Ga0495618_0598020 Ga0495618_0598020_33_593 186
221 3300046516 Ga0495628_0004724 Ga0495628_0004724_753_1313 186
222 3300046516 Ga0495628_0019722 Ga0495628_0019722_4002_4562 186
223 3300046516 Ga0495628_0160779 Ga0495628_0160779_546_1106 186
224 3300046517 Ga0495630_0016483 Ga0495630_0016483_3365_3925 186
225 3300046517 Ga0495630_0385510 Ga0495630_0385510_262_822 186
226 3300046529 Ga0495652_0028740 Ga0495652_0028740_4028_4588 186
227 3300046529 Ga0495652_0046364 Ga0495652_0046364_285_845 186
228 3300046529 Ga0495652_0236075 Ga0495652_0236075_654_1214 186
229 3300046531 Ga0495665_0037035 Ga0495665_0037035_738_1298 186
230 3300046533 Ga0495640_0031547 Ga0495640_0031547_355_915 186
231 3300046533 Ga0495640_0324340 Ga0495640_0324340_171_731 186
232 3300046535 Ga0495586_0099383 Ga0495586_0099383_697_1257 186
233 3300046535 Ga0495586_0286701 Ga0495586_0286701_30_590 186
234 3300046536 Ga0495587_0012557 Ga0495587_0012557_423_983 186
235 3300046536 Ga0495587_0079111 Ga0495587_0079111_768_1328 186
236 3300046536 Ga0495587_0330773 Ga0495587_0330773_107_667 186
237 3300046543 Ga0495645_0000166 Ga0495645_0000166_18411_18971 186
238 3300046557 Ga0495622_0199928 Ga0495622_0199928_156_716 186
239 3300046559 Ga0495667_0193654 Ga0495667_0193654_101_664 186
240 3300046559 Ga0495667_0244087 Ga0495667_0244087_304_864 186
241 3300046642 Ga0495634_0135864 Ga0495634_0135864_355_915 186
242 3300046663 Ga0495635_0032494 Ga0495635_0032494_900_1460 186
243 3300046665 Ga0495661_0267137 Ga0495661_0267137_249_809 186
244 3300046674 Ga0495588_0060823 Ga0495588_0060823_506_1093 186
245 3300046675 Ga0495657_0081830 Ga0495657_0081830_657_1217 186
246 3300046678 Ga0495599_0019880 Ga0495599_0019880_1565_2125 186
247 3300046678 Ga0495599_0052165 Ga0495599_0052165_1889_2449 186
248 3300046681 Ga0495647_0013399 Ga0495647_0013399_261_821 186
249 3300046683 Ga0495658_0180523 Ga0495658_0180523_284_844 186
250 3300046683 Ga0495658_0317198 Ga0495658_0317198_365_925 186
251 3300046689 Ga0495613_0089888 Ga0495613_0089888_1080_1640 186
252 3300046689 Ga0495613_0709702 Ga0495613_0709702_20_580 186
253 3300046690 Ga0495624_0033353 Ga0495624_0033353_1251_1838 186
254 3300046690 Ga0495624_0054156 Ga0495624_0054156_1164_1724 186
255 3300046692 Ga0495671_0185293 Ga0495671_0185293_206_766 186
256 3300046809 Ga0495600_0509136 Ga0495600_0509136_133_693 186
257 3300047317 Ga0495604_0117751 Ga0495604_0117751_1038_1598 186
258 3300047317 Ga0495604_0299950 Ga0495604_0299950_449_1009 186
259 3300047319 Ga0495674_0006376 Ga0495674_0006376_5784_6344 186
260 3300047321 Ga0495676_0188253 Ga0495676_0188253_830_1390 186
261 3300047322 Ga0495680_0247449 Ga0495680_0247449_55_615 186
262 3300047444 Ga0495675_0038763 Ga0495675_0038763_2392_2952 186
263 3300047471 Ga0495684_0041612 Ga0495684_0041612_2339_2899 186
264 3300047471 Ga0495684_0337517 Ga0495684_0337517_385_945 186
265 3300047673 Ga0495593_0090815 Ga0495593_0090815_981_1541 186
266 3300048088 Ga0495602_0132769 Ga0495602_0132769_458_1018 186
267 3300048903 Ga0496100_0135792 Ga0496100_0135792_755_1351 186
268 3300048903 Ga0496100_0305326 Ga0496100_0305326_540_1112 186
269 3300048903 Ga0496100_0450678 Ga0496100_0450678_176_736 186
270 3300048904 Ga0496101_0010596 Ga0496101_0010596_26_586 186
271 3300048904 Ga0496101_0071333 Ga0496101_0071333_570_1166 186
272 3300048905 Ga0496102_0220350 Ga0496102_0220350_177_737 186
273 3300048906 Ga0496103_0019470 Ga0496103_0019470_81_641 186
274 3300048907 Ga0496104_0025001 Ga0496104_0025001_4212_4808 186
275 3300048908 Ga0496105_0005805 Ga0496105_0005805_152_712 186
276 3300048908 Ga0496105_0045480 Ga0496105_0045480_1419_1979 186
277 3300048908 Ga0496105_0155492 Ga0496105_0155492_861_1421 186
278 3300048908 Ga0496105_0212767 Ga0496105_0212767_884_1480 186
279 3300048909 Ga0496106_0027103 Ga0496106_0027103_177_737 186
280 3300048909 Ga0496106_0116033 Ga0496106_0116033_432_992 186
281 3300048909 Ga0496106_0539947 Ga0496106_0539947_227_787 186
282 3300048910 Ga0496107_0029015 Ga0496107_0029015_422_1018 186
283 3300048910 Ga0496107_0128845 Ga0496107_0128845_103_663 186
284 3300048911 Ga0496108_0019990 Ga0496108_0019990_503_1099 186
285 3300048912 Ga0496109_0012275 Ga0496109_0012275_103_663 186
286 3300048912 Ga0496109_0133973 Ga0496109_0133973_451_1047 186
287 3300048913 Ga0496110_0026013 Ga0496110_0026013_436_1032 186
288 3300048913 Ga0496110_0173689 Ga0496110_0173689_66_626 186
289 3300048913 Ga0496110_0209950 Ga0496110_0209950_68_628 186
290 3300048914 Ga0496111_0093684 Ga0496111_0093684_1114_1710 186
291 3300048915 Ga0496112_0257387 Ga0496112_0257387_76_636 186
292 3300048916 Ga0496113_0065771 Ga0496113_0065771_204_800 186
293 3300048917 Ga0496114_0005349 Ga0496114_0005349_9152_9712 186
294 3300048917 Ga0496114_0065534 Ga0496114_0065534_422_1018 186
295 3300048918 Ga0496115_0178028 Ga0496115_0178028_757_1317 186
296 3300048918 Ga0496115_0190974 Ga0496115_0190974_464_1117 186
297 3300048918 Ga0496115_0438064 Ga0496115_0438064_198_758 186
298 3300049576 Ga0501040_0316676 Ga0501040_0316676_335_922 186
299 3300050489 nmdc:mga03683_97057_c1 nmdc:mga03683_97057_c1_514_1074 186
300 3300050490 nmdc:mga03n38_434049_c1 nmdc:mga03n38_434049_c1_84_644 186
301 3300050491 nmdc:mga00v17_271058_c1 nmdc:mga00v17_271058_c1_511_1071 186
302 3300050492 nmdc:mga0yw44_446405_c1 nmdc:mga0yw44_446405_c1_199_759 186
303 3300050492 nmdc:mga0yw44_54640_c1 nmdc:mga0yw44_54640_c1_1743_2303 186
304 3300050494 nmdc:mga06z11_126406_c1 nmdc:mga06z11_126406_c1_426_986 186
305 3300050507 nmdc:mga05p37_26391_c1 nmdc:mga05p37_26391_c1_4246_4806 186
306 3300050509 nmdc:mga0qj67_4_c1 nmdc:mga0qj67_4_c1_53224_53784 186
307 3300050511 nmdc:mga08y16_144754_c1 nmdc:mga08y16_144754_c1_735_1295 186
308 3300050512 nmdc:mga0n895_549058_c1 nmdc:mga0n895_549058_c1_389_985 186
309 3300050512 nmdc:mga0n895_87260_c1 nmdc:mga0n895_87260_c1_1866_2426 186
310 3300050513 nmdc:mga0rr50_502155_c1 nmdc:mga0rr50_502155_c1_136_696 186
311 3300053077 Ga0495601_0008342 Ga0495601_0008342_1009_1569 186
312 3300053077 Ga0495601_0026436 Ga0495601_0026436_1664_2224 186
313 3300053077 Ga0495601_0109883 Ga0495601_0109883_1139_1699 186
314 3300053077 Ga0495601_0339750 Ga0495601_0339750_168_728 186
315 3300053083 Ga0495655_0082980 Ga0495655_0082980_123_710 186
316 3300053084 Ga0495595_0005513 Ga0495595_0005513_4101_4661 186
317 3300053085 Ga0495619_0406400 Ga0495619_0406400_309_869 186
318 3300053085 Ga0495619_0540158 Ga0495619_0540158_134_694 186
319 3300053178 Ga0500637_0071204 Ga0500637_0071204_136_768 186
320 3300005328 Ga0070676_10705429 Ga0070676_107054291 187
321 3300005331 Ga0070670_100020187 Ga0070670_1000201872 187
322 3300005335 Ga0070666_10462467 Ga0070666_104624672 187
323 3300005335 Ga0070666_10792587 Ga0070666_107925871 187
324 3300005337 Ga0070682_100033603 Ga0070682_1000336032 187
325 3300005339 Ga0070660_100321379 Ga0070660_1003213791 187
326 3300005340 Ga0070689_101141972 Ga0070689_1011419721 187
327 3300005347 Ga0070668_100134085 Ga0070668_1001340852 187
328 3300005354 Ga0070675_100439931 Ga0070675_1004399312 187
329 3300005354 Ga0070675_100675562 Ga0070675_1006755621 187
330 3300005355 Ga0070671_100509088 Ga0070671_1005090882 187
331 3300005356 Ga0070674_100059554 Ga0070674_1000595542 187
332 3300005364 Ga0070673_100812572 Ga0070673_1008125721 187
333 3300005364 Ga0070673_100908507 Ga0070673_1009085071 187
334 3300005364 Ga0070673_101462324 Ga0070673_1014623241 187
335 3300005367 Ga0070667_100287209 Ga0070667_1002872092 187
336 3300005367 Ga0070667_100420876 Ga0070667_1004208762 187
337 3300005434 Ga0070709_10089244 Ga0070709_100892442 187
338 3300005434 Ga0070709_10089991 Ga0070709_100899912 187
339 3300005434 Ga0070709_10234526 Ga0070709_102345262 187
340 3300005435 Ga0070714_100326704 Ga0070714_1003267042 187
341 3300005435 Ga0070714_100373999 Ga0070714_1003739992 187
342 3300005436 Ga0070713_100004064 Ga0070713_1000040644 187
343 3300005436 Ga0070713_100305932 Ga0070713_1003059321 187
344 3300005436 Ga0070713_100332559 Ga0070713_1003325592 187
345 3300005436 Ga0070713_100742548 Ga0070713_1007425481 187
346 3300005437 Ga0070710_10120056 Ga0070710_101200562 187
347 3300005437 Ga0070710_10200926 Ga0070710_102009262 187
348 3300005439 Ga0070711_100017996 Ga0070711_1000179962 187
349 3300005439 Ga0070711_100048110 Ga0070711_1000481102 187
350 3300005439 Ga0070711_100175835 Ga0070711_1001758352 187
351 3300005444 Ga0070694_100169977 Ga0070694_1001699772 187
352 3300005445 Ga0070708_100363369 Ga0070708_1003633692 187
353 3300005455 Ga0070663_100137635 Ga0070663_1001376352 187
354 3300005455 Ga0070663_100144408 Ga0070663_1001444081 187
355 3300005456 Ga0070678_100010560 Ga0070678_1000105601 187
356 3300005456 Ga0070678_100119432 Ga0070678_1001194321 187
357 3300005457 Ga0070662_100341685 Ga0070662_1003416852 187
358 3300005458 Ga0070681_10039956 Ga0070681_100399563 187
359 3300005466 Ga0070685_10019770 Ga0070685_100197702 187
360 3300005468 Ga0070707_100200256 Ga0070707_1002002562 187
361 3300005468 Ga0070707_100299047 Ga0070707_1002990472 187
362 3300005471 Ga0070698_100356072 Ga0070698_1003560722 187
363 3300005518 Ga0070699_100010939 Ga0070699_1000109394 187
364 3300005518 Ga0070699_100048006 Ga0070699_1000480062 187
365 3300005518 Ga0070699_100296518 Ga0070699_1002965181 187
366 3300005530 Ga0070679_100612914 Ga0070679_1006129142 187
367 3300005535 Ga0070684_100268760 Ga0070684_1002687602 187
368 3300005536 Ga0070697_100644915 Ga0070697_1006449152 187
369 3300005536 Ga0070697_100733443 Ga0070697_1007334432 187
370 3300005544 Ga0070686_100255020 Ga0070686_1002550201 187
371 3300005547 Ga0070693_100038951 Ga0070693_1000389512 187
372 3300005548 Ga0070665_100022395 Ga0070665_1000223953 187
373 3300005549 Ga0070704_100171589 Ga0070704_1001715892 187
374 3300005549 Ga0070704_100566641 Ga0070704_1005666412 187
375 3300005563 Ga0068855_100372247 Ga0068855_1003722471 187
376 3300005564 Ga0070664_100037789 Ga0070664_1000377891 187
377 3300005614 Ga0068856_100074034 Ga0068856_1000740343 187
378 3300005614 Ga0068856_100804499 Ga0068856_1008044992 187
379 3300005617 Ga0068859_100879067 Ga0068859_1008790671 187
380 3300005617 Ga0068859_102049897 Ga0068859_1020498971 187
381 3300005618 Ga0068864_100282053 Ga0068864_1002820533 187
382 3300005843 Ga0068860_100464631 Ga0068860_1004646312 187
383 3300005844 Ga0068862_101328062 Ga0068862_1013280621 187
384 3300005937 Ga0081455_10000369 Ga0081455_1000036948 187
385 3300005937 Ga0081455_10025395 Ga0081455_100253952 187
386 3300005937 Ga0081455_10027696 Ga0081455_100276963 187
387 3300005937 Ga0081455_10502183 Ga0081455_105021832 187
388 3300005937 Ga0081455_10626011 Ga0081455_106260112 187
389 3300005983 Ga0081540_1003967 Ga0081540_10039672 187
390 3300006028 Ga0070717_10044387 Ga0070717_100443871 187
391 3300006028 Ga0070717_10085937 Ga0070717_100859372 187
392 3300006028 Ga0070717_10199114 Ga0070717_101991143 187
393 3300006038 Ga0075365_10065984 Ga0075365_100659842 187
394 3300006042 Ga0075368_10125951 Ga0075368_101259512 187
395 3300006051 Ga0075364_10145467 Ga0075364_101454671 187
396 3300006058 Ga0075432_10092256 Ga0075432_100922562 187
397 3300006163 Ga0070715_10063356 Ga0070715_100633562 187
398 3300006173 Ga0070716_100025208 Ga0070716_1000252082 187
399 3300006173 Ga0070716_100509906 Ga0070716_1005099061 187
400 3300006175 Ga0070712_100001051 Ga0070712_1000010512 187
401 3300006175 Ga0070712_100518095 Ga0070712_1005180952 187
402 3300006237 Ga0097621_100250240 Ga0097621_1002502402 187
403 3300006237 Ga0097621_100515682 Ga0097621_1005156822 187
404 3300006358 Ga0068871_100015941 Ga0068871_1000159415 187
405 3300006844 Ga0075428_100065454 Ga0075428_1000654542 187
406 3300006844 Ga0075428_100098943 Ga0075428_1000989433 187
407 3300006844 Ga0075428_100298068 Ga0075428_1002980682 187
408 3300006844 Ga0075428_100521767 Ga0075428_1005217672 187
409 3300006847 Ga0075431_100054123 Ga0075431_1000541234 187
410 3300006847 Ga0075431_100072487 Ga0075431_1000724872 187
411 3300006847 Ga0075431_100137660 Ga0075431_1001376602 187
412 3300006847 Ga0075431_100274988 Ga0075431_1002749882 187
413 3300006847 Ga0075431_100471779 Ga0075431_1004717792 187
414 3300006852 Ga0075433_10108487 Ga0075433_101084872 187
415 3300006871 Ga0075434_100057057 Ga0075434_1000570572 187
416 3300006871 Ga0075434_100094195 Ga0075434_1000941952 187
417 3300006871 Ga0075434_100130149 Ga0075434_1001301492 187
418 3300006871 Ga0075434_100153131 Ga0075434_1001531312 187
419 3300006871 Ga0075434_100208202 Ga0075434_1002082023 187
420 3300006871 Ga0075434_100747784 Ga0075434_1007477842 187
421 3300006880 Ga0075429_100049636 Ga0075429_1000496362 187
422 3300006881 Ga0068865_100312179 Ga0068865_1003121792 187
423 3300006881 Ga0068865_100373856 Ga0068865_1003738562 187
424 3300006914 Ga0075436_100236140 Ga0075436_1002361402 187
425 3300006914 Ga0075436_100499748 Ga0075436_1004997482 187
426 3300006931 Ga0097620_100879053 Ga0097620_1008790531 187
427 3300007076 Ga0075435_100084778 Ga0075435_1000847783 187
428 3300007076 Ga0075435_100310268 Ga0075435_1003102681 187
429 3300007788 Ga0099795_10008229 Ga0099795_100082294 187
430 3300009093 Ga0105240_11375095 Ga0105240_113750951 187
431 3300009094 Ga0111539_10011327 Ga0111539_100113276 187
432 3300009094 Ga0111539_10926368 Ga0111539_109263682 187
433 3300009098 Ga0105245_10069966 Ga0105245_100699662 187
434 3300009098 Ga0105245_10209838 Ga0105245_102098382 187
435 3300009101 Ga0105247_10016260 Ga0105247_100162603 187
436 3300009101 Ga0105247_10135926 Ga0105247_101359261 187
437 3300009101 Ga0105247_10645487 Ga0105247_106454871 187
438 3300009147 Ga0114129_10047462 Ga0114129_100474623 187
439 3300009147 Ga0114129_10051163 Ga0114129_100511635 187
440 3300009147 Ga0114129_10126590 Ga0114129_101265905 187
441 3300009147 Ga0114129_10225891 Ga0114129_102258912 187
442 3300009147 Ga0114129_10723089 Ga0114129_107230891 187
443 3300009147 Ga0114129_10962283 Ga0114129_109622832 187
444 3300009148 Ga0105243_10299969 Ga0105243_102999692 187
445 3300009176 Ga0105242_10008956 Ga0105242_100089564 187
446 3300009176 Ga0105242_10413060 Ga0105242_104130602 187
447 3300009177 Ga0105248_10030452 Ga0105248_100304523 187
448 3300009177 Ga0105248_10033903 Ga0105248_100339033 187
449 3300009545 Ga0105237_10237172 Ga0105237_102371721 187
450 3300009545 Ga0105237_10481968 Ga0105237_104819682 187
451 3300009545 Ga0105237_10591465 Ga0105237_105914651 187
452 3300009553 Ga0105249_10571350 Ga0105249_105713502 187
453 3300010159 Ga0099796_10063043 Ga0099796_100630432 187
454 3300010375 Ga0105239_10122001 Ga0105239_101220012 187
455 3300010375 Ga0105239_11305336 Ga0105239_113053361 187
456 3300011119 Ga0105246_10041041 Ga0105246_100410413 187
457 3300011119 Ga0105246_10059375 Ga0105246_100593752 187
458 3300011119 Ga0105246_10594586 Ga0105246_105945861 187
459 3300013105 Ga0157369_11268499 Ga0157369_112684991 187
460 3300013296 Ga0157374_10247517 Ga0157374_102475173 187
461 3300013296 Ga0157374_10363596 Ga0157374_103635962 187
462 3300013296 Ga0157374_11086336 Ga0157374_110863362 187
463 3300013297 Ga0157378_10127112 Ga0157378_101271122 187
464 3300013297 Ga0157378_10455034 Ga0157378_104550342 187
465 3300013306 Ga0163162_10234402 Ga0163162_102344022 187
466 3300013306 Ga0163162_10786228 Ga0163162_107862281 187
467 3300013307 Ga0157372_10107145 Ga0157372_101071453 187
468 3300013308 Ga0157375_10056268 Ga0157375_100562683 187
469 3300013308 Ga0157375_10245014 Ga0157375_102450142 187
470 3300014325 Ga0163163_10082133 Ga0163163_100821333 187
471 3300014325 Ga0163163_10199769 Ga0163163_101997691 187
472 3300014325 Ga0163163_10898951 Ga0163163_108989512 187
473 3300014326 Ga0157380_10387475 Ga0157380_103874752 187
474 3300014968 Ga0157379_10036120 Ga0157379_100361203 187
475 3300014968 Ga0157379_11471424 Ga0157379_114714241 187
476 3300014969 Ga0157376_10030575 Ga0157376_100305752 187
477 3300014969 Ga0157376_10440628 Ga0157376_104406282 187
478 3300017792 Ga0163161_10180794 Ga0163161_101807943 187
479 3300024227 Ga0228598_1017655 Ga0228598_10176552 187
480 3300025898 Ga0207692_10017719 Ga0207692_100177191 187
481 3300025898 Ga0207692_10133377 Ga0207692_101333772 187
482 3300025898 Ga0207692_10226249 Ga0207692_102262492 187
483 3300025900 Ga0207710_10007860 Ga0207710_100078605 187
484 3300025903 Ga0207680_10083989 Ga0207680_100839892 187
485 3300025903 Ga0207680_10416178 Ga0207680_104161781 187
486 3300025906 Ga0207699_10102070 Ga0207699_101020702 187
487 3300025907 Ga0207645_10129460 Ga0207645_101294603 187
488 3300025910 Ga0207684_10065109 Ga0207684_100651092 187
489 3300025912 Ga0207707_10031910 Ga0207707_100319103 187
490 3300025914 Ga0207671_10245467 Ga0207671_102454672 187
491 3300025915 Ga0207693_10002798 Ga0207693_100027983 187
492 3300025915 Ga0207693_10044059 Ga0207693_100440593 187
493 3300025915 Ga0207693_10145853 Ga0207693_101458532 187
494 3300025915 Ga0207693_10214584 Ga0207693_102145842 187
495 3300025916 Ga0207663_10034645 Ga0207663_100346452 187
496 3300025916 Ga0207663_10037618 Ga0207663_100376182 187
497 3300025920 Ga0207649_10062796 Ga0207649_100627962 187
498 3300025922 Ga0207646_10041572 Ga0207646_100415721 187
499 3300025924 Ga0207694_10233327 Ga0207694_102333272 187
500 3300025925 Ga0207650_10006118 Ga0207650_100061182 187
501 3300025926 Ga0207659_10136810 Ga0207659_101368102 187
502 3300025927 Ga0207687_10006865 Ga0207687_100068654 187
503 3300025927 Ga0207687_10157687 Ga0207687_101576872 187
504 3300025928 Ga0207700_10043966 Ga0207700_100439663 187
505 3300025928 Ga0207700_10370204 Ga0207700_103702042 187
506 3300025928 Ga0207700_10715841 Ga0207700_107158411 187
507 3300025928 Ga0207700_10719528 Ga0207700_107195282 187
508 3300025929 Ga0207664_10275014 Ga0207664_102750142 187
509 3300025931 Ga0207644_10020189 Ga0207644_100201894 187
510 3300025931 Ga0207644_10184309 Ga0207644_101843092 187
511 3300025931 Ga0207644_10457265 Ga0207644_104572652 187
512 3300025933 Ga0207706_10036765 Ga0207706_100367652 187
513 3300025934 Ga0207686_10742644 Ga0207686_107426441 187
514 3300025935 Ga0207709_10266630 Ga0207709_102666302 187
515 3300025938 Ga0207704_10103113 Ga0207704_101031133 187
516 3300025939 Ga0207665_10018755 Ga0207665_100187552 187
517 3300025939 Ga0207665_10159069 Ga0207665_101590692 187
518 3300025939 Ga0207665_10309797 Ga0207665_103097971 187
519 3300025941 Ga0207711_10008135 Ga0207711_100081354 187
520 3300025942 Ga0207689_10297973 Ga0207689_102979731 187
521 3300025945 Ga0207679_10155666 Ga0207679_101556662 187
522 3300025945 Ga0207679_10652996 Ga0207679_106529962 187
523 3300025960 Ga0207651_10544820 Ga0207651_105448201 187
524 3300025960 Ga0207651_10649667 Ga0207651_106496672 187
525 3300025960 Ga0207651_10750614 Ga0207651_107506142 187
526 3300025981 Ga0207640_10320631 Ga0207640_103206312 187
527 3300025986 Ga0207658_10045484 Ga0207658_100454843 187
528 3300026035 Ga0207703_10356636 Ga0207703_103566362 187
529 3300026067 Ga0207678_10014350 Ga0207678_100143502 187
530 3300026067 Ga0207678_10166576 Ga0207678_101665762 187
531 3300026078 Ga0207702_10230700 Ga0207702_102307002 187
532 3300026078 Ga0207702_10869053 Ga0207702_108690531 187
533 3300026088 Ga0207641_10093274 Ga0207641_100932742 187
534 3300026095 Ga0207676_10236149 Ga0207676_102361492 187
535 3300026118 Ga0207675_100127492 Ga0207675_1001274922 187
536 3300026121 Ga0207683_10004571 Ga0207683_100045712 187
537 3300026121 Ga0207683_10338071 Ga0207683_103380712 187
538 3300027866 Ga0209813_10077399 Ga0209813_100773992 187
539 3300027907 Ga0207428_10223975 Ga0207428_102239752 187
540 3300028379 Ga0268266_10005703 Ga0268266_100057033 187
541 3300028380 Ga0268265_11299873 Ga0268265_112998732 187
542 3300031235 Ga0265330_10083913 Ga0265330_100839132 187
543 3300031241 Ga0265325_10014844 Ga0265325_100148443 187
544 3300031249 Ga0265339_10204696 Ga0265339_102046962 187
545 3300031711 Ga0265314_10004866 Ga0265314_1000486613 187
546 3300031711 Ga0265314_10075050 Ga0265314_100750502 187
547 3300034819 Ga0373958_0017676 Ga0373958_0017676_683_1246 187
548 3300034820 Ga0373959_0018494 Ga0373959_0018494_183_746 187
549 3300035083 Ga0373926_0002409 Ga0373926_0002409_2246_2809 187
550 3300035083 Ga0373926_0011990 Ga0373926_0011990_1838_2401 187
551 3300035085 Ga0373929_0018370 Ga0373929_0018370_769_1332 187
552 3300035086 Ga0373934_0005641 Ga0373934_0005641_2470_3033 187
553 3300035089 Ga0373944_0027529 Ga0373944_0027529_1017_1580 187
554 3300035089 Ga0373944_0030232 Ga0373944_0030232_826_1389 187
555 3300035090 Ga0373949_0055680 Ga0373949_0055680_356_919 187
556 3300035091 Ga0373951_0080294 Ga0373951_0080294_258_821 187
557 3300035111 Ga0373923_0111806 Ga0373923_0111806_388_951 187
558 3300035111 Ga0373923_0245344 Ga0373923_0245344_156_719 187
559 3300035112 Ga0373932_0031617 Ga0373932_0031617_276_839 187
560 3300035113 Ga0373936_0397703 Ga0373936_0397703_24_587 187
561 3300035114 Ga0373939_0027092 Ga0373939_0027092_976_1539 187
562 3300035115 Ga0373941_0008648 Ga0373941_0008648_993_1556 187
563 3300035116 Ga0373945_0005807 Ga0373945_0005807_1819_2382 187
564 3300035116 Ga0373945_0022810 Ga0373945_0022810_251_814 187
565 3300035117 Ga0373953_0000877 Ga0373953_0000877_2700_3263 187
566 3300035118 Ga0373954_0011839 Ga0373954_0011839_571_1134 187
567 3300035118 Ga0373954_0184958 Ga0373954_0184958_263_826 187
568 3300035119 Ga0373956_0165348 Ga0373956_0165348_423_986 187
569 3300035119 Ga0373956_0409182 Ga0373956_0409182_50_613 187
570 3300035120 Ga0373957_0002376 Ga0373957_0002376_1221_1784 187
571 3300035121 Ga0373960_0140220 Ga0373960_0140220_49_612 187
572 3300035170 Ga0373943_0026578 Ga0373943_0026578_1788_2351 187
573 3300035170 Ga0373943_0126914 Ga0373943_0126914_84_647 187
574 3300035171 Ga0373946_0006713 Ga0373946_0006713_1641_2204 187
575 3300035171 Ga0373946_0205277 Ga0373946_0205277_219_782 187
576 3300035172 Ga0373955_0016702 Ga0373955_0016702_3011_3574 187
577 3300035172 Ga0373955_0078167 Ga0373955_0078167_1166_1729 187
578 3300035172 Ga0373955_0424577 Ga0373955_0424577_13_576 187
579 3300035172 Ga0373955_0490218 Ga0373955_0490218_75_638 187
580 3300035207 Ga0373942_0031774 Ga0373942_0031774_782_1345 187
581 3300035242 Ga0373962_0029486 Ga0373962_0029486_52_615 187
582 3300035410 Ga0373924_0009379 Ga0373924_0009379_2530_3093 187
583 3300035410 Ga0373924_0028068 Ga0373924_0028068_255_818 187
584 3300035691 Ga0373931_0013244 Ga0373931_0013244_3023_3586 187
585 3300035691 Ga0373931_0179451 Ga0373931_0179451_581_1144 187
586 3300035692 Ga0373935_0012670 Ga0373935_0012670_3104_3667 187
587 3300035692 Ga0373935_0086510 Ga0373935_0086510_883_1446 187
588 3300035692 Ga0373935_0100346 Ga0373935_0100346_680_1243 187
589 3300035692 Ga0373935_0313162 Ga0373935_0313162_236_799 187
590 3300035692 Ga0373935_0352447 Ga0373935_0352447_384_947 187
591 3300035695 Ga0373927_0021247 Ga0373927_0021247_1378_1941 187
592 3300035695 Ga0373927_0236388 Ga0373927_0236388_381_944 187
593 3300035695 Ga0373927_0238926 Ga0373927_0238926_261_824 187
594 3300035724 Ga0373933_0001118 Ga0373933_0001118_449_1012 187
595 3300035725 Ga0373947_0007475 Ga0373947_0007475_3791_4354 187
596 3300035725 Ga0373947_0029051 Ga0373947_0029051_564_1127 187
597 3300035725 Ga0373947_0162168 Ga0373947_0162168_20_583 187
598 3300036401 Ga0373937_0018721 Ga0373937_0018721_3774_4337 187
599 3300036401 Ga0373937_0040421 Ga0373937_0040421_271_834 187
600 3300036401 Ga0373937_0104151 Ga0373937_0104151_402_1082 187
601 3300036401 Ga0373937_0266076 Ga0373937_0266076_495_1058 187
602 3300037068 Ga0373925_0110678 Ga0373925_0110678_845_1408 187
603 3300037068 Ga0373925_0220536 Ga0373925_0220536_381_944 187
604 3300037068 Ga0373925_0360162 Ga0373925_0360162_20_583 187
605 3300037068 Ga0373925_0513087 Ga0373925_0513087_170_733 187
606 3300037068 Ga0373925_0892732 Ga0373925_0892732_104_667 187
607 3300037466 Ga0395898_0089739 Ga0395898_0089739_2076_2639 187
608 3300037853 Ga0436364_0877934 Ga0436364_0877934_237_800 187
609 3300038443 Ga0395901_0266843 Ga0395901_0266843_194_757 187
610 3300039437 Ga0436365_1155159 Ga0436365_1155159_181_744 187
611 3300039447 Ga0436361_0443883 Ga0436361_0443883_2614_3177 187
612 3300039450 Ga0436363_0595633 Ga0436363_0595633_730_1293 187
613 3300039453 Ga0436362_0005602 Ga0436362_0005602_104_667 187
614 3300041507 Ga0451851_0045297 Ga0451851_0045297_356_919 187
615 3300044719 Ga0466971_0315003 Ga0466971_0315003_124_687 187
616 3300044842 Ga0466957_0382873 Ga0466957_0382873_86_649 187
617 3300046452 Ga0495617_139348 Ga0495617_139348_94_657 187
618 3300046454 Ga0495592_0012848 Ga0495592_0012848_2607_3170 187
619 3300046454 Ga0495592_0016333 Ga0495592_0016333_3090_3653 187
620 3300046455 Ga0495603_0043755 Ga0495603_0043755_1941_2504 187
621 3300046455 Ga0495603_0104575 Ga0495603_0104575_718_1281 187
622 3300046455 Ga0495603_0128429 Ga0495603_0128429_597_1160 187
623 3300046459 Ga0495629_0005405 Ga0495629_0005405_6298_6861 187
624 3300046459 Ga0495629_0056166 Ga0495629_0056166_121_684 187
625 3300046459 Ga0495629_0106030 Ga0495629_0106030_344_907 187
626 3300046459 Ga0495629_0269628 Ga0495629_0269628_170_733 187
627 3300046460 Ga0495638_0147456 Ga0495638_0147456_660_1223 187
628 3300046461 Ga0495641_0017369 Ga0495641_0017369_1385_1948 187
629 3300046461 Ga0495641_0124583 Ga0495641_0124583_269_832 187
630 3300046461 Ga0495641_0151858 Ga0495641_0151858_422_985 187
631 3300046462 Ga0495651_0002600 Ga0495651_0002600_3159_3722 187
632 3300046462 Ga0495651_0129777 Ga0495651_0129777_932_1612 187
633 3300046463 Ga0495653_0001047 Ga0495653_0001047_5398_5961 187
634 3300046463 Ga0495653_0041639 Ga0495653_0041639_2638_3318 187
635 3300046463 Ga0495653_0175829 Ga0495653_0175829_646_1209 187
636 3300046472 Ga0495580_0172853 Ga0495580_0172853_761_1324 187
637 3300046472 Ga0495580_0186826 Ga0495580_0186826_643_1206 187
638 3300046473 Ga0495582_0040009 Ga0495582_0040009_271_834 187
639 3300046475 Ga0495639_0014761 Ga0495639_0014761_1019_1582 187
640 3300046475 Ga0495639_0165819 Ga0495639_0165819_404_967 187
641 3300046476 Ga0495662_0038805 Ga0495662_0038805_963_1526 187
642 3300046476 Ga0495662_0171134 Ga0495662_0171134_131_694 187
643 3300046476 Ga0495662_0260180 Ga0495662_0260180_78_641 187
644 3300046477 Ga0495664_0066334 Ga0495664_0066334_261_824 187
645 3300046477 Ga0495664_0118522 Ga0495664_0118522_31_594 187
646 3300046491 Ga0495584_0120627 Ga0495584_0120627_737_1300 187
647 3300046499 Ga0495594_0061996 Ga0495594_0061996_100_663 187
648 3300046499 Ga0495594_0157511 Ga0495594_0157511_122_685 187
649 3300046499 Ga0495594_0220951 Ga0495594_0220951_447_1010 187
650 3300046511 Ga0495608_0002112 Ga0495608_0002112_1573_2136 187
651 3300046511 Ga0495608_0172435 Ga0495608_0172435_569_1132 187
652 3300046514 Ga0495618_0005758 Ga0495618_0005758_3287_3850 187
653 3300046514 Ga0495618_0353085 Ga0495618_0353085_126_806 187
654 3300046514 Ga0495618_0400653 Ga0495618_0400653_84_647 187
655 3300046516 Ga0495628_0003957 Ga0495628_0003957_29_592 187
656 3300046517 Ga0495630_0216081 Ga0495630_0216081_372_935 187
657 3300046526 Ga0495666_0010416 Ga0495666_0010416_3522_4085 187
658 3300046529 Ga0495652_0003317 Ga0495652_0003317_3798_4361 187
659 3300046529 Ga0495652_0063428 Ga0495652_0063428_1663_2343 187
660 3300046529 Ga0495652_0201615 Ga0495652_0201615_428_991 187
661 3300046529 Ga0495652_0285065 Ga0495652_0285065_368_931 187
662 3300046529 Ga0495652_0368774 Ga0495652_0368774_245_922 187
663 3300046531 Ga0495665_0006593 Ga0495665_0006593_3097_3660 187
664 3300046531 Ga0495665_0063490 Ga0495665_0063490_1283_1846 187
665 3300046533 Ga0495640_0015437 Ga0495640_0015437_669_1232 187
666 3300046533 Ga0495640_0066207 Ga0495640_0066207_37_717 187
667 3300046533 Ga0495640_0151938 Ga0495640_0151938_864_1427 187
668 3300046535 Ga0495586_0003837 Ga0495586_0003837_4020_4583 187
669 3300046536 Ga0495587_0000701 Ga0495587_0000701_20030_20593 187
670 3300046536 Ga0495587_0046379 Ga0495587_0046379_1770_2333 187
671 3300046543 Ga0495645_0002582 Ga0495645_0002582_2581_3144 187
672 3300046559 Ga0495667_0011101 Ga0495667_0011101_1400_1963 187
673 3300046559 Ga0495667_0026841 Ga0495667_0026841_3106_3669 187
674 3300046559 Ga0495667_0103554 Ga0495667_0103554_733_1296 187
675 3300046559 Ga0495667_0179943 Ga0495667_0179943_194_874 187
676 3300046615 Ga0495656_0046474 Ga0495656_0046474_773_1336 187
677 3300046615 Ga0495656_0077236 Ga0495656_0077236_560_1123 187
678 3300046642 Ga0495634_0020611 Ga0495634_0020611_3540_4103 187
679 3300046642 Ga0495634_0103259 Ga0495634_0103259_242_922 187
680 3300046663 Ga0495635_0011643 Ga0495635_0011643_3622_4185 187
681 3300046663 Ga0495635_0046775 Ga0495635_0046775_1268_1831 187
682 3300046663 Ga0495635_0206973 Ga0495635_0206973_743_1306 187
683 3300046664 Ga0495659_0042965 Ga0495659_0042965_75_638 187
684 3300046664 Ga0495659_0063075 Ga0495659_0063075_251_814 187
685 3300046675 Ga0495657_0009262 Ga0495657_0009262_680_1243 187
686 3300046678 Ga0495599_0021570 Ga0495599_0021570_157_720 187
687 3300046678 Ga0495599_0291073 Ga0495599_0291073_24_587 187
688 3300046679 Ga0495623_0001363 Ga0495623_0001363_2977_3540 187
689 3300046680 Ga0495646_0012104 Ga0495646_0012104_2453_3016 187
690 3300046680 Ga0495646_0231663 Ga0495646_0231663_65_628 187
691 3300046681 Ga0495647_0008403 Ga0495647_0008403_2190_2753 187
692 3300046681 Ga0495647_0096635 Ga0495647_0096635_178_741 187
693 3300046681 Ga0495647_0155707 Ga0495647_0155707_364_927 187
694 3300046683 Ga0495658_0001737 Ga0495658_0001737_3354_3917 187
695 3300046683 Ga0495658_0016443 Ga0495658_0016443_2194_2757 187
696 3300046683 Ga0495658_0036939 Ga0495658_0036939_404_967 187
697 3300046683 Ga0495658_0477464 Ga0495658_0477464_137_700 187
698 3300046689 Ga0495613_0055710 Ga0495613_0055710_658_1221 187
699 3300046689 Ga0495613_0066277 Ga0495613_0066277_986_1549 187
700 3300046689 Ga0495613_0074672 Ga0495613_0074672_899_1462 187
701 3300046689 Ga0495613_0569223 Ga0495613_0569223_82_645 187
702 3300046690 Ga0495624_0024085 Ga0495624_0024085_2876_3439 187
703 3300046690 Ga0495624_0060864 Ga0495624_0060864_1599_2162 187
704 3300046690 Ga0495624_0120750 Ga0495624_0120750_899_1462 187
705 3300046809 Ga0495600_0014977 Ga0495600_0014977_3893_4456 187
706 3300046809 Ga0495600_0039724 Ga0495600_0039724_1091_1654 187
707 3300047317 Ga0495604_0002172 Ga0495604_0002172_1573_2136 187
708 3300047317 Ga0495604_0053030 Ga0495604_0053030_2284_2964 187
709 3300047317 Ga0495604_0095679 Ga0495604_0095679_509_1072 187
710 3300047317 Ga0495604_0126855 Ga0495604_0126855_821_1498 187
711 3300047319 Ga0495674_0085854 Ga0495674_0085854_120_683 187
712 3300047319 Ga0495674_0086887 Ga0495674_0086887_1410_1973 187
713 3300047319 Ga0495674_0180036 Ga0495674_0180036_444_1007 187
714 3300047319 Ga0495674_0195572 Ga0495674_0195572_736_1299 187
715 3300047319 Ga0495674_0477048 Ga0495674_0477048_344_907 187
716 3300047321 Ga0495676_0039162 Ga0495676_0039162_710_1273 187
717 3300047322 Ga0495680_0016420 Ga0495680_0016420_2497_3060 187
718 3300047322 Ga0495680_0062248 Ga0495680_0062248_1788_2351 187
719 3300047322 Ga0495680_0257097 Ga0495680_0257097_307_870 187
720 3300047444 Ga0495675_0000485 Ga0495675_0000485_23400_23963 187
721 3300047471 Ga0495684_0023838 Ga0495684_0023838_3003_3566 187
722 3300047471 Ga0495684_0124080 Ga0495684_0124080_755_1318 187
723 3300047471 Ga0495684_0234473 Ga0495684_0234473_438_1001 187
724 3300047673 Ga0495593_0027342 Ga0495593_0027342_337_900 187
725 3300047673 Ga0495593_0043250 Ga0495593_0043250_1050_1613 187
726 3300047673 Ga0495593_0208179 Ga0495593_0208179_90_653 187
727 3300047673 Ga0495593_0271638 Ga0495593_0271638_58_621 187
728 3300048088 Ga0495602_0042301 Ga0495602_0042301_1738_2301 187
729 3300048088 Ga0495602_0189350 Ga0495602_0189350_782_1462 187
730 3300048089 Ga0495614_0011763 Ga0495614_0011763_263_826 187
731 3300048089 Ga0495614_0112153 Ga0495614_0112153_617_1180 187
732 3300048903 Ga0496100_0009014 Ga0496100_0009014_3407_3970 187
733 3300048903 Ga0496100_0014007 Ga0496100_0014007_201_764 187
734 3300048903 Ga0496100_0132474 Ga0496100_0132474_1021_1584 187
735 3300048903 Ga0496100_0302255 Ga0496100_0302255_417_980 187
736 3300048903 Ga0496100_0328021 Ga0496100_0328021_571_1134 187
737 3300048903 Ga0496100_1121228 Ga0496100_1121228_21_584 187
738 3300048904 Ga0496101_0006290 Ga0496101_0006290_3192_3755 187
739 3300048904 Ga0496101_0063235 Ga0496101_0063235_925_1488 187
740 3300048904 Ga0496101_0149083 Ga0496101_0149083_494_1057 187
741 3300048904 Ga0496101_0346278 Ga0496101_0346278_62_625 187
742 3300048905 Ga0496102_0003862 Ga0496102_0003862_4183_4746 187
743 3300048905 Ga0496102_0040023 Ga0496102_0040023_2527_3090 187
744 3300048905 Ga0496102_0067474 Ga0496102_0067474_1909_2472 187
745 3300048905 Ga0496102_0317253 Ga0496102_0317253_455_1018 187
746 3300048906 Ga0496103_0003140 Ga0496103_0003140_2146_2709 187
747 3300048906 Ga0496103_0038956 Ga0496103_0038956_888_1451 187
748 3300048906 Ga0496103_0313922 Ga0496103_0313922_96_659 187
749 3300048907 Ga0496104_0004241 Ga0496104_0004241_5748_6311 187
750 3300048907 Ga0496104_0004499 Ga0496104_0004499_11458_12021 187
751 3300048907 Ga0496104_0008656 Ga0496104_0008656_2326_2889 187
752 3300048907 Ga0496104_0085508 Ga0496104_0085508_1793_2356 187
753 3300048907 Ga0496104_0097622 Ga0496104_0097622_850_1413 187
754 3300048907 Ga0496104_0170432 Ga0496104_0170432_1244_1807 187
755 3300048907 Ga0496104_0291156 Ga0496104_0291156_84_647 187
756 3300048908 Ga0496105_0015465 Ga0496105_0015465_1776_2339 187
757 3300048908 Ga0496105_0028022 Ga0496105_0028022_1346_1909 187
758 3300048908 Ga0496105_0099222 Ga0496105_0099222_1578_2141 187
759 3300048908 Ga0496105_0104617 Ga0496105_0104617_1751_2314 187
760 3300048908 Ga0496105_0127661 Ga0496105_0127661_1460_2023 187
761 3300048908 Ga0496105_0143866 Ga0496105_0143866_330_893 187
762 3300048909 Ga0496106_0004037 Ga0496106_0004037_1302_1865 187
763 3300048909 Ga0496106_0016268 Ga0496106_0016268_2407_2970 187
764 3300048909 Ga0496106_0031959 Ga0496106_0031959_2740_3303 187
765 3300048909 Ga0496106_0071005 Ga0496106_0071005_91_654 187
766 3300048909 Ga0496106_0149352 Ga0496106_0149352_664_1251 187
767 3300048909 Ga0496106_0208523 Ga0496106_0208523_181_744 187
768 3300048909 Ga0496106_0967921 Ga0496106_0967921_50_613 187
769 3300048910 Ga0496107_0019167 Ga0496107_0019167_129_692 187
770 3300048910 Ga0496107_0065999 Ga0496107_0065999_1302_1865 187
771 3300048910 Ga0496107_0092882 Ga0496107_0092882_337_900 187
772 3300048911 Ga0496108_0000692 Ga0496108_0000692_13368_13931 187
773 3300048911 Ga0496108_0035668 Ga0496108_0035668_1307_1870 187
774 3300048911 Ga0496108_0093826 Ga0496108_0093826_698_1261 187
775 3300048911 Ga0496108_0319071 Ga0496108_0319071_113_676 187
776 3300048911 Ga0496108_0610112 Ga0496108_0610112_172_735 187
777 3300048912 Ga0496109_0000624 Ga0496109_0000624_13333_13896 187
778 3300048912 Ga0496109_0005168 Ga0496109_0005168_1889_2452 187
779 3300048912 Ga0496109_0033526 Ga0496109_0033526_3884_4447 187
780 3300048912 Ga0496109_0118303 Ga0496109_0118303_253_816 187
781 3300048912 Ga0496109_0750877 Ga0496109_0750877_202_765 187
782 3300048913 Ga0496110_0001274 Ga0496110_0001274_12827_13390 187
783 3300048913 Ga0496110_0010628 Ga0496110_0010628_650_1213 187
784 3300048913 Ga0496110_0017893 Ga0496110_0017893_2094_2657 187
785 3300048913 Ga0496110_0029618 Ga0496110_0029618_1972_2535 187
786 3300048914 Ga0496111_0000696 Ga0496111_0000696_7702_8265 187
787 3300048914 Ga0496111_0013239 Ga0496111_0013239_2971_3534 187
788 3300048914 Ga0496111_0028621 Ga0496111_0028621_2564_3127 187
789 3300048914 Ga0496111_0700804 Ga0496111_0700804_25_588 187
790 3300048915 Ga0496112_0000601 Ga0496112_0000601_13379_13942 187
791 3300048915 Ga0496112_0006054 Ga0496112_0006054_2245_2808 187
792 3300048915 Ga0496112_0114946 Ga0496112_0114946_1895_2458 187
793 3300048915 Ga0496112_0139822 Ga0496112_0139822_152_715 187
794 3300048915 Ga0496112_0178662 Ga0496112_0178662_1308_1871 187
795 3300048915 Ga0496112_0324476 Ga0496112_0324476_105_668 187
796 3300048915 Ga0496112_0578973 Ga0496112_0578973_265_828 187
797 3300048916 Ga0496113_0003449 Ga0496113_0003449_2454_3017 187
798 3300048916 Ga0496113_0017621 Ga0496113_0017621_2878_3441 187
799 3300048916 Ga0496113_0137222 Ga0496113_0137222_681_1244 187
800 3300048916 Ga0496113_0295804 Ga0496113_0295804_563_1126 187
801 3300048917 Ga0496114_0076662 Ga0496114_0076662_548_1111 187
802 3300048917 Ga0496114_0126187 Ga0496114_0126187_975_1538 187
803 3300048917 Ga0496114_0449878 Ga0496114_0449878_398_961 187
804 3300048917 Ga0496114_0700168 Ga0496114_0700168_153_716 187
805 3300048917 Ga0496114_1015401 Ga0496114_1015401_55_618 187
806 3300048918 Ga0496115_0013680 Ga0496115_0013680_5090_5653 187
807 3300048918 Ga0496115_0242957 Ga0496115_0242957_74_637 187
808 3300048918 Ga0496115_0293772 Ga0496115_0293772_68_631 187
809 3300048918 Ga0496115_0315304 Ga0496115_0315304_229_792 187
810 3300048918 Ga0496115_0545337 Ga0496115_0545337_203_766 187
811 3300050492 nmdc:mga0yw44_1439_c2 nmdc:mga0yw44_1439_c2_5478_6041 187
812 3300050492 nmdc:mga0yw44_3517_c1 nmdc:mga0yw44_3517_c1_401_1081 187
813 3300050507 nmdc:mga05p37_11335_c1 nmdc:mga05p37_11335_c1_7033_7596 187
814 3300050507 nmdc:mga05p37_119370_c1 nmdc:mga05p37_119370_c1_1903_2466 187
815 3300050507 nmdc:mga05p37_272693_c1 nmdc:mga05p37_272693_c1_240_803 187
816 3300050507 nmdc:mga05p37_291971_c1 nmdc:mga05p37_291971_c1_356_919 187
817 3300050507 nmdc:mga05p37_64107_c1 nmdc:mga05p37_64107_c1_2528_3091 187
818 3300050508 nmdc:mga09592_40107_c1 nmdc:mga09592_40107_c1_1560_2123 187
819 3300050510 nmdc:mga06r32_105758_c1 nmdc:mga06r32_105758_c1_699_1262 187
820 3300050510 nmdc:mga06r32_183936_c1 nmdc:mga06r32_183936_c1_1237_1800 187
821 3300050510 nmdc:mga06r32_67523_c1 nmdc:mga06r32_67523_c1_2011_2691 187
822 3300050510 nmdc:mga06r32_89123_c1 nmdc:mga06r32_89123_c1_2224_2787 187
823 3300050511 nmdc:mga08y16_1435524_c1 nmdc:mga08y16_1435524_c1_11_574 187
824 3300050512 nmdc:mga0n895_298942_c1 nmdc:mga0n895_298942_c1_892_1455 187
825 3300050513 nmdc:mga0rr50_120985_c1 nmdc:mga0rr50_120985_c1_503_1066 187
826 3300050513 nmdc:mga0rr50_539319_c1 nmdc:mga0rr50_539319_c1_370_933 187
827 3300050514 nmdc:mga08x19_529604_c1 nmdc:mga08x19_529604_c1_227_790 187
828 3300050515 nmdc:mga0a205_286808_c1 nmdc:mga0a205_286808_c1_317_880 187
829 3300050515 nmdc:mga0a205_35703_c1 nmdc:mga0a205_35703_c1_1606_2169 187
830 3300053077 Ga0495601_0004131 Ga0495601_0004131_6402_6965 187
831 3300053077 Ga0495601_0004957 Ga0495601_0004957_2453_3016 187
832 3300053077 Ga0495601_0017589 Ga0495601_0017589_1788_2468 187
833 3300053077 Ga0495601_0464485 Ga0495601_0464485_116_796 187
834 3300053078 Ga0495612_0004798 Ga0495612_0004798_2582_3145 187
835 3300053078 Ga0495612_0005266 Ga0495612_0005266_1142_1705 187
836 3300053078 Ga0495612_0021164 Ga0495612_0021164_96_776 187
837 3300053084 Ga0495595_0007484 Ga0495595_0007484_3339_3902 187
838 3300053084 Ga0495595_0010073 Ga0495595_0010073_3327_3890 187
839 3300053084 Ga0495595_0142049 Ga0495595_0142049_551_1114 187
840 3300053085 Ga0495619_0000149 Ga0495619_0000149_38656_39336 187
841 3300053085 Ga0495619_0001954 Ga0495619_0001954_2251_2814 187
842 3300053085 Ga0495619_0007106 Ga0495619_0007106_4956_5519 187
843 3300053085 Ga0495619_0007508 Ga0495619_0007508_1819_2382 187
844 3300053085 Ga0495619_0058657 Ga0495619_0058657_444_1007 187
845 3300053085 Ga0495619_0289850 Ga0495619_0289850_423_986 187
846 3300053087 Ga0500643_005326 Ga0500643_005326_427_990 187
847 3300053088 Ga0500644_0001263 Ga0500644_0001263_1718_2281 187
848 3300053093 Ga0500651_0036588 Ga0500651_0036588_2328_2891 187
849 3300053094 Ga0500566_0294925 Ga0500566_0294925_72_635 187
850 3300053119 Ga0500595_000016 Ga0500595_000016_41832_42395 187
851 3300053119 Ga0500595_013460 Ga0500595_013460_1677_2240 187
852 3300053131 Ga0500652_006592 Ga0500652_006592_2442_3005 187
853 3300053153 Ga0500616_0000006 Ga0500616_0000006_682149_682712 187
854 3300053153 Ga0500616_0176801 Ga0500616_0176801_177_740 187
855 3300053730 Ga0500645_000033 Ga0500645_000033_11832_12395 187
856 3300060353 Ga0501082_0807635 Ga0501082_0807635_19_582 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

85

219

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ldc-assembly1.cif.gz_A high resolution open mthk pore structure crystallized in 100 mm k+ 0.3718 94 175
3ldc-assembly1.cif.gz_A-3 high resolution open mthk pore structure crystallized in 100 mm k+ 0.3718 94 175
6u6h-assembly1.cif.gz_A calcium-bound mthk open-inactivated state 3 0.3718 94 175
6u9p-assembly1.cif.gz_A wild-type mthk pore in ~150 mm k+ 0.3695 94 175
3ldc-assembly1.cif.gz_A high resolution open mthk pore structure crystallized in 100 mm k+ 0.3679 94 175
ID Description Score Start End Superfamily
af_Q9W581_654_778_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3819 123 178 1.10.287.70
3behB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3804 101 174 1.10.287.70
3ldcA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3718 94 175 1.10.287.70
af_B0UYF4_307_417_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3704 96 163 1.10.287.70
af_O16158_2_183_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.3689 44 162 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A536YJA9-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9444 41 187
AF-A0A1Q7BYJ7-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9436 22 187
AF-A0A6L8EJL0-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9414 17 187
AF-A0A1Q7BYJ7-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9381 22 187
AF-A0A536YJA9-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9381 41 187

Feature Viewer

pLDDT pTM Quality
89.1 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map