F483536

General Info

Members Datasets Scaffolds Average Seq Length
853 298 1706 81

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10908686|Ga0070710_109086862
Length 98
Sequence MRARVFVTLKPSVFDPQGRTIAEALHSLGYASVADVRQGKYFELDLATTEAATARQLAAEVADKVLANPVIESYRIEVVGAESAAPVGAELPPPGGRS

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
118 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
119 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
120 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
121 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
122 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 1.17
Rhizosphere 97.19
Stem 0
Stem Tuber 0
Unclassified 7.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10908686 3300005437 Bacteria 636
2 JGI24034J26672_10114255 3300002239 Unclassified 518
3 JGI24751J29686_10015939 3300002459 Bacteria 1550
4 JGI24751J29686_10041066 3300002459 Bacteria 957
5 JGI24751J29686_10076684 3300002459 Bacteria 691
6 JGI24751J29686_10110809 3300002459 Unclassified 575
7 JGI25406J46586_10175071 3300003203 Unclassified 626
8 Ga0058861_11877824 3300004800 Bacteria 665
9 Ga0065714_10159535 3300005288 Bacteria 1059
10 Ga0065704_10500566 3300005289 Unclassified 667
11 Ga0065704_10700005 3300005289 Bacteria 561
12 Ga0065712_10081290 3300005290 Bacteria 3020
13 Ga0065712_10103693 3300005290 Bacteria 1979
14 Ga0065712_10135607 3300005290 Bacteria 1501
15 Ga0065712_10179708 3300005290 Bacteria 1199
16 Ga0065715_10025302 3300005293 Bacteria 1867
17 Ga0065715_10278577 3300005293 Bacteria 1092
18 Ga0065715_10283309 3300005293 Bacteria 1081
19 Ga0065715_10324553 3300005293 Bacteria 995
20 Ga0065715_10383109 3300005293 Bacteria 901
21 Ga0065707_10050251 3300005295 Bacteria 1001
22 Ga0065707_10491417 3300005295 Bacteria 765
23 Ga0065707_10517758 3300005295 Bacteria 744
24 Ga0065707_11022106 3300005295 Unclassified 534
25 Ga0070658_10377277 3300005327 Bacteria 1216
26 Ga0070658_11972009 3300005327 Bacteria 504
27 Ga0070676_10102455 3300005328 Bacteria 1771
28 Ga0070676_10551862 3300005328 Bacteria 825
29 Ga0070676_11327627 3300005328 Unclassified 550
30 Ga0070676_11331301 3300005328 Bacteria 549
31 Ga0070683_100070671 3300005329 Bacteria 3256
32 Ga0070683_100652991 3300005329 Bacteria 1007
33 Ga0070690_100002272 3300005330 Bacteria 10295
34 Ga0070690_101108744 3300005330 Bacteria 628
35 Ga0070690_101499862 3300005330 Unclassified 545
36 Ga0070670_100007985 3300005331 Bacteria 9001
37 Ga0070670_100043598 3300005331 Bacteria 3856
38 Ga0070670_100292550 3300005331 Bacteria 1424
39 Ga0070670_100310331 3300005331 Bacteria 1381
40 Ga0070670_100482882 3300005331 Bacteria 1100
41 Ga0070670_101039606 3300005331 Unclassified 746
42 Ga0070670_101208262 3300005331 Bacteria 691
43 Ga0070670_101622043 3300005331 Bacteria 595
44 Ga0070670_101634213 3300005331 Unclassified 592
45 Ga0070677_10026524 3300005333 Bacteria 2173
46 Ga0070677_10639717 3300005333 Bacteria 593
47 Ga0070677_10781274 3300005333 Bacteria 544
48 Ga0068869_100538527 3300005334 Bacteria 979
49 Ga0068869_100672154 3300005334 Bacteria 881
50 Ga0070666_10069241 3300005335 Bacteria 2399
51 Ga0070666_10098067 3300005335 Bacteria 2018
52 Ga0070666_10181420 3300005335 Bacteria 1477
53 Ga0070666_10501820 3300005335 Bacteria 880
54 Ga0070666_10515118 3300005335 Bacteria 868
55 Ga0070666_11140581 3300005335 Bacteria 580
56 Ga0070666_11261595 3300005335 Bacteria 551
57 Ga0070666_11496935 3300005335 Unclassified 505
58 Ga0070682_101257703 3300005337 Archaea 627
59 Ga0068868_100079152 3300005338 Bacteria 2633
60 Ga0068868_100148056 3300005338 Bacteria 1932
61 Ga0068868_100653349 3300005338 Bacteria 937
62 Ga0068868_100660013 3300005338 Bacteria 932
63 Ga0068868_100662974 3300005338 Bacteria 930
64 Ga0068868_100838288 3300005338 Unclassified 832
65 Ga0068868_101291274 3300005338 Bacteria 678
66 Ga0070660_100005652 3300005339 Bacteria 8664
67 Ga0070660_100341137 3300005339 Bacteria 1233
68 Ga0070689_100136707 3300005340 Bacteria 1968
69 Ga0070689_100174750 3300005340 Bacteria 1742
70 Ga0070689_100189127 3300005340 Bacteria 1676
71 Ga0070689_100218139 3300005340 Bacteria 1564
72 Ga0070689_100227523 3300005340 Bacteria 1532
73 Ga0070689_100231002 3300005340 Bacteria 1521
74 Ga0070689_100777528 3300005340 Bacteria 841
75 Ga0070689_102146441 3300005340 Bacteria 512
76 Ga0070691_10000294 3300005341 Bacteria 17412
77 Ga0070687_100164431 3300005343 Bacteria 1315
78 Ga0070687_100238090 3300005343 Bacteria 1124
79 Ga0070687_100311981 3300005343 Bacteria 1002
80 Ga0070687_101383323 3300005343 Bacteria 525
81 Ga0070668_100045224 3300005347 Bacteria 3378
82 Ga0070668_100752731 3300005347 Bacteria 863
83 Ga0070668_101155903 3300005347 Bacteria 700
84 Ga0070668_101347123 3300005347 Bacteria 650
85 Ga0070668_101732371 3300005347 Bacteria 574
86 Ga0070668_102204480 3300005347 Bacteria 509
87 Ga0070669_100010029 3300005353 Bacteria 6734
88 Ga0070669_100031184 3300005353 Bacteria 3850
89 Ga0070669_100153832 3300005353 Bacteria 1782
90 Ga0070669_100441825 3300005353 Bacteria 1071
91 Ga0070675_100022847 3300005354 Bacteria 4997
92 Ga0070675_100025171 3300005354 Bacteria 4770
93 Ga0070675_100031919 3300005354 Bacteria 4259
94 Ga0070675_100272877 3300005354 Bacteria 1484
95 Ga0070675_101472764 3300005354 Unclassified 628
96 Ga0070675_101953407 3300005354 Bacteria 541
97 Ga0070671_100018425 3300005355 Bacteria 5670
98 Ga0070671_100475726 3300005355 Bacteria 1073
99 Ga0070671_100585171 3300005355 Bacteria 964
100 Ga0070671_101174011 3300005355 Bacteria 675
101 Ga0070671_101976532 3300005355 Bacteria 519
102 Ga0070674_100129654 3300005356 Bacteria 1878
103 Ga0070674_100388075 3300005356 Bacteria 1138
104 Ga0070674_101211335 3300005356 Bacteria 671
105 Ga0070674_101590357 3300005356 Bacteria 589
106 Ga0070673_100208496 3300005364 Bacteria 1686
107 Ga0070673_100318839 3300005364 Bacteria 1373
108 Ga0070673_100587187 3300005364 Bacteria 1015
109 Ga0070673_100762082 3300005364 Viruses 892
110 Ga0070673_101059116 3300005364 Bacteria 757
111 Ga0070673_101423220 3300005364 Bacteria 653
112 Ga0070673_102031198 3300005364 Bacteria 546
113 Ga0070673_102201291 3300005364 Unclassified 524
114 Ga0070688_100025142 3300005365 Bacteria 3524
115 Ga0070688_100075925 3300005365 Bacteria 2161
116 Ga0070688_100076431 3300005365 Bacteria 2155
117 Ga0070688_100157904 3300005365 Bacteria 1556
118 Ga0070688_100747506 3300005365 Bacteria 761
119 Ga0070688_101011727 3300005365 Bacteria 661
120 Ga0070688_101048846 3300005365 Bacteria 650
121 Ga0070688_101128796 3300005365 Bacteria 628
122 Ga0070659_100099115 3300005366 Bacteria 2344
123 Ga0070659_100598550 3300005366 Bacteria 947
124 Ga0070659_101830385 3300005366 Bacteria 544
125 Ga0070667_100023919 3300005367 Bacteria 5073
126 Ga0070667_100192362 3300005367 Bacteria 1808
127 Ga0070667_100312455 3300005367 Bacteria 1417
128 Ga0070667_100771462 3300005367 Bacteria 892
129 Ga0070667_100883092 3300005367 Bacteria 832
130 Ga0070703_10100431 3300005406 Bacteria 1019
131 Ga0070703_10103558 3300005406 Bacteria 1007
132 Ga0070709_10011948 3300005434 Bacteria 4852
133 Ga0070709_10051725 3300005434 Bacteria 2579
134 Ga0070709_10064897 3300005434 Bacteria 2336
135 Ga0070714_100003779 3300005435 Bacteria 11354
136 Ga0070713_100487317 3300005436 Bacteria 1162
137 Ga0070713_101597786 3300005436 Unclassified 633
138 Ga0070710_10318617 3300005437 Bacteria 1020
139 Ga0070701_10022791 3300005438 Bacteria 3007
140 Ga0070701_10696932 3300005438 Unclassified 683
141 Ga0070701_11133627 3300005438 Unclassified 552
142 Ga0070711_100225777 3300005439 Bacteria 1458
143 Ga0070711_101268662 3300005439 Bacteria 639
144 Ga0070705_100114158 3300005440 Bacteria 1732
145 Ga0070700_100575083 3300005441 Bacteria 879
146 Ga0070700_101027667 3300005441 Unclassified 679
147 Ga0070700_101263998 3300005441 Unclassified 619
148 Ga0070700_101323748 3300005441 Bacteria 606
149 Ga0070700_101346085 3300005441 Bacteria 602
150 Ga0070694_100017963 3300005444 Bacteria 4479
151 Ga0070694_100067740 3300005444 Bacteria 2451
152 Ga0070694_100400196 3300005444 Bacteria 1075
153 Ga0070708_100018024 3300005445 Bacteria 5904
154 Ga0070708_100084634 3300005445 Bacteria 2877
155 Ga0070708_100251921 3300005445 Bacteria 1659
156 Ga0070708_100412945 3300005445 Bacteria 1273
157 Ga0070708_100649519 3300005445 Unclassified 994
158 Ga0070663_100761924 3300005455 Bacteria 827
159 Ga0070663_101147595 3300005455 Bacteria 681
160 Ga0070678_100081148 3300005456 Bacteria 2458
161 Ga0070678_100211891 3300005456 Bacteria 1606
162 Ga0070678_100853006 3300005456 Bacteria 830
163 Ga0070678_100906102 3300005456 Bacteria 806
164 Ga0070678_102032418 3300005456 Unclassified 544
165 Ga0070662_100238392 3300005457 Bacteria 1458
166 Ga0070662_100400465 3300005457 Bacteria 1133
167 Ga0070662_101214262 3300005457 Bacteria 648
168 Ga0070662_101696894 3300005457 Bacteria 545
169 Ga0070662_101819889 3300005457 Bacteria 526
170 Ga0070681_10108122 3300005458 Bacteria 2721
171 Ga0070681_10200838 3300005458 Bacteria 1912
172 Ga0068867_100031728 3300005459 Bacteria 3817
173 Ga0068867_100044633 3300005459 Bacteria 3248
174 Ga0068867_100287353 3300005459 Bacteria 1351
175 Ga0068867_100548881 3300005459 Bacteria 1001
176 Ga0070685_10035627 3300005466 Bacteria 2809
177 Ga0070685_10586867 3300005466 Bacteria 800
178 Ga0070685_11491750 3300005466 Unclassified 521
179 Ga0070706_100498470 3300005467 Bacteria 1133
180 Ga0070706_100842650 3300005467 Unclassified 848
181 Ga0070706_101191059 3300005467 Bacteria 700
182 Ga0070706_101582977 3300005467 Bacteria 598
183 Ga0070707_100626910 3300005468 Bacteria 1038
184 Ga0070707_100717334 3300005468 Bacteria 963
185 Ga0070707_100830796 3300005468 Bacteria 888
186 Ga0070707_101278154 3300005468 Bacteria 700
187 Ga0070698_100111960 3300005471 Bacteria 2694
188 Ga0070698_100310463 3300005471 Bacteria 1508
189 Ga0070698_100343918 3300005471 Bacteria 1423
190 Ga0070698_100798709 3300005471 Bacteria 888
191 Ga0070699_100000613 3300005518 Bacteria 33675
192 Ga0070699_100114541 3300005518 Bacteria 2369
193 Ga0070699_100281441 3300005518 Bacteria 1490
194 Ga0070699_100956386 3300005518 Unclassified 785
195 Ga0070699_101595553 3300005518 Bacteria 598
196 Ga0070679_100002755 3300005530 Bacteria 15989
197 Ga0070679_100128287 3300005530 Bacteria 2518
198 Ga0070679_100199295 3300005530 Bacteria 1969
199 Ga0070679_101187955 3300005530 Bacteria 708
200 Ga0070684_100833966 3300005535 Bacteria 863
201 Ga0070684_101670459 3300005535 Unclassified 601
202 Ga0070697_100387720 3300005536 Bacteria 1211
203 Ga0070697_100784477 3300005536 Bacteria 843
204 Ga0070697_100930253 3300005536 Bacteria 772
205 Ga0070697_101187550 3300005536 Bacteria 680
206 Ga0068853_101045053 3300005539 Bacteria 787
207 Ga0068853_101709198 3300005539 Bacteria 610
208 Ga0068853_101745262 3300005539 Bacteria 603
209 Ga0068853_101946303 3300005539 Bacteria 570
210 Ga0070672_100134927 3300005543 Bacteria 2032
211 Ga0070672_100257890 3300005543 Bacteria 1470
212 Ga0070672_100265134 3300005543 Bacteria 1449
213 Ga0070672_100356965 3300005543 Bacteria 1247
214 Ga0070672_100399352 3300005543 Bacteria 1178
215 Ga0070672_100495923 3300005543 Bacteria 1056
216 Ga0070672_100908821 3300005543 Bacteria 778
217 Ga0070686_100000398 3300005544 Bacteria 27472
218 Ga0070686_100248760 3300005544 Bacteria 1297
219 Ga0070686_101201621 3300005544 Bacteria 630
220 Ga0070686_101918204 3300005544 Unclassified 506
221 Ga0070695_100005655 3300005545 Bacteria 7366
222 Ga0070695_100056138 3300005545 Bacteria 2540
223 Ga0070695_100684234 3300005545 Bacteria 813
224 Ga0070695_100761749 3300005545 Bacteria 773
225 Ga0070696_100018552 3300005546 Bacteria 4704
226 Ga0070696_100192650 3300005546 Bacteria 1518
227 Ga0070696_100294852 3300005546 Bacteria 1240
228 Ga0070696_101686880 3300005546 Bacteria 546
229 Ga0070693_100108509 3300005547 Bacteria 1703
230 Ga0070693_100336509 3300005547 Bacteria 1029
231 Ga0070693_100514911 3300005547 Bacteria 851
232 Ga0070693_100842005 3300005547 Bacteria 683
233 Ga0070693_100879280 3300005547 Bacteria 670
234 Ga0070693_101481861 3300005547 Bacteria 530
235 Ga0070665_100013036 3300005548 Bacteria 8372
236 Ga0070665_100038174 3300005548 Bacteria 4828
237 Ga0070665_100070161 3300005548 Bacteria 3511
238 Ga0070665_100221597 3300005548 Bacteria 1892
239 Ga0070665_100544389 3300005548 Bacteria 1173
240 Ga0070665_101073068 3300005548 Unclassified 817
241 Ga0070704_100015763 3300005549 Bacteria 4757
242 Ga0070704_100605975 3300005549 Bacteria 963
243 Ga0070704_100837355 3300005549 Bacteria 824
244 Ga0068855_100029977 3300005563 Bacteria 6506
245 Ga0068855_100790640 3300005563 Bacteria 1009
246 Ga0068855_101531359 3300005563 Bacteria 684
247 Ga0070664_100441624 3300005564 Bacteria 1194
248 Ga0070664_100593234 3300005564 Bacteria 1027
249 Ga0070664_100944132 3300005564 Bacteria 809
250 Ga0070664_101068041 3300005564 Bacteria 760
251 Ga0070664_101503164 3300005564 Unclassified 637
252 Ga0070664_101798543 3300005564 Bacteria 581
253 Ga0068857_101392890 3300005577 Bacteria 682
254 Ga0068854_100109159 3300005578 Bacteria 2085
255 Ga0068854_101580977 3300005578 Bacteria 597
256 Ga0068854_101633484 3300005578 Bacteria 588
257 Ga0068854_102213547 3300005578 Bacteria 509
258 Ga0068854_102264036 3300005578 Unclassified 503
259 Ga0068856_100785587 3300005614 Bacteria 972
260 Ga0068856_102702656 3300005614 Bacteria 502
261 Ga0070702_100000788 3300005615 Bacteria 12059
262 Ga0070702_100118095 3300005615 Bacteria 1656
263 Ga0068852_100689536 3300005616 Bacteria 1031
264 Ga0068852_100745807 3300005616 Bacteria 991
265 Ga0068852_100962399 3300005616 Bacteria 872
266 Ga0068859_100055680 3300005617 Bacteria 3979
267 Ga0068859_100593844 3300005617 Bacteria 1201
268 Ga0068859_100733359 3300005617 Bacteria 1078
269 Ga0068859_100856898 3300005617 Bacteria 994
270 Ga0068859_101090896 3300005617 Bacteria 878
271 Ga0068859_101100568 3300005617 Bacteria 874
272 Ga0068859_101982297 3300005617 Bacteria 643
273 Ga0068859_103064992 3300005617 Bacteria 510
274 Ga0068859_103066807 3300005617 Bacteria 510
275 Ga0068864_100014671 3300005618 Bacteria 6506
276 Ga0068864_100106531 3300005618 Bacteria 2493
277 Ga0068864_101166173 3300005618 Bacteria 768
278 Ga0068864_101266742 3300005618 Bacteria 737
279 Ga0068866_10202935 3300005718 Bacteria 1186
280 Ga0068866_10839464 3300005718 Bacteria 642
281 Ga0068866_10974913 3300005718 Bacteria 601
282 Ga0068861_100004702 3300005719 Bacteria 9179
283 Ga0068861_100411556 3300005719 Bacteria 1203
284 Ga0068861_100712062 3300005719 Unclassified 934
285 Ga0068861_100744953 3300005719 Bacteria 915
286 Ga0068861_102356498 3300005719 Bacteria 535
287 Ga0068870_10662672 3300005840 Bacteria 716
288 Ga0068863_100192218 3300005841 Bacteria 1962
289 Ga0068863_100581451 3300005841 Bacteria 1107
290 Ga0068863_100698470 3300005841 Bacteria 1008
291 Ga0068863_100787405 3300005841 Bacteria 948
292 Ga0068863_101394214 3300005841 Unclassified 708
293 Ga0068863_101835923 3300005841 Bacteria 616
294 Ga0068858_100010329 3300005842 Bacteria 8845
295 Ga0068858_100010453 3300005842 Bacteria 8792
296 Ga0068858_100115932 3300005842 Bacteria 2504
297 Ga0068858_100127582 3300005842 Bacteria 2384
298 Ga0068858_100228042 3300005842 Bacteria 1765
299 Ga0068858_100267323 3300005842 Bacteria 1626
300 Ga0068858_100605752 3300005842 Bacteria 1063
301 Ga0068858_101495046 3300005842 Bacteria 666
302 Ga0068860_100050841 3300005843 Bacteria 3944
303 Ga0068860_100318174 3300005843 Bacteria 1527
304 Ga0068860_100867873 3300005843 Unclassified 918
305 Ga0068860_100989716 3300005843 Bacteria 859
306 Ga0068860_101640283 3300005843 Bacteria 665
307 Ga0068860_101738598 3300005843 Unclassified 646
308 Ga0068860_101938937 3300005843 Bacteria 611
309 Ga0068860_101998910 3300005843 Unclassified 601
310 Ga0068860_102069165 3300005843 Bacteria 591
311 Ga0068860_102850708 3300005843 Bacteria 501
312 Ga0068862_100019590 3300005844 Bacteria 5649
313 Ga0068862_100071545 3300005844 Bacteria 2994
314 Ga0068862_100571862 3300005844 Unclassified 1082
315 Ga0068862_101128789 3300005844 Bacteria 780
316 Ga0068862_101321851 3300005844 Bacteria 722
317 Ga0068862_101967436 3300005844 Bacteria 595
318 Ga0068862_102088522 3300005844 Unclassified 578
319 Ga0081455_10012175 3300005937 Bacteria 8592
320 Ga0081455_10015660 3300005937 Bacteria 7354
321 Ga0081455_10408514 3300005937 Bacteria 940
322 Ga0081455_10496974 3300005937 Bacteria 820
323 Ga0081539_10117916 3300005985 Bacteria 1323
324 Ga0081539_10198427 3300005985 Bacteria 929
325 Ga0075364_10193720 3300006051 Bacteria 1377
326 Ga0070715_10835692 3300006163 Bacteria 562
327 Ga0070715_10842195 3300006163 Bacteria 560
328 Ga0070716_100422531 3300006173 Unclassified 964
329 Ga0070716_100464440 3300006173 Bacteria 926
330 Ga0070716_101453395 3300006173 Unclassified 559
331 Ga0070712_100136139 3300006175 Bacteria 1868
332 Ga0075367_10123951 3300006178 Bacteria 1594
333 Ga0075366_10334109 3300006195 Bacteria 929
334 Ga0097621_100000956 3300006237 Bacteria 20258
335 Ga0097621_100013084 3300006237 Bacteria 6171
336 Ga0097621_100071073 3300006237 Bacteria 2875
337 Ga0097621_100201371 3300006237 Bacteria 1728
338 Ga0097621_100234373 3300006237 Bacteria 1603
339 Ga0097621_100285577 3300006237 Bacteria 1454
340 Ga0097621_100339434 3300006237 Bacteria 1334
341 Ga0097621_100414081 3300006237 Bacteria 1209
342 Ga0075370_10362190 3300006353 Bacteria 867
343 Ga0068871_100000863 3300006358 Bacteria 20190
344 Ga0068871_100024422 3300006358 Bacteria 4687
345 Ga0068871_100056540 3300006358 Bacteria 3190
346 Ga0068871_100073351 3300006358 Bacteria 2821
347 Ga0068871_100253407 3300006358 Bacteria 1534
348 Ga0068871_100326410 3300006358 Bacteria 1353
349 Ga0068871_100355859 3300006358 Bacteria 1296
350 Ga0068871_100476504 3300006358 Bacteria 1122
351 Ga0068871_100490804 3300006358 Bacteria 1106
352 Ga0068871_100528882 3300006358 Unclassified 1066
353 Ga0068871_100594781 3300006358 Bacteria 1006
354 Ga0068871_100827819 3300006358 Bacteria 855
355 Ga0068871_100923971 3300006358 Bacteria 810
356 Ga0068871_101342606 3300006358 Bacteria 673
357 Ga0068871_102238611 3300006358 Unclassified 521
358 Ga0075428_100084388 3300006844 Bacteria 3466
359 Ga0075428_100561915 3300006844 Bacteria 1219
360 Ga0075428_100618994 3300006844 Bacteria 1156
361 Ga0075428_101687430 3300006844 Unclassified 661
362 Ga0075428_102409624 3300006844 Bacteria 540
363 Ga0075428_102476536 3300006844 Bacteria 532
364 Ga0075431_100097510 3300006847 Bacteria 3036
365 Ga0075431_101746041 3300006847 Bacteria 579
366 Ga0075433_10132512 3300006852 Bacteria 2214
367 Ga0075433_10161487 3300006852 Bacteria 1994
368 Ga0075433_10298297 3300006852 Bacteria 1427
369 Ga0075433_10433488 3300006852 Bacteria 1159
370 Ga0075433_10511207 3300006852 Bacteria 1057
371 Ga0075433_10652461 3300006852 Bacteria 923
372 Ga0075433_10789944 3300006852 Bacteria 830
373 Ga0075434_100001123 3300006871 Bacteria 22004
374 Ga0075434_100007156 3300006871 Bacteria 10315
375 Ga0075434_100012495 3300006871 Bacteria 8053
376 Ga0075434_100027992 3300006871 Bacteria 5534
377 Ga0075434_100198101 3300006871 Bacteria 2028
378 Ga0075434_100307655 3300006871 Bacteria 1605
379 Ga0075434_100315494 3300006871 Bacteria 1584
380 Ga0075434_100435343 3300006871 Bacteria 1332
381 Ga0075434_100911454 3300006871 Bacteria 894
382 Ga0075434_100960715 3300006871 Bacteria 869
383 Ga0075434_101209296 3300006871 Bacteria 768
384 Ga0075429_100415025 3300006880 Bacteria 1179
385 Ga0075429_100435972 3300006880 Bacteria 1148
386 Ga0075429_101286491 3300006880 Bacteria 638
387 Ga0068865_100051191 3300006881 Bacteria 2857
388 Ga0068865_100135853 3300006881 Bacteria 1848
389 Ga0068865_100347939 3300006881 Bacteria 1200
390 Ga0068865_100507127 3300006881 Bacteria 1007
391 Ga0068865_100593902 3300006881 Bacteria 935
392 Ga0068865_100770153 3300006881 Bacteria 828
393 Ga0068865_100842651 3300006881 Bacteria 794
394 Ga0068865_101664061 3300006881 Unclassified 575
395 Ga0075436_100004597 3300006914 Bacteria 9457
396 Ga0075436_100027306 3300006914 Bacteria 3929
397 Ga0075436_100075038 3300006914 Bacteria 2341
398 Ga0075436_100158235 3300006914 Bacteria 1596
399 Ga0075436_100324116 3300006914 Bacteria 1107
400 Ga0075436_100433008 3300006914 Bacteria 956
401 Ga0075436_101063490 3300006914 Bacteria 608
402 Ga0075436_101376270 3300006914 Bacteria 535
403 Ga0097620_100055681 3300006931 Bacteria 3979
404 Ga0097620_100593839 3300006931 Bacteria 1201
405 Ga0097620_100733336 3300006931 Bacteria 1078
406 Ga0097620_100856858 3300006931 Bacteria 994
407 Ga0097620_101090935 3300006931 Bacteria 878
408 Ga0097620_101100300 3300006931 Bacteria 874
409 Ga0097620_101982301 3300006931 Bacteria 643
410 Ga0097620_103064174 3300006931 Bacteria 510
411 Ga0097620_103067133 3300006931 Bacteria 510
412 Ga0075435_100000346 3300007076 Bacteria 28639
413 Ga0075435_100002191 3300007076 Bacteria 12888
414 Ga0075435_100006443 3300007076 Bacteria 8302
415 Ga0075435_100074250 3300007076 Bacteria 2781
416 Ga0075435_100114047 3300007076 Bacteria 2250
417 Ga0075435_100241391 3300007076 Bacteria 1537
418 Ga0075435_100247645 3300007076 Bacteria 1517
419 Ga0075435_101039361 3300007076 Bacteria 716
420 Ga0099794_10319170 3300007265 Bacteria 806
421 Ga0099795_10554052 3300007788 Bacteria 542
422 Ga0105240_10197491 3300009093 Bacteria 2360
423 Ga0105240_10272035 3300009093 Bacteria 1950
424 Ga0105240_10295893 3300009093 Bacteria 1853
425 Ga0105240_10682699 3300009093 Bacteria 1123
426 Ga0105240_10760612 3300009093 Bacteria 1053
427 Ga0105240_12342393 3300009093 Bacteria 553
428 Ga0111539_10011775 3300009094 Bacteria 10966
429 Ga0111539_10037680 3300009094 Bacteria 5838
430 Ga0111539_10295942 3300009094 Bacteria 1884
431 Ga0111539_10527619 3300009094 Bacteria 1375
432 Ga0111539_12091518 3300009094 Bacteria 657
433 Ga0111539_12776410 3300009094 Unclassified 567
434 Ga0111539_13268197 3300009094 Bacteria 522
435 Ga0105245_10079092 3300009098 Bacteria 3001
436 Ga0105245_10190406 3300009098 Bacteria 1964
437 Ga0105245_10214066 3300009098 Bacteria 1856
438 Ga0105245_10413086 3300009098 Bacteria 1351
439 Ga0105245_10765842 3300009098 Bacteria 1002
440 Ga0105245_11543011 3300009098 Bacteria 715
441 Ga0105245_11546222 3300009098 Bacteria 715
442 Ga0105245_11680614 3300009098 Bacteria 687
443 Ga0105245_11809017 3300009098 Unclassified 664
444 Ga0105247_10062089 3300009101 Bacteria 2317
445 Ga0105247_10878360 3300009101 Bacteria 691
446 Ga0114129_10006904 3300009147 Bacteria 16150
447 Ga0114129_10014362 3300009147 Bacteria 11288
448 Ga0114129_10269687 3300009147 Bacteria 2278
449 Ga0114129_10277870 3300009147 Bacteria 2238
450 Ga0114129_10310751 3300009147 Bacteria 2098
451 Ga0114129_10364435 3300009147 Bacteria 1911
452 Ga0114129_10440484 3300009147 Bacteria 1710
453 Ga0114129_10557105 3300009147 Bacteria 1490
454 Ga0114129_11085495 3300009147 Bacteria 1003
455 Ga0114129_11654732 3300009147 Bacteria 782
456 Ga0105243_10369906 3300009148 Bacteria 1322
457 Ga0105243_10480377 3300009148 Bacteria 1173
458 Ga0105243_10924100 3300009148 Bacteria 869
459 Ga0105243_11028031 3300009148 Bacteria 828
460 Ga0105243_11138498 3300009148 Bacteria 790
461 Ga0105243_12012122 3300009148 Unclassified 612
462 Ga0105243_12208787 3300009148 Bacteria 587
463 Ga0105241_10165881 3300009174 Bacteria 1820
464 Ga0105241_10237682 3300009174 Bacteria 1539
465 Ga0105241_10907827 3300009174 Bacteria 818
466 Ga0105242_10004492 3300009176 Bacteria 10837
467 Ga0105242_10015128 3300009176 Bacteria 5989
468 Ga0105242_10030212 3300009176 Bacteria 4326
469 Ga0105242_10233899 3300009176 Bacteria 1648
470 Ga0105242_10266216 3300009176 Bacteria 1550
471 Ga0105242_10423041 3300009176 Bacteria 1249
472 Ga0105242_10431993 3300009176 Bacteria 1237
473 Ga0105242_10455083 3300009176 Bacteria 1207
474 Ga0105242_11182024 3300009176 Unclassified 783
475 Ga0105242_11365609 3300009176 Bacteria 735
476 Ga0105242_11447885 3300009176 Bacteria 716
477 Ga0105248_10005114 3300009177 Bacteria 14471
478 Ga0105248_10011453 3300009177 Bacteria 9774
479 Ga0105248_10013748 3300009177 Bacteria 8910
480 Ga0105248_10024496 3300009177 Bacteria 6710
481 Ga0105248_10081935 3300009177 Bacteria 3628
482 Ga0105248_10109794 3300009177 Bacteria 3110
483 Ga0105248_10134818 3300009177 Bacteria 2786
484 Ga0105248_10173082 3300009177 Bacteria 2433
485 Ga0105248_10173497 3300009177 Bacteria 2430
486 Ga0105248_10175229 3300009177 Bacteria 2418
487 Ga0105248_10285486 3300009177 Bacteria 1858
488 Ga0105248_10325824 3300009177 Bacteria 1730
489 Ga0105248_10741913 3300009177 Bacteria 1108
490 Ga0105248_10830033 3300009177 Bacteria 1043
491 Ga0105248_11020408 3300009177 Bacteria 935
492 Ga0105248_11048116 3300009177 Bacteria 921
493 Ga0105248_11510734 3300009177 Bacteria 760
494 Ga0105248_11794010 3300009177 Bacteria 696
495 Ga0105248_12092501 3300009177 Unclassified 644
496 Ga0105248_12978272 3300009177 Bacteria 540
497 Ga0105237_10345602 3300009545 Bacteria 1492
498 Ga0105237_11409866 3300009545 Bacteria 703
499 Ga0105238_11712959 3300009551 Bacteria 660
500 Ga0105249_10428589 3300009553 Bacteria 1358
501 Ga0105249_10534380 3300009553 Bacteria 1221
502 Ga0105249_11943892 3300009553 Bacteria 661
503 Ga0105249_12915899 3300009553 Unclassified 549
504 Ga0105239_11426051 3300010375 Bacteria 800
505 Ga0105246_11906787 3300011119 Bacteria 571
506 Ga0157344_1016644 3300012476 Bacteria 596
507 Ga0157325_1001005 3300012485 Bacteria 1215
508 Ga0157323_1021457 3300012495 Unclassified 619
509 Ga0157319_1001779 3300012497 Bacteria 1160
510 Ga0157339_1017659 3300012505 Unclassified 727
511 Ga0157342_1030137 3300012507 Bacteria 679
512 Ga0157370_10777447 3300013104 Bacteria 872
513 Ga0157369_10682816 3300013105 Unclassified 1058
514 Ga0157374_10102664 3300013296 Bacteria 2743
515 Ga0157374_10790683 3300013296 Bacteria 964
516 Ga0157374_11964031 3300013296 Unclassified 611
517 Ga0157378_10008843 3300013297 Bacteria 8761
518 Ga0157378_10348390 3300013297 Bacteria 1446
519 Ga0157378_10394930 3300013297 Bacteria 1361
520 Ga0157378_10574537 3300013297 Bacteria 1136
521 Ga0157378_10791447 3300013297 Bacteria 973
522 Ga0157378_11065322 3300013297 Bacteria 845
523 Ga0157378_11308212 3300013297 Bacteria 766
524 Ga0157378_11745353 3300013297 Bacteria 670
525 Ga0157378_12547223 3300013297 Bacteria 564
526 Ga0163162_10042153 3300013306 Bacteria 4567
527 Ga0163162_10142812 3300013306 Bacteria 2508
528 Ga0163162_10982692 3300013306 Bacteria 954
529 Ga0157375_10094347 3300013308 Bacteria 3061
530 Ga0157375_10194844 3300013308 Bacteria 2181
531 Ga0157375_10329866 3300013308 Bacteria 1691
532 Ga0157375_10376384 3300013308 Bacteria 1586
533 Ga0157375_12107819 3300013308 Bacteria 671
534 Ga0157375_13426813 3300013308 Unclassified 528
535 Ga0157375_13655880 3300013308 Bacteria 511
536 Ga0163163_10000042 3300014325 Bacteria 138794
537 Ga0163163_10017121 3300014325 Bacteria 6751
538 Ga0163163_10101493 3300014325 Bacteria 2899
539 Ga0163163_10134947 3300014325 Bacteria 2509
540 Ga0163163_10759935 3300014325 Bacteria 1033
541 Ga0163163_11007159 3300014325 Bacteria 896
542 Ga0163163_11284745 3300014325 Bacteria 794
543 Ga0157380_10309275 3300014326 Bacteria 1460
544 Ga0157380_10620234 3300014326 Bacteria 1073
545 Ga0157380_10663702 3300014326 Bacteria 1042
546 Ga0157380_10829187 3300014326 Unclassified 945
547 Ga0157380_11093736 3300014326 Bacteria 836
548 Ga0157380_11138682 3300014326 Bacteria 821
549 Ga0157380_11223645 3300014326 Bacteria 795
550 Ga0157380_11795841 3300014326 Bacteria 672
551 Ga0157377_10162394 3300014745 Bacteria 1390
552 Ga0157377_10686180 3300014745 Bacteria 742
553 Ga0157379_10012034 3300014968 Bacteria 7558
554 Ga0157379_10044286 3300014968 Bacteria 3972
555 Ga0157379_10048580 3300014968 Bacteria 3787
556 Ga0157379_10599178 3300014968 Bacteria 1028
557 Ga0157379_11121133 3300014968 Bacteria 754
558 Ga0157376_10180212 3300014969 Bacteria 1931
559 Ga0157376_10183434 3300014969 Bacteria 1915
560 Ga0157376_10188046 3300014969 Bacteria 1892
561 Ga0157376_10189400 3300014969 Bacteria 1886
562 Ga0157376_10270943 3300014969 Bacteria 1595
563 Ga0157376_10725673 3300014969 Bacteria 1001
564 Ga0157376_10767845 3300014969 Bacteria 974
565 Ga0157376_10849168 3300014969 Bacteria 928
566 Ga0206356_11573733 3300020070 Bacteria 1263
567 Ga0207697_10320890 3300025315 Bacteria 687
568 Ga0207692_10676306 3300025898 Bacteria 668
569 Ga0207680_10476567 3300025903 Bacteria 887
570 Ga0207685_10605588 3300025905 Bacteria 588
571 Ga0207685_10637188 3300025905 Bacteria 575
572 Ga0207654_11096630 3300025911 Unclassified 580
573 Ga0207707_10402503 3300025912 Bacteria 1175
574 Ga0207695_11522100 3300025913 Bacteria 549
575 Ga0207663_11005209 3300025916 Bacteria 669
576 Ga0207660_10302093 3300025917 Bacteria 1274
577 Ga0207662_10191413 3300025918 Bacteria 1320
578 Ga0207652_10083730 3300025921 Bacteria 2793
579 Ga0207681_11643387 3300025923 Bacteria 537
580 Ga0207650_10362306 3300025925 Bacteria 1195
581 Ga0207650_10708822 3300025925 Bacteria 850
582 Ga0207659_10087940 3300025926 Bacteria 2314
583 Ga0207659_11716617 3300025926 Bacteria 534
584 Ga0207644_10619102 3300025931 Bacteria 900
585 Ga0207644_11827006 3300025931 Bacteria 508
586 Ga0207690_10077663 3300025932 Bacteria 2308
587 Ga0207686_11018449 3300025934 Bacteria 672
588 Ga0207670_10192727 3300025936 Bacteria 1543
589 Ga0207670_10475101 3300025936 Bacteria 1012
590 Ga0207704_10076513 3300025938 Bacteria 2145
591 Ga0207704_10505974 3300025938 Bacteria 974
592 Ga0207691_10030055 3300025940 Bacteria 5080
593 Ga0207711_10025323 3300025941 Bacteria 4978
594 Ga0207711_10107326 3300025941 Bacteria 2479
595 Ga0207711_10180641 3300025941 Bacteria 1919
596 Ga0207711_10946580 3300025941 Unclassified 800
597 Ga0207689_11519816 3300025942 Bacteria 559
598 Ga0207679_10530954 3300025945 Bacteria 1053
599 Ga0207679_11210572 3300025945 Bacteria 693
600 Ga0207651_11170471 3300025960 Bacteria 690
601 Ga0207668_11280176 3300025972 Bacteria 660
602 Ga0207640_10815654 3300025981 Bacteria 809
603 Ga0207658_10447005 3300025986 Bacteria 1144
604 Ga0207677_10380258 3300026023 Bacteria 1192
605 Ga0207677_10677170 3300026023 Bacteria 913
606 Ga0207703_10480837 3300026035 Bacteria 1164
607 Ga0207703_10838816 3300026035 Bacteria 879
608 Ga0207639_10906781 3300026041 Bacteria 824
609 Ga0207639_11513629 3300026041 Bacteria 630
610 Ga0207708_10273835 3300026075 Bacteria 1366
611 Ga0207648_10017511 3300026089 Bacteria 6515
612 Ga0207648_12159001 3300026089 Bacteria 518
613 Ga0207676_11611329 3300026095 Bacteria 647
614 Ga0207675_100491996 3300026118 Bacteria 1220
615 Ga0207683_10159758 3300026121 Bacteria 2037
616 Ga0307408_100034661 3300031548 Bacteria 3537
617 Ga0307408_100592284 3300031548 Bacteria 984
618 Ga0265313_10217596 3300031595 Bacteria 789
619 Ga0307405_10036831 3300031731 Bacteria 2935
620 Ga0307405_10896664 3300031731 Unclassified 750
621 Ga0307413_10381605 3300031824 Bacteria 1098
622 Ga0307406_10315222 3300031901 Bacteria 1207
623 Ga0307407_10147460 3300031903 Bacteria 1525
624 Ga0307412_10046022 3300031911 Bacteria 2856
625 Ga0307412_10391283 3300031911 Bacteria 1129
626 Ga0307416_100397917 3300032002 Bacteria 1414
627 Ga0307416_100728649 3300032002 Bacteria 1083
628 Ga0307416_100945560 3300032002 Bacteria 963
629 Ga0307416_103439373 3300032002 Bacteria 530
630 Ga0307411_10070160 3300032005 Bacteria 2370
631 Ga0307415_100806130 3300032126 Bacteria 857
632 Ga0373948_0058975 3300034817 Bacteria 839
633 Ga0373934_0015682 3300035086 Bacteria 2876
634 Ga0373934_0363445 3300035086 Bacteria 603
635 Ga0373923_0030854 3300035111 Bacteria 2158
636 Ga0373923_0154977 3300035111 Bacteria 1042
637 Ga0373923_0236601 3300035111 Bacteria 852
638 Ga0373936_0101907 3300035113 Bacteria 1212
639 Ga0373936_0277894 3300035113 Bacteria 752
640 Ga0373945_0100847 3300035116 Bacteria 1129
641 Ga0373953_0103858 3300035117 Bacteria 1198
642 Ga0373953_0203153 3300035117 Bacteria 857
643 Ga0373954_0355986 3300035118 Bacteria 723
644 Ga0373954_0497676 3300035118 Bacteria 604
645 Ga0373956_0098234 3300035119 Bacteria 1356
646 Ga0373956_0147933 3300035119 Bacteria 1104
647 Ga0373956_0297739 3300035119 Bacteria 768
648 Ga0373957_0014815 3300035120 Bacteria 2672
649 Ga0373957_0025497 3300035120 Bacteria 2131
650 Ga0373957_0101243 3300035120 Bacteria 1154
651 Ga0373943_0015259 3300035170 Bacteria 3488
652 Ga0373946_0019054 3300035171 Bacteria 2640
653 Ga0373955_0004427 3300035172 Bacteria 6223
654 Ga0373955_0049192 3300035172 Bacteria 2288
655 Ga0373955_0236627 3300035172 Bacteria 1093
656 Ga0373924_0006091 3300035410 Bacteria 4307
657 Ga0373924_0049820 3300035410 Bacteria 1734
658 Ga0373931_1213356 3300035691 Bacteria 517
659 Ga0373935_0040221 3300035692 Bacteria 2934
660 Ga0373935_0455264 3300035692 Bacteria 925
661 Ga0373927_0451093 3300035695 Bacteria 849
662 Ga0373933_0012176 3300035724 Bacteria 4752
663 Ga0373933_0323504 3300035724 Bacteria 1000
664 Ga0373933_0672220 3300035724 Bacteria 681
665 Ga0373947_0019450 3300035725 Bacteria 3915
666 Ga0373947_0239788 3300035725 Bacteria 1196
667 Ga0373937_0000796 3300036401 Bacteria 27033
668 Ga0373937_0298578 3300036401 Bacteria 1522
669 Ga0373937_0517297 3300036401 Bacteria 1134
670 Ga0373925_0014368 3300037068 Bacteria 5728
671 Ga0373925_0587565 3300037068 Bacteria 917
672 Ga0373925_1072873 3300037068 Bacteria 663
673 Ga0373925_1662438 3300037068 Bacteria 522
674 Ga0395905_0771778 3300037471 Unclassified 864
675 Ga0436361_0941465 3300039447 Unclassified 583
676 Ga0439436_0169983 3300041404 Bacteria 618
677 Ga0439433_0027524 3300041999 Bacteria 1290
678 Ga0439462_0014960 3300042015 Bacteria 1997
679 Ga0439446_0187402 3300042156 Unclassified 694
680 Ga0439460_0246921 3300042461 Bacteria 616
681 Ga0466957_1179221 3300044842 Bacteria 554
682 Ga0466958_1031584 3300045836 Bacteria 537
683 Ga0495592_0035807 3300046454 Bacteria 3740
684 Ga0495592_0100507 3300046454 Bacteria 2062
685 Ga0495629_0136719 3300046459 Bacteria 1706
686 Ga0495629_0229489 3300046459 Bacteria 1280
687 Ga0495651_0124151 3300046462 Bacteria 1892
688 Ga0495651_0183551 3300046462 Bacteria 1479
689 Ga0495653_0548011 3300046463 Unclassified 716
690 Ga0495580_0058380 3300046472 Bacteria 2714
691 Ga0495582_0167747 3300046473 Bacteria 1249
692 Ga0495662_0211172 3300046476 Bacteria 957
693 Ga0495662_0403676 3300046476 Bacteria 671
694 Ga0495608_0009283 3300046511 Bacteria 6877
695 Ga0495618_0225938 3300046514 Bacteria 1180
696 Ga0495618_0315567 3300046514 Bacteria 969
697 Ga0495628_0031085 3300046516 Bacteria 4319
698 Ga0495628_0087394 3300046516 Bacteria 2417
699 Ga0495628_0257958 3300046516 Bacteria 1300
700 Ga0495630_0073969 3300046517 Bacteria 2566
701 Ga0495652_0358108 3300046529 Bacteria 1043
702 Ga0495652_0549617 3300046529 Bacteria 794
703 Ga0495665_0205220 3300046531 Bacteria 1021
704 Ga0495665_0528461 3300046531 Bacteria 593
705 Ga0495640_0072929 3300046533 Bacteria 2299
706 Ga0495640_0824679 3300046533 Unclassified 552
707 Ga0495586_0161034 3300046535 Bacteria 1266
708 Ga0495587_0036174 3300046536 Bacteria 2971
709 Ga0495621_0176703 3300046539 Bacteria 850
710 Ga0495645_0058353 3300046543 Bacteria 2800
711 Ga0495645_0140856 3300046543 Bacteria 1682
712 Ga0495667_0032780 3300046559 Bacteria 3479
713 Ga0495634_0525677 3300046642 Bacteria 692
714 Ga0495634_0597494 3300046642 Bacteria 641
715 Ga0495599_0211370 3300046678 Bacteria 1189
716 Ga0495599_0234082 3300046678 Bacteria 1121
717 Ga0495599_0408494 3300046678 Bacteria 808
718 Ga0495623_0091537 3300046679 Bacteria 1866
719 Ga0495647_0149342 3300046681 Bacteria 1001
720 Ga0495658_0211331 3300046683 Bacteria 1212
721 Ga0495658_0314770 3300046683 Bacteria 991
722 Ga0495669_0000860 3300046684 Bacteria 12848
723 Ga0495613_0009892 3300046689 Bacteria 7089
724 Ga0495613_0342743 3300046689 Bacteria 1028
725 Ga0495624_0557878 3300046690 Bacteria 684
726 Ga0495670_0390925 3300046691 Bacteria 751
727 Ga0495600_0262080 3300046809 Bacteria 1098
728 Ga0495600_0716977 3300046809 Unclassified 601
729 Ga0495581_0676392 3300047315 Bacteria 596
730 Ga0495604_0317864 3300047317 Bacteria 1041
731 Ga0495674_0031396 3300047319 Bacteria 4826
732 Ga0495674_0497078 3300047319 Bacteria 976
733 Ga0495680_0120445 3300047322 Bacteria 1938
734 Ga0495684_0000549 3300047471 Bacteria 30432
735 Ga0495684_0296280 3300047471 Bacteria 1163
736 Ga0496104_0572432 3300048907 Bacteria 1040
737 Ga0496104_1177394 3300048907 Bacteria 670
738 Ga0496105_0179896 3300048908 Bacteria 1732
739 Ga0496106_1356298 3300048909 Unclassified 551
740 Ga0496108_0850237 3300048911 Bacteria 785
741 Ga0496110_0126468 3300048913 Bacteria 2306
742 Ga0496110_0933599 3300048913 Bacteria 774
743 Ga0496110_1200569 3300048913 Bacteria 667
744 Ga0496113_0319238 3300048916 Bacteria 1245
745 Ga0496114_0181747 3300048917 Bacteria 1837
746 Ga0496119_0000766 3300048922 Bacteria 43156
747 Ga0496122_0003989 3300048925 Bacteria 18819
748 Ga0496123_0000732 3300048926 Bacteria 53376
749 Ga0496124_0530540 3300048927 Bacteria 782
750 Ga0501301_048223 3300049524 Bacteria 501
751 Ga0501031_0044402 3300049568 Bacteria 2900
752 Ga0501032_0012637 3300049569 Bacteria 6024
753 Ga0501032_0021634 3300049569 Bacteria 4470
754 Ga0501032_0316021 3300049569 Bacteria 1008
755 Ga0501033_0005639 3300049570 Bacteria 9889
756 Ga0501033_0010094 3300049570 Bacteria 7246
757 Ga0501033_0011790 3300049570 Bacteria 6681
758 Ga0501034_0029118 3300049571 Bacteria 5614
759 Ga0501034_0098668 3300049571 Bacteria 2916
760 Ga0501034_0240253 3300049571 Bacteria 1757
761 Ga0501036_0001004 3300049572 Bacteria 21312
762 Ga0501036_0010148 3300049572 Bacteria 7761
763 Ga0501036_0237292 3300049572 Bacteria 1529
764 Ga0501037_0001467 3300049573 Bacteria 17296
765 Ga0501037_0097975 3300049573 Bacteria 2118
766 Ga0501037_0101893 3300049573 Bacteria 2071
767 Ga0501038_0003829 3300049574 Bacteria 13993
768 Ga0501038_0007413 3300049574 Bacteria 10119
769 Ga0501038_0033577 3300049574 Bacteria 4519
770 Ga0501039_0029082 3300049575 Bacteria 4255
771 Ga0501039_0627984 3300049575 Bacteria 841
772 Ga0501040_0048416 3300049576 Bacteria 2905
773 Ga0501041_1103336 3300049577 Bacteria 511
774 Ga0501042_0013950 3300049578 Bacteria 5474
775 Ga0501042_0126514 3300049578 Bacteria 1840
776 Ga0501043_0011314 3300049579 Bacteria 6983
777 Ga0501043_0016104 3300049579 Bacteria 5864
778 Ga0501043_0018766 3300049579 Bacteria 5427
779 Ga0501046_0020967 3300049580 Bacteria 5395
780 Ga0501046_0032453 3300049580 Bacteria 4228
781 Ga0501046_0089661 3300049580 Bacteria 2366
782 Ga0501047_0004046 3300049581 Bacteria 13787
783 Ga0501047_0036698 3300049581 Bacteria 4737
784 Ga0501047_1448395 3300049581 Bacteria 502
785 Ga0501048_0001810 3300049582 Bacteria 16239
786 Ga0501048_0069114 3300049582 Bacteria 2494
787 Ga0501048_0247396 3300049582 Bacteria 1265
788 Ga0501048_0767252 3300049582 Bacteria 693
789 Ga0501067_0000955 3300049583 Bacteria 15486
790 Ga0501067_0031037 3300049583 Bacteria 2965
791 Ga0501067_0059513 3300049583 Bacteria 2114
792 Ga0501067_0598232 3300049583 Bacteria 618
793 Ga0501068_0018472 3300049584 Bacteria 4037
794 Ga0501068_0023853 3300049584 Bacteria 3587
795 Ga0501068_0024708 3300049584 Bacteria 3529
796 Ga0501069_0008665 3300049585 Bacteria 5356
797 Ga0501069_0010899 3300049585 Bacteria 4817
798 Ga0501069_0087945 3300049585 Bacteria 1755
799 Ga0501070_0012349 3300049586 Bacteria 7205
800 Ga0501070_0034161 3300049586 Bacteria 4253
801 Ga0501070_0090742 3300049586 Bacteria 2528
802 Ga0501071_0002605 3300049587 Bacteria 11026
803 Ga0501071_0219436 3300049587 Bacteria 1431
804 Ga0501072_0205685 3300049588 Bacteria 1569
805 Ga0501073_0000607 3300049589 Bacteria 25259
806 Ga0501073_0019730 3300049589 Bacteria 4865
807 Ga0501073_0144017 3300049589 Bacteria 1651
808 Ga0501074_0013369 3300049590 Bacteria 5968
809 Ga0501074_0014973 3300049590 Bacteria 5643
810 Ga0501076_0043502 3300049592 Bacteria 3539
811 Ga0501076_0730223 3300049592 Bacteria 817
812 Ga0501079_0001009 3300049741 Bacteria 19500
813 Ga0501079_0001893 3300049741 Bacteria 14994
814 Ga0501079_0154043 3300049741 Bacteria 1791
815 Ga0501080_0023231 3300049742 Bacteria 5749
816 Ga0501080_0081857 3300049742 Bacteria 2998
817 Ga0501080_0469448 3300049742 Bacteria 1126
818 Ga0501083_0045319 3300049744 Bacteria 2975
819 Ga0501083_0085495 3300049744 Bacteria 2086
820 Ga0501083_0101187 3300049744 Bacteria 1900
821 Ga0501035_0022938 3300049822 Bacteria 5729
822 Ga0501035_0035560 3300049822 Bacteria 4519
823 Ga0501035_0257988 3300049822 Bacteria 1478
824 Ga0501044_0007201 3300049823 Bacteria 12235
825 Ga0501044_0043490 3300049823 Bacteria 4665
826 Ga0501044_0912941 3300049823 Bacteria 752
827 Ga0501045_0031192 3300049824 Bacteria 3860
828 Ga0501045_0150501 3300049824 Bacteria 1731
829 nmdc:mga0k408_711639_c1 3300050493 Bacteria 588
830 nmdc:mga05p37_1001886_c1 3300050507 Bacteria 887
831 nmdc:mga05p37_683663_c1 3300050507 Bacteria 1143
832 nmdc:mga08x19_59538_c1 3300050514 Bacteria 2473
833 nmdc:mga0a205_1148255_c1 3300050515 Unclassified 624
834 Ga0495601_0007465 3300053077 Bacteria 6414
835 Ga0495601_0343948 3300053077 Bacteria 970
836 Ga0495601_0466288 3300053077 Bacteria 816
837 Ga0495595_0234157 3300053084 Bacteria 918
838 Ga0495595_0502307 3300053084 Bacteria 618
839 Ga0495619_0003759 3300053085 Bacteria 9772
840 Ga0495619_0052044 3300053085 Bacteria 2707
841 Ga0495619_0915597 3300053085 Bacteria 589
842 Ga0500556_0000036 3300053104 Bacteria 144864
843 Ga0500592_024927 3300053116 Bacteria 965
844 Ga0500652_016472 3300053131 Bacteria 2690
845 Ga0500616_0120243 3300053153 Bacteria 1256
846 Ga0500645_004699 3300053730 Bacteria 5186
847 Ga0501084_0008081 3300054114 Bacteria 8665
848 Ga0501084_0036152 3300054114 Bacteria 4126
849 Ga0501084_0292233 3300054114 Bacteria 1376
850 Ga0501082_0006743 3300060353 Bacteria 9927
851 Ga0501082_0122537 3300060353 Bacteria 2254
852 Ga0501082_0438047 3300060353 Bacteria 1141
853 Ga0501082_0472008 3300060353 Bacteria 1096
854 Ga0070710_10908686
855 JGI24034J26672_10114255
856 JGI24751J29686_10015939
857 JGI24751J29686_10041066
858 JGI24751J29686_10076684
859 JGI24751J29686_10110809
860 JGI25406J46586_10175071
861 Ga0058861_11877824
862 Ga0065714_10159535
863 Ga0065704_10500566
864 Ga0065704_10700005
865 Ga0065712_10081290
866 Ga0065712_10103693
867 Ga0065712_10135607
868 Ga0065712_10179708
869 Ga0065715_10025302
870 Ga0065715_10278577
871 Ga0065715_10283309
872 Ga0065715_10324553
873 Ga0065715_10383109
874 Ga0065707_10050251
875 Ga0065707_10491417
876 Ga0065707_10517758
877 Ga0065707_11022106
878 Ga0070658_10377277
879 Ga0070658_11972009
880 Ga0070676_10102455
881 Ga0070676_10551862
882 Ga0070676_11327627
883 Ga0070676_11331301
884 Ga0070683_100070671
885 Ga0070683_100652991
886 Ga0070690_100002272
887 Ga0070690_101108744
888 Ga0070690_101499862
889 Ga0070670_100007985
890 Ga0070670_100043598
891 Ga0070670_100292550
892 Ga0070670_100310331
893 Ga0070670_100482882
894 Ga0070670_101039606
895 Ga0070670_101208262
896 Ga0070670_101622043
897 Ga0070670_101634213
898 Ga0070677_10026524
899 Ga0070677_10639717
900 Ga0070677_10781274
901 Ga0068869_100538527
902 Ga0068869_100672154
903 Ga0070666_10069241
904 Ga0070666_10098067
905 Ga0070666_10181420
906 Ga0070666_10501820
907 Ga0070666_10515118
908 Ga0070666_11140581
909 Ga0070666_11261595
910 Ga0070666_11496935
911 Ga0070682_101257703
912 Ga0068868_100079152
913 Ga0068868_100148056
914 Ga0068868_100653349
915 Ga0068868_100660013
916 Ga0068868_100662974
917 Ga0068868_100838288
918 Ga0068868_101291274
919 Ga0070660_100005652
920 Ga0070660_100341137
921 Ga0070689_100136707
922 Ga0070689_100174750
923 Ga0070689_100189127
924 Ga0070689_100218139
925 Ga0070689_100227523
926 Ga0070689_100231002
927 Ga0070689_100777528
928 Ga0070689_102146441
929 Ga0070691_10000294
930 Ga0070687_100164431
931 Ga0070687_100238090
932 Ga0070687_100311981
933 Ga0070687_101383323
934 Ga0070668_100045224
935 Ga0070668_100752731
936 Ga0070668_101155903
937 Ga0070668_101347123
938 Ga0070668_101732371
939 Ga0070668_102204480
940 Ga0070669_100010029
941 Ga0070669_100031184
942 Ga0070669_100153832
943 Ga0070669_100441825
944 Ga0070675_100022847
945 Ga0070675_100025171
946 Ga0070675_100031919
947 Ga0070675_100272877
948 Ga0070675_101472764
949 Ga0070675_101953407
950 Ga0070671_100018425
951 Ga0070671_100475726
952 Ga0070671_100585171
953 Ga0070671_101174011
954 Ga0070671_101976532
955 Ga0070674_100129654
956 Ga0070674_100388075
957 Ga0070674_101211335
958 Ga0070674_101590357
959 Ga0070673_100208496
960 Ga0070673_100318839
961 Ga0070673_100587187
962 Ga0070673_100762082
963 Ga0070673_101059116
964 Ga0070673_101423220
965 Ga0070673_102031198
966 Ga0070673_102201291
967 Ga0070688_100025142
968 Ga0070688_100075925
969 Ga0070688_100076431
970 Ga0070688_100157904
971 Ga0070688_100747506
972 Ga0070688_101011727
973 Ga0070688_101048846
974 Ga0070688_101128796
975 Ga0070659_100099115
976 Ga0070659_100598550
977 Ga0070659_101830385
978 Ga0070667_100023919
979 Ga0070667_100192362
980 Ga0070667_100312455
981 Ga0070667_100771462
982 Ga0070667_100883092
983 Ga0070703_10100431
984 Ga0070703_10103558
985 Ga0070709_10011948
986 Ga0070709_10051725
987 Ga0070709_10064897
988 Ga0070714_100003779
989 Ga0070713_100487317
990 Ga0070713_101597786
991 Ga0070710_10318617
992 Ga0070701_10022791
993 Ga0070701_10696932
994 Ga0070701_11133627
995 Ga0070711_100225777
996 Ga0070711_101268662
997 Ga0070705_100114158
998 Ga0070700_100575083
999 Ga0070700_101027667
1000 Ga0070700_101263998
1001 Ga0070700_101323748
1002 Ga0070700_101346085
1003 Ga0070694_100017963
1004 Ga0070694_100067740
1005 Ga0070694_100400196
1006 Ga0070708_100018024
1007 Ga0070708_100084634
1008 Ga0070708_100251921
1009 Ga0070708_100412945
1010 Ga0070708_100649519
1011 Ga0070663_100761924
1012 Ga0070663_101147595
1013 Ga0070678_100081148
1014 Ga0070678_100211891
1015 Ga0070678_100853006
1016 Ga0070678_100906102
1017 Ga0070678_102032418
1018 Ga0070662_100238392
1019 Ga0070662_100400465
1020 Ga0070662_101214262
1021 Ga0070662_101696894
1022 Ga0070662_101819889
1023 Ga0070681_10108122
1024 Ga0070681_10200838
1025 Ga0068867_100031728
1026 Ga0068867_100044633
1027 Ga0068867_100287353
1028 Ga0068867_100548881
1029 Ga0070685_10035627
1030 Ga0070685_10586867
1031 Ga0070685_11491750
1032 Ga0070706_100498470
1033 Ga0070706_100842650
1034 Ga0070706_101191059
1035 Ga0070706_101582977
1036 Ga0070707_100626910
1037 Ga0070707_100717334
1038 Ga0070707_100830796
1039 Ga0070707_101278154
1040 Ga0070698_100111960
1041 Ga0070698_100310463
1042 Ga0070698_100343918
1043 Ga0070698_100798709
1044 Ga0070699_100000613
1045 Ga0070699_100114541
1046 Ga0070699_100281441
1047 Ga0070699_100956386
1048 Ga0070699_101595553
1049 Ga0070679_100002755
1050 Ga0070679_100128287
1051 Ga0070679_100199295
1052 Ga0070679_101187955
1053 Ga0070684_100833966
1054 Ga0070684_101670459
1055 Ga0070697_100387720
1056 Ga0070697_100784477
1057 Ga0070697_100930253
1058 Ga0070697_101187550
1059 Ga0068853_101045053
1060 Ga0068853_101709198
1061 Ga0068853_101745262
1062 Ga0068853_101946303
1063 Ga0070672_100134927
1064 Ga0070672_100257890
1065 Ga0070672_100265134
1066 Ga0070672_100356965
1067 Ga0070672_100399352
1068 Ga0070672_100495923
1069 Ga0070672_100908821
1070 Ga0070686_100000398
1071 Ga0070686_100248760
1072 Ga0070686_101201621
1073 Ga0070686_101918204
1074 Ga0070695_100005655
1075 Ga0070695_100056138
1076 Ga0070695_100684234
1077 Ga0070695_100761749
1078 Ga0070696_100018552
1079 Ga0070696_100192650
1080 Ga0070696_100294852
1081 Ga0070696_101686880
1082 Ga0070693_100108509
1083 Ga0070693_100336509
1084 Ga0070693_100514911
1085 Ga0070693_100842005
1086 Ga0070693_100879280
1087 Ga0070693_101481861
1088 Ga0070665_100013036
1089 Ga0070665_100038174
1090 Ga0070665_100070161
1091 Ga0070665_100221597
1092 Ga0070665_100544389
1093 Ga0070665_101073068
1094 Ga0070704_100015763
1095 Ga0070704_100605975
1096 Ga0070704_100837355
1097 Ga0068855_100029977
1098 Ga0068855_100790640
1099 Ga0068855_101531359
1100 Ga0070664_100441624
1101 Ga0070664_100593234
1102 Ga0070664_100944132
1103 Ga0070664_101068041
1104 Ga0070664_101503164
1105 Ga0070664_101798543
1106 Ga0068857_101392890
1107 Ga0068854_100109159
1108 Ga0068854_101580977
1109 Ga0068854_101633484
1110 Ga0068854_102213547
1111 Ga0068854_102264036
1112 Ga0068856_100785587
1113 Ga0068856_102702656
1114 Ga0070702_100000788
1115 Ga0070702_100118095
1116 Ga0068852_100689536
1117 Ga0068852_100745807
1118 Ga0068852_100962399
1119 Ga0068859_100055680
1120 Ga0068859_100593844
1121 Ga0068859_100733359
1122 Ga0068859_100856898
1123 Ga0068859_101090896
1124 Ga0068859_101100568
1125 Ga0068859_101982297
1126 Ga0068859_103064992
1127 Ga0068859_103066807
1128 Ga0068864_100014671
1129 Ga0068864_100106531
1130 Ga0068864_101166173
1131 Ga0068864_101266742
1132 Ga0068866_10202935
1133 Ga0068866_10839464
1134 Ga0068866_10974913
1135 Ga0068861_100004702
1136 Ga0068861_100411556
1137 Ga0068861_100712062
1138 Ga0068861_100744953
1139 Ga0068861_102356498
1140 Ga0068870_10662672
1141 Ga0068863_100192218
1142 Ga0068863_100581451
1143 Ga0068863_100698470
1144 Ga0068863_100787405
1145 Ga0068863_101394214
1146 Ga0068863_101835923
1147 Ga0068858_100010329
1148 Ga0068858_100010453
1149 Ga0068858_100115932
1150 Ga0068858_100127582
1151 Ga0068858_100228042
1152 Ga0068858_100267323
1153 Ga0068858_100605752
1154 Ga0068858_101495046
1155 Ga0068860_100050841
1156 Ga0068860_100318174
1157 Ga0068860_100867873
1158 Ga0068860_100989716
1159 Ga0068860_101640283
1160 Ga0068860_101738598
1161 Ga0068860_101938937
1162 Ga0068860_101998910
1163 Ga0068860_102069165
1164 Ga0068860_102850708
1165 Ga0068862_100019590
1166 Ga0068862_100071545
1167 Ga0068862_100571862
1168 Ga0068862_101128789
1169 Ga0068862_101321851
1170 Ga0068862_101967436
1171 Ga0068862_102088522
1172 Ga0081455_10012175
1173 Ga0081455_10015660
1174 Ga0081455_10408514
1175 Ga0081455_10496974
1176 Ga0081539_10117916
1177 Ga0081539_10198427
1178 Ga0075364_10193720
1179 Ga0070715_10835692
1180 Ga0070715_10842195
1181 Ga0070716_100422531
1182 Ga0070716_100464440
1183 Ga0070716_101453395
1184 Ga0070712_100136139
1185 Ga0075367_10123951
1186 Ga0075366_10334109
1187 Ga0097621_100000956
1188 Ga0097621_100013084
1189 Ga0097621_100071073
1190 Ga0097621_100201371
1191 Ga0097621_100234373
1192 Ga0097621_100285577
1193 Ga0097621_100339434
1194 Ga0097621_100414081
1195 Ga0075370_10362190
1196 Ga0068871_100000863
1197 Ga0068871_100024422
1198 Ga0068871_100056540
1199 Ga0068871_100073351
1200 Ga0068871_100253407
1201 Ga0068871_100326410
1202 Ga0068871_100355859
1203 Ga0068871_100476504
1204 Ga0068871_100490804
1205 Ga0068871_100528882
1206 Ga0068871_100594781
1207 Ga0068871_100827819
1208 Ga0068871_100923971
1209 Ga0068871_101342606
1210 Ga0068871_102238611
1211 Ga0075428_100084388
1212 Ga0075428_100561915
1213 Ga0075428_100618994
1214 Ga0075428_101687430
1215 Ga0075428_102409624
1216 Ga0075428_102476536
1217 Ga0075431_100097510
1218 Ga0075431_101746041
1219 Ga0075433_10132512
1220 Ga0075433_10161487
1221 Ga0075433_10298297
1222 Ga0075433_10433488
1223 Ga0075433_10511207
1224 Ga0075433_10652461
1225 Ga0075433_10789944
1226 Ga0075434_100001123
1227 Ga0075434_100007156
1228 Ga0075434_100012495
1229 Ga0075434_100027992
1230 Ga0075434_100198101
1231 Ga0075434_100307655
1232 Ga0075434_100315494
1233 Ga0075434_100435343
1234 Ga0075434_100911454
1235 Ga0075434_100960715
1236 Ga0075434_101209296
1237 Ga0075429_100415025
1238 Ga0075429_100435972
1239 Ga0075429_101286491
1240 Ga0068865_100051191
1241 Ga0068865_100135853
1242 Ga0068865_100347939
1243 Ga0068865_100507127
1244 Ga0068865_100593902
1245 Ga0068865_100770153
1246 Ga0068865_100842651
1247 Ga0068865_101664061
1248 Ga0075436_100004597
1249 Ga0075436_100027306
1250 Ga0075436_100075038
1251 Ga0075436_100158235
1252 Ga0075436_100324116
1253 Ga0075436_100433008
1254 Ga0075436_101063490
1255 Ga0075436_101376270
1256 Ga0097620_100055681
1257 Ga0097620_100593839
1258 Ga0097620_100733336
1259 Ga0097620_100856858
1260 Ga0097620_101090935
1261 Ga0097620_101100300
1262 Ga0097620_101982301
1263 Ga0097620_103064174
1264 Ga0097620_103067133
1265 Ga0075435_100000346
1266 Ga0075435_100002191
1267 Ga0075435_100006443
1268 Ga0075435_100074250
1269 Ga0075435_100114047
1270 Ga0075435_100241391
1271 Ga0075435_100247645
1272 Ga0075435_101039361
1273 Ga0099794_10319170
1274 Ga0099795_10554052
1275 Ga0105240_10197491
1276 Ga0105240_10272035
1277 Ga0105240_10295893
1278 Ga0105240_10682699
1279 Ga0105240_10760612
1280 Ga0105240_12342393
1281 Ga0111539_10011775
1282 Ga0111539_10037680
1283 Ga0111539_10295942
1284 Ga0111539_10527619
1285 Ga0111539_12091518
1286 Ga0111539_12776410
1287 Ga0111539_13268197
1288 Ga0105245_10079092
1289 Ga0105245_10190406
1290 Ga0105245_10214066
1291 Ga0105245_10413086
1292 Ga0105245_10765842
1293 Ga0105245_11543011
1294 Ga0105245_11546222
1295 Ga0105245_11680614
1296 Ga0105245_11809017
1297 Ga0105247_10062089
1298 Ga0105247_10878360
1299 Ga0114129_10006904
1300 Ga0114129_10014362
1301 Ga0114129_10269687
1302 Ga0114129_10277870
1303 Ga0114129_10310751
1304 Ga0114129_10364435
1305 Ga0114129_10440484
1306 Ga0114129_10557105
1307 Ga0114129_11085495
1308 Ga0114129_11654732
1309 Ga0105243_10369906
1310 Ga0105243_10480377
1311 Ga0105243_10924100
1312 Ga0105243_11028031
1313 Ga0105243_11138498
1314 Ga0105243_12012122
1315 Ga0105243_12208787
1316 Ga0105241_10165881
1317 Ga0105241_10237682
1318 Ga0105241_10907827
1319 Ga0105242_10004492
1320 Ga0105242_10015128
1321 Ga0105242_10030212
1322 Ga0105242_10233899
1323 Ga0105242_10266216
1324 Ga0105242_10423041
1325 Ga0105242_10431993
1326 Ga0105242_10455083
1327 Ga0105242_11182024
1328 Ga0105242_11365609
1329 Ga0105242_11447885
1330 Ga0105248_10005114
1331 Ga0105248_10011453
1332 Ga0105248_10013748
1333 Ga0105248_10024496
1334 Ga0105248_10081935
1335 Ga0105248_10109794
1336 Ga0105248_10134818
1337 Ga0105248_10173082
1338 Ga0105248_10173497
1339 Ga0105248_10175229
1340 Ga0105248_10285486
1341 Ga0105248_10325824
1342 Ga0105248_10741913
1343 Ga0105248_10830033
1344 Ga0105248_11020408
1345 Ga0105248_11048116
1346 Ga0105248_11510734
1347 Ga0105248_11794010
1348 Ga0105248_12092501
1349 Ga0105248_12978272
1350 Ga0105237_10345602
1351 Ga0105237_11409866
1352 Ga0105238_11712959
1353 Ga0105249_10428589
1354 Ga0105249_10534380
1355 Ga0105249_11943892
1356 Ga0105249_12915899
1357 Ga0105239_11426051
1358 Ga0105246_11906787
1359 Ga0157344_1016644
1360 Ga0157325_1001005
1361 Ga0157323_1021457
1362 Ga0157319_1001779
1363 Ga0157339_1017659
1364 Ga0157342_1030137
1365 Ga0157370_10777447
1366 Ga0157369_10682816
1367 Ga0157374_10102664
1368 Ga0157374_10790683
1369 Ga0157374_11964031
1370 Ga0157378_10008843
1371 Ga0157378_10348390
1372 Ga0157378_10394930
1373 Ga0157378_10574537
1374 Ga0157378_10791447
1375 Ga0157378_11065322
1376 Ga0157378_11308212
1377 Ga0157378_11745353
1378 Ga0157378_12547223
1379 Ga0163162_10042153
1380 Ga0163162_10142812
1381 Ga0163162_10982692
1382 Ga0157375_10094347
1383 Ga0157375_10194844
1384 Ga0157375_10329866
1385 Ga0157375_10376384
1386 Ga0157375_12107819
1387 Ga0157375_13426813
1388 Ga0157375_13655880
1389 Ga0163163_10000042
1390 Ga0163163_10017121
1391 Ga0163163_10101493
1392 Ga0163163_10134947
1393 Ga0163163_10759935
1394 Ga0163163_11007159
1395 Ga0163163_11284745
1396 Ga0157380_10309275
1397 Ga0157380_10620234
1398 Ga0157380_10663702
1399 Ga0157380_10829187
1400 Ga0157380_11093736
1401 Ga0157380_11138682
1402 Ga0157380_11223645
1403 Ga0157380_11795841
1404 Ga0157377_10162394
1405 Ga0157377_10686180
1406 Ga0157379_10012034
1407 Ga0157379_10044286
1408 Ga0157379_10048580
1409 Ga0157379_10599178
1410 Ga0157379_11121133
1411 Ga0157376_10180212
1412 Ga0157376_10183434
1413 Ga0157376_10188046
1414 Ga0157376_10189400
1415 Ga0157376_10270943
1416 Ga0157376_10725673
1417 Ga0157376_10767845
1418 Ga0157376_10849168
1419 Ga0206356_11573733
1420 Ga0207697_10320890
1421 Ga0207692_10676306
1422 Ga0207680_10476567
1423 Ga0207685_10605588
1424 Ga0207685_10637188
1425 Ga0207654_11096630
1426 Ga0207707_10402503
1427 Ga0207695_11522100
1428 Ga0207663_11005209
1429 Ga0207660_10302093
1430 Ga0207662_10191413
1431 Ga0207652_10083730
1432 Ga0207681_11643387
1433 Ga0207650_10362306
1434 Ga0207650_10708822
1435 Ga0207659_10087940
1436 Ga0207659_11716617
1437 Ga0207644_10619102
1438 Ga0207644_11827006
1439 Ga0207690_10077663
1440 Ga0207686_11018449
1441 Ga0207670_10192727
1442 Ga0207670_10475101
1443 Ga0207704_10076513
1444 Ga0207704_10505974
1445 Ga0207691_10030055
1446 Ga0207711_10025323
1447 Ga0207711_10107326
1448 Ga0207711_10180641
1449 Ga0207711_10946580
1450 Ga0207689_11519816
1451 Ga0207679_10530954
1452 Ga0207679_11210572
1453 Ga0207651_11170471
1454 Ga0207668_11280176
1455 Ga0207640_10815654
1456 Ga0207658_10447005
1457 Ga0207677_10380258
1458 Ga0207677_10677170
1459 Ga0207703_10480837
1460 Ga0207703_10838816
1461 Ga0207639_10906781
1462 Ga0207639_11513629
1463 Ga0207708_10273835
1464 Ga0207648_10017511
1465 Ga0207648_12159001
1466 Ga0207676_11611329
1467 Ga0207675_100491996
1468 Ga0207683_10159758
1469 Ga0307408_100034661
1470 Ga0307408_100592284
1471 Ga0265313_10217596
1472 Ga0307405_10036831
1473 Ga0307405_10896664
1474 Ga0307413_10381605
1475 Ga0307406_10315222
1476 Ga0307407_10147460
1477 Ga0307412_10046022
1478 Ga0307412_10391283
1479 Ga0307416_100397917
1480 Ga0307416_100728649
1481 Ga0307416_100945560
1482 Ga0307416_103439373
1483 Ga0307411_10070160
1484 Ga0307415_100806130
1485 Ga0373948_0058975
1486 Ga0373934_0015682
1487 Ga0373934_0363445
1488 Ga0373923_0030854
1489 Ga0373923_0154977
1490 Ga0373923_0236601
1491 Ga0373936_0101907
1492 Ga0373936_0277894
1493 Ga0373945_0100847
1494 Ga0373953_0103858
1495 Ga0373953_0203153
1496 Ga0373954_0355986
1497 Ga0373954_0497676
1498 Ga0373956_0098234
1499 Ga0373956_0147933
1500 Ga0373956_0297739
1501 Ga0373957_0014815
1502 Ga0373957_0025497
1503 Ga0373957_0101243
1504 Ga0373943_0015259
1505 Ga0373946_0019054
1506 Ga0373955_0004427
1507 Ga0373955_0049192
1508 Ga0373955_0236627
1509 Ga0373924_0006091
1510 Ga0373924_0049820
1511 Ga0373931_1213356
1512 Ga0373935_0040221
1513 Ga0373935_0455264
1514 Ga0373927_0451093
1515 Ga0373933_0012176
1516 Ga0373933_0323504
1517 Ga0373933_0672220
1518 Ga0373947_0019450
1519 Ga0373947_0239788
1520 Ga0373937_0000796
1521 Ga0373937_0298578
1522 Ga0373937_0517297
1523 Ga0373925_0014368
1524 Ga0373925_0587565
1525 Ga0373925_1072873
1526 Ga0373925_1662438
1527 Ga0395905_0771778
1528 Ga0436361_0941465
1529 Ga0439436_0169983
1530 Ga0439433_0027524
1531 Ga0439462_0014960
1532 Ga0439446_0187402
1533 Ga0439460_0246921
1534 Ga0466957_1179221
1535 Ga0466958_1031584
1536 Ga0495592_0035807
1537 Ga0495592_0100507
1538 Ga0495629_0136719
1539 Ga0495629_0229489
1540 Ga0495651_0124151
1541 Ga0495651_0183551
1542 Ga0495653_0548011
1543 Ga0495580_0058380
1544 Ga0495582_0167747
1545 Ga0495662_0211172
1546 Ga0495662_0403676
1547 Ga0495608_0009283
1548 Ga0495618_0225938
1549 Ga0495618_0315567
1550 Ga0495628_0031085
1551 Ga0495628_0087394
1552 Ga0495628_0257958
1553 Ga0495630_0073969
1554 Ga0495652_0358108
1555 Ga0495652_0549617
1556 Ga0495665_0205220
1557 Ga0495665_0528461
1558 Ga0495640_0072929
1559 Ga0495640_0824679
1560 Ga0495586_0161034
1561 Ga0495587_0036174
1562 Ga0495621_0176703
1563 Ga0495645_0058353
1564 Ga0495645_0140856
1565 Ga0495667_0032780
1566 Ga0495634_0525677
1567 Ga0495634_0597494
1568 Ga0495599_0211370
1569 Ga0495599_0234082
1570 Ga0495599_0408494
1571 Ga0495623_0091537
1572 Ga0495647_0149342
1573 Ga0495658_0211331
1574 Ga0495658_0314770
1575 Ga0495669_0000860
1576 Ga0495613_0009892
1577 Ga0495613_0342743
1578 Ga0495624_0557878
1579 Ga0495670_0390925
1580 Ga0495600_0262080
1581 Ga0495600_0716977
1582 Ga0495581_0676392
1583 Ga0495604_0317864
1584 Ga0495674_0031396
1585 Ga0495674_0497078
1586 Ga0495680_0120445
1587 Ga0495684_0000549
1588 Ga0495684_0296280
1589 Ga0496104_0572432
1590 Ga0496104_1177394
1591 Ga0496105_0179896
1592 Ga0496106_1356298
1593 Ga0496108_0850237
1594 Ga0496110_0126468
1595 Ga0496110_0933599
1596 Ga0496110_1200569
1597 Ga0496113_0319238
1598 Ga0496114_0181747
1599 Ga0496119_0000766
1600 Ga0496122_0003989
1601 Ga0496123_0000732
1602 Ga0496124_0530540
1603 Ga0501301_048223
1604 Ga0501031_0044402
1605 Ga0501032_0012637
1606 Ga0501032_0021634
1607 Ga0501032_0316021
1608 Ga0501033_0005639
1609 Ga0501033_0010094
1610 Ga0501033_0011790
1611 Ga0501034_0029118
1612 Ga0501034_0098668
1613 Ga0501034_0240253
1614 Ga0501036_0001004
1615 Ga0501036_0010148
1616 Ga0501036_0237292
1617 Ga0501037_0001467
1618 Ga0501037_0097975
1619 Ga0501037_0101893
1620 Ga0501038_0003829
1621 Ga0501038_0007413
1622 Ga0501038_0033577
1623 Ga0501039_0029082
1624 Ga0501039_0627984
1625 Ga0501040_0048416
1626 Ga0501041_1103336
1627 Ga0501042_0013950
1628 Ga0501042_0126514
1629 Ga0501043_0011314
1630 Ga0501043_0016104
1631 Ga0501043_0018766
1632 Ga0501046_0020967
1633 Ga0501046_0032453
1634 Ga0501046_0089661
1635 Ga0501047_0004046
1636 Ga0501047_0036698
1637 Ga0501047_1448395
1638 Ga0501048_0001810
1639 Ga0501048_0069114
1640 Ga0501048_0247396
1641 Ga0501048_0767252
1642 Ga0501067_0000955
1643 Ga0501067_0031037
1644 Ga0501067_0059513
1645 Ga0501067_0598232
1646 Ga0501068_0018472
1647 Ga0501068_0023853
1648 Ga0501068_0024708
1649 Ga0501069_0008665
1650 Ga0501069_0010899
1651 Ga0501069_0087945
1652 Ga0501070_0012349
1653 Ga0501070_0034161
1654 Ga0501070_0090742
1655 Ga0501071_0002605
1656 Ga0501071_0219436
1657 Ga0501072_0205685
1658 Ga0501073_0000607
1659 Ga0501073_0019730
1660 Ga0501073_0144017
1661 Ga0501074_0013369
1662 Ga0501074_0014973
1663 Ga0501076_0043502
1664 Ga0501076_0730223
1665 Ga0501079_0001009
1666 Ga0501079_0001893
1667 Ga0501079_0154043
1668 Ga0501080_0023231
1669 Ga0501080_0081857
1670 Ga0501080_0469448
1671 Ga0501083_0045319
1672 Ga0501083_0085495
1673 Ga0501083_0101187
1674 Ga0501035_0022938
1675 Ga0501035_0035560
1676 Ga0501035_0257988
1677 Ga0501044_0007201
1678 Ga0501044_0043490
1679 Ga0501044_0912941
1680 Ga0501045_0031192
1681 Ga0501045_0150501
1682 nmdc:mga0k408_711639_c1
1683 nmdc:mga05p37_1001886_c1
1684 nmdc:mga05p37_683663_c1
1685 nmdc:mga08x19_59538_c1
1686 nmdc:mga0a205_1148255_c1
1687 Ga0495601_0007465
1688 Ga0495601_0343948
1689 Ga0495601_0466288
1690 Ga0495595_0234157
1691 Ga0495595_0502307
1692 Ga0495619_0003759
1693 Ga0495619_0052044
1694 Ga0495619_0915597
1695 Ga0500556_0000036
1696 Ga0500592_024927
1697 Ga0500652_016472
1698 Ga0500616_0120243
1699 Ga0500645_004699
1700 Ga0501084_0008081
1701 Ga0501084_0036152
1702 Ga0501084_0292233
1703 Ga0501082_0006743
1704 Ga0501082_0122537
1705 Ga0501082_0438047
1706 Ga0501082_0472008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

78

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1spb-assembly1.cif.gz_P subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c 0.712 4 79
3ofe-assembly2.cif.gz_B structured domain of drosophila melanogaster boca p41 2 2 crystal form 0.6828 1 79
1scj-assembly1.cif.gz_B crystal structure of subtilisin-propeptide complex 0.6777 4 79
5jmv-assembly1.cif.gz_E crystal structure of mjkae1-pfupcc1 complex 0.6734 1 67
3ofe-assembly2.cif.gz_B structured domain of drosophila melanogaster boca p41 2 2 crystal form 0.6685 1 79
ID Description Score Start End Superfamily
1spbP00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 0.712 4 79 3.30.70.80
af_B6VCA2_26_115_3.30.70.850 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8, pro-domain 0.6709 4 77 3.30.70.850
2cyyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6567 2 78 3.30.70.920
3j81j03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;EIF_2_alpha 0.6564 1 64 3.30.70.1130
1spbP00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Peptidase S8 propeptide/proteinase inhibitor I9 0.6561 4 79 3.30.70.80
ID Description Score Start End GO Terms
AF-A0A7J3Y0N6-F1-model_v4 Competence/damage-inducible protein A 0.7256 1 78
AF-A0A7J3Y0N6-F1-model_v4 Competence/damage-inducible protein A 0.7102 1 78
AF-A0A6C1MXB8-F1-model_v4 Glutamate synthase 0.7057 2 78 GO:0005737
GO:0051224
AF-A0A7S1VG15-F1-model_v4 ABC transporter domain-containing protein 0.685 2 77 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A7C4HM39-F1-model_v4 Competence/damage-inducible protein A 0.6829 2 77

Map