F483505

General Info

Members Datasets Scaffolds Average Seq Length
852 321 852 92

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10039726|Ga0265328_100397262
Length 113
Sequence MGRIRAAARAEDVMDERDLYDEKQETRKATLNCPHCHQSAEYDLGWFVRTKKRQLPGRADERDRAKFAKARSYMVRRDDLVACKNLRCRKRFEVSGVQSVAFLDEQVPVERKQ

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
303 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
308 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
309 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 6.69
Rhizosphere 92.14
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001100 3300001976 Bacteria 3706
2 JGI24737J22298_10167643 3300001990 Unclassified 648
3 JGI24743J22301_10028888 3300001991 Eukaryota 1087
4 JGI24033J26618_1019761 3300002155 Unclassified 855
5 JGI24034J26672_10000337 3300002239 Bacteria 6045
6 JGI24751J29686_10000704 3300002459 Bacteria 8154
7 rootH1_10023707 3300003316 Bacteria 1780
8 Ga0058863_10023995 3300004799 Bacteria 734
9 Ga0058862_12692804 3300004803 Unclassified 845
10 Ga0065712_10077652 3300005290 Unclassified 3462
11 Ga0065715_10000987 3300005293 Bacteria 10061
12 Ga0065715_10688515 3300005293 Unclassified 633
13 Ga0065707_10181797 3300005295 Unclassified 1414
14 Ga0070658_10026605 3300005327 Unclassified 4642
15 Ga0070658_10114778 3300005327 Bacteria 2234
16 Ga0070683_100034979 3300005329 Bacteria 4592
17 Ga0070683_100538893 3300005329 Bacteria 1116
18 Ga0070683_101864135 3300005329 Unclassified 578
19 Ga0070690_100168815 3300005330 Bacteria 1504
20 Ga0070690_100455888 3300005330 Unclassified 949
21 Ga0070670_100368101 3300005331 Bacteria 1265
22 Ga0070670_100654023 3300005331 Unclassified 943
23 Ga0068869_100419330 3300005334 Bacteria 1104
24 Ga0068869_101052596 3300005334 Bacteria 710
25 Ga0070666_11021624 3300005335 Bacteria 614
26 Ga0070680_100045686 3300005336 Bacteria 3561
27 Ga0070680_100177835 3300005336 Bacteria 1791
28 Ga0070680_100648246 3300005336 Bacteria 908
29 Ga0070680_100695121 3300005336 Unclassified 875
30 Ga0070680_100808497 3300005336 Unclassified 808
31 Ga0070680_101498247 3300005336 Bacteria 584
32 Ga0070682_100026601 3300005337 Bacteria 3464
33 Ga0070682_100030142 3300005337 Unclassified 3272
34 Ga0070682_100039509 3300005337 Bacteria 2900
35 Ga0068868_100005847 3300005338 Bacteria 8671
36 Ga0068868_100041733 3300005338 Bacteria 3575
37 Ga0068868_101155308 3300005338 Unclassified 714
38 Ga0068868_101521471 3300005338 Unclassified 627
39 Ga0070660_100011892 3300005339 Bacteria 6206
40 Ga0070660_100244417 3300005339 Bacteria 1462
41 Ga0070689_100001794 3300005340 Bacteria 13790
42 Ga0070687_100007106 3300005343 Bacteria 4638
43 Ga0070661_100020981 3300005344 Bacteria 4663
44 Ga0070661_100023061 3300005344 Unclassified 4460
45 Ga0070661_100273787 3300005344 Bacteria 1308
46 Ga0070661_100641995 3300005344 Bacteria 861
47 Ga0070661_101696074 3300005344 Bacteria 535
48 Ga0070692_10034365 3300005345 Bacteria 2561
49 Ga0070668_100196526 3300005347 Unclassified 1654
50 Ga0070668_101521432 3300005347 Unclassified 612
51 Ga0070669_100009677 3300005353 Bacteria 6865
52 Ga0070669_100657442 3300005353 Bacteria 882
53 Ga0070675_100127127 3300005354 Bacteria 2169
54 Ga0070671_100032972 3300005355 Bacteria 4281
55 Ga0070671_100257526 3300005355 Bacteria 1483
56 Ga0070674_100014116 3300005356 Bacteria 4959
57 Ga0070673_100017192 3300005364 Bacteria 5135
58 Ga0070673_101536667 3300005364 Bacteria 628
59 Ga0070688_100002058 3300005365 Bacteria 10154
60 Ga0070688_100366073 3300005365 Bacteria 1059
61 Ga0070659_100024736 3300005366 Unclassified 4605
62 Ga0070659_100436004 3300005366 Bacteria 1109
63 Ga0070667_100180757 3300005367 Bacteria 1865
64 Ga0070667_101620490 3300005367 Unclassified 608
65 Ga0070667_101876032 3300005367 Unclassified 564
66 Ga0070709_10218588 3300005434 Bacteria 1358
67 Ga0070709_10274308 3300005434 Bacteria 1223
68 Ga0070709_10438885 3300005434 Unclassified 981
69 Ga0070709_10680957 3300005434 Unclassified 799
70 Ga0070709_10686462 3300005434 Bacteria 796
71 Ga0070709_10927770 3300005434 Unclassified 690
72 Ga0070709_11233883 3300005434 Unclassified 602
73 Ga0070714_100000183 3300005435 Bacteria 49970
74 Ga0070714_100033971 3300005435 Bacteria 4270
75 Ga0070714_100061176 3300005435 Bacteria 3233
76 Ga0070714_100272918 3300005435 Bacteria 1569
77 Ga0070714_100324820 3300005435 Bacteria 1440
78 Ga0070714_100638205 3300005435 Bacteria 1024
79 Ga0070714_100792017 3300005435 Unclassified 918
80 Ga0070714_100899996 3300005435 Bacteria 859
81 Ga0070714_100973984 3300005435 Unclassified 825
82 Ga0070714_101117163 3300005435 Bacteria 768
83 Ga0070714_101499549 3300005435 Bacteria 659
84 Ga0070714_101981096 3300005435 Unclassified 568
85 Ga0070713_100023609 3300005436 Bacteria 4775
86 Ga0070713_100028256 3300005436 Bacteria 4427
87 Ga0070713_100069129 3300005436 Unclassified 2977
88 Ga0070713_100244038 3300005436 Unclassified 1636
89 Ga0070713_100717377 3300005436 Bacteria 955
90 Ga0070713_100836188 3300005436 Bacteria 884
91 Ga0070713_100951760 3300005436 Unclassified 827
92 Ga0070713_101753220 3300005436 Unclassified 603
93 Ga0070713_101849992 3300005436 Unclassified 586
94 Ga0070713_101928915 3300005436 Bacteria 573
95 Ga0070710_10061816 3300005437 Bacteria 2134
96 Ga0070710_10210269 3300005437 Bacteria 1233
97 Ga0070710_10515526 3300005437 Bacteria 821
98 Ga0070710_10599149 3300005437 Bacteria 767
99 Ga0070710_10914061 3300005437 Unclassified 634
100 Ga0070710_11020633 3300005437 Bacteria 604
101 Ga0070710_11389211 3300005437 Unclassified 525
102 Ga0070711_100044649 3300005439 Bacteria 3009
103 Ga0070711_100324674 3300005439 Unclassified 1231
104 Ga0070711_100350117 3300005439 Bacteria 1187
105 Ga0070711_100391088 3300005439 Bacteria 1126
106 Ga0070711_101244354 3300005439 Unclassified 645
107 Ga0070705_100024988 3300005440 Bacteria 3232
108 Ga0070705_101056716 3300005440 Unclassified 662
109 Ga0070700_100072700 3300005441 Unclassified 2199
110 Ga0070694_100336848 3300005444 Bacteria 1165
111 Ga0070694_101684455 3300005444 Unclassified 539
112 Ga0070663_100064452 3300005455 Unclassified 2648
113 Ga0070678_100616350 3300005456 Bacteria 970
114 Ga0070662_100360555 3300005457 Bacteria 1193
115 Ga0070681_10028494 3300005458 Bacteria 5615
116 Ga0070681_10063281 3300005458 Bacteria 3672
117 Ga0070681_10064405 3300005458 Unclassified 3636
118 Ga0070681_10233834 3300005458 Bacteria 1752
119 Ga0070681_10310418 3300005458 Bacteria 1486
120 Ga0070681_10417526 3300005458 Unclassified 1253
121 Ga0070681_10736551 3300005458 Unclassified 902
122 Ga0070681_10870980 3300005458 Bacteria 819
123 Ga0070681_11150165 3300005458 Bacteria 697
124 Ga0068867_100082865 3300005459 Bacteria 2420
125 Ga0070685_10004126 3300005466 Bacteria 7329
126 Ga0070707_100082687 3300005468 Bacteria 3101
127 Ga0070707_101166073 3300005468 Bacteria 736
128 Ga0070679_100009060 3300005530 Bacteria 9390
129 Ga0070679_100041797 3300005530 Bacteria 4563
130 Ga0070679_100049113 3300005530 Bacteria 4202
131 Ga0070679_100281193 3300005530 Bacteria 1617
132 Ga0070679_100347177 3300005530 Bacteria 1432
133 Ga0070679_100487258 3300005530 Bacteria 1177
134 Ga0070679_100517925 3300005530 Bacteria 1136
135 Ga0070679_100699335 3300005530 Bacteria 956
136 Ga0070679_101583193 3300005530 Unclassified 603
137 Ga0070679_102189212 3300005530 Bacteria 502
138 Ga0070684_100002682 3300005535 Bacteria 13145
139 Ga0070684_100054714 3300005535 Bacteria 3477
140 Ga0070684_100101202 3300005535 Bacteria 2575
141 Ga0070684_100253904 3300005535 Bacteria 1607
142 Ga0070684_101364374 3300005535 Bacteria 667
143 Ga0070697_100006153 3300005536 Bacteria 9286
144 Ga0068853_100016340 3300005539 Bacteria 6106
145 Ga0068853_100197807 3300005539 Bacteria 1828
146 Ga0068853_100276794 3300005539 Bacteria 1546
147 Ga0068853_100604842 3300005539 Bacteria 1041
148 Ga0068853_100976563 3300005539 Unclassified 815
149 Ga0068853_102474951 3300005539 Unclassified 503
150 Ga0070672_100003745 3300005543 Bacteria 9901
151 Ga0070686_100485333 3300005544 Unclassified 956
152 Ga0070686_100610841 3300005544 Unclassified 860
153 Ga0070695_100848135 3300005545 Unclassified 735
154 Ga0070696_100112546 3300005546 Unclassified 1961
155 Ga0070696_100551268 3300005546 Unclassified 924
156 Ga0070693_100105611 3300005547 Bacteria 1723
157 Ga0070693_100162884 3300005547 Bacteria 1422
158 Ga0070693_100172870 3300005547 Bacteria 1385
159 Ga0070665_100018649 3300005548 Bacteria 6954
160 Ga0070665_101383046 3300005548 Unclassified 713
161 Ga0070704_102064699 3300005549 Unclassified 529
162 Ga0068855_100020077 3300005563 Bacteria 8024
163 Ga0068855_100152904 3300005563 Bacteria 2623
164 Ga0068855_100222770 3300005563 Bacteria 2114
165 Ga0068855_100355651 3300005563 Bacteria 1612
166 Ga0068855_100657991 3300005563 Bacteria 1124
167 Ga0068855_100682325 3300005563 Bacteria 1101
168 Ga0070664_100143608 3300005564 Bacteria 2103
169 Ga0070664_100220385 3300005564 Bacteria 1697
170 Ga0070664_100229022 3300005564 Bacteria 1665
171 Ga0070664_100783958 3300005564 Unclassified 891
172 Ga0068857_100003337 3300005577 Bacteria 13362
173 Ga0068857_100072067 3300005577 Bacteria 3079
174 Ga0068857_100258031 3300005577 Bacteria 1599
175 Ga0068857_100931540 3300005577 Unclassified 834
176 Ga0068857_100990387 3300005577 Bacteria 809
177 Ga0068857_101100468 3300005577 Unclassified 767
178 Ga0068854_100004220 3300005578 Bacteria 9046
179 Ga0068854_101256651 3300005578 Unclassified 665
180 Ga0068854_101655987 3300005578 Unclassified 584
181 Ga0068854_101707364 3300005578 Bacteria 576
182 Ga0068856_100027595 3300005614 Bacteria 5538
183 Ga0068856_100037749 3300005614 Unclassified 4740
184 Ga0068856_100041407 3300005614 Bacteria 4527
185 Ga0068856_100055186 3300005614 Unclassified 3921
186 Ga0068856_100151650 3300005614 Bacteria 2327
187 Ga0068856_100559022 3300005614 Unclassified 1165
188 Ga0068856_100972854 3300005614 Unclassified 867
189 Ga0068856_101235390 3300005614 Bacteria 763
190 Ga0068856_101644074 3300005614 Unclassified 655
191 Ga0068856_101698318 3300005614 Unclassified 644
192 Ga0070702_100398975 3300005615 Bacteria 983
193 Ga0070702_100934224 3300005615 Unclassified 682
194 Ga0068852_100079181 3300005616 Bacteria 2910
195 Ga0068852_102315881 3300005616 Unclassified 558
196 Ga0068852_102783593 3300005616 Unclassified 508
197 Ga0068864_100032295 3300005618 Bacteria 4447
198 Ga0068864_100193489 3300005618 Bacteria 1865
199 Ga0068864_100823976 3300005618 Bacteria 913
200 Ga0068864_100925747 3300005618 Unclassified 862
201 Ga0068864_102359504 3300005618 Bacteria 538
202 Ga0068866_10009998 3300005718 Unclassified 4052
203 Ga0068866_10514773 3300005718 Unclassified 794
204 Ga0068861_100009849 3300005719 Bacteria 6609
205 Ga0068870_10000935 3300005840 Bacteria 11452
206 Ga0068863_100023970 3300005841 Bacteria 5823
207 Ga0068863_100068107 3300005841 Unclassified 3367
208 Ga0068863_100306705 3300005841 Bacteria 1540
209 Ga0068863_101960798 3300005841 Unclassified 596
210 Ga0068863_102037876 3300005841 Unclassified 584
211 Ga0068858_100249002 3300005842 Bacteria 1687
212 Ga0068860_100089866 3300005843 Bacteria 2925
213 Ga0068860_100091141 3300005843 Bacteria 2904
214 Ga0068860_100258050 3300005843 Bacteria 1698
215 Ga0081540_1011430 3300005983 Bacteria 5932
216 Ga0070717_10035619 3300006028 Bacteria 4031
217 Ga0070717_10086596 3300006028 Bacteria 2637
218 Ga0070717_10177409 3300006028 Bacteria 1855
219 Ga0070717_10258786 3300006028 Bacteria 1539
220 Ga0070717_10993567 3300006028 Unclassified 764
221 Ga0070717_11342150 3300006028 Bacteria 650
222 Ga0070717_11844966 3300006028 Unclassified 546
223 Ga0070715_10194927 3300006163 Bacteria 1025
224 Ga0070716_100046340 3300006173 Bacteria 2446
225 Ga0070716_100188529 3300006173 Unclassified 1360
226 Ga0070716_100475554 3300006173 Bacteria 916
227 Ga0070716_100599980 3300006173 Bacteria 828
228 Ga0070716_100726225 3300006173 Unclassified 761
229 Ga0070716_101223739 3300006173 Unclassified 604
230 Ga0070712_100261165 3300006175 Unclassified 1388
231 Ga0070712_100375156 3300006175 Bacteria 1170
232 Ga0070712_100433466 3300006175 Bacteria 1091
233 Ga0070712_100734140 3300006175 Unclassified 844
234 Ga0070712_100962207 3300006175 Bacteria 738
235 Ga0070712_101476121 3300006175 Bacteria 594
236 Ga0097621_100000484 3300006237 Bacteria 27786
237 Ga0097621_100410450 3300006237 Bacteria 1214
238 Ga0097621_100799368 3300006237 Bacteria 874
239 Ga0097621_101190384 3300006237 Unclassified 717
240 Ga0068871_100005759 3300006358 Bacteria 8700
241 Ga0068871_100155849 3300006358 Bacteria 1950
242 Ga0068871_101718241 3300006358 Bacteria 595
243 Ga0075433_10835213 3300006852 Unclassified 804
244 Ga0075434_100000177 3300006871 Bacteria 41424
245 Ga0075434_100980254 3300006871 Unclassified 859
246 Ga0068865_100215811 3300006881 Unclassified 1497
247 Ga0075436_100007556 3300006914 Bacteria 7425
248 Ga0075436_100015125 3300006914 Bacteria 5289
249 Ga0075436_100100656 3300006914 Bacteria 2013
250 Ga0075436_100167646 3300006914 Unclassified 1550
251 Ga0075436_100652049 3300006914 Unclassified 778
252 Ga0097620_100981155 3300006931 Unclassified 927
253 Ga0075435_100000319 3300007076 Bacteria 29633
254 Ga0075435_100214588 3300007076 Bacteria 1633
255 Ga0075435_100792877 3300007076 Unclassified 825
256 Ga0105250_10009360 3300009092 Bacteria 4130
257 Ga0105250_10514357 3300009092 Unclassified 545
258 Ga0105240_10036492 3300009093 Bacteria 6322
259 Ga0105240_10037121 3300009093 Bacteria 6263
260 Ga0105240_10349489 3300009093 Unclassified 1678
261 Ga0105240_10670948 3300009093 Bacteria 1134
262 Ga0105240_10767800 3300009093 Unclassified 1047
263 Ga0105240_11012617 3300009093 Unclassified 888
264 Ga0105240_11453900 3300009093 Bacteria 719
265 Ga0105240_11887384 3300009093 Unclassified 622
266 Ga0105240_11952947 3300009093 Bacteria 610
267 Ga0105240_12195018 3300009093 Bacteria 572
268 Ga0105245_10003145 3300009098 Bacteria 14771
269 Ga0105245_10007043 3300009098 Bacteria 9863
270 Ga0105245_10041692 3300009098 Bacteria 4092
271 Ga0105245_10192516 3300009098 Bacteria 1954
272 Ga0105245_10471270 3300009098 Unclassified 1267
273 Ga0105245_10906204 3300009098 Bacteria 923
274 Ga0105247_10001507 3300009101 Bacteria 16650
275 Ga0114129_10184786 3300009147 Bacteria 2834
276 Ga0105243_10447461 3300009148 Unclassified 1211
277 Ga0105241_10019278 3300009174 Bacteria 5031
278 Ga0105241_10071374 3300009174 Bacteria 2696
279 Ga0105241_10273184 3300009174 Bacteria 1441
280 Ga0105241_10401991 3300009174 Bacteria 1202
281 Ga0105241_10535740 3300009174 Unclassified 1049
282 Ga0105241_10896387 3300009174 Unclassified 823
283 Ga0105241_11078040 3300009174 Unclassified 755
284 Ga0105241_11802192 3300009174 Bacteria 597
285 Ga0105241_12640656 3300009174 Unclassified 505
286 Ga0105242_10016443 3300009176 Bacteria 5752
287 Ga0105242_10053867 3300009176 Bacteria 3286
288 Ga0105248_10074434 3300009177 Bacteria 3817
289 Ga0105248_10171911 3300009177 Bacteria 2442
290 Ga0105248_10220359 3300009177 Bacteria 2136
291 Ga0105248_10447047 3300009177 Bacteria 1456
292 Ga0105248_10452143 3300009177 Bacteria 1447
293 Ga0105248_10679601 3300009177 Bacteria 1161
294 Ga0105237_10053790 3300009545 Unclassified 4037
295 Ga0105237_10592128 3300009545 Bacteria 1116
296 Ga0105237_10744921 3300009545 Bacteria 986
297 Ga0105237_11447883 3300009545 Unclassified 693
298 Ga0105238_10016655 3300009551 Bacteria 7446
299 Ga0105238_10022654 3300009551 Bacteria 6402
300 Ga0105238_10137453 3300009551 Bacteria 2421
301 Ga0105238_10294358 3300009551 Bacteria 1606
302 Ga0105238_10480988 3300009551 Bacteria 1241
303 Ga0105238_10556099 3300009551 Unclassified 1152
304 Ga0105238_10921055 3300009551 Bacteria 893
305 Ga0105238_11013972 3300009551 Unclassified 851
306 Ga0105238_11792211 3300009551 Unclassified 646
307 Ga0105238_12056725 3300009551 Unclassified 605
308 Ga0105238_12060705 3300009551 Unclassified 604
309 Ga0105238_12546412 3300009551 Unclassified 548
310 Ga0105249_10112207 3300009553 Bacteria 2578
311 Ga0099796_10042002 3300010159 Bacteria 1551
312 Ga0105239_10005962 3300010375 Bacteria 14181
313 Ga0105239_10086301 3300010375 Bacteria 3459
314 Ga0105239_10323194 3300010375 Bacteria 1740
315 Ga0105239_10808630 3300010375 Bacteria 1074
316 Ga0105239_11395350 3300010375 Unclassified 809
317 Ga0105239_11934011 3300010375 Bacteria 684
318 Ga0105239_13302566 3300010375 Unclassified 525
319 Ga0105246_10001854 3300011119 Bacteria 12705
320 Ga0105246_11616123 3300011119 Unclassified 613
321 Ga0157373_10001119 3300013100 Bacteria 20585
322 Ga0157373_10031848 3300013100 Bacteria 3797
323 Ga0157373_10396401 3300013100 Unclassified 989
324 Ga0157373_10729658 3300013100 Unclassified 727
325 Ga0157371_10005666 3300013102 Bacteria 10485
326 Ga0157371_10701612 3300013102 Bacteria 758
327 Ga0157370_10164565 3300013104 Bacteria 2063
328 Ga0157370_11990995 3300013104 Bacteria 521
329 Ga0157369_10001345 3300013105 Bacteria 30363
330 Ga0157369_10035084 3300013105 Bacteria 5501
331 Ga0157369_10038299 3300013105 Bacteria 5243
332 Ga0157369_10052365 3300013105 Bacteria 4417
333 Ga0157369_10147636 3300013105 Bacteria 2486
334 Ga0157369_10498082 3300013105 Bacteria 1260
335 Ga0157369_10585526 3300013105 Unclassified 1152
336 Ga0157369_10751627 3300013105 Unclassified 1003
337 Ga0157369_11238855 3300013105 Unclassified 761
338 Ga0157369_11311606 3300013105 Bacteria 738
339 Ga0157369_11436830 3300013105 Unclassified 702
340 Ga0157369_12259641 3300013105 Unclassified 551
341 Ga0157369_12263761 3300013105 Unclassified 551
342 Ga0157374_10011069 3300013296 Bacteria 7793
343 Ga0157374_10026177 3300013296 Bacteria 5246
344 Ga0157374_10033131 3300013296 Bacteria 4712
345 Ga0157374_10058122 3300013296 Unclassified 3614
346 Ga0157374_10093053 3300013296 Bacteria 2877
347 Ga0157374_10163595 3300013296 Bacteria 2168
348 Ga0157374_10283774 3300013296 Bacteria 1635
349 Ga0157374_10719607 3300013296 Unclassified 1012
350 Ga0157378_10000145 3300013297 Bacteria 66719
351 Ga0157378_10397411 3300013297 Bacteria 1357
352 Ga0157378_10739562 3300013297 Bacteria 1006
353 Ga0157378_11452698 3300013297 Unclassified 729
354 Ga0163162_10087570 3300013306 Bacteria 3193
355 Ga0163162_10206352 3300013306 Bacteria 2094
356 Ga0163162_12193052 3300013306 Unclassified 634
357 Ga0157372_10008298 3300013307 Bacteria 11043
358 Ga0157372_10033302 3300013307 Bacteria 5658
359 Ga0157372_10111529 3300013307 Unclassified 3134
360 Ga0157372_10116160 3300013307 Bacteria 3068
361 Ga0157372_10215434 3300013307 Unclassified 2226
362 Ga0157372_10353409 3300013307 Bacteria 1712
363 Ga0157375_13167096 3300013308 Unclassified 549
364 Ga0163163_10025274 3300014325 Bacteria 5662
365 Ga0163163_10059974 3300014325 Bacteria 3765
366 Ga0163163_10149055 3300014325 Bacteria 2384
367 Ga0163163_10762080 3300014325 Unclassified 1031
368 Ga0182008_10626640 3300014497 Unclassified 606
369 Ga0182008_10847554 3300014497 Bacteria 534
370 Ga0157377_10007969 3300014745 Bacteria 5144
371 Ga0157379_10060793 3300014968 Bacteria 3378
372 Ga0157379_10428888 3300014968 Bacteria 1218
373 Ga0157376_10031084 3300014969 Bacteria 4271
374 Ga0157376_10452452 3300014969 Unclassified 1253
375 Ga0157376_11597902 3300014969 Bacteria 686
376 Ga0182006_1019925 3300015261 Bacteria 2816
377 Ga0182007_10002409 3300015262 Bacteria 9337
378 Ga0163161_10103478 3300017792 Bacteria 2122
379 Ga0206356_10207189 3300020070 Unclassified 972
380 Ga0206355_1512251 3300020076 Bacteria 992
381 Ga0206351_10464849 3300020077 Bacteria 559
382 Ga0206352_10895603 3300020078 Unclassified 680
383 Ga0206350_11534362 3300020080 Unclassified 515
384 Ga0154015_1279385 3300020610 Bacteria 1650
385 Ga0213873_10042379 3300021358 Bacteria 1177
386 Ga0213874_10086069 3300021377 Unclassified 1025
387 Ga0224712_10070837 3300022467 Bacteria 1415
388 Ga0207673_1021856 3300025290 Unclassified 867
389 Ga0207426_1137607 3300025302 Bacteria 584
390 Ga0207697_10012379 3300025315 Bacteria 3577
391 Ga0207696_1041015 3300025711 Bacteria 1354
392 Ga0207682_10091581 3300025893 Unclassified 1319
393 Ga0207692_10023063 3300025898 Bacteria 2874
394 Ga0207692_10072310 3300025898 Bacteria 1821
395 Ga0207692_10175590 3300025898 Bacteria 1244
396 Ga0207692_10218755 3300025898 Bacteria 1128
397 Ga0207692_10732721 3300025898 Unclassified 643
398 Ga0207642_10101305 3300025899 Bacteria 1446
399 Ga0207642_10427703 3300025899 Unclassified 798
400 Ga0207710_10211733 3300025900 Unclassified 960
401 Ga0207710_10487651 3300025900 Bacteria 639
402 Ga0207688_10003069 3300025901 Bacteria 9113
403 Ga0207680_10195855 3300025903 Unclassified 1374
404 Ga0207680_10755074 3300025903 Bacteria 697
405 Ga0207647_10002063 3300025904 Bacteria 15352
406 Ga0207647_10006155 3300025904 Bacteria 8740
407 Ga0207647_10378050 3300025904 Bacteria 800
408 Ga0207685_10142327 3300025905 Bacteria 1076
409 Ga0207699_10089981 3300025906 Bacteria 1925
410 Ga0207699_10138949 3300025906 Bacteria 1594
411 Ga0207699_10140721 3300025906 Bacteria 1585
412 Ga0207699_10156817 3300025906 Unclassified 1512
413 Ga0207699_10191208 3300025906 Bacteria 1381
414 Ga0207699_10343204 3300025906 Unclassified 1052
415 Ga0207699_10363051 3300025906 Bacteria 1024
416 Ga0207699_11007123 3300025906 Unclassified 616
417 Ga0207699_11399524 3300025906 Unclassified 517
418 Ga0207645_10000901 3300025907 Bacteria 24637
419 Ga0207645_11087942 3300025907 Unclassified 539
420 Ga0207643_10000172 3300025908 Bacteria 44395
421 Ga0207705_10045267 3300025909 Bacteria 3163
422 Ga0207705_10513714 3300025909 Unclassified 931
423 Ga0207705_11001144 3300025909 Bacteria 646
424 Ga0207654_10395459 3300025911 Unclassified 960
425 Ga0207654_10659285 3300025911 Bacteria 750
426 Ga0207654_10704808 3300025911 Unclassified 725
427 Ga0207654_11096868 3300025911 Unclassified 580
428 Ga0207654_11450224 3300025911 Unclassified 501
429 Ga0207707_10060930 3300025912 Bacteria 3283
430 Ga0207707_10112690 3300025912 Bacteria 2378
431 Ga0207707_10177908 3300025912 Bacteria 1858
432 Ga0207707_10501566 3300025912 Unclassified 1035
433 Ga0207707_10502933 3300025912 Unclassified 1033
434 Ga0207707_10533333 3300025912 Unclassified 999
435 Ga0207707_10631450 3300025912 Bacteria 904
436 Ga0207707_10787269 3300025912 Unclassified 793
437 Ga0207707_11540672 3300025912 Unclassified 525
438 Ga0207695_11315022 3300025913 Unclassified 603
439 Ga0207671_10151305 3300025914 Bacteria 1793
440 Ga0207671_10977274 3300025914 Unclassified 668
441 Ga0207671_11469141 3300025914 Bacteria 527
442 Ga0207693_10077982 3300025915 Unclassified 2594
443 Ga0207693_10578518 3300025915 Bacteria 875
444 Ga0207693_10653952 3300025915 Unclassified 816
445 Ga0207663_10313172 3300025916 Bacteria 1177
446 Ga0207663_10402743 3300025916 Bacteria 1047
447 Ga0207663_10498430 3300025916 Bacteria 946
448 Ga0207660_10092661 3300025917 Bacteria 2243
449 Ga0207660_10103262 3300025917 Bacteria 2132
450 Ga0207660_10108214 3300025917 Bacteria 2087
451 Ga0207660_10354029 3300025917 Bacteria 1177
452 Ga0207660_10458451 3300025917 Bacteria 1031
453 Ga0207660_10605707 3300025917 Bacteria 892
454 Ga0207660_10894506 3300025917 Unclassified 725
455 Ga0207662_10002090 3300025918 Bacteria 9922
456 Ga0207657_10000660 3300025919 Bacteria 36719
457 Ga0207657_11202892 3300025919 Unclassified 576
458 Ga0207649_10001125 3300025920 Bacteria 16224
459 Ga0207649_10329425 3300025920 Bacteria 1124
460 Ga0207652_10078006 3300025921 Bacteria 2891
461 Ga0207652_10084852 3300025921 Bacteria 2775
462 Ga0207652_10115237 3300025921 Bacteria 2387
463 Ga0207652_10162586 3300025921 Bacteria 2002
464 Ga0207652_10483898 3300025921 Bacteria 1115
465 Ga0207652_10553165 3300025921 Bacteria 1034
466 Ga0207652_10572017 3300025921 Bacteria 1015
467 Ga0207652_11100325 3300025921 Bacteria 695
468 Ga0207646_10423062 3300025922 Bacteria 1202
469 Ga0207646_11731012 3300025922 Unclassified 536
470 Ga0207694_10289281 3300025924 Unclassified 1347
471 Ga0207694_10391218 3300025924 Bacteria 1155
472 Ga0207694_10454115 3300025924 Bacteria 1070
473 Ga0207694_10652886 3300025924 Bacteria 886
474 Ga0207650_10000059 3300025925 Bacteria 151427
475 Ga0207650_10144414 3300025925 Bacteria 1873
476 Ga0207650_10402085 3300025925 Unclassified 1134
477 Ga0207650_11341767 3300025925 Unclassified 609
478 Ga0207659_10071146 3300025926 Bacteria 2539
479 Ga0207687_10003663 3300025927 Bacteria 10349
480 Ga0207687_10009003 3300025927 Bacteria 6526
481 Ga0207687_10097260 3300025927 Bacteria 2159
482 Ga0207687_10378008 3300025927 Bacteria 1160
483 Ga0207687_10809445 3300025927 Unclassified 799
484 Ga0207700_10052978 3300025928 Unclassified 3037
485 Ga0207700_10096429 3300025928 Bacteria 2348
486 Ga0207700_10403578 3300025928 Bacteria 1198
487 Ga0207700_10440415 3300025928 Bacteria 1147
488 Ga0207700_10679714 3300025928 Bacteria 918
489 Ga0207700_11087226 3300025928 Unclassified 715
490 Ga0207700_11377148 3300025928 Unclassified 627
491 Ga0207664_10153852 3300025929 Unclassified 1956
492 Ga0207664_10162743 3300025929 Bacteria 1904
493 Ga0207664_10886907 3300025929 Bacteria 801
494 Ga0207664_11713824 3300025929 Bacteria 551
495 Ga0207644_10149789 3300025931 Unclassified 1804
496 Ga0207644_10613543 3300025931 Bacteria 904
497 Ga0207644_10676296 3300025931 Bacteria 860
498 Ga0207644_11350881 3300025931 Bacteria 599
499 Ga0207690_10149339 3300025932 Bacteria 1731
500 Ga0207690_10282315 3300025932 Bacteria 1293
501 Ga0207690_11362858 3300025932 Bacteria 593
502 Ga0207706_10000723 3300025933 Bacteria 34501
503 Ga0207706_10082973 3300025933 Bacteria 2817
504 Ga0207686_10107083 3300025934 Bacteria 1878
505 Ga0207686_10622330 3300025934 Unclassified 852
506 Ga0207709_11096733 3300025935 Unclassified 653
507 Ga0207704_10534212 3300025938 Unclassified 950
508 Ga0207665_10186645 3300025939 Unclassified 1504
509 Ga0207665_10370094 3300025939 Unclassified 1085
510 Ga0207665_10748534 3300025939 Bacteria 770
511 Ga0207691_10001129 3300025940 Bacteria 26514
512 Ga0207691_11400936 3300025940 Unclassified 574
513 Ga0207711_10010662 3300025941 Bacteria 7642
514 Ga0207711_10354258 3300025941 Bacteria 1359
515 Ga0207711_10965471 3300025941 Bacteria 791
516 Ga0207711_10976392 3300025941 Unclassified 786
517 Ga0207711_11006148 3300025941 Unclassified 773
518 Ga0207689_10203792 3300025942 Unclassified 1633
519 Ga0207689_10903620 3300025942 Unclassified 745
520 Ga0207689_11474515 3300025942 Unclassified 569
521 Ga0207661_10015604 3300025944 Bacteria 5594
522 Ga0207661_10096426 3300025944 Bacteria 2475
523 Ga0207661_10928453 3300025944 Bacteria 802
524 Ga0207679_10000415 3300025945 Bacteria 30616
525 Ga0207667_10006054 3300025949 Bacteria 14707
526 Ga0207667_10318463 3300025949 Bacteria 1588
527 Ga0207667_11019639 3300025949 Unclassified 814
528 Ga0207667_11445100 3300025949 Bacteria 660
529 Ga0207667_11587734 3300025949 Unclassified 623
530 Ga0207651_10010359 3300025960 Bacteria 5162
531 Ga0207651_10633779 3300025960 Unclassified 937
532 Ga0207668_10008891 3300025972 Bacteria 6007
533 Ga0207640_10045169 3300025981 Bacteria 2827
534 Ga0207640_10504562 3300025981 Bacteria 1008
535 Ga0207640_10624380 3300025981 Unclassified 915
536 Ga0207658_10014195 3300025986 Bacteria 5455
537 Ga0207658_10191920 3300025986 Bacteria 1699
538 Ga0207658_11784359 3300025986 Unclassified 561
539 Ga0207677_10017217 3300026023 Bacteria 4302
540 Ga0207677_10033691 3300026023 Bacteria 3308
541 Ga0207677_10158054 3300026023 Bacteria 1758
542 Ga0207677_10786837 3300026023 Bacteria 851
543 Ga0207703_10013619 3300026035 Bacteria 6337
544 Ga0207703_11769781 3300026035 Bacteria 594
545 Ga0207639_10076788 3300026041 Bacteria 2631
546 Ga0207639_10076954 3300026041 Bacteria 2628
547 Ga0207639_10355113 3300026041 Bacteria 1310
548 Ga0207639_10762615 3300026041 Bacteria 900
549 Ga0207639_10841749 3300026041 Unclassified 856
550 Ga0207639_11457974 3300026041 Bacteria 642
551 Ga0207678_10000581 3300026067 Bacteria 33440
552 Ga0207678_10653937 3300026067 Bacteria 923
553 Ga0207708_10146596 3300026075 Bacteria 1855
554 Ga0207702_10222682 3300026078 Unclassified 1758
555 Ga0207702_10565218 3300026078 Unclassified 1113
556 Ga0207702_10910654 3300026078 Unclassified 871
557 Ga0207702_11127990 3300026078 Unclassified 778
558 Ga0207641_10000025 3300026088 Bacteria 247727
559 Ga0207641_11301139 3300026088 Unclassified 727
560 Ga0207641_12005734 3300026088 Unclassified 580
561 Ga0207648_10003458 3300026089 Bacteria 16561
562 Ga0207648_10220378 3300026089 Bacteria 1686
563 Ga0207648_11946367 3300026089 Unclassified 549
564 Ga0207676_10000252 3300026095 Bacteria 46432
565 Ga0207676_10032451 3300026095 Bacteria 3935
566 Ga0207676_12082278 3300026095 Bacteria 566
567 Ga0207674_10000162 3300026116 Bacteria 79631
568 Ga0207674_10085960 3300026116 Bacteria 3139
569 Ga0207674_10244013 3300026116 Bacteria 1743
570 Ga0207674_10766300 3300026116 Unclassified 931
571 Ga0207675_100017450 3300026118 Bacteria 6700
572 Ga0207683_10001306 3300026121 Bacteria 22515
573 Ga0207683_10226238 3300026121 Bacteria 1705
574 Ga0207683_10725175 3300026121 Bacteria 922
575 Ga0207698_10290702 3300026142 Unclassified 1516
576 Ga0207698_11759518 3300026142 Unclassified 635
577 Ga0207698_12025110 3300026142 Unclassified 590
578 Ga0209998_10046632 3300027717 Bacteria 995
579 Ga0268266_10039280 3300028379 Bacteria 4031
580 Ga0268266_10118698 3300028379 Bacteria 2351
581 Ga0268266_11860746 3300028379 Unclassified 576
582 Ga0268265_10004703 3300028380 Bacteria 9421
583 Ga0268264_10050987 3300028381 Bacteria 3447
584 Ga0268264_10107924 3300028381 Bacteria 2433
585 Ga0268264_12591801 3300028381 Unclassified 512
586 Ga0265338_10134304 3300028800 Bacteria 1948
587 Ga0265338_11110356 3300028800 Unclassified 532
588 Ga0265328_10039726 3300031239 Bacteria 1735
589 Ga0265328_10323709 3300031239 Unclassified 598
590 Ga0265325_10005290 3300031241 Bacteria 8000
591 Ga0265325_10069646 3300031241 Bacteria 1768
592 Ga0265325_10402463 3300031241 Unclassified 599
593 Ga0265340_10030554 3300031247 Unclassified 2699
594 Ga0265331_10009077 3300031250 Bacteria 5615
595 Ga0265331_10040471 3300031250 Unclassified 2267
596 Ga0265327_10054337 3300031251 Bacteria 2073
597 Ga0265316_10023396 3300031344 Bacteria 5191
598 Ga0265316_10068518 3300031344 Bacteria 2741
599 Ga0265316_10147654 3300031344 Bacteria 1763
600 Ga0265316_10740895 3300031344 Unclassified 691
601 Ga0307408_100012830 3300031548 Bacteria 5558
602 Ga0265313_10008949 3300031595 Bacteria 6569
603 Ga0265314_10024067 3300031711 Bacteria 4626
604 Ga0307405_10032987 3300031731 Unclassified 3067
605 Ga0307405_10602317 3300031731 Unclassified 897
606 Ga0307413_10175803 3300031824 Bacteria 1521
607 Ga0307410_10004067 3300031852 Bacteria 7481
608 Ga0307407_10030849 3300031903 Bacteria 2897
609 Ga0307407_10857085 3300031903 Unclassified 695
610 Ga0307412_10404596 3300031911 Bacteria 1112
611 Ga0307409_100223561 3300031995 Bacteria 1701
612 Ga0307416_100072666 3300032002 Unclassified 2864
613 Ga0307416_100156122 3300032002 Bacteria 2101
614 Ga0307416_100367833 3300032002 Unclassified 1463
615 Ga0307414_10597790 3300032004 Bacteria 989
616 Ga0307411_10006952 3300032005 Bacteria 5711
617 Ga0307415_100273151 3300032126 Bacteria 1386
618 Ga0307415_101457998 3300032126 Bacteria 653
619 Ga0373950_0041607 3300034818 Unclassified 881
620 Ga0373926_0002055 3300035083 Bacteria 6335
621 Ga0373926_0121933 3300035083 Unclassified 983
622 Ga0373934_0235300 3300035086 Bacteria 756
623 Ga0373944_0023562 3300035089 Bacteria 1797
624 Ga0373944_0114371 3300035089 Unclassified 924
625 Ga0373923_0039536 3300035111 Bacteria 1938
626 Ga0373923_0051294 3300035111 Viruses 1730
627 Ga0373923_0095947 3300035111 Bacteria 1302
628 Ga0373923_0111481 3300035111 Bacteria 1215
629 Ga0373923_0212153 3300035111 Bacteria 898
630 Ga0373936_0240612 3300035113 Unclassified 806
631 Ga0373936_0506507 3300035113 Unclassified 562
632 Ga0373936_0581361 3300035113 Bacteria 525
633 Ga0373945_0001313 3300035116 Bacteria 7543
634 Ga0373945_0322350 3300035116 Bacteria 665
635 Ga0373956_0234414 3300035119 Bacteria 872
636 Ga0373943_0006731 3300035170 Bacteria 5158
637 Ga0373946_0012860 3300035171 Bacteria 3138
638 Ga0373955_0013343 3300035172 Bacteria 3972
639 Ga0373955_0324828 3300035172 Bacteria 930
640 Ga0373955_1025560 3300035172 Unclassified 508
641 Ga0373924_0000248 3300035410 Bacteria 16512
642 Ga0373924_0142201 3300035410 Bacteria 1047
643 Ga0373935_0003124 3300035692 Bacteria 9554
644 Ga0373935_0034467 3300035692 Bacteria 3155
645 Ga0373935_0048008 3300035692 Bacteria 2701
646 Ga0373935_0096713 3300035692 Bacteria 1941
647 Ga0373935_0398230 3300035692 Unclassified 988
648 Ga0373935_0609527 3300035692 Bacteria 799
649 Ga0373935_1408267 3300035692 Unclassified 521
650 Ga0373935_1452802 3300035692 Bacteria 513
651 Ga0373927_0079790 3300035695 Bacteria 2120
652 Ga0373927_0080544 3300035695 Bacteria 2110
653 Ga0373927_0316908 3300035695 Unclassified 1027
654 Ga0373927_1115395 3300035695 Unclassified 520
655 Ga0373933_0399813 3300035724 Bacteria 896
656 Ga0373933_0664490 3300035724 Unclassified 685
657 Ga0373933_0860179 3300035724 Unclassified 597
658 Ga0373947_0017811 3300035725 Unclassified 4086
659 Ga0373947_0028162 3300035725 Bacteria 3291
660 Ga0373947_0122539 3300035725 Bacteria 1653
661 Ga0373937_0000437 3300036401 Bacteria 38580
662 Ga0373937_0072227 3300036401 Unclassified 3182
663 Ga0373937_0173066 3300036401 Bacteria 2026
664 Ga0373937_0197899 3300036401 Bacteria 1889
665 Ga0373937_0455986 3300036401 Unclassified 1214
666 Ga0373937_0638659 3300036401 Unclassified 1010
667 Ga0373937_0641992 3300036401 Unclassified 1007
668 Ga0373937_0680383 3300036401 Bacteria 975
669 Ga0373937_1454142 3300036401 Unclassified 633
670 Ga0373925_0005732 3300037068 Bacteria 9234
671 Ga0373925_0043304 3300037068 Bacteria 3340
672 Ga0373925_1008285 3300037068 Bacteria 685
673 Ga0373925_1368167 3300037068 Bacteria 580
674 Ga0373925_1720913 3300037068 Unclassified 512
675 Ga0395900_0119579 3300037418 Bacteria 2704
676 Ga0395898_0049727 3300037466 Bacteria 4107
677 Ga0395898_0744507 3300037466 Bacteria 921
678 Ga0395898_1511931 3300037466 Unclassified 597
679 Ga0395898_1572946 3300037466 Unclassified 582
680 Ga0395898_1676973 3300037466 Bacteria 559
681 Ga0395901_1992297 3300038443 Unclassified 527
682 Ga0436365_0163368 3300039437 Bacteria 1218
683 Ga0436361_0488693 3300039447 Bacteria 1847
684 Ga0436363_0501633 3300039450 Unclassified 3132
685 Ga0436363_0882976 3300039450 Bacteria 732
686 Ga0436363_0921361 3300039450 Bacteria 639
687 Ga0436363_1608620 3300039450 Bacteria 2224
688 Ga0436362_0763575 3300039453 Viruses 1587
689 Ga0436362_0774876 3300039453 Unclassified 591
690 Ga0451839_0856090 3300041496 Unclassified 898
691 Ga0451577_0000054 3300042876 Bacteria 278798
692 Ga0451577_0804712 3300042876 Bacteria 849
693 Ga0451577_1068579 3300042876 Bacteria 723
694 Ga0451577_1855001 3300042876 Unclassified 528
695 Ga0453683_0003233 3300044673 Bacteria 12114
696 Ga0453683_0203042 3300044673 Bacteria 1259
697 Ga0466966_0306187 3300044684 Bacteria 955
698 Ga0466966_0705261 3300044684 Bacteria 608
699 Ga0466963_0017484 3300044694 Unclassified 4470
700 Ga0453684_0000289 3300044712 Bacteria 215476
701 Ga0453684_0219315 3300044712 Bacteria 2205
702 Ga0453684_0527378 3300044712 Bacteria 1304
703 Ga0453684_0640634 3300044712 Bacteria 1161
704 Ga0453684_1515091 3300044712 Bacteria 691
705 Ga0453684_2109050 3300044712 Bacteria 565
706 Ga0466968_0434700 3300044735 Bacteria 647
707 Ga0466968_0591980 3300044735 Unclassified 559
708 Ga0466970_0735198 3300044765 Bacteria 576
709 Ga0466957_0000065 3300044842 Bacteria 40207
710 Ga0466957_0115257 3300044842 Unclassified 1708
711 Ga0466957_0672916 3300044842 Bacteria 729
712 Ga0466957_1257174 3300044842 Bacteria 537
713 Ga0466959_0016961 3300045049 Bacteria 5331
714 Ga0451576_0003350 3300045051 Bacteria 22194
715 Ga0451576_0133045 3300045051 Bacteria 2592
716 Ga0451576_0165179 3300045051 Bacteria 2310
717 Ga0451576_0456697 3300045051 Bacteria 1341
718 Ga0451576_0471208 3300045051 Unclassified 1319
719 Ga0451576_2317614 3300045051 Unclassified 550
720 Ga0451576_2617154 3300045051 Bacteria 514
721 Ga0466967_0055328 3300045976 Bacteria 3495
722 Ga0466967_0068117 3300045976 Bacteria 3177
723 Ga0466967_0623768 3300045976 Unclassified 1065
724 Ga0466967_1097650 3300045976 Unclassified 793
725 Ga0466967_1784469 3300045976 Unclassified 612
726 Ga0466967_2560717 3300045976 Unclassified 505
727 Ga0495603_0547288 3300046455 Unclassified 663
728 Ga0495651_0044034 3300046462 Bacteria 3460
729 Ga0495651_0273510 3300046462 Bacteria 1144
730 Ga0495651_0763501 3300046462 Bacteria 599
731 Ga0495653_0680180 3300046463 Unclassified 626
732 Ga0495580_0194241 3300046472 Bacteria 1399
733 Ga0495580_0341787 3300046472 Bacteria 1015
734 Ga0495580_0370711 3300046472 Unclassified 968
735 Ga0495580_1023839 3300046472 Unclassified 525
736 Ga0495582_0031880 3300046473 Bacteria 2898
737 Ga0495582_0698873 3300046473 Bacteria 587
738 Ga0495639_0446603 3300046475 Unclassified 656
739 Ga0495664_0919595 3300046477 Unclassified 511
740 Ga0495594_0836129 3300046499 Unclassified 518
741 Ga0495608_0035097 3300046511 Unclassified 3384
742 Ga0495618_0871673 3300046514 Unclassified 521
743 Ga0495630_0063439 3300046517 Bacteria 2775
744 Ga0495630_0609423 3300046517 Bacteria 837
745 Ga0495643_0098609 3300046522 Bacteria 1500
746 Ga0495642_0507901 3300046528 Unclassified 534
747 Ga0495652_0136619 3300046529 Bacteria 1934
748 Ga0495665_0014305 3300046531 Unclassified 4281
749 Ga0495586_0160442 3300046535 Bacteria 1268
750 Ga0495587_0787533 3300046536 Bacteria 519
751 Ga0495667_0317686 3300046559 Unclassified 986
752 Ga0495635_0031352 3300046663 Unclassified 3691
753 Ga0495657_0077229 3300046675 Bacteria 2161
754 Ga0495599_0692187 3300046678 Unclassified 588
755 Ga0495623_0046319 3300046679 Bacteria 2761
756 Ga0495669_0005788 3300046684 Bacteria 5156
757 Ga0495669_0012701 3300046684 Bacteria 3586
758 Ga0495669_0016894 3300046684 Bacteria 3130
759 Ga0495669_0176818 3300046684 Unclassified 1016
760 Ga0495670_0574543 3300046691 Bacteria 614
761 Ga0495649_0005004 3300046694 Bacteria 8522
762 Ga0495604_0148206 3300047317 Unclassified 1670
763 Ga0495676_0968702 3300047321 Unclassified 544
764 Ga0495687_066994 3300047443 Bacteria 1455
765 Ga0495675_0200620 3300047444 Unclassified 1214
766 Ga0495593_0409404 3300047673 Unclassified 678
767 Ga0495602_0357183 3300048088 Bacteria 1053
768 Ga0495614_0267159 3300048089 Unclassified 785
769 Ga0495614_0499263 3300048089 Unclassified 579
770 Ga0496101_0540257 3300048904 Unclassified 921
771 Ga0496101_0830291 3300048904 Unclassified 728
772 Ga0496102_0028897 3300048905 Bacteria 4956
773 Ga0496102_0067618 3300048905 Unclassified 3278
774 Ga0496102_0131043 3300048905 Bacteria 2347
775 Ga0496102_0389044 3300048905 Unclassified 1312
776 Ga0496102_0707015 3300048905 Unclassified 931
777 Ga0496102_1564600 3300048905 Unclassified 578
778 Ga0496103_0698399 3300048906 Unclassified 643
779 Ga0496104_0258689 3300048907 Bacteria 1653
780 Ga0496104_0273011 3300048907 Bacteria 1604
781 Ga0496104_0363592 3300048907 Bacteria 1359
782 Ga0496104_0503661 3300048907 Bacteria 1122
783 Ga0496104_0993073 3300048907 Bacteria 743
784 Ga0496105_0004526 3300048908 Bacteria 10474
785 Ga0496105_0338256 3300048908 Bacteria 1204
786 Ga0496105_0468113 3300048908 Bacteria 993
787 Ga0496105_1178935 3300048908 Bacteria 565
788 Ga0496106_0129013 3300048909 Bacteria 1982
789 Ga0496106_0145797 3300048909 Bacteria 1865
790 Ga0496107_0613047 3300048910 Bacteria 804
791 Ga0496107_0980642 3300048910 Unclassified 614
792 Ga0496107_1266857 3300048910 Unclassified 528
793 Ga0496108_0000203 3300048911 Bacteria 54921
794 Ga0496108_0086225 3300048911 Bacteria 2666
795 Ga0496108_0238685 3300048911 Bacteria 1581
796 Ga0496109_0000228 3300048912 Bacteria 54849
797 Ga0496109_0031502 3300048912 Bacteria 4759
798 Ga0496109_0738114 3300048912 Bacteria 922
799 Ga0496109_0856969 3300048912 Bacteria 846
800 Ga0496109_1594183 3300048912 Bacteria 587
801 Ga0496110_0000145 3300048913 Bacteria 41800
802 Ga0496110_0023501 3300048913 Bacteria 5244
803 Ga0496110_0076017 3300048913 Bacteria 2985
804 Ga0496110_0513892 3300048913 Bacteria 1090
805 Ga0496111_0023585 3300048914 Unclassified 4321
806 Ga0496111_0082490 3300048914 Bacteria 2348
807 Ga0496111_0114010 3300048914 Bacteria 1992
808 Ga0496112_0000048 3300048915 Bacteria 84789
809 Ga0496112_0008072 3300048915 Bacteria 9398
810 Ga0496112_0022754 3300048915 Bacteria 5979
811 Ga0496112_0063880 3300048915 Bacteria 3632
812 Ga0496112_0069992 3300048915 Bacteria 3466
813 Ga0496112_0166680 3300048915 Unclassified 2169
814 Ga0496112_0296451 3300048915 Bacteria 1563
815 Ga0496112_0308663 3300048915 Bacteria 1527
816 Ga0496112_0605349 3300048915 Bacteria 1027
817 Ga0496112_1008330 3300048915 Unclassified 752
818 Ga0496113_0000613 3300048916 Bacteria 17855
819 Ga0496113_0002484 3300048916 Bacteria 10747
820 Ga0496113_0160797 3300048916 Bacteria 1775
821 Ga0496113_0384461 3300048916 Bacteria 1126
822 Ga0496113_0395806 3300048916 Bacteria 1109
823 Ga0496113_1026221 3300048916 Bacteria 649
824 Ga0496115_0012247 3300048918 Bacteria 6451
825 Ga0496115_0097678 3300048918 Bacteria 2405
826 Ga0496115_1106422 3300048918 Unclassified 600
827 Ga0496126_0342885 3300048929 Bacteria 1224
828 Ga0501290_051396 3300049513 Unclassified 643
829 Ga0501298_028735 3300049521 Bacteria 1080
830 Ga0501048_1222433 3300049582 Unclassified 540
831 Ga0501070_0763463 3300049586 Bacteria 761
832 Ga0501073_0924941 3300049589 Unclassified 600
833 Ga0501256_020613 3300049685 Unclassified 690
834 Ga0501257_277804 3300049686 Unclassified 503
835 Ga0501259_058031 3300049688 Bacteria 802
836 Ga0501080_1068265 3300049742 Bacteria 698
837 Ga0501283_018695 3300049779 Bacteria 1092
838 nmdc:mga05p37_1213488_c1 3300050507 Unclassified 778
839 nmdc:mga05p37_98700_c1 3300050507 Bacteria 3597
840 nmdc:mga0n895_1332383_c1 3300050512 Unclassified 688
841 nmdc:mga0n895_2270_c1 3300050512 Bacteria 14906
842 nmdc:mga0rr50_402415_c1 3300050513 Bacteria 1156
843 nmdc:mga0rr50_72_c1 3300050513 Bacteria 57900
844 nmdc:mga08x19_1075_c1 3300050514 Bacteria 17044
845 nmdc:mga08x19_195825_c1 3300050514 Unclassified 1384
846 nmdc:mga08x19_6208_c1 3300050514 Bacteria 7067
847 nmdc:mga0a205_3646_c1 3300050515 Bacteria 9724
848 Ga0495601_0782841 3300053077 Bacteria 606
849 Ga0495619_0292886 3300053085 Bacteria 1128
850 Ga0501084_0545099 3300054114 Bacteria 980
851 Ga0587079_063939 3300059647 Bacteria 804
852 Ga0530510_0599699 3300061734 Bacteria 838

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10438885 Ga0070709_104388851 90
2 3300005435 Ga0070714_100000183 Ga0070714_10000018326 90
3 3300005435 Ga0070714_100033971 Ga0070714_1000339714 90
4 3300005435 Ga0070714_100324820 Ga0070714_1003248203 90
5 3300005435 Ga0070714_100638205 Ga0070714_1006382052 90
6 3300005436 Ga0070713_100244038 Ga0070713_1002440382 90
7 3300005436 Ga0070713_101849992 Ga0070713_1018499922 90
8 3300005437 Ga0070710_10599149 Ga0070710_105991491 90
9 3300005439 Ga0070711_100044649 Ga0070711_1000446492 90
10 3300005439 Ga0070711_100391088 Ga0070711_1003910882 90
11 3300005439 Ga0070711_101244354 Ga0070711_1012443541 90
12 3300005440 Ga0070705_100024988 Ga0070705_1000249882 90
13 3300005440 Ga0070705_101056716 Ga0070705_1010567161 90
14 3300005444 Ga0070694_101684455 Ga0070694_1016844551 90
15 3300005458 Ga0070681_10233834 Ga0070681_102338342 90
16 3300005614 Ga0068856_100037749 Ga0068856_1000377494 90
17 3300005614 Ga0068856_100055186 Ga0068856_1000551863 90
18 3300006028 Ga0070717_10258786 Ga0070717_102587862 90
19 3300006173 Ga0070716_100726225 Ga0070716_1007262252 90
20 3300006175 Ga0070712_100962207 Ga0070712_1009622072 90
21 3300006871 Ga0075434_100000177 Ga0075434_10000017727 90
22 3300006914 Ga0075436_100007556 Ga0075436_1000075565 90
23 3300007076 Ga0075435_100000319 Ga0075435_1000003198 90
24 3300009098 Ga0105245_10906204 Ga0105245_109062042 90
25 3300009147 Ga0114129_10184786 Ga0114129_101847862 90
26 3300009174 Ga0105241_10535740 Ga0105241_105357401 90
27 3300009174 Ga0105241_11802192 Ga0105241_118021921 90
28 3300009174 Ga0105241_12640656 Ga0105241_126406561 90
29 3300013100 Ga0157373_10396401 Ga0157373_103964012 90
30 3300013105 Ga0157369_11436830 Ga0157369_114368302 90
31 3300013307 Ga0157372_10111529 Ga0157372_101115294 90
32 3300014497 Ga0182008_10847554 Ga0182008_108475541 90
33 3300025915 Ga0207693_10578518 Ga0207693_105785182 90
34 3300050507 nmdc:mga05p37_1213488_c1 nmdc:mga05p37_1213488_c1_191_469 90
35 3300050512 nmdc:mga0n895_2270_c1 nmdc:mga0n895_2270_c1_6181_6459 90
36 3300050513 nmdc:mga0rr50_72_c1 nmdc:mga0rr50_72_c1_49224_49502 90
37 3300050514 nmdc:mga08x19_1075_c1 nmdc:mga08x19_1075_c1_4099_4377 90
38 3300050515 nmdc:mga0a205_3646_c1 nmdc:mga0a205_3646_c1_3471_3749 90
39 3300001976 JGI24752J21851_1001100 JGI24752J21851_10011005 91
40 3300001990 JGI24737J22298_10167643 JGI24737J22298_101676432 91
41 3300001991 JGI24743J22301_10028888 JGI24743J22301_100288883 91
42 3300002155 JGI24033J26618_1019761 JGI24033J26618_10197612 91
43 3300002239 JGI24034J26672_10000337 JGI24034J26672_100003376 91
44 3300002459 JGI24751J29686_10000704 JGI24751J29686_100007045 91
45 3300003316 rootH1_10023707 rootH1_100237073 91
46 3300004799 Ga0058863_10023995 Ga0058863_100239953 91
47 3300004803 Ga0058862_12692804 Ga0058862_126928041 91
48 3300005290 Ga0065712_10077652 Ga0065712_100776521 91
49 3300005293 Ga0065715_10000987 Ga0065715_100009872 91
50 3300005293 Ga0065715_10688515 Ga0065715_106885151 91
51 3300005295 Ga0065707_10181797 Ga0065707_101817971 91
52 3300005327 Ga0070658_10026605 Ga0070658_100266055 91
53 3300005327 Ga0070658_10114778 Ga0070658_101147784 91
54 3300005329 Ga0070683_100034979 Ga0070683_1000349793 91
55 3300005329 Ga0070683_100538893 Ga0070683_1005388933 91
56 3300005329 Ga0070683_101864135 Ga0070683_1018641351 91
57 3300005330 Ga0070690_100168815 Ga0070690_1001688151 91
58 3300005330 Ga0070690_100455888 Ga0070690_1004558881 91
59 3300005331 Ga0070670_100368101 Ga0070670_1003681012 91
60 3300005331 Ga0070670_100654023 Ga0070670_1006540232 91
61 3300005334 Ga0068869_100419330 Ga0068869_1004193303 91
62 3300005334 Ga0068869_101052596 Ga0068869_1010525961 91
63 3300005335 Ga0070666_11021624 Ga0070666_110216241 91
64 3300005336 Ga0070680_100045686 Ga0070680_1000456861 91
65 3300005336 Ga0070680_100177835 Ga0070680_1001778351 91
66 3300005336 Ga0070680_100648246 Ga0070680_1006482462 91
67 3300005336 Ga0070680_100695121 Ga0070680_1006951212 91
68 3300005336 Ga0070680_100808497 Ga0070680_1008084973 91
69 3300005336 Ga0070680_101498247 Ga0070680_1014982472 91
70 3300005337 Ga0070682_100026601 Ga0070682_1000266015 91
71 3300005337 Ga0070682_100030142 Ga0070682_1000301421 91
72 3300005337 Ga0070682_100039509 Ga0070682_1000395094 91
73 3300005338 Ga0068868_100005847 Ga0068868_1000058475 91
74 3300005338 Ga0068868_100041733 Ga0068868_1000417334 91
75 3300005338 Ga0068868_101155308 Ga0068868_1011553082 91
76 3300005338 Ga0068868_101521471 Ga0068868_1015214711 91
77 3300005339 Ga0070660_100011892 Ga0070660_1000118921 91
78 3300005339 Ga0070660_100244417 Ga0070660_1002444173 91
79 3300005340 Ga0070689_100001794 Ga0070689_1000017945 91
80 3300005343 Ga0070687_100007106 Ga0070687_1000071066 91
81 3300005344 Ga0070661_100020981 Ga0070661_1000209815 91
82 3300005344 Ga0070661_100023061 Ga0070661_1000230613 91
83 3300005344 Ga0070661_100273787 Ga0070661_1002737872 91
84 3300005344 Ga0070661_100641995 Ga0070661_1006419952 91
85 3300005344 Ga0070661_101696074 Ga0070661_1016960741 91
86 3300005345 Ga0070692_10034365 Ga0070692_100343652 91
87 3300005347 Ga0070668_100196526 Ga0070668_1001965262 91
88 3300005347 Ga0070668_101521432 Ga0070668_1015214322 91
89 3300005353 Ga0070669_100009677 Ga0070669_1000096775 91
90 3300005353 Ga0070669_100657442 Ga0070669_1006574423 91
91 3300005354 Ga0070675_100127127 Ga0070675_1001271273 91
92 3300005355 Ga0070671_100032972 Ga0070671_1000329725 91
93 3300005355 Ga0070671_100257526 Ga0070671_1002575262 91
94 3300005356 Ga0070674_100014116 Ga0070674_1000141165 91
95 3300005364 Ga0070673_100017192 Ga0070673_1000171926 91
96 3300005364 Ga0070673_101536667 Ga0070673_1015366672 91
97 3300005365 Ga0070688_100002058 Ga0070688_10000205810 91
98 3300005365 Ga0070688_100366073 Ga0070688_1003660733 91
99 3300005366 Ga0070659_100024736 Ga0070659_1000247366 91
100 3300005366 Ga0070659_100436004 Ga0070659_1004360043 91
101 3300005367 Ga0070667_100180757 Ga0070667_1001807573 91
102 3300005367 Ga0070667_101620490 Ga0070667_1016204901 91
103 3300005367 Ga0070667_101876032 Ga0070667_1018760322 91
104 3300005434 Ga0070709_10218588 Ga0070709_102185882 91
105 3300005434 Ga0070709_10274308 Ga0070709_102743083 91
106 3300005434 Ga0070709_10680957 Ga0070709_106809571 91
107 3300005434 Ga0070709_10686462 Ga0070709_106864621 91
108 3300005434 Ga0070709_10927770 Ga0070709_109277701 91
109 3300005434 Ga0070709_11233883 Ga0070709_112338831 91
110 3300005435 Ga0070714_100061176 Ga0070714_1000611763 91
111 3300005435 Ga0070714_100272918 Ga0070714_1002729182 91
112 3300005435 Ga0070714_100792017 Ga0070714_1007920172 91
113 3300005435 Ga0070714_100899996 Ga0070714_1008999962 91
114 3300005435 Ga0070714_100973984 Ga0070714_1009739842 91
115 3300005435 Ga0070714_101117163 Ga0070714_1011171631 91
116 3300005435 Ga0070714_101499549 Ga0070714_1014995491 91
117 3300005435 Ga0070714_101981096 Ga0070714_1019810961 91
118 3300005436 Ga0070713_100023609 Ga0070713_1000236094 91
119 3300005436 Ga0070713_100028256 Ga0070713_1000282564 91
120 3300005436 Ga0070713_100069129 Ga0070713_1000691293 91
121 3300005436 Ga0070713_100717377 Ga0070713_1007173771 91
122 3300005436 Ga0070713_100836188 Ga0070713_1008361882 91
123 3300005436 Ga0070713_100951760 Ga0070713_1009517601 91
124 3300005436 Ga0070713_101753220 Ga0070713_1017532201 91
125 3300005436 Ga0070713_101928915 Ga0070713_1019289151 91
126 3300005437 Ga0070710_10061816 Ga0070710_100618163 91
127 3300005437 Ga0070710_10210269 Ga0070710_102102692 91
128 3300005437 Ga0070710_10515526 Ga0070710_105155261 91
129 3300005437 Ga0070710_10914061 Ga0070710_109140611 91
130 3300005437 Ga0070710_11020633 Ga0070710_110206331 91
131 3300005437 Ga0070710_11389211 Ga0070710_113892112 91
132 3300005439 Ga0070711_100324674 Ga0070711_1003246741 91
133 3300005439 Ga0070711_100350117 Ga0070711_1003501172 91
134 3300005441 Ga0070700_100072700 Ga0070700_1000727002 91
135 3300005444 Ga0070694_100336848 Ga0070694_1003368481 91
136 3300005455 Ga0070663_100064452 Ga0070663_1000644522 91
137 3300005456 Ga0070678_100616350 Ga0070678_1006163503 91
138 3300005457 Ga0070662_100360555 Ga0070662_1003605553 91
139 3300005458 Ga0070681_10028494 Ga0070681_100284949 91
140 3300005458 Ga0070681_10063281 Ga0070681_100632813 91
141 3300005458 Ga0070681_10064405 Ga0070681_100644053 91
142 3300005458 Ga0070681_10310418 Ga0070681_103104184 91
143 3300005458 Ga0070681_10417526 Ga0070681_104175261 91
144 3300005458 Ga0070681_10736551 Ga0070681_107365511 91
145 3300005458 Ga0070681_10870980 Ga0070681_108709802 91
146 3300005458 Ga0070681_11150165 Ga0070681_111501652 91
147 3300005459 Ga0068867_100082865 Ga0068867_1000828651 91
148 3300005466 Ga0070685_10004126 Ga0070685_100041265 91
149 3300005468 Ga0070707_100082687 Ga0070707_1000826873 91
150 3300005468 Ga0070707_101166073 Ga0070707_1011660731 91
151 3300005530 Ga0070679_100009060 Ga0070679_1000090601 91
152 3300005530 Ga0070679_100041797 Ga0070679_1000417977 91
153 3300005530 Ga0070679_100049113 Ga0070679_1000491131 91
154 3300005530 Ga0070679_100281193 Ga0070679_1002811932 91
155 3300005530 Ga0070679_100347177 Ga0070679_1003471772 91
156 3300005530 Ga0070679_100487258 Ga0070679_1004872582 91
157 3300005530 Ga0070679_100517925 Ga0070679_1005179252 91
158 3300005530 Ga0070679_100699335 Ga0070679_1006993352 91
159 3300005530 Ga0070679_101583193 Ga0070679_1015831932 91
160 3300005530 Ga0070679_102189212 Ga0070679_1021892122 91
161 3300005535 Ga0070684_100002682 Ga0070684_1000026825 91
162 3300005535 Ga0070684_100054714 Ga0070684_1000547142 91
163 3300005535 Ga0070684_100101202 Ga0070684_1001012022 91
164 3300005535 Ga0070684_100253904 Ga0070684_1002539041 91
165 3300005535 Ga0070684_101364374 Ga0070684_1013643741 91
166 3300005536 Ga0070697_100006153 Ga0070697_1000061535 91
167 3300005539 Ga0068853_100016340 Ga0068853_1000163405 91
168 3300005539 Ga0068853_100197807 Ga0068853_1001978072 91
169 3300005539 Ga0068853_100276794 Ga0068853_1002767943 91
170 3300005539 Ga0068853_100604842 Ga0068853_1006048422 91
171 3300005539 Ga0068853_100976563 Ga0068853_1009765632 91
172 3300005539 Ga0068853_102474951 Ga0068853_1024749511 91
173 3300005543 Ga0070672_100003745 Ga0070672_1000037452 91
174 3300005544 Ga0070686_100485333 Ga0070686_1004853332 91
175 3300005544 Ga0070686_100610841 Ga0070686_1006108411 91
176 3300005545 Ga0070695_100848135 Ga0070695_1008481352 91
177 3300005546 Ga0070696_100112546 Ga0070696_1001125462 91
178 3300005546 Ga0070696_100551268 Ga0070696_1005512682 91
179 3300005547 Ga0070693_100105611 Ga0070693_1001056112 91
180 3300005547 Ga0070693_100162884 Ga0070693_1001628842 91
181 3300005547 Ga0070693_100172870 Ga0070693_1001728701 91
182 3300005548 Ga0070665_100018649 Ga0070665_1000186493 91
183 3300005548 Ga0070665_101383046 Ga0070665_1013830461 91
184 3300005549 Ga0070704_102064699 Ga0070704_1020646991 91
185 3300005563 Ga0068855_100020077 Ga0068855_1000200777 91
186 3300005563 Ga0068855_100152904 Ga0068855_1001529043 91
187 3300005563 Ga0068855_100222770 Ga0068855_1002227703 91
188 3300005563 Ga0068855_100355651 Ga0068855_1003556514 91
189 3300005563 Ga0068855_100657991 Ga0068855_1006579912 91
190 3300005563 Ga0068855_100682325 Ga0068855_1006823251 91
191 3300005564 Ga0070664_100143608 Ga0070664_1001436081 91
192 3300005564 Ga0070664_100220385 Ga0070664_1002203852 91
193 3300005564 Ga0070664_100229022 Ga0070664_1002290222 91
194 3300005564 Ga0070664_100783958 Ga0070664_1007839582 91
195 3300005577 Ga0068857_100003337 Ga0068857_10000333711 91
196 3300005577 Ga0068857_100072067 Ga0068857_1000720676 91
197 3300005577 Ga0068857_100258031 Ga0068857_1002580311 91
198 3300005577 Ga0068857_100931540 Ga0068857_1009315401 91
199 3300005577 Ga0068857_100990387 Ga0068857_1009903873 91
200 3300005577 Ga0068857_101100468 Ga0068857_1011004682 91
201 3300005578 Ga0068854_100004220 Ga0068854_1000042205 91
202 3300005578 Ga0068854_101256651 Ga0068854_1012566512 91
203 3300005578 Ga0068854_101655987 Ga0068854_1016559872 91
204 3300005578 Ga0068854_101707364 Ga0068854_1017073641 91
205 3300005614 Ga0068856_100027595 Ga0068856_1000275956 91
206 3300005614 Ga0068856_100041407 Ga0068856_1000414075 91
207 3300005614 Ga0068856_100151650 Ga0068856_1001516502 91
208 3300005614 Ga0068856_100559022 Ga0068856_1005590221 91
209 3300005614 Ga0068856_100972854 Ga0068856_1009728542 91
210 3300005614 Ga0068856_101235390 Ga0068856_1012353902 91
211 3300005614 Ga0068856_101644074 Ga0068856_1016440741 91
212 3300005614 Ga0068856_101698318 Ga0068856_1016983181 91
213 3300005615 Ga0070702_100398975 Ga0070702_1003989752 91
214 3300005615 Ga0070702_100934224 Ga0070702_1009342242 91
215 3300005616 Ga0068852_100079181 Ga0068852_1000791811 91
216 3300005616 Ga0068852_102315881 Ga0068852_1023158812 91
217 3300005616 Ga0068852_102783593 Ga0068852_1027835931 91
218 3300005618 Ga0068864_100032295 Ga0068864_1000322952 91
219 3300005618 Ga0068864_100193489 Ga0068864_1001934892 91
220 3300005618 Ga0068864_100823976 Ga0068864_1008239761 91
221 3300005618 Ga0068864_100925747 Ga0068864_1009257472 91
222 3300005618 Ga0068864_102359504 Ga0068864_1023595041 91
223 3300005718 Ga0068866_10009998 Ga0068866_100099983 91
224 3300005718 Ga0068866_10514773 Ga0068866_105147732 91
225 3300005719 Ga0068861_100009849 Ga0068861_1000098494 91
226 3300005840 Ga0068870_10000935 Ga0068870_100009355 91
227 3300005841 Ga0068863_100023970 Ga0068863_1000239702 91
228 3300005841 Ga0068863_100068107 Ga0068863_1000681073 91
229 3300005841 Ga0068863_100306705 Ga0068863_1003067053 91
230 3300005841 Ga0068863_101960798 Ga0068863_1019607982 91
231 3300005841 Ga0068863_102037876 Ga0068863_1020378761 91
232 3300005842 Ga0068858_100249002 Ga0068858_1002490023 91
233 3300005843 Ga0068860_100089866 Ga0068860_1000898665 91
234 3300005843 Ga0068860_100091141 Ga0068860_1000911412 91
235 3300005843 Ga0068860_100258050 Ga0068860_1002580502 91
236 3300005983 Ga0081540_1011430 Ga0081540_10114303 91
237 3300006028 Ga0070717_10035619 Ga0070717_100356193 91
238 3300006028 Ga0070717_10086596 Ga0070717_100865964 91
239 3300006028 Ga0070717_10177409 Ga0070717_101774092 91
240 3300006028 Ga0070717_10993567 Ga0070717_109935672 91
241 3300006028 Ga0070717_11342150 Ga0070717_113421502 91
242 3300006028 Ga0070717_11844966 Ga0070717_118449661 91
243 3300006163 Ga0070715_10194927 Ga0070715_101949271 91
244 3300006173 Ga0070716_100046340 Ga0070716_1000463403 91
245 3300006173 Ga0070716_100188529 Ga0070716_1001885291 91
246 3300006173 Ga0070716_100475554 Ga0070716_1004755542 91
247 3300006173 Ga0070716_100599980 Ga0070716_1005999802 91
248 3300006173 Ga0070716_101223739 Ga0070716_1012237391 91
249 3300006175 Ga0070712_100261165 Ga0070712_1002611652 91
250 3300006175 Ga0070712_100375156 Ga0070712_1003751563 91
251 3300006175 Ga0070712_100433466 Ga0070712_1004334661 91
252 3300006175 Ga0070712_100734140 Ga0070712_1007341401 91
253 3300006175 Ga0070712_101476121 Ga0070712_1014761212 91
254 3300006237 Ga0097621_100000484 Ga0097621_1000004843 91
255 3300006237 Ga0097621_100410450 Ga0097621_1004104502 91
256 3300006237 Ga0097621_100799368 Ga0097621_1007993681 91
257 3300006237 Ga0097621_101190384 Ga0097621_1011903842 91
258 3300006358 Ga0068871_100005759 Ga0068871_1000057593 91
259 3300006358 Ga0068871_100155849 Ga0068871_1001558494 91
260 3300006358 Ga0068871_101718241 Ga0068871_1017182411 91
261 3300006852 Ga0075433_10835213 Ga0075433_108352131 91
262 3300006871 Ga0075434_100980254 Ga0075434_1009802542 91
263 3300006881 Ga0068865_100215811 Ga0068865_1002158112 91
264 3300006914 Ga0075436_100015125 Ga0075436_1000151256 91
265 3300006914 Ga0075436_100100656 Ga0075436_1001006561 91
266 3300006914 Ga0075436_100167646 Ga0075436_1001676462 91
267 3300006914 Ga0075436_100652049 Ga0075436_1006520491 91
268 3300006931 Ga0097620_100981155 Ga0097620_1009811551 91
269 3300007076 Ga0075435_100214588 Ga0075435_1002145883 91
270 3300007076 Ga0075435_100792877 Ga0075435_1007928772 91
271 3300009092 Ga0105250_10009360 Ga0105250_100093604 91
272 3300009092 Ga0105250_10514357 Ga0105250_105143572 91
273 3300009093 Ga0105240_10036492 Ga0105240_100364922 91
274 3300009093 Ga0105240_10037121 Ga0105240_100371213 91
275 3300009093 Ga0105240_10349489 Ga0105240_103494891 91
276 3300009093 Ga0105240_10670948 Ga0105240_106709481 91
277 3300009093 Ga0105240_10767800 Ga0105240_107678001 91
278 3300009093 Ga0105240_11012617 Ga0105240_110126172 91
279 3300009093 Ga0105240_11453900 Ga0105240_114539001 91
280 3300009093 Ga0105240_11887384 Ga0105240_118873841 91
281 3300009093 Ga0105240_11952947 Ga0105240_119529471 91
282 3300009093 Ga0105240_12195018 Ga0105240_121950181 91
283 3300009098 Ga0105245_10003145 Ga0105245_1000314511 91
284 3300009098 Ga0105245_10007043 Ga0105245_100070435 91
285 3300009098 Ga0105245_10041692 Ga0105245_100416924 91
286 3300009098 Ga0105245_10192516 Ga0105245_101925163 91
287 3300009098 Ga0105245_10471270 Ga0105245_104712702 91
288 3300009101 Ga0105247_10001507 Ga0105247_1000150712 91
289 3300009148 Ga0105243_10447461 Ga0105243_104474612 91
290 3300009174 Ga0105241_10019278 Ga0105241_100192785 91
291 3300009174 Ga0105241_10071374 Ga0105241_100713743 91
292 3300009174 Ga0105241_10273184 Ga0105241_102731842 91
293 3300009174 Ga0105241_10401991 Ga0105241_104019912 91
294 3300009174 Ga0105241_10896387 Ga0105241_108963872 91
295 3300009174 Ga0105241_11078040 Ga0105241_110780401 91
296 3300009176 Ga0105242_10016443 Ga0105242_100164435 91
297 3300009176 Ga0105242_10053867 Ga0105242_100538675 91
298 3300009177 Ga0105248_10074434 Ga0105248_100744344 91
299 3300009177 Ga0105248_10171911 Ga0105248_101719112 91
300 3300009177 Ga0105248_10220359 Ga0105248_102203592 91
301 3300009177 Ga0105248_10447047 Ga0105248_104470471 91
302 3300009177 Ga0105248_10452143 Ga0105248_104521431 91
303 3300009177 Ga0105248_10679601 Ga0105248_106796012 91
304 3300009545 Ga0105237_10053790 Ga0105237_100537903 91
305 3300009545 Ga0105237_10592128 Ga0105237_105921282 91
306 3300009545 Ga0105237_10744921 Ga0105237_107449213 91
307 3300009545 Ga0105237_11447883 Ga0105237_114478832 91
308 3300009551 Ga0105238_10016655 Ga0105238_100166555 91
309 3300009551 Ga0105238_10022654 Ga0105238_100226547 91
310 3300009551 Ga0105238_10137453 Ga0105238_101374531 91
311 3300009551 Ga0105238_10294358 Ga0105238_102943582 91
312 3300009551 Ga0105238_10480988 Ga0105238_104809883 91
313 3300009551 Ga0105238_10556099 Ga0105238_105560992 91
314 3300009551 Ga0105238_10921055 Ga0105238_109210553 91
315 3300009551 Ga0105238_11013972 Ga0105238_110139721 91
316 3300009551 Ga0105238_11792211 Ga0105238_117922111 91
317 3300009551 Ga0105238_12056725 Ga0105238_120567251 91
318 3300009551 Ga0105238_12060705 Ga0105238_120607052 91
319 3300009551 Ga0105238_12546412 Ga0105238_125464122 91
320 3300009553 Ga0105249_10112207 Ga0105249_101122073 91
321 3300010159 Ga0099796_10042002 Ga0099796_100420022 91
322 3300010375 Ga0105239_10005962 Ga0105239_1000596214 91
323 3300010375 Ga0105239_10086301 Ga0105239_100863014 91
324 3300010375 Ga0105239_10323194 Ga0105239_103231943 91
325 3300010375 Ga0105239_10808630 Ga0105239_108086303 91
326 3300010375 Ga0105239_11395350 Ga0105239_113953501 91
327 3300010375 Ga0105239_11934011 Ga0105239_119340112 91
328 3300010375 Ga0105239_13302566 Ga0105239_133025661 91
329 3300011119 Ga0105246_10001854 Ga0105246_100018545 91
330 3300011119 Ga0105246_11616123 Ga0105246_116161232 91
331 3300013100 Ga0157373_10001119 Ga0157373_100011195 91
332 3300013100 Ga0157373_10031848 Ga0157373_100318484 91
333 3300013100 Ga0157373_10729658 Ga0157373_107296581 91
334 3300013102 Ga0157371_10005666 Ga0157371_100056663 91
335 3300013102 Ga0157371_10701612 Ga0157371_107016122 91
336 3300013104 Ga0157370_10164565 Ga0157370_101645653 91
337 3300013104 Ga0157370_11990995 Ga0157370_119909952 91
338 3300013105 Ga0157369_10001345 Ga0157369_100013455 91
339 3300013105 Ga0157369_10035084 Ga0157369_100350842 91
340 3300013105 Ga0157369_10038299 Ga0157369_100382995 91
341 3300013105 Ga0157369_10052365 Ga0157369_100523654 91
342 3300013105 Ga0157369_10147636 Ga0157369_101476364 91
343 3300013105 Ga0157369_10498082 Ga0157369_104980823 91
344 3300013105 Ga0157369_10585526 Ga0157369_105855262 91
345 3300013105 Ga0157369_10751627 Ga0157369_107516271 91
346 3300013105 Ga0157369_11238855 Ga0157369_112388552 91
347 3300013105 Ga0157369_11311606 Ga0157369_113116062 91
348 3300013105 Ga0157369_12259641 Ga0157369_122596411 91
349 3300013105 Ga0157369_12263761 Ga0157369_122637611 91
350 3300013296 Ga0157374_10011069 Ga0157374_100110695 91
351 3300013296 Ga0157374_10026177 Ga0157374_100261774 91
352 3300013296 Ga0157374_10033131 Ga0157374_100331314 91
353 3300013296 Ga0157374_10058122 Ga0157374_100581222 91
354 3300013296 Ga0157374_10093053 Ga0157374_100930532 91
355 3300013296 Ga0157374_10163595 Ga0157374_101635954 91
356 3300013296 Ga0157374_10283774 Ga0157374_102837741 91
357 3300013296 Ga0157374_10719607 Ga0157374_107196071 91
358 3300013297 Ga0157378_10000145 Ga0157378_1000014529 91
359 3300013297 Ga0157378_10397411 Ga0157378_103974113 91
360 3300013297 Ga0157378_10739562 Ga0157378_107395622 91
361 3300013297 Ga0157378_11452698 Ga0157378_114526981 91
362 3300013306 Ga0163162_10087570 Ga0163162_100875703 91
363 3300013306 Ga0163162_10206352 Ga0163162_102063523 91
364 3300013306 Ga0163162_12193052 Ga0163162_121930521 91
365 3300013307 Ga0157372_10008298 Ga0157372_100082988 91
366 3300013307 Ga0157372_10033302 Ga0157372_100333028 91
367 3300013307 Ga0157372_10116160 Ga0157372_101161604 91
368 3300013307 Ga0157372_10215434 Ga0157372_102154342 91
369 3300013307 Ga0157372_10353409 Ga0157372_103534092 91
370 3300013308 Ga0157375_13167096 Ga0157375_131670961 91
371 3300014325 Ga0163163_10025274 Ga0163163_100252743 91
372 3300014325 Ga0163163_10059974 Ga0163163_100599743 91
373 3300014325 Ga0163163_10149055 Ga0163163_101490554 91
374 3300014325 Ga0163163_10762080 Ga0163163_107620801 91
375 3300014497 Ga0182008_10626640 Ga0182008_106266401 91
376 3300014745 Ga0157377_10007969 Ga0157377_100079695 91
377 3300014968 Ga0157379_10060793 Ga0157379_100607933 91
378 3300014968 Ga0157379_10428888 Ga0157379_104288882 91
379 3300014969 Ga0157376_10031084 Ga0157376_100310843 91
380 3300014969 Ga0157376_10452452 Ga0157376_104524521 91
381 3300014969 Ga0157376_11597902 Ga0157376_115979022 91
382 3300015261 Ga0182006_1019925 Ga0182006_10199252 91
383 3300015262 Ga0182007_10002409 Ga0182007_100024096 91
384 3300017792 Ga0163161_10103478 Ga0163161_101034781 91
385 3300020070 Ga0206356_10207189 Ga0206356_102071893 91
386 3300020076 Ga0206355_1512251 Ga0206355_15122512 91
387 3300020077 Ga0206351_10464849 Ga0206351_104648491 91
388 3300020078 Ga0206352_10895603 Ga0206352_108956031 91
389 3300020080 Ga0206350_11534362 Ga0206350_115343621 91
390 3300020610 Ga0154015_1279385 Ga0154015_12793853 91
391 3300021358 Ga0213873_10042379 Ga0213873_100423792 91
392 3300021377 Ga0213874_10086069 Ga0213874_100860691 91
393 3300022467 Ga0224712_10070837 Ga0224712_100708372 91
394 3300025290 Ga0207673_1021856 Ga0207673_10218562 91
395 3300025302 Ga0207426_1137607 Ga0207426_11376072 91
396 3300025315 Ga0207697_10012379 Ga0207697_100123794 91
397 3300025711 Ga0207696_1041015 Ga0207696_10410152 91
398 3300025893 Ga0207682_10091581 Ga0207682_100915812 91
399 3300025898 Ga0207692_10023063 Ga0207692_100230632 91
400 3300025898 Ga0207692_10072310 Ga0207692_100723102 91
401 3300025898 Ga0207692_10175590 Ga0207692_101755902 91
402 3300025898 Ga0207692_10218755 Ga0207692_102187553 91
403 3300025898 Ga0207692_10732721 Ga0207692_107327211 91
404 3300025899 Ga0207642_10101305 Ga0207642_101013051 91
405 3300025899 Ga0207642_10427703 Ga0207642_104277032 91
406 3300025900 Ga0207710_10211733 Ga0207710_102117332 91
407 3300025900 Ga0207710_10487651 Ga0207710_104876512 91
408 3300025901 Ga0207688_10003069 Ga0207688_100030695 91
409 3300025903 Ga0207680_10195855 Ga0207680_101958552 91
410 3300025903 Ga0207680_10755074 Ga0207680_107550742 91
411 3300025904 Ga0207647_10002063 Ga0207647_1000206312 91
412 3300025904 Ga0207647_10006155 Ga0207647_100061552 91
413 3300025904 Ga0207647_10378050 Ga0207647_103780501 91
414 3300025905 Ga0207685_10142327 Ga0207685_101423272 91
415 3300025906 Ga0207699_10089981 Ga0207699_100899813 91
416 3300025906 Ga0207699_10138949 Ga0207699_101389493 91
417 3300025906 Ga0207699_10140721 Ga0207699_101407212 91
418 3300025906 Ga0207699_10156817 Ga0207699_101568171 91
419 3300025906 Ga0207699_10191208 Ga0207699_101912082 91
420 3300025906 Ga0207699_10343204 Ga0207699_103432042 91
421 3300025906 Ga0207699_10363051 Ga0207699_103630512 91
422 3300025906 Ga0207699_11007123 Ga0207699_110071232 91
423 3300025906 Ga0207699_11399524 Ga0207699_113995242 91
424 3300025907 Ga0207645_10000901 Ga0207645_1000090119 91
425 3300025907 Ga0207645_11087942 Ga0207645_110879421 91
426 3300025908 Ga0207643_10000172 Ga0207643_1000017214 91
427 3300025909 Ga0207705_10045267 Ga0207705_100452675 91
428 3300025909 Ga0207705_10513714 Ga0207705_105137142 91
429 3300025909 Ga0207705_11001144 Ga0207705_110011442 91
430 3300025911 Ga0207654_10395459 Ga0207654_103954592 91
431 3300025911 Ga0207654_10659285 Ga0207654_106592852 91
432 3300025911 Ga0207654_10704808 Ga0207654_107048081 91
433 3300025911 Ga0207654_11096868 Ga0207654_110968681 91
434 3300025911 Ga0207654_11450224 Ga0207654_114502241 91
435 3300025912 Ga0207707_10060930 Ga0207707_100609302 91
436 3300025912 Ga0207707_10112690 Ga0207707_101126901 91
437 3300025912 Ga0207707_10177908 Ga0207707_101779081 91
438 3300025912 Ga0207707_10501566 Ga0207707_105015662 91
439 3300025912 Ga0207707_10502933 Ga0207707_105029332 91
440 3300025912 Ga0207707_10533333 Ga0207707_105333331 91
441 3300025912 Ga0207707_10631450 Ga0207707_106314502 91
442 3300025912 Ga0207707_10787269 Ga0207707_107872692 91
443 3300025912 Ga0207707_11540672 Ga0207707_115406721 91
444 3300025913 Ga0207695_11315022 Ga0207695_113150222 91
445 3300025914 Ga0207671_10151305 Ga0207671_101513053 91
446 3300025914 Ga0207671_10977274 Ga0207671_109772741 91
447 3300025914 Ga0207671_11469141 Ga0207671_114691412 91
448 3300025915 Ga0207693_10077982 Ga0207693_100779823 91
449 3300025915 Ga0207693_10653952 Ga0207693_106539521 91
450 3300025916 Ga0207663_10313172 Ga0207663_103131722 91
451 3300025916 Ga0207663_10402743 Ga0207663_104027431 91
452 3300025916 Ga0207663_10498430 Ga0207663_104984302 91
453 3300025917 Ga0207660_10092661 Ga0207660_100926615 91
454 3300025917 Ga0207660_10103262 Ga0207660_101032622 91
455 3300025917 Ga0207660_10108214 Ga0207660_101082144 91
456 3300025917 Ga0207660_10354029 Ga0207660_103540292 91
457 3300025917 Ga0207660_10458451 Ga0207660_104584512 91
458 3300025917 Ga0207660_10605707 Ga0207660_106057071 91
459 3300025917 Ga0207660_10894506 Ga0207660_108945061 91
460 3300025918 Ga0207662_10002090 Ga0207662_100020905 91
461 3300025919 Ga0207657_10000660 Ga0207657_1000066017 91
462 3300025919 Ga0207657_11202892 Ga0207657_112028922 91
463 3300025920 Ga0207649_10001125 Ga0207649_1000112511 91
464 3300025920 Ga0207649_10329425 Ga0207649_103294253 91
465 3300025921 Ga0207652_10078006 Ga0207652_100780064 91
466 3300025921 Ga0207652_10084852 Ga0207652_100848522 91
467 3300025921 Ga0207652_10115237 Ga0207652_101152375 91
468 3300025921 Ga0207652_10162586 Ga0207652_101625864 91
469 3300025921 Ga0207652_10483898 Ga0207652_104838982 91
470 3300025921 Ga0207652_10553165 Ga0207652_105531652 91
471 3300025921 Ga0207652_10572017 Ga0207652_105720172 91
472 3300025921 Ga0207652_11100325 Ga0207652_111003252 91
473 3300025922 Ga0207646_10423062 Ga0207646_104230622 91
474 3300025922 Ga0207646_11731012 Ga0207646_117310121 91
475 3300025924 Ga0207694_10289281 Ga0207694_102892812 91
476 3300025924 Ga0207694_10391218 Ga0207694_103912181 91
477 3300025924 Ga0207694_10454115 Ga0207694_104541153 91
478 3300025924 Ga0207694_10652886 Ga0207694_106528863 91
479 3300025925 Ga0207650_10000059 Ga0207650_1000005933 91
480 3300025925 Ga0207650_10144414 Ga0207650_101444141 91
481 3300025925 Ga0207650_10402085 Ga0207650_104020852 91
482 3300025925 Ga0207650_11341767 Ga0207650_113417672 91
483 3300025926 Ga0207659_10071146 Ga0207659_100711463 91
484 3300025927 Ga0207687_10003663 Ga0207687_100036634 91
485 3300025927 Ga0207687_10009003 Ga0207687_100090035 91
486 3300025927 Ga0207687_10097260 Ga0207687_100972602 91
487 3300025927 Ga0207687_10378008 Ga0207687_103780082 91
488 3300025927 Ga0207687_10809445 Ga0207687_108094452 91
489 3300025928 Ga0207700_10052978 Ga0207700_100529783 91
490 3300025928 Ga0207700_10096429 Ga0207700_100964292 91
491 3300025928 Ga0207700_10403578 Ga0207700_104035782 91
492 3300025928 Ga0207700_10440415 Ga0207700_104404151 91
493 3300025928 Ga0207700_10679714 Ga0207700_106797142 91
494 3300025928 Ga0207700_11087226 Ga0207700_110872262 91
495 3300025928 Ga0207700_11377148 Ga0207700_113771481 91
496 3300025929 Ga0207664_10153852 Ga0207664_101538523 91
497 3300025929 Ga0207664_10162743 Ga0207664_101627432 91
498 3300025929 Ga0207664_10886907 Ga0207664_108869071 91
499 3300025929 Ga0207664_11713824 Ga0207664_117138241 91
500 3300025931 Ga0207644_10149789 Ga0207644_101497893 91
501 3300025931 Ga0207644_10613543 Ga0207644_106135433 91
502 3300025931 Ga0207644_10676296 Ga0207644_106762961 91
503 3300025931 Ga0207644_11350881 Ga0207644_113508812 91
504 3300025932 Ga0207690_10149339 Ga0207690_101493392 91
505 3300025932 Ga0207690_10282315 Ga0207690_102823152 91
506 3300025932 Ga0207690_11362858 Ga0207690_113628581 91
507 3300025933 Ga0207706_10000723 Ga0207706_1000072318 91
508 3300025933 Ga0207706_10082973 Ga0207706_100829731 91
509 3300025934 Ga0207686_10107083 Ga0207686_101070832 91
510 3300025934 Ga0207686_10622330 Ga0207686_106223302 91
511 3300025935 Ga0207709_11096733 Ga0207709_110967332 91
512 3300025938 Ga0207704_10534212 Ga0207704_105342122 91
513 3300025939 Ga0207665_10186645 Ga0207665_101866451 91
514 3300025939 Ga0207665_10370094 Ga0207665_103700943 91
515 3300025939 Ga0207665_10748534 Ga0207665_107485341 91
516 3300025940 Ga0207691_10001129 Ga0207691_1000112917 91
517 3300025940 Ga0207691_11400936 Ga0207691_114009361 91
518 3300025941 Ga0207711_10010662 Ga0207711_100106625 91
519 3300025941 Ga0207711_10354258 Ga0207711_103542582 91
520 3300025941 Ga0207711_10965471 Ga0207711_109654711 91
521 3300025941 Ga0207711_10976392 Ga0207711_109763921 91
522 3300025941 Ga0207711_11006148 Ga0207711_110061481 91
523 3300025942 Ga0207689_10203792 Ga0207689_102037923 91
524 3300025942 Ga0207689_10903620 Ga0207689_109036201 91
525 3300025942 Ga0207689_11474515 Ga0207689_114745151 91
526 3300025944 Ga0207661_10015604 Ga0207661_100156043 91
527 3300025944 Ga0207661_10096426 Ga0207661_100964264 91
528 3300025944 Ga0207661_10928453 Ga0207661_109284531 91
529 3300025945 Ga0207679_10000415 Ga0207679_1000041518 91
530 3300025949 Ga0207667_10006054 Ga0207667_100060549 91
531 3300025949 Ga0207667_10318463 Ga0207667_103184632 91
532 3300025949 Ga0207667_11019639 Ga0207667_110196392 91
533 3300025949 Ga0207667_11445100 Ga0207667_114451002 91
534 3300025949 Ga0207667_11587734 Ga0207667_115877341 91
535 3300025960 Ga0207651_10010359 Ga0207651_100103593 91
536 3300025960 Ga0207651_10633779 Ga0207651_106337792 91
537 3300025972 Ga0207668_10008891 Ga0207668_100088915 91
538 3300025981 Ga0207640_10045169 Ga0207640_100451693 91
539 3300025981 Ga0207640_10504562 Ga0207640_105045622 91
540 3300025981 Ga0207640_10624380 Ga0207640_106243801 91
541 3300025986 Ga0207658_10014195 Ga0207658_100141955 91
542 3300025986 Ga0207658_10191920 Ga0207658_101919203 91
543 3300025986 Ga0207658_11784359 Ga0207658_117843592 91
544 3300026023 Ga0207677_10017217 Ga0207677_100172173 91
545 3300026023 Ga0207677_10033691 Ga0207677_100336912 91
546 3300026023 Ga0207677_10158054 Ga0207677_101580542 91
547 3300026023 Ga0207677_10786837 Ga0207677_107868371 91
548 3300026035 Ga0207703_10013619 Ga0207703_100136195 91
549 3300026035 Ga0207703_11769781 Ga0207703_117697812 91
550 3300026041 Ga0207639_10076788 Ga0207639_100767883 91
551 3300026041 Ga0207639_10076954 Ga0207639_100769543 91
552 3300026041 Ga0207639_10355113 Ga0207639_103551131 91
553 3300026041 Ga0207639_10762615 Ga0207639_107626152 91
554 3300026041 Ga0207639_10841749 Ga0207639_108417492 91
555 3300026041 Ga0207639_11457974 Ga0207639_114579741 91
556 3300026067 Ga0207678_10000581 Ga0207678_1000058118 91
557 3300026067 Ga0207678_10653937 Ga0207678_106539372 91
558 3300026075 Ga0207708_10146596 Ga0207708_101465963 91
559 3300026078 Ga0207702_10222682 Ga0207702_102226822 91
560 3300026078 Ga0207702_10565218 Ga0207702_105652182 91
561 3300026078 Ga0207702_10910654 Ga0207702_109106542 91
562 3300026078 Ga0207702_11127990 Ga0207702_111279901 91
563 3300026088 Ga0207641_10000025 Ga0207641_1000002535 91
564 3300026088 Ga0207641_11301139 Ga0207641_113011392 91
565 3300026088 Ga0207641_12005734 Ga0207641_120057342 91
566 3300026089 Ga0207648_10003458 Ga0207648_100034588 91
567 3300026089 Ga0207648_10220378 Ga0207648_102203782 91
568 3300026089 Ga0207648_11946367 Ga0207648_119463672 91
569 3300026095 Ga0207676_10000252 Ga0207676_1000025230 91
570 3300026095 Ga0207676_10032451 Ga0207676_100324512 91
571 3300026095 Ga0207676_12082278 Ga0207676_120822781 91
572 3300026116 Ga0207674_10000162 Ga0207674_1000016229 91
573 3300026116 Ga0207674_10085960 Ga0207674_100859606 91
574 3300026116 Ga0207674_10244013 Ga0207674_102440134 91
575 3300026116 Ga0207674_10766300 Ga0207674_107663001 91
576 3300026118 Ga0207675_100017450 Ga0207675_1000174504 91
577 3300026121 Ga0207683_10001306 Ga0207683_1000130617 91
578 3300026121 Ga0207683_10226238 Ga0207683_102262382 91
579 3300026121 Ga0207683_10725175 Ga0207683_107251752 91
580 3300026142 Ga0207698_10290702 Ga0207698_102907022 91
581 3300026142 Ga0207698_11759518 Ga0207698_117595181 91
582 3300026142 Ga0207698_12025110 Ga0207698_120251101 91
583 3300027717 Ga0209998_10046632 Ga0209998_100466321 91
584 3300028379 Ga0268266_10039280 Ga0268266_100392803 91
585 3300028379 Ga0268266_10118698 Ga0268266_101186982 91
586 3300028379 Ga0268266_11860746 Ga0268266_118607461 91
587 3300028380 Ga0268265_10004703 Ga0268265_100047033 91
588 3300028381 Ga0268264_10050987 Ga0268264_100509875 91
589 3300028381 Ga0268264_10107924 Ga0268264_101079244 91
590 3300028381 Ga0268264_12591801 Ga0268264_125918012 91
591 3300028800 Ga0265338_10134304 Ga0265338_101343041 91
592 3300028800 Ga0265338_11110356 Ga0265338_111103562 91
593 3300031239 Ga0265328_10039726 Ga0265328_100397262 91
594 3300031239 Ga0265328_10323709 Ga0265328_103237091 91
595 3300031241 Ga0265325_10005290 Ga0265325_100052906 91
596 3300031241 Ga0265325_10069646 Ga0265325_100696461 91
597 3300031241 Ga0265325_10402463 Ga0265325_104024631 91
598 3300031247 Ga0265340_10030554 Ga0265340_100305544 91
599 3300031250 Ga0265331_10009077 Ga0265331_100090773 91
600 3300031250 Ga0265331_10040471 Ga0265331_100404713 91
601 3300031251 Ga0265327_10054337 Ga0265327_100543371 91
602 3300031344 Ga0265316_10023396 Ga0265316_100233966 91
603 3300031344 Ga0265316_10068518 Ga0265316_100685183 91
604 3300031344 Ga0265316_10147654 Ga0265316_101476542 91
605 3300031344 Ga0265316_10740895 Ga0265316_107408951 91
606 3300031548 Ga0307408_100012830 Ga0307408_1000128301 91
607 3300031595 Ga0265313_10008949 Ga0265313_100089491 91
608 3300031711 Ga0265314_10024067 Ga0265314_100240673 91
609 3300031731 Ga0307405_10032987 Ga0307405_100329872 91
610 3300031731 Ga0307405_10602317 Ga0307405_106023172 91
611 3300031824 Ga0307413_10175803 Ga0307413_101758032 91
612 3300031852 Ga0307410_10004067 Ga0307410_100040678 91
613 3300031903 Ga0307407_10030849 Ga0307407_100308495 91
614 3300031903 Ga0307407_10857085 Ga0307407_108570851 91
615 3300031911 Ga0307412_10404596 Ga0307412_104045961 91
616 3300031995 Ga0307409_100223561 Ga0307409_1002235613 91
617 3300032002 Ga0307416_100072666 Ga0307416_1000726663 91
618 3300032002 Ga0307416_100156122 Ga0307416_1001561224 91
619 3300032002 Ga0307416_100367833 Ga0307416_1003678331 91
620 3300032004 Ga0307414_10597790 Ga0307414_105977902 91
621 3300032005 Ga0307411_10006952 Ga0307411_100069521 91
622 3300032126 Ga0307415_100273151 Ga0307415_1002731513 91
623 3300032126 Ga0307415_101457998 Ga0307415_1014579981 91
624 3300034818 Ga0373950_0041607 Ga0373950_0041607_575_850 91
625 3300035083 Ga0373926_0002055 Ga0373926_0002055_130_405 91
626 3300035083 Ga0373926_0121933 Ga0373926_0121933_75_377 91
627 3300035086 Ga0373934_0235300 Ga0373934_0235300_74_349 91
628 3300035089 Ga0373944_0023562 Ga0373944_0023562_437_712 91
629 3300035089 Ga0373944_0114371 Ga0373944_0114371_399_674 91
630 3300035111 Ga0373923_0039536 Ga0373923_0039536_420_695 91
631 3300035111 Ga0373923_0051294 Ga0373923_0051294_1276_1551 91
632 3300035111 Ga0373923_0095947 Ga0373923_0095947_81_356 91
633 3300035111 Ga0373923_0111481 Ga0373923_0111481_481_756 91
634 3300035111 Ga0373923_0212153 Ga0373923_0212153_70_372 91
635 3300035113 Ga0373936_0240612 Ga0373936_0240612_413_688 91
636 3300035113 Ga0373936_0506507 Ga0373936_0506507_163_438 91
637 3300035113 Ga0373936_0581361 Ga0373936_0581361_116_391 91
638 3300035116 Ga0373945_0001313 Ga0373945_0001313_1828_2103 91
639 3300035116 Ga0373945_0322350 Ga0373945_0322350_69_344 91
640 3300035119 Ga0373956_0234414 Ga0373956_0234414_496_771 91
641 3300035170 Ga0373943_0006731 Ga0373943_0006731_502_777 91
642 3300035171 Ga0373946_0012860 Ga0373946_0012860_2237_2512 91
643 3300035172 Ga0373955_0013343 Ga0373955_0013343_272_547 91
644 3300035172 Ga0373955_0324828 Ga0373955_0324828_322_597 91
645 3300035172 Ga0373955_1025560 Ga0373955_1025560_102_377 91
646 3300035410 Ga0373924_0000248 Ga0373924_0000248_2558_2833 91
647 3300035410 Ga0373924_0142201 Ga0373924_0142201_149_424 91
648 3300035692 Ga0373935_0003124 Ga0373935_0003124_6292_6567 91
649 3300035692 Ga0373935_0034467 Ga0373935_0034467_1048_1323 91
650 3300035692 Ga0373935_0048008 Ga0373935_0048008_1083_1358 91
651 3300035692 Ga0373935_0096713 Ga0373935_0096713_805_1080 91
652 3300035692 Ga0373935_0398230 Ga0373935_0398230_241_516 91
653 3300035692 Ga0373935_0609527 Ga0373935_0609527_161_436 91
654 3300035692 Ga0373935_1408267 Ga0373935_1408267_235_510 91
655 3300035692 Ga0373935_1452802 Ga0373935_1452802_119_394 91
656 3300035695 Ga0373927_0079790 Ga0373927_0079790_1227_1502 91
657 3300035695 Ga0373927_0080544 Ga0373927_0080544_1259_1534 91
658 3300035695 Ga0373927_0316908 Ga0373927_0316908_715_990 91
659 3300035695 Ga0373927_1115395 Ga0373927_1115395_183_458 91
660 3300035724 Ga0373933_0399813 Ga0373933_0399813_90_365 91
661 3300035724 Ga0373933_0664490 Ga0373933_0664490_31_306 91
662 3300035724 Ga0373933_0860179 Ga0373933_0860179_191_466 91
663 3300035725 Ga0373947_0017811 Ga0373947_0017811_1435_1710 91
664 3300035725 Ga0373947_0028162 Ga0373947_0028162_2552_2827 91
665 3300035725 Ga0373947_0122539 Ga0373947_0122539_844_1122 91
666 3300036401 Ga0373937_0000437 Ga0373937_0000437_6608_6883 91
667 3300036401 Ga0373937_0072227 Ga0373937_0072227_2143_2418 91
668 3300036401 Ga0373937_0173066 Ga0373937_0173066_1188_1463 91
669 3300036401 Ga0373937_0197899 Ga0373937_0197899_1586_1861 91
670 3300036401 Ga0373937_0455986 Ga0373937_0455986_477_752 91
671 3300036401 Ga0373937_0638659 Ga0373937_0638659_110_388 91
672 3300036401 Ga0373937_0641992 Ga0373937_0641992_583_882 91
673 3300036401 Ga0373937_0680383 Ga0373937_0680383_599_874 91
674 3300036401 Ga0373937_1454142 Ga0373937_1454142_339_614 91
675 3300037068 Ga0373925_0005732 Ga0373925_0005732_6991_7266 91
676 3300037068 Ga0373925_0043304 Ga0373925_0043304_2021_2296 91
677 3300037068 Ga0373925_1008285 Ga0373925_1008285_216_491 91
678 3300037068 Ga0373925_1368167 Ga0373925_1368167_222_497 91
679 3300037068 Ga0373925_1720913 Ga0373925_1720913_31_306 91
680 3300037418 Ga0395900_0119579 Ga0395900_0119579_1252_1533 91
681 3300037466 Ga0395898_0049727 Ga0395898_0049727_1055_1330 91
682 3300037466 Ga0395898_0744507 Ga0395898_0744507_41_322 91
683 3300037466 Ga0395898_1511931 Ga0395898_1511931_312_587 91
684 3300037466 Ga0395898_1572946 Ga0395898_1572946_73_348 91
685 3300037466 Ga0395898_1676973 Ga0395898_1676973_190_465 91
686 3300038443 Ga0395901_1992297 Ga0395901_1992297_168_443 91
687 3300039437 Ga0436365_0163368 Ga0436365_0163368_666_941 91
688 3300039447 Ga0436361_0488693 Ga0436361_0488693_942_1274 91
689 3300039450 Ga0436363_0501633 Ga0436363_0501633_2687_2962 91
690 3300039450 Ga0436363_0882976 Ga0436363_0882976_237_512 91
691 3300039450 Ga0436363_0921361 Ga0436363_0921361_236_511 91
692 3300039450 Ga0436363_1608620 Ga0436363_1608620_1771_2046 91
693 3300039453 Ga0436362_0763575 Ga0436362_0763575_1217_1492 91
694 3300039453 Ga0436362_0774876 Ga0436362_0774876_69_344 91
695 3300041496 Ga0451839_0856090 Ga0451839_0856090_545_820 91
696 3300042876 Ga0451577_0000054 Ga0451577_0000054_1396_1671 91
697 3300042876 Ga0451577_0804712 Ga0451577_0804712_220_495 91
698 3300042876 Ga0451577_1068579 Ga0451577_1068579_253_528 91
699 3300042876 Ga0451577_1855001 Ga0451577_1855001_204_479 91
700 3300044673 Ga0453683_0003233 Ga0453683_0003233_561_836 91
701 3300044673 Ga0453683_0203042 Ga0453683_0203042_597_872 91
702 3300044684 Ga0466966_0306187 Ga0466966_0306187_71_346 91
703 3300044684 Ga0466966_0705261 Ga0466966_0705261_197_472 91
704 3300044694 Ga0466963_0017484 Ga0466963_0017484_2880_3155 91
705 3300044712 Ga0453684_0000289 Ga0453684_0000289_73733_74008 91
706 3300044712 Ga0453684_0219315 Ga0453684_0219315_1825_2100 91
707 3300044712 Ga0453684_0527378 Ga0453684_0527378_12_293 91
708 3300044712 Ga0453684_0640634 Ga0453684_0640634_776_1051 91
709 3300044712 Ga0453684_1515091 Ga0453684_1515091_232_507 91
710 3300044712 Ga0453684_2109050 Ga0453684_2109050_217_492 91
711 3300044735 Ga0466968_0434700 Ga0466968_0434700_297_572 91
712 3300044735 Ga0466968_0591980 Ga0466968_0591980_214_489 91
713 3300044765 Ga0466970_0735198 Ga0466970_0735198_238_519 91
714 3300044842 Ga0466957_0000065 Ga0466957_0000065_14550_14825 91
715 3300044842 Ga0466957_0115257 Ga0466957_0115257_1084_1359 91
716 3300044842 Ga0466957_0672916 Ga0466957_0672916_424_699 91
717 3300044842 Ga0466957_1257174 Ga0466957_1257174_205_480 91
718 3300045049 Ga0466959_0016961 Ga0466959_0016961_2712_2987 91
719 3300045051 Ga0451576_0003350 Ga0451576_0003350_20292_20567 91
720 3300045051 Ga0451576_0133045 Ga0451576_0133045_2047_2328 91
721 3300045051 Ga0451576_0165179 Ga0451576_0165179_1263_1538 91
722 3300045051 Ga0451576_0456697 Ga0451576_0456697_268_543 91
723 3300045051 Ga0451576_0471208 Ga0451576_0471208_618_893 91
724 3300045051 Ga0451576_2317614 Ga0451576_2317614_265_540 91
725 3300045051 Ga0451576_2617154 Ga0451576_2617154_166_441 91
726 3300045976 Ga0466967_0055328 Ga0466967_0055328_2872_3147 91
727 3300045976 Ga0466967_0068117 Ga0466967_0068117_1804_2079 91
728 3300045976 Ga0466967_0623768 Ga0466967_0623768_177_452 91
729 3300045976 Ga0466967_1097650 Ga0466967_1097650_482_757 91
730 3300045976 Ga0466967_1784469 Ga0466967_1784469_56_331 91
731 3300045976 Ga0466967_2560717 Ga0466967_2560717_41_316 91
732 3300046455 Ga0495603_0547288 Ga0495603_0547288_278_553 91
733 3300046462 Ga0495651_0044034 Ga0495651_0044034_2109_2387 91
734 3300046462 Ga0495651_0273510 Ga0495651_0273510_445_720 91
735 3300046462 Ga0495651_0763501 Ga0495651_0763501_285_560 91
736 3300046463 Ga0495653_0680180 Ga0495653_0680180_56_331 91
737 3300046472 Ga0495580_0194241 Ga0495580_0194241_216_491 91
738 3300046472 Ga0495580_0341787 Ga0495580_0341787_714_992 91
739 3300046472 Ga0495580_0370711 Ga0495580_0370711_76_351 91
740 3300046472 Ga0495580_1023839 Ga0495580_1023839_194_496 91
741 3300046473 Ga0495582_0031880 Ga0495582_0031880_1536_1811 91
742 3300046473 Ga0495582_0698873 Ga0495582_0698873_83_358 91
743 3300046475 Ga0495639_0446603 Ga0495639_0446603_224_499 91
744 3300046477 Ga0495664_0919595 Ga0495664_0919595_37_312 91
745 3300046499 Ga0495594_0836129 Ga0495594_0836129_71_346 91
746 3300046511 Ga0495608_0035097 Ga0495608_0035097_848_1123 91
747 3300046514 Ga0495618_0871673 Ga0495618_0871673_209_484 91
748 3300046517 Ga0495630_0063439 Ga0495630_0063439_2104_2379 91
749 3300046517 Ga0495630_0609423 Ga0495630_0609423_531_809 91
750 3300046522 Ga0495643_0098609 Ga0495643_0098609_957_1232 91
751 3300046528 Ga0495642_0507901 Ga0495642_0507901_182_457 91
752 3300046529 Ga0495652_0136619 Ga0495652_0136619_370_645 91
753 3300046531 Ga0495665_0014305 Ga0495665_0014305_2566_2841 91
754 3300046535 Ga0495586_0160442 Ga0495586_0160442_773_1048 91
755 3300046536 Ga0495587_0787533 Ga0495587_0787533_91_366 91
756 3300046559 Ga0495667_0317686 Ga0495667_0317686_517_792 91
757 3300046663 Ga0495635_0031352 Ga0495635_0031352_828_1103 91
758 3300046675 Ga0495657_0077229 Ga0495657_0077229_688_963 91
759 3300046678 Ga0495599_0692187 Ga0495599_0692187_145_420 91
760 3300046679 Ga0495623_0046319 Ga0495623_0046319_887_1162 91
761 3300046684 Ga0495669_0005788 Ga0495669_0005788_4697_4972 91
762 3300046684 Ga0495669_0012701 Ga0495669_0012701_1866_2141 91
763 3300046684 Ga0495669_0016894 Ga0495669_0016894_1062_1337 91
764 3300046684 Ga0495669_0176818 Ga0495669_0176818_166_441 91
765 3300046691 Ga0495670_0574543 Ga0495670_0574543_225_500 91
766 3300046694 Ga0495649_0005004 Ga0495649_0005004_6906_7181 91
767 3300047317 Ga0495604_0148206 Ga0495604_0148206_934_1212 91
768 3300047321 Ga0495676_0968702 Ga0495676_0968702_152_427 91
769 3300047443 Ga0495687_066994 Ga0495687_066994_690_965 91
770 3300047444 Ga0495675_0200620 Ga0495675_0200620_870_1145 91
771 3300047673 Ga0495593_0409404 Ga0495593_0409404_48_323 91
772 3300048088 Ga0495602_0357183 Ga0495602_0357183_240_518 91
773 3300048089 Ga0495614_0267159 Ga0495614_0267159_238_513 91
774 3300048089 Ga0495614_0499263 Ga0495614_0499263_188_463 91
775 3300048904 Ga0496101_0540257 Ga0496101_0540257_481_756 91
776 3300048904 Ga0496101_0830291 Ga0496101_0830291_381_656 91
777 3300048905 Ga0496102_0028897 Ga0496102_0028897_1285_1560 91
778 3300048905 Ga0496102_0067618 Ga0496102_0067618_2683_2958 91
779 3300048905 Ga0496102_0131043 Ga0496102_0131043_1858_2133 91
780 3300048905 Ga0496102_0389044 Ga0496102_0389044_809_1084 91
781 3300048905 Ga0496102_0707015 Ga0496102_0707015_376_651 91
782 3300048905 Ga0496102_1564600 Ga0496102_1564600_27_302 91
783 3300048906 Ga0496103_0698399 Ga0496103_0698399_124_399 91
784 3300048907 Ga0496104_0258689 Ga0496104_0258689_787_1062 91
785 3300048907 Ga0496104_0273011 Ga0496104_0273011_31_306 91
786 3300048907 Ga0496104_0363592 Ga0496104_0363592_43_318 91
787 3300048907 Ga0496104_0503661 Ga0496104_0503661_97_372 91
788 3300048907 Ga0496104_0993073 Ga0496104_0993073_352_627 91
789 3300048908 Ga0496105_0004526 Ga0496105_0004526_7177_7452 91
790 3300048908 Ga0496105_0338256 Ga0496105_0338256_359_634 91
791 3300048908 Ga0496105_0468113 Ga0496105_0468113_349_624 91
792 3300048908 Ga0496105_1178935 Ga0496105_1178935_28_303 91
793 3300048909 Ga0496106_0129013 Ga0496106_0129013_908_1183 91
794 3300048909 Ga0496106_0145797 Ga0496106_0145797_1529_1804 91
795 3300048910 Ga0496107_0613047 Ga0496107_0613047_435_710 91
796 3300048910 Ga0496107_0980642 Ga0496107_0980642_213_488 91
797 3300048910 Ga0496107_1266857 Ga0496107_1266857_102_377 91
798 3300048911 Ga0496108_0000203 Ga0496108_0000203_39616_39891 91
799 3300048911 Ga0496108_0086225 Ga0496108_0086225_199_474 91
800 3300048911 Ga0496108_0238685 Ga0496108_0238685_222_497 91
801 3300048912 Ga0496109_0000228 Ga0496109_0000228_48481_48756 91
802 3300048912 Ga0496109_0031502 Ga0496109_0031502_1159_1434 91
803 3300048912 Ga0496109_0738114 Ga0496109_0738114_59_334 91
804 3300048912 Ga0496109_0856969 Ga0496109_0856969_533_808 91
805 3300048912 Ga0496109_1594183 Ga0496109_1594183_134_409 91
806 3300048913 Ga0496110_0000145 Ga0496110_0000145_28626_28901 91
807 3300048913 Ga0496110_0023501 Ga0496110_0023501_3554_3829 91
808 3300048913 Ga0496110_0076017 Ga0496110_0076017_25_300 91
809 3300048913 Ga0496110_0513892 Ga0496110_0513892_17_292 91
810 3300048914 Ga0496111_0023585 Ga0496111_0023585_81_356 91
811 3300048914 Ga0496111_0082490 Ga0496111_0082490_583_858 91
812 3300048914 Ga0496111_0114010 Ga0496111_0114010_554_829 91
813 3300048915 Ga0496112_0000048 Ga0496112_0000048_48190_48465 91
814 3300048915 Ga0496112_0008072 Ga0496112_0008072_4256_4531 91
815 3300048915 Ga0496112_0022754 Ga0496112_0022754_5588_5863 91
816 3300048915 Ga0496112_0063880 Ga0496112_0063880_118_393 91
817 3300048915 Ga0496112_0069992 Ga0496112_0069992_2883_3158 91
818 3300048915 Ga0496112_0166680 Ga0496112_0166680_1143_1418 91
819 3300048915 Ga0496112_0296451 Ga0496112_0296451_193_468 91
820 3300048915 Ga0496112_0308663 Ga0496112_0308663_930_1205 91
821 3300048915 Ga0496112_0605349 Ga0496112_0605349_499_774 91
822 3300048915 Ga0496112_1008330 Ga0496112_1008330_310_585 91
823 3300048916 Ga0496113_0000613 Ga0496113_0000613_16580_16855 91
824 3300048916 Ga0496113_0002484 Ga0496113_0002484_9703_9978 91
825 3300048916 Ga0496113_0160797 Ga0496113_0160797_535_810 91
826 3300048916 Ga0496113_0384461 Ga0496113_0384461_144_419 91
827 3300048916 Ga0496113_0395806 Ga0496113_0395806_811_1086 91
828 3300048916 Ga0496113_1026221 Ga0496113_1026221_51_326 91
829 3300048918 Ga0496115_0012247 Ga0496115_0012247_599_874 91
830 3300048918 Ga0496115_0097678 Ga0496115_0097678_1426_1701 91
831 3300048918 Ga0496115_1106422 Ga0496115_1106422_14_289 91
832 3300048929 Ga0496126_0342885 Ga0496126_0342885_555_836 91
833 3300049513 Ga0501290_051396 Ga0501290_051396_330_605 91
834 3300049521 Ga0501298_028735 Ga0501298_028735_731_1066 91
835 3300049582 Ga0501048_1222433 Ga0501048_1222433_213_512 91
836 3300049586 Ga0501070_0763463 Ga0501070_0763463_217_495 91
837 3300049589 Ga0501073_0924941 Ga0501073_0924941_263_538 91
838 3300049685 Ga0501256_020613 Ga0501256_020613_23_358 91
839 3300049686 Ga0501257_277804 Ga0501257_277804_178_462 91
840 3300049688 Ga0501259_058031 Ga0501259_058031_471_755 91
841 3300049742 Ga0501080_1068265 Ga0501080_1068265_338_637 91
842 3300049779 Ga0501283_018695 Ga0501283_018695_331_666 91
843 3300050507 nmdc:mga05p37_98700_c1 nmdc:mga05p37_98700_c1_295_570 91
844 3300050512 nmdc:mga0n895_1332383_c1 nmdc:mga0n895_1332383_c1_248_523 91
845 3300050513 nmdc:mga0rr50_402415_c1 nmdc:mga0rr50_402415_c1_135_410 91
846 3300050514 nmdc:mga08x19_195825_c1 nmdc:mga08x19_195825_c1_241_516 91
847 3300050514 nmdc:mga08x19_6208_c1 nmdc:mga08x19_6208_c1_2758_3033 91
848 3300053077 Ga0495601_0782841 Ga0495601_0782841_171_446 91
849 3300053085 Ga0495619_0292886 Ga0495619_0292886_740_1015 91
850 3300054114 Ga0501084_0545099 Ga0501084_0545099_112_387 91
851 3300059647 Ga0587079_063939 Ga0587079_063939_456_731 91
852 3300061734 Ga0530510_0599699 Ga0530510_0599699_94_369 91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3agy-assembly1.cif.gz_A crystal structure of human hsp40 hdj1 peptide-binding domain complexed with a c-terminal peptide of hsp70 0.622 4 44
6rpp-assembly1.cif.gz_A crystal structure of pabcdc21-1 intein 0.5933 7 40
7dbi-assembly1.cif.gz_A crystal structure of the peroxisomal acyl-coa hydrolase mpah 0.5662 5 43
8fuv-assembly1.cif.gz_F pseudomonas phage e217 extended sheath and tail tube 0.5219 9 48
5nzi-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosphorylase s374f mutant from leishmania major in complex with udp-glucose 0.5012 1 34
ID Description Score Start End Superfamily
af_Q9VEX5_2_667_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6629 8 35 3.40.50.410
af_P37297_1539_1696_3.30.1010.10 Alpha Beta;2-Layer Sandwich;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 0.6415 9 37 3.30.1010.10
af_P47912_40_551_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.6274 8 36 3.40.50.12780
6d04A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.626 8 42 3.40.630.10
af_Q9NVM9_4_692_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.616 7 35 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A1F2VEJ9-F1-model_v4 Uncharacterized protein 0.9879 1 91
AF-A0A7W7ZTC8-F1-model_v4 Uncharacterized protein 0.977 1 91
AF-A0A1Q7K0I8-F1-model_v4 Uncharacterized protein 0.9759 1 91
AF-A0A7W7ZTC8-F1-model_v4 Uncharacterized protein 0.9666 1 91
AF-A0A2V9ANF4-F1-model_v4 Uncharacterized protein 0.9638 1 91

Feature Viewer

pLDDT pTM Quality
89.48 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map