F483505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 321 | 852 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10039726|Ga0265328_100397262 |
| Length | 113 |
| Sequence | MGRIRAAARAEDVMDERDLYDEKQETRKATLNCPHCHQSAEYDLGWFVRTKKRQLPGRADERDRAKFAKARSYMVRRDDLVACKNLRCRKRFEVSGVQSVAFLDEQVPVERKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 303 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 308 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 309 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 1.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 6.69 |
| Rhizosphere | 92.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1001100 | 3300001976 | Bacteria | 3706 |
| 2 | JGI24737J22298_10167643 | 3300001990 | Unclassified | 648 |
| 3 | JGI24743J22301_10028888 | 3300001991 | Eukaryota | 1087 |
| 4 | JGI24033J26618_1019761 | 3300002155 | Unclassified | 855 |
| 5 | JGI24034J26672_10000337 | 3300002239 | Bacteria | 6045 |
| 6 | JGI24751J29686_10000704 | 3300002459 | Bacteria | 8154 |
| 7 | rootH1_10023707 | 3300003316 | Bacteria | 1780 |
| 8 | Ga0058863_10023995 | 3300004799 | Bacteria | 734 |
| 9 | Ga0058862_12692804 | 3300004803 | Unclassified | 845 |
| 10 | Ga0065712_10077652 | 3300005290 | Unclassified | 3462 |
| 11 | Ga0065715_10000987 | 3300005293 | Bacteria | 10061 |
| 12 | Ga0065715_10688515 | 3300005293 | Unclassified | 633 |
| 13 | Ga0065707_10181797 | 3300005295 | Unclassified | 1414 |
| 14 | Ga0070658_10026605 | 3300005327 | Unclassified | 4642 |
| 15 | Ga0070658_10114778 | 3300005327 | Bacteria | 2234 |
| 16 | Ga0070683_100034979 | 3300005329 | Bacteria | 4592 |
| 17 | Ga0070683_100538893 | 3300005329 | Bacteria | 1116 |
| 18 | Ga0070683_101864135 | 3300005329 | Unclassified | 578 |
| 19 | Ga0070690_100168815 | 3300005330 | Bacteria | 1504 |
| 20 | Ga0070690_100455888 | 3300005330 | Unclassified | 949 |
| 21 | Ga0070670_100368101 | 3300005331 | Bacteria | 1265 |
| 22 | Ga0070670_100654023 | 3300005331 | Unclassified | 943 |
| 23 | Ga0068869_100419330 | 3300005334 | Bacteria | 1104 |
| 24 | Ga0068869_101052596 | 3300005334 | Bacteria | 710 |
| 25 | Ga0070666_11021624 | 3300005335 | Bacteria | 614 |
| 26 | Ga0070680_100045686 | 3300005336 | Bacteria | 3561 |
| 27 | Ga0070680_100177835 | 3300005336 | Bacteria | 1791 |
| 28 | Ga0070680_100648246 | 3300005336 | Bacteria | 908 |
| 29 | Ga0070680_100695121 | 3300005336 | Unclassified | 875 |
| 30 | Ga0070680_100808497 | 3300005336 | Unclassified | 808 |
| 31 | Ga0070680_101498247 | 3300005336 | Bacteria | 584 |
| 32 | Ga0070682_100026601 | 3300005337 | Bacteria | 3464 |
| 33 | Ga0070682_100030142 | 3300005337 | Unclassified | 3272 |
| 34 | Ga0070682_100039509 | 3300005337 | Bacteria | 2900 |
| 35 | Ga0068868_100005847 | 3300005338 | Bacteria | 8671 |
| 36 | Ga0068868_100041733 | 3300005338 | Bacteria | 3575 |
| 37 | Ga0068868_101155308 | 3300005338 | Unclassified | 714 |
| 38 | Ga0068868_101521471 | 3300005338 | Unclassified | 627 |
| 39 | Ga0070660_100011892 | 3300005339 | Bacteria | 6206 |
| 40 | Ga0070660_100244417 | 3300005339 | Bacteria | 1462 |
| 41 | Ga0070689_100001794 | 3300005340 | Bacteria | 13790 |
| 42 | Ga0070687_100007106 | 3300005343 | Bacteria | 4638 |
| 43 | Ga0070661_100020981 | 3300005344 | Bacteria | 4663 |
| 44 | Ga0070661_100023061 | 3300005344 | Unclassified | 4460 |
| 45 | Ga0070661_100273787 | 3300005344 | Bacteria | 1308 |
| 46 | Ga0070661_100641995 | 3300005344 | Bacteria | 861 |
| 47 | Ga0070661_101696074 | 3300005344 | Bacteria | 535 |
| 48 | Ga0070692_10034365 | 3300005345 | Bacteria | 2561 |
| 49 | Ga0070668_100196526 | 3300005347 | Unclassified | 1654 |
| 50 | Ga0070668_101521432 | 3300005347 | Unclassified | 612 |
| 51 | Ga0070669_100009677 | 3300005353 | Bacteria | 6865 |
| 52 | Ga0070669_100657442 | 3300005353 | Bacteria | 882 |
| 53 | Ga0070675_100127127 | 3300005354 | Bacteria | 2169 |
| 54 | Ga0070671_100032972 | 3300005355 | Bacteria | 4281 |
| 55 | Ga0070671_100257526 | 3300005355 | Bacteria | 1483 |
| 56 | Ga0070674_100014116 | 3300005356 | Bacteria | 4959 |
| 57 | Ga0070673_100017192 | 3300005364 | Bacteria | 5135 |
| 58 | Ga0070673_101536667 | 3300005364 | Bacteria | 628 |
| 59 | Ga0070688_100002058 | 3300005365 | Bacteria | 10154 |
| 60 | Ga0070688_100366073 | 3300005365 | Bacteria | 1059 |
| 61 | Ga0070659_100024736 | 3300005366 | Unclassified | 4605 |
| 62 | Ga0070659_100436004 | 3300005366 | Bacteria | 1109 |
| 63 | Ga0070667_100180757 | 3300005367 | Bacteria | 1865 |
| 64 | Ga0070667_101620490 | 3300005367 | Unclassified | 608 |
| 65 | Ga0070667_101876032 | 3300005367 | Unclassified | 564 |
| 66 | Ga0070709_10218588 | 3300005434 | Bacteria | 1358 |
| 67 | Ga0070709_10274308 | 3300005434 | Bacteria | 1223 |
| 68 | Ga0070709_10438885 | 3300005434 | Unclassified | 981 |
| 69 | Ga0070709_10680957 | 3300005434 | Unclassified | 799 |
| 70 | Ga0070709_10686462 | 3300005434 | Bacteria | 796 |
| 71 | Ga0070709_10927770 | 3300005434 | Unclassified | 690 |
| 72 | Ga0070709_11233883 | 3300005434 | Unclassified | 602 |
| 73 | Ga0070714_100000183 | 3300005435 | Bacteria | 49970 |
| 74 | Ga0070714_100033971 | 3300005435 | Bacteria | 4270 |
| 75 | Ga0070714_100061176 | 3300005435 | Bacteria | 3233 |
| 76 | Ga0070714_100272918 | 3300005435 | Bacteria | 1569 |
| 77 | Ga0070714_100324820 | 3300005435 | Bacteria | 1440 |
| 78 | Ga0070714_100638205 | 3300005435 | Bacteria | 1024 |
| 79 | Ga0070714_100792017 | 3300005435 | Unclassified | 918 |
| 80 | Ga0070714_100899996 | 3300005435 | Bacteria | 859 |
| 81 | Ga0070714_100973984 | 3300005435 | Unclassified | 825 |
| 82 | Ga0070714_101117163 | 3300005435 | Bacteria | 768 |
| 83 | Ga0070714_101499549 | 3300005435 | Bacteria | 659 |
| 84 | Ga0070714_101981096 | 3300005435 | Unclassified | 568 |
| 85 | Ga0070713_100023609 | 3300005436 | Bacteria | 4775 |
| 86 | Ga0070713_100028256 | 3300005436 | Bacteria | 4427 |
| 87 | Ga0070713_100069129 | 3300005436 | Unclassified | 2977 |
| 88 | Ga0070713_100244038 | 3300005436 | Unclassified | 1636 |
| 89 | Ga0070713_100717377 | 3300005436 | Bacteria | 955 |
| 90 | Ga0070713_100836188 | 3300005436 | Bacteria | 884 |
| 91 | Ga0070713_100951760 | 3300005436 | Unclassified | 827 |
| 92 | Ga0070713_101753220 | 3300005436 | Unclassified | 603 |
| 93 | Ga0070713_101849992 | 3300005436 | Unclassified | 586 |
| 94 | Ga0070713_101928915 | 3300005436 | Bacteria | 573 |
| 95 | Ga0070710_10061816 | 3300005437 | Bacteria | 2134 |
| 96 | Ga0070710_10210269 | 3300005437 | Bacteria | 1233 |
| 97 | Ga0070710_10515526 | 3300005437 | Bacteria | 821 |
| 98 | Ga0070710_10599149 | 3300005437 | Bacteria | 767 |
| 99 | Ga0070710_10914061 | 3300005437 | Unclassified | 634 |
| 100 | Ga0070710_11020633 | 3300005437 | Bacteria | 604 |
| 101 | Ga0070710_11389211 | 3300005437 | Unclassified | 525 |
| 102 | Ga0070711_100044649 | 3300005439 | Bacteria | 3009 |
| 103 | Ga0070711_100324674 | 3300005439 | Unclassified | 1231 |
| 104 | Ga0070711_100350117 | 3300005439 | Bacteria | 1187 |
| 105 | Ga0070711_100391088 | 3300005439 | Bacteria | 1126 |
| 106 | Ga0070711_101244354 | 3300005439 | Unclassified | 645 |
| 107 | Ga0070705_100024988 | 3300005440 | Bacteria | 3232 |
| 108 | Ga0070705_101056716 | 3300005440 | Unclassified | 662 |
| 109 | Ga0070700_100072700 | 3300005441 | Unclassified | 2199 |
| 110 | Ga0070694_100336848 | 3300005444 | Bacteria | 1165 |
| 111 | Ga0070694_101684455 | 3300005444 | Unclassified | 539 |
| 112 | Ga0070663_100064452 | 3300005455 | Unclassified | 2648 |
| 113 | Ga0070678_100616350 | 3300005456 | Bacteria | 970 |
| 114 | Ga0070662_100360555 | 3300005457 | Bacteria | 1193 |
| 115 | Ga0070681_10028494 | 3300005458 | Bacteria | 5615 |
| 116 | Ga0070681_10063281 | 3300005458 | Bacteria | 3672 |
| 117 | Ga0070681_10064405 | 3300005458 | Unclassified | 3636 |
| 118 | Ga0070681_10233834 | 3300005458 | Bacteria | 1752 |
| 119 | Ga0070681_10310418 | 3300005458 | Bacteria | 1486 |
| 120 | Ga0070681_10417526 | 3300005458 | Unclassified | 1253 |
| 121 | Ga0070681_10736551 | 3300005458 | Unclassified | 902 |
| 122 | Ga0070681_10870980 | 3300005458 | Bacteria | 819 |
| 123 | Ga0070681_11150165 | 3300005458 | Bacteria | 697 |
| 124 | Ga0068867_100082865 | 3300005459 | Bacteria | 2420 |
| 125 | Ga0070685_10004126 | 3300005466 | Bacteria | 7329 |
| 126 | Ga0070707_100082687 | 3300005468 | Bacteria | 3101 |
| 127 | Ga0070707_101166073 | 3300005468 | Bacteria | 736 |
| 128 | Ga0070679_100009060 | 3300005530 | Bacteria | 9390 |
| 129 | Ga0070679_100041797 | 3300005530 | Bacteria | 4563 |
| 130 | Ga0070679_100049113 | 3300005530 | Bacteria | 4202 |
| 131 | Ga0070679_100281193 | 3300005530 | Bacteria | 1617 |
| 132 | Ga0070679_100347177 | 3300005530 | Bacteria | 1432 |
| 133 | Ga0070679_100487258 | 3300005530 | Bacteria | 1177 |
| 134 | Ga0070679_100517925 | 3300005530 | Bacteria | 1136 |
| 135 | Ga0070679_100699335 | 3300005530 | Bacteria | 956 |
| 136 | Ga0070679_101583193 | 3300005530 | Unclassified | 603 |
| 137 | Ga0070679_102189212 | 3300005530 | Bacteria | 502 |
| 138 | Ga0070684_100002682 | 3300005535 | Bacteria | 13145 |
| 139 | Ga0070684_100054714 | 3300005535 | Bacteria | 3477 |
| 140 | Ga0070684_100101202 | 3300005535 | Bacteria | 2575 |
| 141 | Ga0070684_100253904 | 3300005535 | Bacteria | 1607 |
| 142 | Ga0070684_101364374 | 3300005535 | Bacteria | 667 |
| 143 | Ga0070697_100006153 | 3300005536 | Bacteria | 9286 |
| 144 | Ga0068853_100016340 | 3300005539 | Bacteria | 6106 |
| 145 | Ga0068853_100197807 | 3300005539 | Bacteria | 1828 |
| 146 | Ga0068853_100276794 | 3300005539 | Bacteria | 1546 |
| 147 | Ga0068853_100604842 | 3300005539 | Bacteria | 1041 |
| 148 | Ga0068853_100976563 | 3300005539 | Unclassified | 815 |
| 149 | Ga0068853_102474951 | 3300005539 | Unclassified | 503 |
| 150 | Ga0070672_100003745 | 3300005543 | Bacteria | 9901 |
| 151 | Ga0070686_100485333 | 3300005544 | Unclassified | 956 |
| 152 | Ga0070686_100610841 | 3300005544 | Unclassified | 860 |
| 153 | Ga0070695_100848135 | 3300005545 | Unclassified | 735 |
| 154 | Ga0070696_100112546 | 3300005546 | Unclassified | 1961 |
| 155 | Ga0070696_100551268 | 3300005546 | Unclassified | 924 |
| 156 | Ga0070693_100105611 | 3300005547 | Bacteria | 1723 |
| 157 | Ga0070693_100162884 | 3300005547 | Bacteria | 1422 |
| 158 | Ga0070693_100172870 | 3300005547 | Bacteria | 1385 |
| 159 | Ga0070665_100018649 | 3300005548 | Bacteria | 6954 |
| 160 | Ga0070665_101383046 | 3300005548 | Unclassified | 713 |
| 161 | Ga0070704_102064699 | 3300005549 | Unclassified | 529 |
| 162 | Ga0068855_100020077 | 3300005563 | Bacteria | 8024 |
| 163 | Ga0068855_100152904 | 3300005563 | Bacteria | 2623 |
| 164 | Ga0068855_100222770 | 3300005563 | Bacteria | 2114 |
| 165 | Ga0068855_100355651 | 3300005563 | Bacteria | 1612 |
| 166 | Ga0068855_100657991 | 3300005563 | Bacteria | 1124 |
| 167 | Ga0068855_100682325 | 3300005563 | Bacteria | 1101 |
| 168 | Ga0070664_100143608 | 3300005564 | Bacteria | 2103 |
| 169 | Ga0070664_100220385 | 3300005564 | Bacteria | 1697 |
| 170 | Ga0070664_100229022 | 3300005564 | Bacteria | 1665 |
| 171 | Ga0070664_100783958 | 3300005564 | Unclassified | 891 |
| 172 | Ga0068857_100003337 | 3300005577 | Bacteria | 13362 |
| 173 | Ga0068857_100072067 | 3300005577 | Bacteria | 3079 |
| 174 | Ga0068857_100258031 | 3300005577 | Bacteria | 1599 |
| 175 | Ga0068857_100931540 | 3300005577 | Unclassified | 834 |
| 176 | Ga0068857_100990387 | 3300005577 | Bacteria | 809 |
| 177 | Ga0068857_101100468 | 3300005577 | Unclassified | 767 |
| 178 | Ga0068854_100004220 | 3300005578 | Bacteria | 9046 |
| 179 | Ga0068854_101256651 | 3300005578 | Unclassified | 665 |
| 180 | Ga0068854_101655987 | 3300005578 | Unclassified | 584 |
| 181 | Ga0068854_101707364 | 3300005578 | Bacteria | 576 |
| 182 | Ga0068856_100027595 | 3300005614 | Bacteria | 5538 |
| 183 | Ga0068856_100037749 | 3300005614 | Unclassified | 4740 |
| 184 | Ga0068856_100041407 | 3300005614 | Bacteria | 4527 |
| 185 | Ga0068856_100055186 | 3300005614 | Unclassified | 3921 |
| 186 | Ga0068856_100151650 | 3300005614 | Bacteria | 2327 |
| 187 | Ga0068856_100559022 | 3300005614 | Unclassified | 1165 |
| 188 | Ga0068856_100972854 | 3300005614 | Unclassified | 867 |
| 189 | Ga0068856_101235390 | 3300005614 | Bacteria | 763 |
| 190 | Ga0068856_101644074 | 3300005614 | Unclassified | 655 |
| 191 | Ga0068856_101698318 | 3300005614 | Unclassified | 644 |
| 192 | Ga0070702_100398975 | 3300005615 | Bacteria | 983 |
| 193 | Ga0070702_100934224 | 3300005615 | Unclassified | 682 |
| 194 | Ga0068852_100079181 | 3300005616 | Bacteria | 2910 |
| 195 | Ga0068852_102315881 | 3300005616 | Unclassified | 558 |
| 196 | Ga0068852_102783593 | 3300005616 | Unclassified | 508 |
| 197 | Ga0068864_100032295 | 3300005618 | Bacteria | 4447 |
| 198 | Ga0068864_100193489 | 3300005618 | Bacteria | 1865 |
| 199 | Ga0068864_100823976 | 3300005618 | Bacteria | 913 |
| 200 | Ga0068864_100925747 | 3300005618 | Unclassified | 862 |
| 201 | Ga0068864_102359504 | 3300005618 | Bacteria | 538 |
| 202 | Ga0068866_10009998 | 3300005718 | Unclassified | 4052 |
| 203 | Ga0068866_10514773 | 3300005718 | Unclassified | 794 |
| 204 | Ga0068861_100009849 | 3300005719 | Bacteria | 6609 |
| 205 | Ga0068870_10000935 | 3300005840 | Bacteria | 11452 |
| 206 | Ga0068863_100023970 | 3300005841 | Bacteria | 5823 |
| 207 | Ga0068863_100068107 | 3300005841 | Unclassified | 3367 |
| 208 | Ga0068863_100306705 | 3300005841 | Bacteria | 1540 |
| 209 | Ga0068863_101960798 | 3300005841 | Unclassified | 596 |
| 210 | Ga0068863_102037876 | 3300005841 | Unclassified | 584 |
| 211 | Ga0068858_100249002 | 3300005842 | Bacteria | 1687 |
| 212 | Ga0068860_100089866 | 3300005843 | Bacteria | 2925 |
| 213 | Ga0068860_100091141 | 3300005843 | Bacteria | 2904 |
| 214 | Ga0068860_100258050 | 3300005843 | Bacteria | 1698 |
| 215 | Ga0081540_1011430 | 3300005983 | Bacteria | 5932 |
| 216 | Ga0070717_10035619 | 3300006028 | Bacteria | 4031 |
| 217 | Ga0070717_10086596 | 3300006028 | Bacteria | 2637 |
| 218 | Ga0070717_10177409 | 3300006028 | Bacteria | 1855 |
| 219 | Ga0070717_10258786 | 3300006028 | Bacteria | 1539 |
| 220 | Ga0070717_10993567 | 3300006028 | Unclassified | 764 |
| 221 | Ga0070717_11342150 | 3300006028 | Bacteria | 650 |
| 222 | Ga0070717_11844966 | 3300006028 | Unclassified | 546 |
| 223 | Ga0070715_10194927 | 3300006163 | Bacteria | 1025 |
| 224 | Ga0070716_100046340 | 3300006173 | Bacteria | 2446 |
| 225 | Ga0070716_100188529 | 3300006173 | Unclassified | 1360 |
| 226 | Ga0070716_100475554 | 3300006173 | Bacteria | 916 |
| 227 | Ga0070716_100599980 | 3300006173 | Bacteria | 828 |
| 228 | Ga0070716_100726225 | 3300006173 | Unclassified | 761 |
| 229 | Ga0070716_101223739 | 3300006173 | Unclassified | 604 |
| 230 | Ga0070712_100261165 | 3300006175 | Unclassified | 1388 |
| 231 | Ga0070712_100375156 | 3300006175 | Bacteria | 1170 |
| 232 | Ga0070712_100433466 | 3300006175 | Bacteria | 1091 |
| 233 | Ga0070712_100734140 | 3300006175 | Unclassified | 844 |
| 234 | Ga0070712_100962207 | 3300006175 | Bacteria | 738 |
| 235 | Ga0070712_101476121 | 3300006175 | Bacteria | 594 |
| 236 | Ga0097621_100000484 | 3300006237 | Bacteria | 27786 |
| 237 | Ga0097621_100410450 | 3300006237 | Bacteria | 1214 |
| 238 | Ga0097621_100799368 | 3300006237 | Bacteria | 874 |
| 239 | Ga0097621_101190384 | 3300006237 | Unclassified | 717 |
| 240 | Ga0068871_100005759 | 3300006358 | Bacteria | 8700 |
| 241 | Ga0068871_100155849 | 3300006358 | Bacteria | 1950 |
| 242 | Ga0068871_101718241 | 3300006358 | Bacteria | 595 |
| 243 | Ga0075433_10835213 | 3300006852 | Unclassified | 804 |
| 244 | Ga0075434_100000177 | 3300006871 | Bacteria | 41424 |
| 245 | Ga0075434_100980254 | 3300006871 | Unclassified | 859 |
| 246 | Ga0068865_100215811 | 3300006881 | Unclassified | 1497 |
| 247 | Ga0075436_100007556 | 3300006914 | Bacteria | 7425 |
| 248 | Ga0075436_100015125 | 3300006914 | Bacteria | 5289 |
| 249 | Ga0075436_100100656 | 3300006914 | Bacteria | 2013 |
| 250 | Ga0075436_100167646 | 3300006914 | Unclassified | 1550 |
| 251 | Ga0075436_100652049 | 3300006914 | Unclassified | 778 |
| 252 | Ga0097620_100981155 | 3300006931 | Unclassified | 927 |
| 253 | Ga0075435_100000319 | 3300007076 | Bacteria | 29633 |
| 254 | Ga0075435_100214588 | 3300007076 | Bacteria | 1633 |
| 255 | Ga0075435_100792877 | 3300007076 | Unclassified | 825 |
| 256 | Ga0105250_10009360 | 3300009092 | Bacteria | 4130 |
| 257 | Ga0105250_10514357 | 3300009092 | Unclassified | 545 |
| 258 | Ga0105240_10036492 | 3300009093 | Bacteria | 6322 |
| 259 | Ga0105240_10037121 | 3300009093 | Bacteria | 6263 |
| 260 | Ga0105240_10349489 | 3300009093 | Unclassified | 1678 |
| 261 | Ga0105240_10670948 | 3300009093 | Bacteria | 1134 |
| 262 | Ga0105240_10767800 | 3300009093 | Unclassified | 1047 |
| 263 | Ga0105240_11012617 | 3300009093 | Unclassified | 888 |
| 264 | Ga0105240_11453900 | 3300009093 | Bacteria | 719 |
| 265 | Ga0105240_11887384 | 3300009093 | Unclassified | 622 |
| 266 | Ga0105240_11952947 | 3300009093 | Bacteria | 610 |
| 267 | Ga0105240_12195018 | 3300009093 | Bacteria | 572 |
| 268 | Ga0105245_10003145 | 3300009098 | Bacteria | 14771 |
| 269 | Ga0105245_10007043 | 3300009098 | Bacteria | 9863 |
| 270 | Ga0105245_10041692 | 3300009098 | Bacteria | 4092 |
| 271 | Ga0105245_10192516 | 3300009098 | Bacteria | 1954 |
| 272 | Ga0105245_10471270 | 3300009098 | Unclassified | 1267 |
| 273 | Ga0105245_10906204 | 3300009098 | Bacteria | 923 |
| 274 | Ga0105247_10001507 | 3300009101 | Bacteria | 16650 |
| 275 | Ga0114129_10184786 | 3300009147 | Bacteria | 2834 |
| 276 | Ga0105243_10447461 | 3300009148 | Unclassified | 1211 |
| 277 | Ga0105241_10019278 | 3300009174 | Bacteria | 5031 |
| 278 | Ga0105241_10071374 | 3300009174 | Bacteria | 2696 |
| 279 | Ga0105241_10273184 | 3300009174 | Bacteria | 1441 |
| 280 | Ga0105241_10401991 | 3300009174 | Bacteria | 1202 |
| 281 | Ga0105241_10535740 | 3300009174 | Unclassified | 1049 |
| 282 | Ga0105241_10896387 | 3300009174 | Unclassified | 823 |
| 283 | Ga0105241_11078040 | 3300009174 | Unclassified | 755 |
| 284 | Ga0105241_11802192 | 3300009174 | Bacteria | 597 |
| 285 | Ga0105241_12640656 | 3300009174 | Unclassified | 505 |
| 286 | Ga0105242_10016443 | 3300009176 | Bacteria | 5752 |
| 287 | Ga0105242_10053867 | 3300009176 | Bacteria | 3286 |
| 288 | Ga0105248_10074434 | 3300009177 | Bacteria | 3817 |
| 289 | Ga0105248_10171911 | 3300009177 | Bacteria | 2442 |
| 290 | Ga0105248_10220359 | 3300009177 | Bacteria | 2136 |
| 291 | Ga0105248_10447047 | 3300009177 | Bacteria | 1456 |
| 292 | Ga0105248_10452143 | 3300009177 | Bacteria | 1447 |
| 293 | Ga0105248_10679601 | 3300009177 | Bacteria | 1161 |
| 294 | Ga0105237_10053790 | 3300009545 | Unclassified | 4037 |
| 295 | Ga0105237_10592128 | 3300009545 | Bacteria | 1116 |
| 296 | Ga0105237_10744921 | 3300009545 | Bacteria | 986 |
| 297 | Ga0105237_11447883 | 3300009545 | Unclassified | 693 |
| 298 | Ga0105238_10016655 | 3300009551 | Bacteria | 7446 |
| 299 | Ga0105238_10022654 | 3300009551 | Bacteria | 6402 |
| 300 | Ga0105238_10137453 | 3300009551 | Bacteria | 2421 |
| 301 | Ga0105238_10294358 | 3300009551 | Bacteria | 1606 |
| 302 | Ga0105238_10480988 | 3300009551 | Bacteria | 1241 |
| 303 | Ga0105238_10556099 | 3300009551 | Unclassified | 1152 |
| 304 | Ga0105238_10921055 | 3300009551 | Bacteria | 893 |
| 305 | Ga0105238_11013972 | 3300009551 | Unclassified | 851 |
| 306 | Ga0105238_11792211 | 3300009551 | Unclassified | 646 |
| 307 | Ga0105238_12056725 | 3300009551 | Unclassified | 605 |
| 308 | Ga0105238_12060705 | 3300009551 | Unclassified | 604 |
| 309 | Ga0105238_12546412 | 3300009551 | Unclassified | 548 |
| 310 | Ga0105249_10112207 | 3300009553 | Bacteria | 2578 |
| 311 | Ga0099796_10042002 | 3300010159 | Bacteria | 1551 |
| 312 | Ga0105239_10005962 | 3300010375 | Bacteria | 14181 |
| 313 | Ga0105239_10086301 | 3300010375 | Bacteria | 3459 |
| 314 | Ga0105239_10323194 | 3300010375 | Bacteria | 1740 |
| 315 | Ga0105239_10808630 | 3300010375 | Bacteria | 1074 |
| 316 | Ga0105239_11395350 | 3300010375 | Unclassified | 809 |
| 317 | Ga0105239_11934011 | 3300010375 | Bacteria | 684 |
| 318 | Ga0105239_13302566 | 3300010375 | Unclassified | 525 |
| 319 | Ga0105246_10001854 | 3300011119 | Bacteria | 12705 |
| 320 | Ga0105246_11616123 | 3300011119 | Unclassified | 613 |
| 321 | Ga0157373_10001119 | 3300013100 | Bacteria | 20585 |
| 322 | Ga0157373_10031848 | 3300013100 | Bacteria | 3797 |
| 323 | Ga0157373_10396401 | 3300013100 | Unclassified | 989 |
| 324 | Ga0157373_10729658 | 3300013100 | Unclassified | 727 |
| 325 | Ga0157371_10005666 | 3300013102 | Bacteria | 10485 |
| 326 | Ga0157371_10701612 | 3300013102 | Bacteria | 758 |
| 327 | Ga0157370_10164565 | 3300013104 | Bacteria | 2063 |
| 328 | Ga0157370_11990995 | 3300013104 | Bacteria | 521 |
| 329 | Ga0157369_10001345 | 3300013105 | Bacteria | 30363 |
| 330 | Ga0157369_10035084 | 3300013105 | Bacteria | 5501 |
| 331 | Ga0157369_10038299 | 3300013105 | Bacteria | 5243 |
| 332 | Ga0157369_10052365 | 3300013105 | Bacteria | 4417 |
| 333 | Ga0157369_10147636 | 3300013105 | Bacteria | 2486 |
| 334 | Ga0157369_10498082 | 3300013105 | Bacteria | 1260 |
| 335 | Ga0157369_10585526 | 3300013105 | Unclassified | 1152 |
| 336 | Ga0157369_10751627 | 3300013105 | Unclassified | 1003 |
| 337 | Ga0157369_11238855 | 3300013105 | Unclassified | 761 |
| 338 | Ga0157369_11311606 | 3300013105 | Bacteria | 738 |
| 339 | Ga0157369_11436830 | 3300013105 | Unclassified | 702 |
| 340 | Ga0157369_12259641 | 3300013105 | Unclassified | 551 |
| 341 | Ga0157369_12263761 | 3300013105 | Unclassified | 551 |
| 342 | Ga0157374_10011069 | 3300013296 | Bacteria | 7793 |
| 343 | Ga0157374_10026177 | 3300013296 | Bacteria | 5246 |
| 344 | Ga0157374_10033131 | 3300013296 | Bacteria | 4712 |
| 345 | Ga0157374_10058122 | 3300013296 | Unclassified | 3614 |
| 346 | Ga0157374_10093053 | 3300013296 | Bacteria | 2877 |
| 347 | Ga0157374_10163595 | 3300013296 | Bacteria | 2168 |
| 348 | Ga0157374_10283774 | 3300013296 | Bacteria | 1635 |
| 349 | Ga0157374_10719607 | 3300013296 | Unclassified | 1012 |
| 350 | Ga0157378_10000145 | 3300013297 | Bacteria | 66719 |
| 351 | Ga0157378_10397411 | 3300013297 | Bacteria | 1357 |
| 352 | Ga0157378_10739562 | 3300013297 | Bacteria | 1006 |
| 353 | Ga0157378_11452698 | 3300013297 | Unclassified | 729 |
| 354 | Ga0163162_10087570 | 3300013306 | Bacteria | 3193 |
| 355 | Ga0163162_10206352 | 3300013306 | Bacteria | 2094 |
| 356 | Ga0163162_12193052 | 3300013306 | Unclassified | 634 |
| 357 | Ga0157372_10008298 | 3300013307 | Bacteria | 11043 |
| 358 | Ga0157372_10033302 | 3300013307 | Bacteria | 5658 |
| 359 | Ga0157372_10111529 | 3300013307 | Unclassified | 3134 |
| 360 | Ga0157372_10116160 | 3300013307 | Bacteria | 3068 |
| 361 | Ga0157372_10215434 | 3300013307 | Unclassified | 2226 |
| 362 | Ga0157372_10353409 | 3300013307 | Bacteria | 1712 |
| 363 | Ga0157375_13167096 | 3300013308 | Unclassified | 549 |
| 364 | Ga0163163_10025274 | 3300014325 | Bacteria | 5662 |
| 365 | Ga0163163_10059974 | 3300014325 | Bacteria | 3765 |
| 366 | Ga0163163_10149055 | 3300014325 | Bacteria | 2384 |
| 367 | Ga0163163_10762080 | 3300014325 | Unclassified | 1031 |
| 368 | Ga0182008_10626640 | 3300014497 | Unclassified | 606 |
| 369 | Ga0182008_10847554 | 3300014497 | Bacteria | 534 |
| 370 | Ga0157377_10007969 | 3300014745 | Bacteria | 5144 |
| 371 | Ga0157379_10060793 | 3300014968 | Bacteria | 3378 |
| 372 | Ga0157379_10428888 | 3300014968 | Bacteria | 1218 |
| 373 | Ga0157376_10031084 | 3300014969 | Bacteria | 4271 |
| 374 | Ga0157376_10452452 | 3300014969 | Unclassified | 1253 |
| 375 | Ga0157376_11597902 | 3300014969 | Bacteria | 686 |
| 376 | Ga0182006_1019925 | 3300015261 | Bacteria | 2816 |
| 377 | Ga0182007_10002409 | 3300015262 | Bacteria | 9337 |
| 378 | Ga0163161_10103478 | 3300017792 | Bacteria | 2122 |
| 379 | Ga0206356_10207189 | 3300020070 | Unclassified | 972 |
| 380 | Ga0206355_1512251 | 3300020076 | Bacteria | 992 |
| 381 | Ga0206351_10464849 | 3300020077 | Bacteria | 559 |
| 382 | Ga0206352_10895603 | 3300020078 | Unclassified | 680 |
| 383 | Ga0206350_11534362 | 3300020080 | Unclassified | 515 |
| 384 | Ga0154015_1279385 | 3300020610 | Bacteria | 1650 |
| 385 | Ga0213873_10042379 | 3300021358 | Bacteria | 1177 |
| 386 | Ga0213874_10086069 | 3300021377 | Unclassified | 1025 |
| 387 | Ga0224712_10070837 | 3300022467 | Bacteria | 1415 |
| 388 | Ga0207673_1021856 | 3300025290 | Unclassified | 867 |
| 389 | Ga0207426_1137607 | 3300025302 | Bacteria | 584 |
| 390 | Ga0207697_10012379 | 3300025315 | Bacteria | 3577 |
| 391 | Ga0207696_1041015 | 3300025711 | Bacteria | 1354 |
| 392 | Ga0207682_10091581 | 3300025893 | Unclassified | 1319 |
| 393 | Ga0207692_10023063 | 3300025898 | Bacteria | 2874 |
| 394 | Ga0207692_10072310 | 3300025898 | Bacteria | 1821 |
| 395 | Ga0207692_10175590 | 3300025898 | Bacteria | 1244 |
| 396 | Ga0207692_10218755 | 3300025898 | Bacteria | 1128 |
| 397 | Ga0207692_10732721 | 3300025898 | Unclassified | 643 |
| 398 | Ga0207642_10101305 | 3300025899 | Bacteria | 1446 |
| 399 | Ga0207642_10427703 | 3300025899 | Unclassified | 798 |
| 400 | Ga0207710_10211733 | 3300025900 | Unclassified | 960 |
| 401 | Ga0207710_10487651 | 3300025900 | Bacteria | 639 |
| 402 | Ga0207688_10003069 | 3300025901 | Bacteria | 9113 |
| 403 | Ga0207680_10195855 | 3300025903 | Unclassified | 1374 |
| 404 | Ga0207680_10755074 | 3300025903 | Bacteria | 697 |
| 405 | Ga0207647_10002063 | 3300025904 | Bacteria | 15352 |
| 406 | Ga0207647_10006155 | 3300025904 | Bacteria | 8740 |
| 407 | Ga0207647_10378050 | 3300025904 | Bacteria | 800 |
| 408 | Ga0207685_10142327 | 3300025905 | Bacteria | 1076 |
| 409 | Ga0207699_10089981 | 3300025906 | Bacteria | 1925 |
| 410 | Ga0207699_10138949 | 3300025906 | Bacteria | 1594 |
| 411 | Ga0207699_10140721 | 3300025906 | Bacteria | 1585 |
| 412 | Ga0207699_10156817 | 3300025906 | Unclassified | 1512 |
| 413 | Ga0207699_10191208 | 3300025906 | Bacteria | 1381 |
| 414 | Ga0207699_10343204 | 3300025906 | Unclassified | 1052 |
| 415 | Ga0207699_10363051 | 3300025906 | Bacteria | 1024 |
| 416 | Ga0207699_11007123 | 3300025906 | Unclassified | 616 |
| 417 | Ga0207699_11399524 | 3300025906 | Unclassified | 517 |
| 418 | Ga0207645_10000901 | 3300025907 | Bacteria | 24637 |
| 419 | Ga0207645_11087942 | 3300025907 | Unclassified | 539 |
| 420 | Ga0207643_10000172 | 3300025908 | Bacteria | 44395 |
| 421 | Ga0207705_10045267 | 3300025909 | Bacteria | 3163 |
| 422 | Ga0207705_10513714 | 3300025909 | Unclassified | 931 |
| 423 | Ga0207705_11001144 | 3300025909 | Bacteria | 646 |
| 424 | Ga0207654_10395459 | 3300025911 | Unclassified | 960 |
| 425 | Ga0207654_10659285 | 3300025911 | Bacteria | 750 |
| 426 | Ga0207654_10704808 | 3300025911 | Unclassified | 725 |
| 427 | Ga0207654_11096868 | 3300025911 | Unclassified | 580 |
| 428 | Ga0207654_11450224 | 3300025911 | Unclassified | 501 |
| 429 | Ga0207707_10060930 | 3300025912 | Bacteria | 3283 |
| 430 | Ga0207707_10112690 | 3300025912 | Bacteria | 2378 |
| 431 | Ga0207707_10177908 | 3300025912 | Bacteria | 1858 |
| 432 | Ga0207707_10501566 | 3300025912 | Unclassified | 1035 |
| 433 | Ga0207707_10502933 | 3300025912 | Unclassified | 1033 |
| 434 | Ga0207707_10533333 | 3300025912 | Unclassified | 999 |
| 435 | Ga0207707_10631450 | 3300025912 | Bacteria | 904 |
| 436 | Ga0207707_10787269 | 3300025912 | Unclassified | 793 |
| 437 | Ga0207707_11540672 | 3300025912 | Unclassified | 525 |
| 438 | Ga0207695_11315022 | 3300025913 | Unclassified | 603 |
| 439 | Ga0207671_10151305 | 3300025914 | Bacteria | 1793 |
| 440 | Ga0207671_10977274 | 3300025914 | Unclassified | 668 |
| 441 | Ga0207671_11469141 | 3300025914 | Bacteria | 527 |
| 442 | Ga0207693_10077982 | 3300025915 | Unclassified | 2594 |
| 443 | Ga0207693_10578518 | 3300025915 | Bacteria | 875 |
| 444 | Ga0207693_10653952 | 3300025915 | Unclassified | 816 |
| 445 | Ga0207663_10313172 | 3300025916 | Bacteria | 1177 |
| 446 | Ga0207663_10402743 | 3300025916 | Bacteria | 1047 |
| 447 | Ga0207663_10498430 | 3300025916 | Bacteria | 946 |
| 448 | Ga0207660_10092661 | 3300025917 | Bacteria | 2243 |
| 449 | Ga0207660_10103262 | 3300025917 | Bacteria | 2132 |
| 450 | Ga0207660_10108214 | 3300025917 | Bacteria | 2087 |
| 451 | Ga0207660_10354029 | 3300025917 | Bacteria | 1177 |
| 452 | Ga0207660_10458451 | 3300025917 | Bacteria | 1031 |
| 453 | Ga0207660_10605707 | 3300025917 | Bacteria | 892 |
| 454 | Ga0207660_10894506 | 3300025917 | Unclassified | 725 |
| 455 | Ga0207662_10002090 | 3300025918 | Bacteria | 9922 |
| 456 | Ga0207657_10000660 | 3300025919 | Bacteria | 36719 |
| 457 | Ga0207657_11202892 | 3300025919 | Unclassified | 576 |
| 458 | Ga0207649_10001125 | 3300025920 | Bacteria | 16224 |
| 459 | Ga0207649_10329425 | 3300025920 | Bacteria | 1124 |
| 460 | Ga0207652_10078006 | 3300025921 | Bacteria | 2891 |
| 461 | Ga0207652_10084852 | 3300025921 | Bacteria | 2775 |
| 462 | Ga0207652_10115237 | 3300025921 | Bacteria | 2387 |
| 463 | Ga0207652_10162586 | 3300025921 | Bacteria | 2002 |
| 464 | Ga0207652_10483898 | 3300025921 | Bacteria | 1115 |
| 465 | Ga0207652_10553165 | 3300025921 | Bacteria | 1034 |
| 466 | Ga0207652_10572017 | 3300025921 | Bacteria | 1015 |
| 467 | Ga0207652_11100325 | 3300025921 | Bacteria | 695 |
| 468 | Ga0207646_10423062 | 3300025922 | Bacteria | 1202 |
| 469 | Ga0207646_11731012 | 3300025922 | Unclassified | 536 |
| 470 | Ga0207694_10289281 | 3300025924 | Unclassified | 1347 |
| 471 | Ga0207694_10391218 | 3300025924 | Bacteria | 1155 |
| 472 | Ga0207694_10454115 | 3300025924 | Bacteria | 1070 |
| 473 | Ga0207694_10652886 | 3300025924 | Bacteria | 886 |
| 474 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 475 | Ga0207650_10144414 | 3300025925 | Bacteria | 1873 |
| 476 | Ga0207650_10402085 | 3300025925 | Unclassified | 1134 |
| 477 | Ga0207650_11341767 | 3300025925 | Unclassified | 609 |
| 478 | Ga0207659_10071146 | 3300025926 | Bacteria | 2539 |
| 479 | Ga0207687_10003663 | 3300025927 | Bacteria | 10349 |
| 480 | Ga0207687_10009003 | 3300025927 | Bacteria | 6526 |
| 481 | Ga0207687_10097260 | 3300025927 | Bacteria | 2159 |
| 482 | Ga0207687_10378008 | 3300025927 | Bacteria | 1160 |
| 483 | Ga0207687_10809445 | 3300025927 | Unclassified | 799 |
| 484 | Ga0207700_10052978 | 3300025928 | Unclassified | 3037 |
| 485 | Ga0207700_10096429 | 3300025928 | Bacteria | 2348 |
| 486 | Ga0207700_10403578 | 3300025928 | Bacteria | 1198 |
| 487 | Ga0207700_10440415 | 3300025928 | Bacteria | 1147 |
| 488 | Ga0207700_10679714 | 3300025928 | Bacteria | 918 |
| 489 | Ga0207700_11087226 | 3300025928 | Unclassified | 715 |
| 490 | Ga0207700_11377148 | 3300025928 | Unclassified | 627 |
| 491 | Ga0207664_10153852 | 3300025929 | Unclassified | 1956 |
| 492 | Ga0207664_10162743 | 3300025929 | Bacteria | 1904 |
| 493 | Ga0207664_10886907 | 3300025929 | Bacteria | 801 |
| 494 | Ga0207664_11713824 | 3300025929 | Bacteria | 551 |
| 495 | Ga0207644_10149789 | 3300025931 | Unclassified | 1804 |
| 496 | Ga0207644_10613543 | 3300025931 | Bacteria | 904 |
| 497 | Ga0207644_10676296 | 3300025931 | Bacteria | 860 |
| 498 | Ga0207644_11350881 | 3300025931 | Bacteria | 599 |
| 499 | Ga0207690_10149339 | 3300025932 | Bacteria | 1731 |
| 500 | Ga0207690_10282315 | 3300025932 | Bacteria | 1293 |
| 501 | Ga0207690_11362858 | 3300025932 | Bacteria | 593 |
| 502 | Ga0207706_10000723 | 3300025933 | Bacteria | 34501 |
| 503 | Ga0207706_10082973 | 3300025933 | Bacteria | 2817 |
| 504 | Ga0207686_10107083 | 3300025934 | Bacteria | 1878 |
| 505 | Ga0207686_10622330 | 3300025934 | Unclassified | 852 |
| 506 | Ga0207709_11096733 | 3300025935 | Unclassified | 653 |
| 507 | Ga0207704_10534212 | 3300025938 | Unclassified | 950 |
| 508 | Ga0207665_10186645 | 3300025939 | Unclassified | 1504 |
| 509 | Ga0207665_10370094 | 3300025939 | Unclassified | 1085 |
| 510 | Ga0207665_10748534 | 3300025939 | Bacteria | 770 |
| 511 | Ga0207691_10001129 | 3300025940 | Bacteria | 26514 |
| 512 | Ga0207691_11400936 | 3300025940 | Unclassified | 574 |
| 513 | Ga0207711_10010662 | 3300025941 | Bacteria | 7642 |
| 514 | Ga0207711_10354258 | 3300025941 | Bacteria | 1359 |
| 515 | Ga0207711_10965471 | 3300025941 | Bacteria | 791 |
| 516 | Ga0207711_10976392 | 3300025941 | Unclassified | 786 |
| 517 | Ga0207711_11006148 | 3300025941 | Unclassified | 773 |
| 518 | Ga0207689_10203792 | 3300025942 | Unclassified | 1633 |
| 519 | Ga0207689_10903620 | 3300025942 | Unclassified | 745 |
| 520 | Ga0207689_11474515 | 3300025942 | Unclassified | 569 |
| 521 | Ga0207661_10015604 | 3300025944 | Bacteria | 5594 |
| 522 | Ga0207661_10096426 | 3300025944 | Bacteria | 2475 |
| 523 | Ga0207661_10928453 | 3300025944 | Bacteria | 802 |
| 524 | Ga0207679_10000415 | 3300025945 | Bacteria | 30616 |
| 525 | Ga0207667_10006054 | 3300025949 | Bacteria | 14707 |
| 526 | Ga0207667_10318463 | 3300025949 | Bacteria | 1588 |
| 527 | Ga0207667_11019639 | 3300025949 | Unclassified | 814 |
| 528 | Ga0207667_11445100 | 3300025949 | Bacteria | 660 |
| 529 | Ga0207667_11587734 | 3300025949 | Unclassified | 623 |
| 530 | Ga0207651_10010359 | 3300025960 | Bacteria | 5162 |
| 531 | Ga0207651_10633779 | 3300025960 | Unclassified | 937 |
| 532 | Ga0207668_10008891 | 3300025972 | Bacteria | 6007 |
| 533 | Ga0207640_10045169 | 3300025981 | Bacteria | 2827 |
| 534 | Ga0207640_10504562 | 3300025981 | Bacteria | 1008 |
| 535 | Ga0207640_10624380 | 3300025981 | Unclassified | 915 |
| 536 | Ga0207658_10014195 | 3300025986 | Bacteria | 5455 |
| 537 | Ga0207658_10191920 | 3300025986 | Bacteria | 1699 |
| 538 | Ga0207658_11784359 | 3300025986 | Unclassified | 561 |
| 539 | Ga0207677_10017217 | 3300026023 | Bacteria | 4302 |
| 540 | Ga0207677_10033691 | 3300026023 | Bacteria | 3308 |
| 541 | Ga0207677_10158054 | 3300026023 | Bacteria | 1758 |
| 542 | Ga0207677_10786837 | 3300026023 | Bacteria | 851 |
| 543 | Ga0207703_10013619 | 3300026035 | Bacteria | 6337 |
| 544 | Ga0207703_11769781 | 3300026035 | Bacteria | 594 |
| 545 | Ga0207639_10076788 | 3300026041 | Bacteria | 2631 |
| 546 | Ga0207639_10076954 | 3300026041 | Bacteria | 2628 |
| 547 | Ga0207639_10355113 | 3300026041 | Bacteria | 1310 |
| 548 | Ga0207639_10762615 | 3300026041 | Bacteria | 900 |
| 549 | Ga0207639_10841749 | 3300026041 | Unclassified | 856 |
| 550 | Ga0207639_11457974 | 3300026041 | Bacteria | 642 |
| 551 | Ga0207678_10000581 | 3300026067 | Bacteria | 33440 |
| 552 | Ga0207678_10653937 | 3300026067 | Bacteria | 923 |
| 553 | Ga0207708_10146596 | 3300026075 | Bacteria | 1855 |
| 554 | Ga0207702_10222682 | 3300026078 | Unclassified | 1758 |
| 555 | Ga0207702_10565218 | 3300026078 | Unclassified | 1113 |
| 556 | Ga0207702_10910654 | 3300026078 | Unclassified | 871 |
| 557 | Ga0207702_11127990 | 3300026078 | Unclassified | 778 |
| 558 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 559 | Ga0207641_11301139 | 3300026088 | Unclassified | 727 |
| 560 | Ga0207641_12005734 | 3300026088 | Unclassified | 580 |
| 561 | Ga0207648_10003458 | 3300026089 | Bacteria | 16561 |
| 562 | Ga0207648_10220378 | 3300026089 | Bacteria | 1686 |
| 563 | Ga0207648_11946367 | 3300026089 | Unclassified | 549 |
| 564 | Ga0207676_10000252 | 3300026095 | Bacteria | 46432 |
| 565 | Ga0207676_10032451 | 3300026095 | Bacteria | 3935 |
| 566 | Ga0207676_12082278 | 3300026095 | Bacteria | 566 |
| 567 | Ga0207674_10000162 | 3300026116 | Bacteria | 79631 |
| 568 | Ga0207674_10085960 | 3300026116 | Bacteria | 3139 |
| 569 | Ga0207674_10244013 | 3300026116 | Bacteria | 1743 |
| 570 | Ga0207674_10766300 | 3300026116 | Unclassified | 931 |
| 571 | Ga0207675_100017450 | 3300026118 | Bacteria | 6700 |
| 572 | Ga0207683_10001306 | 3300026121 | Bacteria | 22515 |
| 573 | Ga0207683_10226238 | 3300026121 | Bacteria | 1705 |
| 574 | Ga0207683_10725175 | 3300026121 | Bacteria | 922 |
| 575 | Ga0207698_10290702 | 3300026142 | Unclassified | 1516 |
| 576 | Ga0207698_11759518 | 3300026142 | Unclassified | 635 |
| 577 | Ga0207698_12025110 | 3300026142 | Unclassified | 590 |
| 578 | Ga0209998_10046632 | 3300027717 | Bacteria | 995 |
| 579 | Ga0268266_10039280 | 3300028379 | Bacteria | 4031 |
| 580 | Ga0268266_10118698 | 3300028379 | Bacteria | 2351 |
| 581 | Ga0268266_11860746 | 3300028379 | Unclassified | 576 |
| 582 | Ga0268265_10004703 | 3300028380 | Bacteria | 9421 |
| 583 | Ga0268264_10050987 | 3300028381 | Bacteria | 3447 |
| 584 | Ga0268264_10107924 | 3300028381 | Bacteria | 2433 |
| 585 | Ga0268264_12591801 | 3300028381 | Unclassified | 512 |
| 586 | Ga0265338_10134304 | 3300028800 | Bacteria | 1948 |
| 587 | Ga0265338_11110356 | 3300028800 | Unclassified | 532 |
| 588 | Ga0265328_10039726 | 3300031239 | Bacteria | 1735 |
| 589 | Ga0265328_10323709 | 3300031239 | Unclassified | 598 |
| 590 | Ga0265325_10005290 | 3300031241 | Bacteria | 8000 |
| 591 | Ga0265325_10069646 | 3300031241 | Bacteria | 1768 |
| 592 | Ga0265325_10402463 | 3300031241 | Unclassified | 599 |
| 593 | Ga0265340_10030554 | 3300031247 | Unclassified | 2699 |
| 594 | Ga0265331_10009077 | 3300031250 | Bacteria | 5615 |
| 595 | Ga0265331_10040471 | 3300031250 | Unclassified | 2267 |
| 596 | Ga0265327_10054337 | 3300031251 | Bacteria | 2073 |
| 597 | Ga0265316_10023396 | 3300031344 | Bacteria | 5191 |
| 598 | Ga0265316_10068518 | 3300031344 | Bacteria | 2741 |
| 599 | Ga0265316_10147654 | 3300031344 | Bacteria | 1763 |
| 600 | Ga0265316_10740895 | 3300031344 | Unclassified | 691 |
| 601 | Ga0307408_100012830 | 3300031548 | Bacteria | 5558 |
| 602 | Ga0265313_10008949 | 3300031595 | Bacteria | 6569 |
| 603 | Ga0265314_10024067 | 3300031711 | Bacteria | 4626 |
| 604 | Ga0307405_10032987 | 3300031731 | Unclassified | 3067 |
| 605 | Ga0307405_10602317 | 3300031731 | Unclassified | 897 |
| 606 | Ga0307413_10175803 | 3300031824 | Bacteria | 1521 |
| 607 | Ga0307410_10004067 | 3300031852 | Bacteria | 7481 |
| 608 | Ga0307407_10030849 | 3300031903 | Bacteria | 2897 |
| 609 | Ga0307407_10857085 | 3300031903 | Unclassified | 695 |
| 610 | Ga0307412_10404596 | 3300031911 | Bacteria | 1112 |
| 611 | Ga0307409_100223561 | 3300031995 | Bacteria | 1701 |
| 612 | Ga0307416_100072666 | 3300032002 | Unclassified | 2864 |
| 613 | Ga0307416_100156122 | 3300032002 | Bacteria | 2101 |
| 614 | Ga0307416_100367833 | 3300032002 | Unclassified | 1463 |
| 615 | Ga0307414_10597790 | 3300032004 | Bacteria | 989 |
| 616 | Ga0307411_10006952 | 3300032005 | Bacteria | 5711 |
| 617 | Ga0307415_100273151 | 3300032126 | Bacteria | 1386 |
| 618 | Ga0307415_101457998 | 3300032126 | Bacteria | 653 |
| 619 | Ga0373950_0041607 | 3300034818 | Unclassified | 881 |
| 620 | Ga0373926_0002055 | 3300035083 | Bacteria | 6335 |
| 621 | Ga0373926_0121933 | 3300035083 | Unclassified | 983 |
| 622 | Ga0373934_0235300 | 3300035086 | Bacteria | 756 |
| 623 | Ga0373944_0023562 | 3300035089 | Bacteria | 1797 |
| 624 | Ga0373944_0114371 | 3300035089 | Unclassified | 924 |
| 625 | Ga0373923_0039536 | 3300035111 | Bacteria | 1938 |
| 626 | Ga0373923_0051294 | 3300035111 | Viruses | 1730 |
| 627 | Ga0373923_0095947 | 3300035111 | Bacteria | 1302 |
| 628 | Ga0373923_0111481 | 3300035111 | Bacteria | 1215 |
| 629 | Ga0373923_0212153 | 3300035111 | Bacteria | 898 |
| 630 | Ga0373936_0240612 | 3300035113 | Unclassified | 806 |
| 631 | Ga0373936_0506507 | 3300035113 | Unclassified | 562 |
| 632 | Ga0373936_0581361 | 3300035113 | Bacteria | 525 |
| 633 | Ga0373945_0001313 | 3300035116 | Bacteria | 7543 |
| 634 | Ga0373945_0322350 | 3300035116 | Bacteria | 665 |
| 635 | Ga0373956_0234414 | 3300035119 | Bacteria | 872 |
| 636 | Ga0373943_0006731 | 3300035170 | Bacteria | 5158 |
| 637 | Ga0373946_0012860 | 3300035171 | Bacteria | 3138 |
| 638 | Ga0373955_0013343 | 3300035172 | Bacteria | 3972 |
| 639 | Ga0373955_0324828 | 3300035172 | Bacteria | 930 |
| 640 | Ga0373955_1025560 | 3300035172 | Unclassified | 508 |
| 641 | Ga0373924_0000248 | 3300035410 | Bacteria | 16512 |
| 642 | Ga0373924_0142201 | 3300035410 | Bacteria | 1047 |
| 643 | Ga0373935_0003124 | 3300035692 | Bacteria | 9554 |
| 644 | Ga0373935_0034467 | 3300035692 | Bacteria | 3155 |
| 645 | Ga0373935_0048008 | 3300035692 | Bacteria | 2701 |
| 646 | Ga0373935_0096713 | 3300035692 | Bacteria | 1941 |
| 647 | Ga0373935_0398230 | 3300035692 | Unclassified | 988 |
| 648 | Ga0373935_0609527 | 3300035692 | Bacteria | 799 |
| 649 | Ga0373935_1408267 | 3300035692 | Unclassified | 521 |
| 650 | Ga0373935_1452802 | 3300035692 | Bacteria | 513 |
| 651 | Ga0373927_0079790 | 3300035695 | Bacteria | 2120 |
| 652 | Ga0373927_0080544 | 3300035695 | Bacteria | 2110 |
| 653 | Ga0373927_0316908 | 3300035695 | Unclassified | 1027 |
| 654 | Ga0373927_1115395 | 3300035695 | Unclassified | 520 |
| 655 | Ga0373933_0399813 | 3300035724 | Bacteria | 896 |
| 656 | Ga0373933_0664490 | 3300035724 | Unclassified | 685 |
| 657 | Ga0373933_0860179 | 3300035724 | Unclassified | 597 |
| 658 | Ga0373947_0017811 | 3300035725 | Unclassified | 4086 |
| 659 | Ga0373947_0028162 | 3300035725 | Bacteria | 3291 |
| 660 | Ga0373947_0122539 | 3300035725 | Bacteria | 1653 |
| 661 | Ga0373937_0000437 | 3300036401 | Bacteria | 38580 |
| 662 | Ga0373937_0072227 | 3300036401 | Unclassified | 3182 |
| 663 | Ga0373937_0173066 | 3300036401 | Bacteria | 2026 |
| 664 | Ga0373937_0197899 | 3300036401 | Bacteria | 1889 |
| 665 | Ga0373937_0455986 | 3300036401 | Unclassified | 1214 |
| 666 | Ga0373937_0638659 | 3300036401 | Unclassified | 1010 |
| 667 | Ga0373937_0641992 | 3300036401 | Unclassified | 1007 |
| 668 | Ga0373937_0680383 | 3300036401 | Bacteria | 975 |
| 669 | Ga0373937_1454142 | 3300036401 | Unclassified | 633 |
| 670 | Ga0373925_0005732 | 3300037068 | Bacteria | 9234 |
| 671 | Ga0373925_0043304 | 3300037068 | Bacteria | 3340 |
| 672 | Ga0373925_1008285 | 3300037068 | Bacteria | 685 |
| 673 | Ga0373925_1368167 | 3300037068 | Bacteria | 580 |
| 674 | Ga0373925_1720913 | 3300037068 | Unclassified | 512 |
| 675 | Ga0395900_0119579 | 3300037418 | Bacteria | 2704 |
| 676 | Ga0395898_0049727 | 3300037466 | Bacteria | 4107 |
| 677 | Ga0395898_0744507 | 3300037466 | Bacteria | 921 |
| 678 | Ga0395898_1511931 | 3300037466 | Unclassified | 597 |
| 679 | Ga0395898_1572946 | 3300037466 | Unclassified | 582 |
| 680 | Ga0395898_1676973 | 3300037466 | Bacteria | 559 |
| 681 | Ga0395901_1992297 | 3300038443 | Unclassified | 527 |
| 682 | Ga0436365_0163368 | 3300039437 | Bacteria | 1218 |
| 683 | Ga0436361_0488693 | 3300039447 | Bacteria | 1847 |
| 684 | Ga0436363_0501633 | 3300039450 | Unclassified | 3132 |
| 685 | Ga0436363_0882976 | 3300039450 | Bacteria | 732 |
| 686 | Ga0436363_0921361 | 3300039450 | Bacteria | 639 |
| 687 | Ga0436363_1608620 | 3300039450 | Bacteria | 2224 |
| 688 | Ga0436362_0763575 | 3300039453 | Viruses | 1587 |
| 689 | Ga0436362_0774876 | 3300039453 | Unclassified | 591 |
| 690 | Ga0451839_0856090 | 3300041496 | Unclassified | 898 |
| 691 | Ga0451577_0000054 | 3300042876 | Bacteria | 278798 |
| 692 | Ga0451577_0804712 | 3300042876 | Bacteria | 849 |
| 693 | Ga0451577_1068579 | 3300042876 | Bacteria | 723 |
| 694 | Ga0451577_1855001 | 3300042876 | Unclassified | 528 |
| 695 | Ga0453683_0003233 | 3300044673 | Bacteria | 12114 |
| 696 | Ga0453683_0203042 | 3300044673 | Bacteria | 1259 |
| 697 | Ga0466966_0306187 | 3300044684 | Bacteria | 955 |
| 698 | Ga0466966_0705261 | 3300044684 | Bacteria | 608 |
| 699 | Ga0466963_0017484 | 3300044694 | Unclassified | 4470 |
| 700 | Ga0453684_0000289 | 3300044712 | Bacteria | 215476 |
| 701 | Ga0453684_0219315 | 3300044712 | Bacteria | 2205 |
| 702 | Ga0453684_0527378 | 3300044712 | Bacteria | 1304 |
| 703 | Ga0453684_0640634 | 3300044712 | Bacteria | 1161 |
| 704 | Ga0453684_1515091 | 3300044712 | Bacteria | 691 |
| 705 | Ga0453684_2109050 | 3300044712 | Bacteria | 565 |
| 706 | Ga0466968_0434700 | 3300044735 | Bacteria | 647 |
| 707 | Ga0466968_0591980 | 3300044735 | Unclassified | 559 |
| 708 | Ga0466970_0735198 | 3300044765 | Bacteria | 576 |
| 709 | Ga0466957_0000065 | 3300044842 | Bacteria | 40207 |
| 710 | Ga0466957_0115257 | 3300044842 | Unclassified | 1708 |
| 711 | Ga0466957_0672916 | 3300044842 | Bacteria | 729 |
| 712 | Ga0466957_1257174 | 3300044842 | Bacteria | 537 |
| 713 | Ga0466959_0016961 | 3300045049 | Bacteria | 5331 |
| 714 | Ga0451576_0003350 | 3300045051 | Bacteria | 22194 |
| 715 | Ga0451576_0133045 | 3300045051 | Bacteria | 2592 |
| 716 | Ga0451576_0165179 | 3300045051 | Bacteria | 2310 |
| 717 | Ga0451576_0456697 | 3300045051 | Bacteria | 1341 |
| 718 | Ga0451576_0471208 | 3300045051 | Unclassified | 1319 |
| 719 | Ga0451576_2317614 | 3300045051 | Unclassified | 550 |
| 720 | Ga0451576_2617154 | 3300045051 | Bacteria | 514 |
| 721 | Ga0466967_0055328 | 3300045976 | Bacteria | 3495 |
| 722 | Ga0466967_0068117 | 3300045976 | Bacteria | 3177 |
| 723 | Ga0466967_0623768 | 3300045976 | Unclassified | 1065 |
| 724 | Ga0466967_1097650 | 3300045976 | Unclassified | 793 |
| 725 | Ga0466967_1784469 | 3300045976 | Unclassified | 612 |
| 726 | Ga0466967_2560717 | 3300045976 | Unclassified | 505 |
| 727 | Ga0495603_0547288 | 3300046455 | Unclassified | 663 |
| 728 | Ga0495651_0044034 | 3300046462 | Bacteria | 3460 |
| 729 | Ga0495651_0273510 | 3300046462 | Bacteria | 1144 |
| 730 | Ga0495651_0763501 | 3300046462 | Bacteria | 599 |
| 731 | Ga0495653_0680180 | 3300046463 | Unclassified | 626 |
| 732 | Ga0495580_0194241 | 3300046472 | Bacteria | 1399 |
| 733 | Ga0495580_0341787 | 3300046472 | Bacteria | 1015 |
| 734 | Ga0495580_0370711 | 3300046472 | Unclassified | 968 |
| 735 | Ga0495580_1023839 | 3300046472 | Unclassified | 525 |
| 736 | Ga0495582_0031880 | 3300046473 | Bacteria | 2898 |
| 737 | Ga0495582_0698873 | 3300046473 | Bacteria | 587 |
| 738 | Ga0495639_0446603 | 3300046475 | Unclassified | 656 |
| 739 | Ga0495664_0919595 | 3300046477 | Unclassified | 511 |
| 740 | Ga0495594_0836129 | 3300046499 | Unclassified | 518 |
| 741 | Ga0495608_0035097 | 3300046511 | Unclassified | 3384 |
| 742 | Ga0495618_0871673 | 3300046514 | Unclassified | 521 |
| 743 | Ga0495630_0063439 | 3300046517 | Bacteria | 2775 |
| 744 | Ga0495630_0609423 | 3300046517 | Bacteria | 837 |
| 745 | Ga0495643_0098609 | 3300046522 | Bacteria | 1500 |
| 746 | Ga0495642_0507901 | 3300046528 | Unclassified | 534 |
| 747 | Ga0495652_0136619 | 3300046529 | Bacteria | 1934 |
| 748 | Ga0495665_0014305 | 3300046531 | Unclassified | 4281 |
| 749 | Ga0495586_0160442 | 3300046535 | Bacteria | 1268 |
| 750 | Ga0495587_0787533 | 3300046536 | Bacteria | 519 |
| 751 | Ga0495667_0317686 | 3300046559 | Unclassified | 986 |
| 752 | Ga0495635_0031352 | 3300046663 | Unclassified | 3691 |
| 753 | Ga0495657_0077229 | 3300046675 | Bacteria | 2161 |
| 754 | Ga0495599_0692187 | 3300046678 | Unclassified | 588 |
| 755 | Ga0495623_0046319 | 3300046679 | Bacteria | 2761 |
| 756 | Ga0495669_0005788 | 3300046684 | Bacteria | 5156 |
| 757 | Ga0495669_0012701 | 3300046684 | Bacteria | 3586 |
| 758 | Ga0495669_0016894 | 3300046684 | Bacteria | 3130 |
| 759 | Ga0495669_0176818 | 3300046684 | Unclassified | 1016 |
| 760 | Ga0495670_0574543 | 3300046691 | Bacteria | 614 |
| 761 | Ga0495649_0005004 | 3300046694 | Bacteria | 8522 |
| 762 | Ga0495604_0148206 | 3300047317 | Unclassified | 1670 |
| 763 | Ga0495676_0968702 | 3300047321 | Unclassified | 544 |
| 764 | Ga0495687_066994 | 3300047443 | Bacteria | 1455 |
| 765 | Ga0495675_0200620 | 3300047444 | Unclassified | 1214 |
| 766 | Ga0495593_0409404 | 3300047673 | Unclassified | 678 |
| 767 | Ga0495602_0357183 | 3300048088 | Bacteria | 1053 |
| 768 | Ga0495614_0267159 | 3300048089 | Unclassified | 785 |
| 769 | Ga0495614_0499263 | 3300048089 | Unclassified | 579 |
| 770 | Ga0496101_0540257 | 3300048904 | Unclassified | 921 |
| 771 | Ga0496101_0830291 | 3300048904 | Unclassified | 728 |
| 772 | Ga0496102_0028897 | 3300048905 | Bacteria | 4956 |
| 773 | Ga0496102_0067618 | 3300048905 | Unclassified | 3278 |
| 774 | Ga0496102_0131043 | 3300048905 | Bacteria | 2347 |
| 775 | Ga0496102_0389044 | 3300048905 | Unclassified | 1312 |
| 776 | Ga0496102_0707015 | 3300048905 | Unclassified | 931 |
| 777 | Ga0496102_1564600 | 3300048905 | Unclassified | 578 |
| 778 | Ga0496103_0698399 | 3300048906 | Unclassified | 643 |
| 779 | Ga0496104_0258689 | 3300048907 | Bacteria | 1653 |
| 780 | Ga0496104_0273011 | 3300048907 | Bacteria | 1604 |
| 781 | Ga0496104_0363592 | 3300048907 | Bacteria | 1359 |
| 782 | Ga0496104_0503661 | 3300048907 | Bacteria | 1122 |
| 783 | Ga0496104_0993073 | 3300048907 | Bacteria | 743 |
| 784 | Ga0496105_0004526 | 3300048908 | Bacteria | 10474 |
| 785 | Ga0496105_0338256 | 3300048908 | Bacteria | 1204 |
| 786 | Ga0496105_0468113 | 3300048908 | Bacteria | 993 |
| 787 | Ga0496105_1178935 | 3300048908 | Bacteria | 565 |
| 788 | Ga0496106_0129013 | 3300048909 | Bacteria | 1982 |
| 789 | Ga0496106_0145797 | 3300048909 | Bacteria | 1865 |
| 790 | Ga0496107_0613047 | 3300048910 | Bacteria | 804 |
| 791 | Ga0496107_0980642 | 3300048910 | Unclassified | 614 |
| 792 | Ga0496107_1266857 | 3300048910 | Unclassified | 528 |
| 793 | Ga0496108_0000203 | 3300048911 | Bacteria | 54921 |
| 794 | Ga0496108_0086225 | 3300048911 | Bacteria | 2666 |
| 795 | Ga0496108_0238685 | 3300048911 | Bacteria | 1581 |
| 796 | Ga0496109_0000228 | 3300048912 | Bacteria | 54849 |
| 797 | Ga0496109_0031502 | 3300048912 | Bacteria | 4759 |
| 798 | Ga0496109_0738114 | 3300048912 | Bacteria | 922 |
| 799 | Ga0496109_0856969 | 3300048912 | Bacteria | 846 |
| 800 | Ga0496109_1594183 | 3300048912 | Bacteria | 587 |
| 801 | Ga0496110_0000145 | 3300048913 | Bacteria | 41800 |
| 802 | Ga0496110_0023501 | 3300048913 | Bacteria | 5244 |
| 803 | Ga0496110_0076017 | 3300048913 | Bacteria | 2985 |
| 804 | Ga0496110_0513892 | 3300048913 | Bacteria | 1090 |
| 805 | Ga0496111_0023585 | 3300048914 | Unclassified | 4321 |
| 806 | Ga0496111_0082490 | 3300048914 | Bacteria | 2348 |
| 807 | Ga0496111_0114010 | 3300048914 | Bacteria | 1992 |
| 808 | Ga0496112_0000048 | 3300048915 | Bacteria | 84789 |
| 809 | Ga0496112_0008072 | 3300048915 | Bacteria | 9398 |
| 810 | Ga0496112_0022754 | 3300048915 | Bacteria | 5979 |
| 811 | Ga0496112_0063880 | 3300048915 | Bacteria | 3632 |
| 812 | Ga0496112_0069992 | 3300048915 | Bacteria | 3466 |
| 813 | Ga0496112_0166680 | 3300048915 | Unclassified | 2169 |
| 814 | Ga0496112_0296451 | 3300048915 | Bacteria | 1563 |
| 815 | Ga0496112_0308663 | 3300048915 | Bacteria | 1527 |
| 816 | Ga0496112_0605349 | 3300048915 | Bacteria | 1027 |
| 817 | Ga0496112_1008330 | 3300048915 | Unclassified | 752 |
| 818 | Ga0496113_0000613 | 3300048916 | Bacteria | 17855 |
| 819 | Ga0496113_0002484 | 3300048916 | Bacteria | 10747 |
| 820 | Ga0496113_0160797 | 3300048916 | Bacteria | 1775 |
| 821 | Ga0496113_0384461 | 3300048916 | Bacteria | 1126 |
| 822 | Ga0496113_0395806 | 3300048916 | Bacteria | 1109 |
| 823 | Ga0496113_1026221 | 3300048916 | Bacteria | 649 |
| 824 | Ga0496115_0012247 | 3300048918 | Bacteria | 6451 |
| 825 | Ga0496115_0097678 | 3300048918 | Bacteria | 2405 |
| 826 | Ga0496115_1106422 | 3300048918 | Unclassified | 600 |
| 827 | Ga0496126_0342885 | 3300048929 | Bacteria | 1224 |
| 828 | Ga0501290_051396 | 3300049513 | Unclassified | 643 |
| 829 | Ga0501298_028735 | 3300049521 | Bacteria | 1080 |
| 830 | Ga0501048_1222433 | 3300049582 | Unclassified | 540 |
| 831 | Ga0501070_0763463 | 3300049586 | Bacteria | 761 |
| 832 | Ga0501073_0924941 | 3300049589 | Unclassified | 600 |
| 833 | Ga0501256_020613 | 3300049685 | Unclassified | 690 |
| 834 | Ga0501257_277804 | 3300049686 | Unclassified | 503 |
| 835 | Ga0501259_058031 | 3300049688 | Bacteria | 802 |
| 836 | Ga0501080_1068265 | 3300049742 | Bacteria | 698 |
| 837 | Ga0501283_018695 | 3300049779 | Bacteria | 1092 |
| 838 | nmdc:mga05p37_1213488_c1 | 3300050507 | Unclassified | 778 |
| 839 | nmdc:mga05p37_98700_c1 | 3300050507 | Bacteria | 3597 |
| 840 | nmdc:mga0n895_1332383_c1 | 3300050512 | Unclassified | 688 |
| 841 | nmdc:mga0n895_2270_c1 | 3300050512 | Bacteria | 14906 |
| 842 | nmdc:mga0rr50_402415_c1 | 3300050513 | Bacteria | 1156 |
| 843 | nmdc:mga0rr50_72_c1 | 3300050513 | Bacteria | 57900 |
| 844 | nmdc:mga08x19_1075_c1 | 3300050514 | Bacteria | 17044 |
| 845 | nmdc:mga08x19_195825_c1 | 3300050514 | Unclassified | 1384 |
| 846 | nmdc:mga08x19_6208_c1 | 3300050514 | Bacteria | 7067 |
| 847 | nmdc:mga0a205_3646_c1 | 3300050515 | Bacteria | 9724 |
| 848 | Ga0495601_0782841 | 3300053077 | Bacteria | 606 |
| 849 | Ga0495619_0292886 | 3300053085 | Bacteria | 1128 |
| 850 | Ga0501084_0545099 | 3300054114 | Bacteria | 980 |
| 851 | Ga0587079_063939 | 3300059647 | Bacteria | 804 |
| 852 | Ga0530510_0599699 | 3300061734 | Bacteria | 838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10438885 | Ga0070709_104388851 | 90 |
| 2 | 3300005435 | Ga0070714_100000183 | Ga0070714_10000018326 | 90 |
| 3 | 3300005435 | Ga0070714_100033971 | Ga0070714_1000339714 | 90 |
| 4 | 3300005435 | Ga0070714_100324820 | Ga0070714_1003248203 | 90 |
| 5 | 3300005435 | Ga0070714_100638205 | Ga0070714_1006382052 | 90 |
| 6 | 3300005436 | Ga0070713_100244038 | Ga0070713_1002440382 | 90 |
| 7 | 3300005436 | Ga0070713_101849992 | Ga0070713_1018499922 | 90 |
| 8 | 3300005437 | Ga0070710_10599149 | Ga0070710_105991491 | 90 |
| 9 | 3300005439 | Ga0070711_100044649 | Ga0070711_1000446492 | 90 |
| 10 | 3300005439 | Ga0070711_100391088 | Ga0070711_1003910882 | 90 |
| 11 | 3300005439 | Ga0070711_101244354 | Ga0070711_1012443541 | 90 |
| 12 | 3300005440 | Ga0070705_100024988 | Ga0070705_1000249882 | 90 |
| 13 | 3300005440 | Ga0070705_101056716 | Ga0070705_1010567161 | 90 |
| 14 | 3300005444 | Ga0070694_101684455 | Ga0070694_1016844551 | 90 |
| 15 | 3300005458 | Ga0070681_10233834 | Ga0070681_102338342 | 90 |
| 16 | 3300005614 | Ga0068856_100037749 | Ga0068856_1000377494 | 90 |
| 17 | 3300005614 | Ga0068856_100055186 | Ga0068856_1000551863 | 90 |
| 18 | 3300006028 | Ga0070717_10258786 | Ga0070717_102587862 | 90 |
| 19 | 3300006173 | Ga0070716_100726225 | Ga0070716_1007262252 | 90 |
| 20 | 3300006175 | Ga0070712_100962207 | Ga0070712_1009622072 | 90 |
| 21 | 3300006871 | Ga0075434_100000177 | Ga0075434_10000017727 | 90 |
| 22 | 3300006914 | Ga0075436_100007556 | Ga0075436_1000075565 | 90 |
| 23 | 3300007076 | Ga0075435_100000319 | Ga0075435_1000003198 | 90 |
| 24 | 3300009098 | Ga0105245_10906204 | Ga0105245_109062042 | 90 |
| 25 | 3300009147 | Ga0114129_10184786 | Ga0114129_101847862 | 90 |
| 26 | 3300009174 | Ga0105241_10535740 | Ga0105241_105357401 | 90 |
| 27 | 3300009174 | Ga0105241_11802192 | Ga0105241_118021921 | 90 |
| 28 | 3300009174 | Ga0105241_12640656 | Ga0105241_126406561 | 90 |
| 29 | 3300013100 | Ga0157373_10396401 | Ga0157373_103964012 | 90 |
| 30 | 3300013105 | Ga0157369_11436830 | Ga0157369_114368302 | 90 |
| 31 | 3300013307 | Ga0157372_10111529 | Ga0157372_101115294 | 90 |
| 32 | 3300014497 | Ga0182008_10847554 | Ga0182008_108475541 | 90 |
| 33 | 3300025915 | Ga0207693_10578518 | Ga0207693_105785182 | 90 |
| 34 | 3300050507 | nmdc:mga05p37_1213488_c1 | nmdc:mga05p37_1213488_c1_191_469 | 90 |
| 35 | 3300050512 | nmdc:mga0n895_2270_c1 | nmdc:mga0n895_2270_c1_6181_6459 | 90 |
| 36 | 3300050513 | nmdc:mga0rr50_72_c1 | nmdc:mga0rr50_72_c1_49224_49502 | 90 |
| 37 | 3300050514 | nmdc:mga08x19_1075_c1 | nmdc:mga08x19_1075_c1_4099_4377 | 90 |
| 38 | 3300050515 | nmdc:mga0a205_3646_c1 | nmdc:mga0a205_3646_c1_3471_3749 | 90 |
| 39 | 3300001976 | JGI24752J21851_1001100 | JGI24752J21851_10011005 | 91 |
| 40 | 3300001990 | JGI24737J22298_10167643 | JGI24737J22298_101676432 | 91 |
| 41 | 3300001991 | JGI24743J22301_10028888 | JGI24743J22301_100288883 | 91 |
| 42 | 3300002155 | JGI24033J26618_1019761 | JGI24033J26618_10197612 | 91 |
| 43 | 3300002239 | JGI24034J26672_10000337 | JGI24034J26672_100003376 | 91 |
| 44 | 3300002459 | JGI24751J29686_10000704 | JGI24751J29686_100007045 | 91 |
| 45 | 3300003316 | rootH1_10023707 | rootH1_100237073 | 91 |
| 46 | 3300004799 | Ga0058863_10023995 | Ga0058863_100239953 | 91 |
| 47 | 3300004803 | Ga0058862_12692804 | Ga0058862_126928041 | 91 |
| 48 | 3300005290 | Ga0065712_10077652 | Ga0065712_100776521 | 91 |
| 49 | 3300005293 | Ga0065715_10000987 | Ga0065715_100009872 | 91 |
| 50 | 3300005293 | Ga0065715_10688515 | Ga0065715_106885151 | 91 |
| 51 | 3300005295 | Ga0065707_10181797 | Ga0065707_101817971 | 91 |
| 52 | 3300005327 | Ga0070658_10026605 | Ga0070658_100266055 | 91 |
| 53 | 3300005327 | Ga0070658_10114778 | Ga0070658_101147784 | 91 |
| 54 | 3300005329 | Ga0070683_100034979 | Ga0070683_1000349793 | 91 |
| 55 | 3300005329 | Ga0070683_100538893 | Ga0070683_1005388933 | 91 |
| 56 | 3300005329 | Ga0070683_101864135 | Ga0070683_1018641351 | 91 |
| 57 | 3300005330 | Ga0070690_100168815 | Ga0070690_1001688151 | 91 |
| 58 | 3300005330 | Ga0070690_100455888 | Ga0070690_1004558881 | 91 |
| 59 | 3300005331 | Ga0070670_100368101 | Ga0070670_1003681012 | 91 |
| 60 | 3300005331 | Ga0070670_100654023 | Ga0070670_1006540232 | 91 |
| 61 | 3300005334 | Ga0068869_100419330 | Ga0068869_1004193303 | 91 |
| 62 | 3300005334 | Ga0068869_101052596 | Ga0068869_1010525961 | 91 |
| 63 | 3300005335 | Ga0070666_11021624 | Ga0070666_110216241 | 91 |
| 64 | 3300005336 | Ga0070680_100045686 | Ga0070680_1000456861 | 91 |
| 65 | 3300005336 | Ga0070680_100177835 | Ga0070680_1001778351 | 91 |
| 66 | 3300005336 | Ga0070680_100648246 | Ga0070680_1006482462 | 91 |
| 67 | 3300005336 | Ga0070680_100695121 | Ga0070680_1006951212 | 91 |
| 68 | 3300005336 | Ga0070680_100808497 | Ga0070680_1008084973 | 91 |
| 69 | 3300005336 | Ga0070680_101498247 | Ga0070680_1014982472 | 91 |
| 70 | 3300005337 | Ga0070682_100026601 | Ga0070682_1000266015 | 91 |
| 71 | 3300005337 | Ga0070682_100030142 | Ga0070682_1000301421 | 91 |
| 72 | 3300005337 | Ga0070682_100039509 | Ga0070682_1000395094 | 91 |
| 73 | 3300005338 | Ga0068868_100005847 | Ga0068868_1000058475 | 91 |
| 74 | 3300005338 | Ga0068868_100041733 | Ga0068868_1000417334 | 91 |
| 75 | 3300005338 | Ga0068868_101155308 | Ga0068868_1011553082 | 91 |
| 76 | 3300005338 | Ga0068868_101521471 | Ga0068868_1015214711 | 91 |
| 77 | 3300005339 | Ga0070660_100011892 | Ga0070660_1000118921 | 91 |
| 78 | 3300005339 | Ga0070660_100244417 | Ga0070660_1002444173 | 91 |
| 79 | 3300005340 | Ga0070689_100001794 | Ga0070689_1000017945 | 91 |
| 80 | 3300005343 | Ga0070687_100007106 | Ga0070687_1000071066 | 91 |
| 81 | 3300005344 | Ga0070661_100020981 | Ga0070661_1000209815 | 91 |
| 82 | 3300005344 | Ga0070661_100023061 | Ga0070661_1000230613 | 91 |
| 83 | 3300005344 | Ga0070661_100273787 | Ga0070661_1002737872 | 91 |
| 84 | 3300005344 | Ga0070661_100641995 | Ga0070661_1006419952 | 91 |
| 85 | 3300005344 | Ga0070661_101696074 | Ga0070661_1016960741 | 91 |
| 86 | 3300005345 | Ga0070692_10034365 | Ga0070692_100343652 | 91 |
| 87 | 3300005347 | Ga0070668_100196526 | Ga0070668_1001965262 | 91 |
| 88 | 3300005347 | Ga0070668_101521432 | Ga0070668_1015214322 | 91 |
| 89 | 3300005353 | Ga0070669_100009677 | Ga0070669_1000096775 | 91 |
| 90 | 3300005353 | Ga0070669_100657442 | Ga0070669_1006574423 | 91 |
| 91 | 3300005354 | Ga0070675_100127127 | Ga0070675_1001271273 | 91 |
| 92 | 3300005355 | Ga0070671_100032972 | Ga0070671_1000329725 | 91 |
| 93 | 3300005355 | Ga0070671_100257526 | Ga0070671_1002575262 | 91 |
| 94 | 3300005356 | Ga0070674_100014116 | Ga0070674_1000141165 | 91 |
| 95 | 3300005364 | Ga0070673_100017192 | Ga0070673_1000171926 | 91 |
| 96 | 3300005364 | Ga0070673_101536667 | Ga0070673_1015366672 | 91 |
| 97 | 3300005365 | Ga0070688_100002058 | Ga0070688_10000205810 | 91 |
| 98 | 3300005365 | Ga0070688_100366073 | Ga0070688_1003660733 | 91 |
| 99 | 3300005366 | Ga0070659_100024736 | Ga0070659_1000247366 | 91 |
| 100 | 3300005366 | Ga0070659_100436004 | Ga0070659_1004360043 | 91 |
| 101 | 3300005367 | Ga0070667_100180757 | Ga0070667_1001807573 | 91 |
| 102 | 3300005367 | Ga0070667_101620490 | Ga0070667_1016204901 | 91 |
| 103 | 3300005367 | Ga0070667_101876032 | Ga0070667_1018760322 | 91 |
| 104 | 3300005434 | Ga0070709_10218588 | Ga0070709_102185882 | 91 |
| 105 | 3300005434 | Ga0070709_10274308 | Ga0070709_102743083 | 91 |
| 106 | 3300005434 | Ga0070709_10680957 | Ga0070709_106809571 | 91 |
| 107 | 3300005434 | Ga0070709_10686462 | Ga0070709_106864621 | 91 |
| 108 | 3300005434 | Ga0070709_10927770 | Ga0070709_109277701 | 91 |
| 109 | 3300005434 | Ga0070709_11233883 | Ga0070709_112338831 | 91 |
| 110 | 3300005435 | Ga0070714_100061176 | Ga0070714_1000611763 | 91 |
| 111 | 3300005435 | Ga0070714_100272918 | Ga0070714_1002729182 | 91 |
| 112 | 3300005435 | Ga0070714_100792017 | Ga0070714_1007920172 | 91 |
| 113 | 3300005435 | Ga0070714_100899996 | Ga0070714_1008999962 | 91 |
| 114 | 3300005435 | Ga0070714_100973984 | Ga0070714_1009739842 | 91 |
| 115 | 3300005435 | Ga0070714_101117163 | Ga0070714_1011171631 | 91 |
| 116 | 3300005435 | Ga0070714_101499549 | Ga0070714_1014995491 | 91 |
| 117 | 3300005435 | Ga0070714_101981096 | Ga0070714_1019810961 | 91 |
| 118 | 3300005436 | Ga0070713_100023609 | Ga0070713_1000236094 | 91 |
| 119 | 3300005436 | Ga0070713_100028256 | Ga0070713_1000282564 | 91 |
| 120 | 3300005436 | Ga0070713_100069129 | Ga0070713_1000691293 | 91 |
| 121 | 3300005436 | Ga0070713_100717377 | Ga0070713_1007173771 | 91 |
| 122 | 3300005436 | Ga0070713_100836188 | Ga0070713_1008361882 | 91 |
| 123 | 3300005436 | Ga0070713_100951760 | Ga0070713_1009517601 | 91 |
| 124 | 3300005436 | Ga0070713_101753220 | Ga0070713_1017532201 | 91 |
| 125 | 3300005436 | Ga0070713_101928915 | Ga0070713_1019289151 | 91 |
| 126 | 3300005437 | Ga0070710_10061816 | Ga0070710_100618163 | 91 |
| 127 | 3300005437 | Ga0070710_10210269 | Ga0070710_102102692 | 91 |
| 128 | 3300005437 | Ga0070710_10515526 | Ga0070710_105155261 | 91 |
| 129 | 3300005437 | Ga0070710_10914061 | Ga0070710_109140611 | 91 |
| 130 | 3300005437 | Ga0070710_11020633 | Ga0070710_110206331 | 91 |
| 131 | 3300005437 | Ga0070710_11389211 | Ga0070710_113892112 | 91 |
| 132 | 3300005439 | Ga0070711_100324674 | Ga0070711_1003246741 | 91 |
| 133 | 3300005439 | Ga0070711_100350117 | Ga0070711_1003501172 | 91 |
| 134 | 3300005441 | Ga0070700_100072700 | Ga0070700_1000727002 | 91 |
| 135 | 3300005444 | Ga0070694_100336848 | Ga0070694_1003368481 | 91 |
| 136 | 3300005455 | Ga0070663_100064452 | Ga0070663_1000644522 | 91 |
| 137 | 3300005456 | Ga0070678_100616350 | Ga0070678_1006163503 | 91 |
| 138 | 3300005457 | Ga0070662_100360555 | Ga0070662_1003605553 | 91 |
| 139 | 3300005458 | Ga0070681_10028494 | Ga0070681_100284949 | 91 |
| 140 | 3300005458 | Ga0070681_10063281 | Ga0070681_100632813 | 91 |
| 141 | 3300005458 | Ga0070681_10064405 | Ga0070681_100644053 | 91 |
| 142 | 3300005458 | Ga0070681_10310418 | Ga0070681_103104184 | 91 |
| 143 | 3300005458 | Ga0070681_10417526 | Ga0070681_104175261 | 91 |
| 144 | 3300005458 | Ga0070681_10736551 | Ga0070681_107365511 | 91 |
| 145 | 3300005458 | Ga0070681_10870980 | Ga0070681_108709802 | 91 |
| 146 | 3300005458 | Ga0070681_11150165 | Ga0070681_111501652 | 91 |
| 147 | 3300005459 | Ga0068867_100082865 | Ga0068867_1000828651 | 91 |
| 148 | 3300005466 | Ga0070685_10004126 | Ga0070685_100041265 | 91 |
| 149 | 3300005468 | Ga0070707_100082687 | Ga0070707_1000826873 | 91 |
| 150 | 3300005468 | Ga0070707_101166073 | Ga0070707_1011660731 | 91 |
| 151 | 3300005530 | Ga0070679_100009060 | Ga0070679_1000090601 | 91 |
| 152 | 3300005530 | Ga0070679_100041797 | Ga0070679_1000417977 | 91 |
| 153 | 3300005530 | Ga0070679_100049113 | Ga0070679_1000491131 | 91 |
| 154 | 3300005530 | Ga0070679_100281193 | Ga0070679_1002811932 | 91 |
| 155 | 3300005530 | Ga0070679_100347177 | Ga0070679_1003471772 | 91 |
| 156 | 3300005530 | Ga0070679_100487258 | Ga0070679_1004872582 | 91 |
| 157 | 3300005530 | Ga0070679_100517925 | Ga0070679_1005179252 | 91 |
| 158 | 3300005530 | Ga0070679_100699335 | Ga0070679_1006993352 | 91 |
| 159 | 3300005530 | Ga0070679_101583193 | Ga0070679_1015831932 | 91 |
| 160 | 3300005530 | Ga0070679_102189212 | Ga0070679_1021892122 | 91 |
| 161 | 3300005535 | Ga0070684_100002682 | Ga0070684_1000026825 | 91 |
| 162 | 3300005535 | Ga0070684_100054714 | Ga0070684_1000547142 | 91 |
| 163 | 3300005535 | Ga0070684_100101202 | Ga0070684_1001012022 | 91 |
| 164 | 3300005535 | Ga0070684_100253904 | Ga0070684_1002539041 | 91 |
| 165 | 3300005535 | Ga0070684_101364374 | Ga0070684_1013643741 | 91 |
| 166 | 3300005536 | Ga0070697_100006153 | Ga0070697_1000061535 | 91 |
| 167 | 3300005539 | Ga0068853_100016340 | Ga0068853_1000163405 | 91 |
| 168 | 3300005539 | Ga0068853_100197807 | Ga0068853_1001978072 | 91 |
| 169 | 3300005539 | Ga0068853_100276794 | Ga0068853_1002767943 | 91 |
| 170 | 3300005539 | Ga0068853_100604842 | Ga0068853_1006048422 | 91 |
| 171 | 3300005539 | Ga0068853_100976563 | Ga0068853_1009765632 | 91 |
| 172 | 3300005539 | Ga0068853_102474951 | Ga0068853_1024749511 | 91 |
| 173 | 3300005543 | Ga0070672_100003745 | Ga0070672_1000037452 | 91 |
| 174 | 3300005544 | Ga0070686_100485333 | Ga0070686_1004853332 | 91 |
| 175 | 3300005544 | Ga0070686_100610841 | Ga0070686_1006108411 | 91 |
| 176 | 3300005545 | Ga0070695_100848135 | Ga0070695_1008481352 | 91 |
| 177 | 3300005546 | Ga0070696_100112546 | Ga0070696_1001125462 | 91 |
| 178 | 3300005546 | Ga0070696_100551268 | Ga0070696_1005512682 | 91 |
| 179 | 3300005547 | Ga0070693_100105611 | Ga0070693_1001056112 | 91 |
| 180 | 3300005547 | Ga0070693_100162884 | Ga0070693_1001628842 | 91 |
| 181 | 3300005547 | Ga0070693_100172870 | Ga0070693_1001728701 | 91 |
| 182 | 3300005548 | Ga0070665_100018649 | Ga0070665_1000186493 | 91 |
| 183 | 3300005548 | Ga0070665_101383046 | Ga0070665_1013830461 | 91 |
| 184 | 3300005549 | Ga0070704_102064699 | Ga0070704_1020646991 | 91 |
| 185 | 3300005563 | Ga0068855_100020077 | Ga0068855_1000200777 | 91 |
| 186 | 3300005563 | Ga0068855_100152904 | Ga0068855_1001529043 | 91 |
| 187 | 3300005563 | Ga0068855_100222770 | Ga0068855_1002227703 | 91 |
| 188 | 3300005563 | Ga0068855_100355651 | Ga0068855_1003556514 | 91 |
| 189 | 3300005563 | Ga0068855_100657991 | Ga0068855_1006579912 | 91 |
| 190 | 3300005563 | Ga0068855_100682325 | Ga0068855_1006823251 | 91 |
| 191 | 3300005564 | Ga0070664_100143608 | Ga0070664_1001436081 | 91 |
| 192 | 3300005564 | Ga0070664_100220385 | Ga0070664_1002203852 | 91 |
| 193 | 3300005564 | Ga0070664_100229022 | Ga0070664_1002290222 | 91 |
| 194 | 3300005564 | Ga0070664_100783958 | Ga0070664_1007839582 | 91 |
| 195 | 3300005577 | Ga0068857_100003337 | Ga0068857_10000333711 | 91 |
| 196 | 3300005577 | Ga0068857_100072067 | Ga0068857_1000720676 | 91 |
| 197 | 3300005577 | Ga0068857_100258031 | Ga0068857_1002580311 | 91 |
| 198 | 3300005577 | Ga0068857_100931540 | Ga0068857_1009315401 | 91 |
| 199 | 3300005577 | Ga0068857_100990387 | Ga0068857_1009903873 | 91 |
| 200 | 3300005577 | Ga0068857_101100468 | Ga0068857_1011004682 | 91 |
| 201 | 3300005578 | Ga0068854_100004220 | Ga0068854_1000042205 | 91 |
| 202 | 3300005578 | Ga0068854_101256651 | Ga0068854_1012566512 | 91 |
| 203 | 3300005578 | Ga0068854_101655987 | Ga0068854_1016559872 | 91 |
| 204 | 3300005578 | Ga0068854_101707364 | Ga0068854_1017073641 | 91 |
| 205 | 3300005614 | Ga0068856_100027595 | Ga0068856_1000275956 | 91 |
| 206 | 3300005614 | Ga0068856_100041407 | Ga0068856_1000414075 | 91 |
| 207 | 3300005614 | Ga0068856_100151650 | Ga0068856_1001516502 | 91 |
| 208 | 3300005614 | Ga0068856_100559022 | Ga0068856_1005590221 | 91 |
| 209 | 3300005614 | Ga0068856_100972854 | Ga0068856_1009728542 | 91 |
| 210 | 3300005614 | Ga0068856_101235390 | Ga0068856_1012353902 | 91 |
| 211 | 3300005614 | Ga0068856_101644074 | Ga0068856_1016440741 | 91 |
| 212 | 3300005614 | Ga0068856_101698318 | Ga0068856_1016983181 | 91 |
| 213 | 3300005615 | Ga0070702_100398975 | Ga0070702_1003989752 | 91 |
| 214 | 3300005615 | Ga0070702_100934224 | Ga0070702_1009342242 | 91 |
| 215 | 3300005616 | Ga0068852_100079181 | Ga0068852_1000791811 | 91 |
| 216 | 3300005616 | Ga0068852_102315881 | Ga0068852_1023158812 | 91 |
| 217 | 3300005616 | Ga0068852_102783593 | Ga0068852_1027835931 | 91 |
| 218 | 3300005618 | Ga0068864_100032295 | Ga0068864_1000322952 | 91 |
| 219 | 3300005618 | Ga0068864_100193489 | Ga0068864_1001934892 | 91 |
| 220 | 3300005618 | Ga0068864_100823976 | Ga0068864_1008239761 | 91 |
| 221 | 3300005618 | Ga0068864_100925747 | Ga0068864_1009257472 | 91 |
| 222 | 3300005618 | Ga0068864_102359504 | Ga0068864_1023595041 | 91 |
| 223 | 3300005718 | Ga0068866_10009998 | Ga0068866_100099983 | 91 |
| 224 | 3300005718 | Ga0068866_10514773 | Ga0068866_105147732 | 91 |
| 225 | 3300005719 | Ga0068861_100009849 | Ga0068861_1000098494 | 91 |
| 226 | 3300005840 | Ga0068870_10000935 | Ga0068870_100009355 | 91 |
| 227 | 3300005841 | Ga0068863_100023970 | Ga0068863_1000239702 | 91 |
| 228 | 3300005841 | Ga0068863_100068107 | Ga0068863_1000681073 | 91 |
| 229 | 3300005841 | Ga0068863_100306705 | Ga0068863_1003067053 | 91 |
| 230 | 3300005841 | Ga0068863_101960798 | Ga0068863_1019607982 | 91 |
| 231 | 3300005841 | Ga0068863_102037876 | Ga0068863_1020378761 | 91 |
| 232 | 3300005842 | Ga0068858_100249002 | Ga0068858_1002490023 | 91 |
| 233 | 3300005843 | Ga0068860_100089866 | Ga0068860_1000898665 | 91 |
| 234 | 3300005843 | Ga0068860_100091141 | Ga0068860_1000911412 | 91 |
| 235 | 3300005843 | Ga0068860_100258050 | Ga0068860_1002580502 | 91 |
| 236 | 3300005983 | Ga0081540_1011430 | Ga0081540_10114303 | 91 |
| 237 | 3300006028 | Ga0070717_10035619 | Ga0070717_100356193 | 91 |
| 238 | 3300006028 | Ga0070717_10086596 | Ga0070717_100865964 | 91 |
| 239 | 3300006028 | Ga0070717_10177409 | Ga0070717_101774092 | 91 |
| 240 | 3300006028 | Ga0070717_10993567 | Ga0070717_109935672 | 91 |
| 241 | 3300006028 | Ga0070717_11342150 | Ga0070717_113421502 | 91 |
| 242 | 3300006028 | Ga0070717_11844966 | Ga0070717_118449661 | 91 |
| 243 | 3300006163 | Ga0070715_10194927 | Ga0070715_101949271 | 91 |
| 244 | 3300006173 | Ga0070716_100046340 | Ga0070716_1000463403 | 91 |
| 245 | 3300006173 | Ga0070716_100188529 | Ga0070716_1001885291 | 91 |
| 246 | 3300006173 | Ga0070716_100475554 | Ga0070716_1004755542 | 91 |
| 247 | 3300006173 | Ga0070716_100599980 | Ga0070716_1005999802 | 91 |
| 248 | 3300006173 | Ga0070716_101223739 | Ga0070716_1012237391 | 91 |
| 249 | 3300006175 | Ga0070712_100261165 | Ga0070712_1002611652 | 91 |
| 250 | 3300006175 | Ga0070712_100375156 | Ga0070712_1003751563 | 91 |
| 251 | 3300006175 | Ga0070712_100433466 | Ga0070712_1004334661 | 91 |
| 252 | 3300006175 | Ga0070712_100734140 | Ga0070712_1007341401 | 91 |
| 253 | 3300006175 | Ga0070712_101476121 | Ga0070712_1014761212 | 91 |
| 254 | 3300006237 | Ga0097621_100000484 | Ga0097621_1000004843 | 91 |
| 255 | 3300006237 | Ga0097621_100410450 | Ga0097621_1004104502 | 91 |
| 256 | 3300006237 | Ga0097621_100799368 | Ga0097621_1007993681 | 91 |
| 257 | 3300006237 | Ga0097621_101190384 | Ga0097621_1011903842 | 91 |
| 258 | 3300006358 | Ga0068871_100005759 | Ga0068871_1000057593 | 91 |
| 259 | 3300006358 | Ga0068871_100155849 | Ga0068871_1001558494 | 91 |
| 260 | 3300006358 | Ga0068871_101718241 | Ga0068871_1017182411 | 91 |
| 261 | 3300006852 | Ga0075433_10835213 | Ga0075433_108352131 | 91 |
| 262 | 3300006871 | Ga0075434_100980254 | Ga0075434_1009802542 | 91 |
| 263 | 3300006881 | Ga0068865_100215811 | Ga0068865_1002158112 | 91 |
| 264 | 3300006914 | Ga0075436_100015125 | Ga0075436_1000151256 | 91 |
| 265 | 3300006914 | Ga0075436_100100656 | Ga0075436_1001006561 | 91 |
| 266 | 3300006914 | Ga0075436_100167646 | Ga0075436_1001676462 | 91 |
| 267 | 3300006914 | Ga0075436_100652049 | Ga0075436_1006520491 | 91 |
| 268 | 3300006931 | Ga0097620_100981155 | Ga0097620_1009811551 | 91 |
| 269 | 3300007076 | Ga0075435_100214588 | Ga0075435_1002145883 | 91 |
| 270 | 3300007076 | Ga0075435_100792877 | Ga0075435_1007928772 | 91 |
| 271 | 3300009092 | Ga0105250_10009360 | Ga0105250_100093604 | 91 |
| 272 | 3300009092 | Ga0105250_10514357 | Ga0105250_105143572 | 91 |
| 273 | 3300009093 | Ga0105240_10036492 | Ga0105240_100364922 | 91 |
| 274 | 3300009093 | Ga0105240_10037121 | Ga0105240_100371213 | 91 |
| 275 | 3300009093 | Ga0105240_10349489 | Ga0105240_103494891 | 91 |
| 276 | 3300009093 | Ga0105240_10670948 | Ga0105240_106709481 | 91 |
| 277 | 3300009093 | Ga0105240_10767800 | Ga0105240_107678001 | 91 |
| 278 | 3300009093 | Ga0105240_11012617 | Ga0105240_110126172 | 91 |
| 279 | 3300009093 | Ga0105240_11453900 | Ga0105240_114539001 | 91 |
| 280 | 3300009093 | Ga0105240_11887384 | Ga0105240_118873841 | 91 |
| 281 | 3300009093 | Ga0105240_11952947 | Ga0105240_119529471 | 91 |
| 282 | 3300009093 | Ga0105240_12195018 | Ga0105240_121950181 | 91 |
| 283 | 3300009098 | Ga0105245_10003145 | Ga0105245_1000314511 | 91 |
| 284 | 3300009098 | Ga0105245_10007043 | Ga0105245_100070435 | 91 |
| 285 | 3300009098 | Ga0105245_10041692 | Ga0105245_100416924 | 91 |
| 286 | 3300009098 | Ga0105245_10192516 | Ga0105245_101925163 | 91 |
| 287 | 3300009098 | Ga0105245_10471270 | Ga0105245_104712702 | 91 |
| 288 | 3300009101 | Ga0105247_10001507 | Ga0105247_1000150712 | 91 |
| 289 | 3300009148 | Ga0105243_10447461 | Ga0105243_104474612 | 91 |
| 290 | 3300009174 | Ga0105241_10019278 | Ga0105241_100192785 | 91 |
| 291 | 3300009174 | Ga0105241_10071374 | Ga0105241_100713743 | 91 |
| 292 | 3300009174 | Ga0105241_10273184 | Ga0105241_102731842 | 91 |
| 293 | 3300009174 | Ga0105241_10401991 | Ga0105241_104019912 | 91 |
| 294 | 3300009174 | Ga0105241_10896387 | Ga0105241_108963872 | 91 |
| 295 | 3300009174 | Ga0105241_11078040 | Ga0105241_110780401 | 91 |
| 296 | 3300009176 | Ga0105242_10016443 | Ga0105242_100164435 | 91 |
| 297 | 3300009176 | Ga0105242_10053867 | Ga0105242_100538675 | 91 |
| 298 | 3300009177 | Ga0105248_10074434 | Ga0105248_100744344 | 91 |
| 299 | 3300009177 | Ga0105248_10171911 | Ga0105248_101719112 | 91 |
| 300 | 3300009177 | Ga0105248_10220359 | Ga0105248_102203592 | 91 |
| 301 | 3300009177 | Ga0105248_10447047 | Ga0105248_104470471 | 91 |
| 302 | 3300009177 | Ga0105248_10452143 | Ga0105248_104521431 | 91 |
| 303 | 3300009177 | Ga0105248_10679601 | Ga0105248_106796012 | 91 |
| 304 | 3300009545 | Ga0105237_10053790 | Ga0105237_100537903 | 91 |
| 305 | 3300009545 | Ga0105237_10592128 | Ga0105237_105921282 | 91 |
| 306 | 3300009545 | Ga0105237_10744921 | Ga0105237_107449213 | 91 |
| 307 | 3300009545 | Ga0105237_11447883 | Ga0105237_114478832 | 91 |
| 308 | 3300009551 | Ga0105238_10016655 | Ga0105238_100166555 | 91 |
| 309 | 3300009551 | Ga0105238_10022654 | Ga0105238_100226547 | 91 |
| 310 | 3300009551 | Ga0105238_10137453 | Ga0105238_101374531 | 91 |
| 311 | 3300009551 | Ga0105238_10294358 | Ga0105238_102943582 | 91 |
| 312 | 3300009551 | Ga0105238_10480988 | Ga0105238_104809883 | 91 |
| 313 | 3300009551 | Ga0105238_10556099 | Ga0105238_105560992 | 91 |
| 314 | 3300009551 | Ga0105238_10921055 | Ga0105238_109210553 | 91 |
| 315 | 3300009551 | Ga0105238_11013972 | Ga0105238_110139721 | 91 |
| 316 | 3300009551 | Ga0105238_11792211 | Ga0105238_117922111 | 91 |
| 317 | 3300009551 | Ga0105238_12056725 | Ga0105238_120567251 | 91 |
| 318 | 3300009551 | Ga0105238_12060705 | Ga0105238_120607052 | 91 |
| 319 | 3300009551 | Ga0105238_12546412 | Ga0105238_125464122 | 91 |
| 320 | 3300009553 | Ga0105249_10112207 | Ga0105249_101122073 | 91 |
| 321 | 3300010159 | Ga0099796_10042002 | Ga0099796_100420022 | 91 |
| 322 | 3300010375 | Ga0105239_10005962 | Ga0105239_1000596214 | 91 |
| 323 | 3300010375 | Ga0105239_10086301 | Ga0105239_100863014 | 91 |
| 324 | 3300010375 | Ga0105239_10323194 | Ga0105239_103231943 | 91 |
| 325 | 3300010375 | Ga0105239_10808630 | Ga0105239_108086303 | 91 |
| 326 | 3300010375 | Ga0105239_11395350 | Ga0105239_113953501 | 91 |
| 327 | 3300010375 | Ga0105239_11934011 | Ga0105239_119340112 | 91 |
| 328 | 3300010375 | Ga0105239_13302566 | Ga0105239_133025661 | 91 |
| 329 | 3300011119 | Ga0105246_10001854 | Ga0105246_100018545 | 91 |
| 330 | 3300011119 | Ga0105246_11616123 | Ga0105246_116161232 | 91 |
| 331 | 3300013100 | Ga0157373_10001119 | Ga0157373_100011195 | 91 |
| 332 | 3300013100 | Ga0157373_10031848 | Ga0157373_100318484 | 91 |
| 333 | 3300013100 | Ga0157373_10729658 | Ga0157373_107296581 | 91 |
| 334 | 3300013102 | Ga0157371_10005666 | Ga0157371_100056663 | 91 |
| 335 | 3300013102 | Ga0157371_10701612 | Ga0157371_107016122 | 91 |
| 336 | 3300013104 | Ga0157370_10164565 | Ga0157370_101645653 | 91 |
| 337 | 3300013104 | Ga0157370_11990995 | Ga0157370_119909952 | 91 |
| 338 | 3300013105 | Ga0157369_10001345 | Ga0157369_100013455 | 91 |
| 339 | 3300013105 | Ga0157369_10035084 | Ga0157369_100350842 | 91 |
| 340 | 3300013105 | Ga0157369_10038299 | Ga0157369_100382995 | 91 |
| 341 | 3300013105 | Ga0157369_10052365 | Ga0157369_100523654 | 91 |
| 342 | 3300013105 | Ga0157369_10147636 | Ga0157369_101476364 | 91 |
| 343 | 3300013105 | Ga0157369_10498082 | Ga0157369_104980823 | 91 |
| 344 | 3300013105 | Ga0157369_10585526 | Ga0157369_105855262 | 91 |
| 345 | 3300013105 | Ga0157369_10751627 | Ga0157369_107516271 | 91 |
| 346 | 3300013105 | Ga0157369_11238855 | Ga0157369_112388552 | 91 |
| 347 | 3300013105 | Ga0157369_11311606 | Ga0157369_113116062 | 91 |
| 348 | 3300013105 | Ga0157369_12259641 | Ga0157369_122596411 | 91 |
| 349 | 3300013105 | Ga0157369_12263761 | Ga0157369_122637611 | 91 |
| 350 | 3300013296 | Ga0157374_10011069 | Ga0157374_100110695 | 91 |
| 351 | 3300013296 | Ga0157374_10026177 | Ga0157374_100261774 | 91 |
| 352 | 3300013296 | Ga0157374_10033131 | Ga0157374_100331314 | 91 |
| 353 | 3300013296 | Ga0157374_10058122 | Ga0157374_100581222 | 91 |
| 354 | 3300013296 | Ga0157374_10093053 | Ga0157374_100930532 | 91 |
| 355 | 3300013296 | Ga0157374_10163595 | Ga0157374_101635954 | 91 |
| 356 | 3300013296 | Ga0157374_10283774 | Ga0157374_102837741 | 91 |
| 357 | 3300013296 | Ga0157374_10719607 | Ga0157374_107196071 | 91 |
| 358 | 3300013297 | Ga0157378_10000145 | Ga0157378_1000014529 | 91 |
| 359 | 3300013297 | Ga0157378_10397411 | Ga0157378_103974113 | 91 |
| 360 | 3300013297 | Ga0157378_10739562 | Ga0157378_107395622 | 91 |
| 361 | 3300013297 | Ga0157378_11452698 | Ga0157378_114526981 | 91 |
| 362 | 3300013306 | Ga0163162_10087570 | Ga0163162_100875703 | 91 |
| 363 | 3300013306 | Ga0163162_10206352 | Ga0163162_102063523 | 91 |
| 364 | 3300013306 | Ga0163162_12193052 | Ga0163162_121930521 | 91 |
| 365 | 3300013307 | Ga0157372_10008298 | Ga0157372_100082988 | 91 |
| 366 | 3300013307 | Ga0157372_10033302 | Ga0157372_100333028 | 91 |
| 367 | 3300013307 | Ga0157372_10116160 | Ga0157372_101161604 | 91 |
| 368 | 3300013307 | Ga0157372_10215434 | Ga0157372_102154342 | 91 |
| 369 | 3300013307 | Ga0157372_10353409 | Ga0157372_103534092 | 91 |
| 370 | 3300013308 | Ga0157375_13167096 | Ga0157375_131670961 | 91 |
| 371 | 3300014325 | Ga0163163_10025274 | Ga0163163_100252743 | 91 |
| 372 | 3300014325 | Ga0163163_10059974 | Ga0163163_100599743 | 91 |
| 373 | 3300014325 | Ga0163163_10149055 | Ga0163163_101490554 | 91 |
| 374 | 3300014325 | Ga0163163_10762080 | Ga0163163_107620801 | 91 |
| 375 | 3300014497 | Ga0182008_10626640 | Ga0182008_106266401 | 91 |
| 376 | 3300014745 | Ga0157377_10007969 | Ga0157377_100079695 | 91 |
| 377 | 3300014968 | Ga0157379_10060793 | Ga0157379_100607933 | 91 |
| 378 | 3300014968 | Ga0157379_10428888 | Ga0157379_104288882 | 91 |
| 379 | 3300014969 | Ga0157376_10031084 | Ga0157376_100310843 | 91 |
| 380 | 3300014969 | Ga0157376_10452452 | Ga0157376_104524521 | 91 |
| 381 | 3300014969 | Ga0157376_11597902 | Ga0157376_115979022 | 91 |
| 382 | 3300015261 | Ga0182006_1019925 | Ga0182006_10199252 | 91 |
| 383 | 3300015262 | Ga0182007_10002409 | Ga0182007_100024096 | 91 |
| 384 | 3300017792 | Ga0163161_10103478 | Ga0163161_101034781 | 91 |
| 385 | 3300020070 | Ga0206356_10207189 | Ga0206356_102071893 | 91 |
| 386 | 3300020076 | Ga0206355_1512251 | Ga0206355_15122512 | 91 |
| 387 | 3300020077 | Ga0206351_10464849 | Ga0206351_104648491 | 91 |
| 388 | 3300020078 | Ga0206352_10895603 | Ga0206352_108956031 | 91 |
| 389 | 3300020080 | Ga0206350_11534362 | Ga0206350_115343621 | 91 |
| 390 | 3300020610 | Ga0154015_1279385 | Ga0154015_12793853 | 91 |
| 391 | 3300021358 | Ga0213873_10042379 | Ga0213873_100423792 | 91 |
| 392 | 3300021377 | Ga0213874_10086069 | Ga0213874_100860691 | 91 |
| 393 | 3300022467 | Ga0224712_10070837 | Ga0224712_100708372 | 91 |
| 394 | 3300025290 | Ga0207673_1021856 | Ga0207673_10218562 | 91 |
| 395 | 3300025302 | Ga0207426_1137607 | Ga0207426_11376072 | 91 |
| 396 | 3300025315 | Ga0207697_10012379 | Ga0207697_100123794 | 91 |
| 397 | 3300025711 | Ga0207696_1041015 | Ga0207696_10410152 | 91 |
| 398 | 3300025893 | Ga0207682_10091581 | Ga0207682_100915812 | 91 |
| 399 | 3300025898 | Ga0207692_10023063 | Ga0207692_100230632 | 91 |
| 400 | 3300025898 | Ga0207692_10072310 | Ga0207692_100723102 | 91 |
| 401 | 3300025898 | Ga0207692_10175590 | Ga0207692_101755902 | 91 |
| 402 | 3300025898 | Ga0207692_10218755 | Ga0207692_102187553 | 91 |
| 403 | 3300025898 | Ga0207692_10732721 | Ga0207692_107327211 | 91 |
| 404 | 3300025899 | Ga0207642_10101305 | Ga0207642_101013051 | 91 |
| 405 | 3300025899 | Ga0207642_10427703 | Ga0207642_104277032 | 91 |
| 406 | 3300025900 | Ga0207710_10211733 | Ga0207710_102117332 | 91 |
| 407 | 3300025900 | Ga0207710_10487651 | Ga0207710_104876512 | 91 |
| 408 | 3300025901 | Ga0207688_10003069 | Ga0207688_100030695 | 91 |
| 409 | 3300025903 | Ga0207680_10195855 | Ga0207680_101958552 | 91 |
| 410 | 3300025903 | Ga0207680_10755074 | Ga0207680_107550742 | 91 |
| 411 | 3300025904 | Ga0207647_10002063 | Ga0207647_1000206312 | 91 |
| 412 | 3300025904 | Ga0207647_10006155 | Ga0207647_100061552 | 91 |
| 413 | 3300025904 | Ga0207647_10378050 | Ga0207647_103780501 | 91 |
| 414 | 3300025905 | Ga0207685_10142327 | Ga0207685_101423272 | 91 |
| 415 | 3300025906 | Ga0207699_10089981 | Ga0207699_100899813 | 91 |
| 416 | 3300025906 | Ga0207699_10138949 | Ga0207699_101389493 | 91 |
| 417 | 3300025906 | Ga0207699_10140721 | Ga0207699_101407212 | 91 |
| 418 | 3300025906 | Ga0207699_10156817 | Ga0207699_101568171 | 91 |
| 419 | 3300025906 | Ga0207699_10191208 | Ga0207699_101912082 | 91 |
| 420 | 3300025906 | Ga0207699_10343204 | Ga0207699_103432042 | 91 |
| 421 | 3300025906 | Ga0207699_10363051 | Ga0207699_103630512 | 91 |
| 422 | 3300025906 | Ga0207699_11007123 | Ga0207699_110071232 | 91 |
| 423 | 3300025906 | Ga0207699_11399524 | Ga0207699_113995242 | 91 |
| 424 | 3300025907 | Ga0207645_10000901 | Ga0207645_1000090119 | 91 |
| 425 | 3300025907 | Ga0207645_11087942 | Ga0207645_110879421 | 91 |
| 426 | 3300025908 | Ga0207643_10000172 | Ga0207643_1000017214 | 91 |
| 427 | 3300025909 | Ga0207705_10045267 | Ga0207705_100452675 | 91 |
| 428 | 3300025909 | Ga0207705_10513714 | Ga0207705_105137142 | 91 |
| 429 | 3300025909 | Ga0207705_11001144 | Ga0207705_110011442 | 91 |
| 430 | 3300025911 | Ga0207654_10395459 | Ga0207654_103954592 | 91 |
| 431 | 3300025911 | Ga0207654_10659285 | Ga0207654_106592852 | 91 |
| 432 | 3300025911 | Ga0207654_10704808 | Ga0207654_107048081 | 91 |
| 433 | 3300025911 | Ga0207654_11096868 | Ga0207654_110968681 | 91 |
| 434 | 3300025911 | Ga0207654_11450224 | Ga0207654_114502241 | 91 |
| 435 | 3300025912 | Ga0207707_10060930 | Ga0207707_100609302 | 91 |
| 436 | 3300025912 | Ga0207707_10112690 | Ga0207707_101126901 | 91 |
| 437 | 3300025912 | Ga0207707_10177908 | Ga0207707_101779081 | 91 |
| 438 | 3300025912 | Ga0207707_10501566 | Ga0207707_105015662 | 91 |
| 439 | 3300025912 | Ga0207707_10502933 | Ga0207707_105029332 | 91 |
| 440 | 3300025912 | Ga0207707_10533333 | Ga0207707_105333331 | 91 |
| 441 | 3300025912 | Ga0207707_10631450 | Ga0207707_106314502 | 91 |
| 442 | 3300025912 | Ga0207707_10787269 | Ga0207707_107872692 | 91 |
| 443 | 3300025912 | Ga0207707_11540672 | Ga0207707_115406721 | 91 |
| 444 | 3300025913 | Ga0207695_11315022 | Ga0207695_113150222 | 91 |
| 445 | 3300025914 | Ga0207671_10151305 | Ga0207671_101513053 | 91 |
| 446 | 3300025914 | Ga0207671_10977274 | Ga0207671_109772741 | 91 |
| 447 | 3300025914 | Ga0207671_11469141 | Ga0207671_114691412 | 91 |
| 448 | 3300025915 | Ga0207693_10077982 | Ga0207693_100779823 | 91 |
| 449 | 3300025915 | Ga0207693_10653952 | Ga0207693_106539521 | 91 |
| 450 | 3300025916 | Ga0207663_10313172 | Ga0207663_103131722 | 91 |
| 451 | 3300025916 | Ga0207663_10402743 | Ga0207663_104027431 | 91 |
| 452 | 3300025916 | Ga0207663_10498430 | Ga0207663_104984302 | 91 |
| 453 | 3300025917 | Ga0207660_10092661 | Ga0207660_100926615 | 91 |
| 454 | 3300025917 | Ga0207660_10103262 | Ga0207660_101032622 | 91 |
| 455 | 3300025917 | Ga0207660_10108214 | Ga0207660_101082144 | 91 |
| 456 | 3300025917 | Ga0207660_10354029 | Ga0207660_103540292 | 91 |
| 457 | 3300025917 | Ga0207660_10458451 | Ga0207660_104584512 | 91 |
| 458 | 3300025917 | Ga0207660_10605707 | Ga0207660_106057071 | 91 |
| 459 | 3300025917 | Ga0207660_10894506 | Ga0207660_108945061 | 91 |
| 460 | 3300025918 | Ga0207662_10002090 | Ga0207662_100020905 | 91 |
| 461 | 3300025919 | Ga0207657_10000660 | Ga0207657_1000066017 | 91 |
| 462 | 3300025919 | Ga0207657_11202892 | Ga0207657_112028922 | 91 |
| 463 | 3300025920 | Ga0207649_10001125 | Ga0207649_1000112511 | 91 |
| 464 | 3300025920 | Ga0207649_10329425 | Ga0207649_103294253 | 91 |
| 465 | 3300025921 | Ga0207652_10078006 | Ga0207652_100780064 | 91 |
| 466 | 3300025921 | Ga0207652_10084852 | Ga0207652_100848522 | 91 |
| 467 | 3300025921 | Ga0207652_10115237 | Ga0207652_101152375 | 91 |
| 468 | 3300025921 | Ga0207652_10162586 | Ga0207652_101625864 | 91 |
| 469 | 3300025921 | Ga0207652_10483898 | Ga0207652_104838982 | 91 |
| 470 | 3300025921 | Ga0207652_10553165 | Ga0207652_105531652 | 91 |
| 471 | 3300025921 | Ga0207652_10572017 | Ga0207652_105720172 | 91 |
| 472 | 3300025921 | Ga0207652_11100325 | Ga0207652_111003252 | 91 |
| 473 | 3300025922 | Ga0207646_10423062 | Ga0207646_104230622 | 91 |
| 474 | 3300025922 | Ga0207646_11731012 | Ga0207646_117310121 | 91 |
| 475 | 3300025924 | Ga0207694_10289281 | Ga0207694_102892812 | 91 |
| 476 | 3300025924 | Ga0207694_10391218 | Ga0207694_103912181 | 91 |
| 477 | 3300025924 | Ga0207694_10454115 | Ga0207694_104541153 | 91 |
| 478 | 3300025924 | Ga0207694_10652886 | Ga0207694_106528863 | 91 |
| 479 | 3300025925 | Ga0207650_10000059 | Ga0207650_1000005933 | 91 |
| 480 | 3300025925 | Ga0207650_10144414 | Ga0207650_101444141 | 91 |
| 481 | 3300025925 | Ga0207650_10402085 | Ga0207650_104020852 | 91 |
| 482 | 3300025925 | Ga0207650_11341767 | Ga0207650_113417672 | 91 |
| 483 | 3300025926 | Ga0207659_10071146 | Ga0207659_100711463 | 91 |
| 484 | 3300025927 | Ga0207687_10003663 | Ga0207687_100036634 | 91 |
| 485 | 3300025927 | Ga0207687_10009003 | Ga0207687_100090035 | 91 |
| 486 | 3300025927 | Ga0207687_10097260 | Ga0207687_100972602 | 91 |
| 487 | 3300025927 | Ga0207687_10378008 | Ga0207687_103780082 | 91 |
| 488 | 3300025927 | Ga0207687_10809445 | Ga0207687_108094452 | 91 |
| 489 | 3300025928 | Ga0207700_10052978 | Ga0207700_100529783 | 91 |
| 490 | 3300025928 | Ga0207700_10096429 | Ga0207700_100964292 | 91 |
| 491 | 3300025928 | Ga0207700_10403578 | Ga0207700_104035782 | 91 |
| 492 | 3300025928 | Ga0207700_10440415 | Ga0207700_104404151 | 91 |
| 493 | 3300025928 | Ga0207700_10679714 | Ga0207700_106797142 | 91 |
| 494 | 3300025928 | Ga0207700_11087226 | Ga0207700_110872262 | 91 |
| 495 | 3300025928 | Ga0207700_11377148 | Ga0207700_113771481 | 91 |
| 496 | 3300025929 | Ga0207664_10153852 | Ga0207664_101538523 | 91 |
| 497 | 3300025929 | Ga0207664_10162743 | Ga0207664_101627432 | 91 |
| 498 | 3300025929 | Ga0207664_10886907 | Ga0207664_108869071 | 91 |
| 499 | 3300025929 | Ga0207664_11713824 | Ga0207664_117138241 | 91 |
| 500 | 3300025931 | Ga0207644_10149789 | Ga0207644_101497893 | 91 |
| 501 | 3300025931 | Ga0207644_10613543 | Ga0207644_106135433 | 91 |
| 502 | 3300025931 | Ga0207644_10676296 | Ga0207644_106762961 | 91 |
| 503 | 3300025931 | Ga0207644_11350881 | Ga0207644_113508812 | 91 |
| 504 | 3300025932 | Ga0207690_10149339 | Ga0207690_101493392 | 91 |
| 505 | 3300025932 | Ga0207690_10282315 | Ga0207690_102823152 | 91 |
| 506 | 3300025932 | Ga0207690_11362858 | Ga0207690_113628581 | 91 |
| 507 | 3300025933 | Ga0207706_10000723 | Ga0207706_1000072318 | 91 |
| 508 | 3300025933 | Ga0207706_10082973 | Ga0207706_100829731 | 91 |
| 509 | 3300025934 | Ga0207686_10107083 | Ga0207686_101070832 | 91 |
| 510 | 3300025934 | Ga0207686_10622330 | Ga0207686_106223302 | 91 |
| 511 | 3300025935 | Ga0207709_11096733 | Ga0207709_110967332 | 91 |
| 512 | 3300025938 | Ga0207704_10534212 | Ga0207704_105342122 | 91 |
| 513 | 3300025939 | Ga0207665_10186645 | Ga0207665_101866451 | 91 |
| 514 | 3300025939 | Ga0207665_10370094 | Ga0207665_103700943 | 91 |
| 515 | 3300025939 | Ga0207665_10748534 | Ga0207665_107485341 | 91 |
| 516 | 3300025940 | Ga0207691_10001129 | Ga0207691_1000112917 | 91 |
| 517 | 3300025940 | Ga0207691_11400936 | Ga0207691_114009361 | 91 |
| 518 | 3300025941 | Ga0207711_10010662 | Ga0207711_100106625 | 91 |
| 519 | 3300025941 | Ga0207711_10354258 | Ga0207711_103542582 | 91 |
| 520 | 3300025941 | Ga0207711_10965471 | Ga0207711_109654711 | 91 |
| 521 | 3300025941 | Ga0207711_10976392 | Ga0207711_109763921 | 91 |
| 522 | 3300025941 | Ga0207711_11006148 | Ga0207711_110061481 | 91 |
| 523 | 3300025942 | Ga0207689_10203792 | Ga0207689_102037923 | 91 |
| 524 | 3300025942 | Ga0207689_10903620 | Ga0207689_109036201 | 91 |
| 525 | 3300025942 | Ga0207689_11474515 | Ga0207689_114745151 | 91 |
| 526 | 3300025944 | Ga0207661_10015604 | Ga0207661_100156043 | 91 |
| 527 | 3300025944 | Ga0207661_10096426 | Ga0207661_100964264 | 91 |
| 528 | 3300025944 | Ga0207661_10928453 | Ga0207661_109284531 | 91 |
| 529 | 3300025945 | Ga0207679_10000415 | Ga0207679_1000041518 | 91 |
| 530 | 3300025949 | Ga0207667_10006054 | Ga0207667_100060549 | 91 |
| 531 | 3300025949 | Ga0207667_10318463 | Ga0207667_103184632 | 91 |
| 532 | 3300025949 | Ga0207667_11019639 | Ga0207667_110196392 | 91 |
| 533 | 3300025949 | Ga0207667_11445100 | Ga0207667_114451002 | 91 |
| 534 | 3300025949 | Ga0207667_11587734 | Ga0207667_115877341 | 91 |
| 535 | 3300025960 | Ga0207651_10010359 | Ga0207651_100103593 | 91 |
| 536 | 3300025960 | Ga0207651_10633779 | Ga0207651_106337792 | 91 |
| 537 | 3300025972 | Ga0207668_10008891 | Ga0207668_100088915 | 91 |
| 538 | 3300025981 | Ga0207640_10045169 | Ga0207640_100451693 | 91 |
| 539 | 3300025981 | Ga0207640_10504562 | Ga0207640_105045622 | 91 |
| 540 | 3300025981 | Ga0207640_10624380 | Ga0207640_106243801 | 91 |
| 541 | 3300025986 | Ga0207658_10014195 | Ga0207658_100141955 | 91 |
| 542 | 3300025986 | Ga0207658_10191920 | Ga0207658_101919203 | 91 |
| 543 | 3300025986 | Ga0207658_11784359 | Ga0207658_117843592 | 91 |
| 544 | 3300026023 | Ga0207677_10017217 | Ga0207677_100172173 | 91 |
| 545 | 3300026023 | Ga0207677_10033691 | Ga0207677_100336912 | 91 |
| 546 | 3300026023 | Ga0207677_10158054 | Ga0207677_101580542 | 91 |
| 547 | 3300026023 | Ga0207677_10786837 | Ga0207677_107868371 | 91 |
| 548 | 3300026035 | Ga0207703_10013619 | Ga0207703_100136195 | 91 |
| 549 | 3300026035 | Ga0207703_11769781 | Ga0207703_117697812 | 91 |
| 550 | 3300026041 | Ga0207639_10076788 | Ga0207639_100767883 | 91 |
| 551 | 3300026041 | Ga0207639_10076954 | Ga0207639_100769543 | 91 |
| 552 | 3300026041 | Ga0207639_10355113 | Ga0207639_103551131 | 91 |
| 553 | 3300026041 | Ga0207639_10762615 | Ga0207639_107626152 | 91 |
| 554 | 3300026041 | Ga0207639_10841749 | Ga0207639_108417492 | 91 |
| 555 | 3300026041 | Ga0207639_11457974 | Ga0207639_114579741 | 91 |
| 556 | 3300026067 | Ga0207678_10000581 | Ga0207678_1000058118 | 91 |
| 557 | 3300026067 | Ga0207678_10653937 | Ga0207678_106539372 | 91 |
| 558 | 3300026075 | Ga0207708_10146596 | Ga0207708_101465963 | 91 |
| 559 | 3300026078 | Ga0207702_10222682 | Ga0207702_102226822 | 91 |
| 560 | 3300026078 | Ga0207702_10565218 | Ga0207702_105652182 | 91 |
| 561 | 3300026078 | Ga0207702_10910654 | Ga0207702_109106542 | 91 |
| 562 | 3300026078 | Ga0207702_11127990 | Ga0207702_111279901 | 91 |
| 563 | 3300026088 | Ga0207641_10000025 | Ga0207641_1000002535 | 91 |
| 564 | 3300026088 | Ga0207641_11301139 | Ga0207641_113011392 | 91 |
| 565 | 3300026088 | Ga0207641_12005734 | Ga0207641_120057342 | 91 |
| 566 | 3300026089 | Ga0207648_10003458 | Ga0207648_100034588 | 91 |
| 567 | 3300026089 | Ga0207648_10220378 | Ga0207648_102203782 | 91 |
| 568 | 3300026089 | Ga0207648_11946367 | Ga0207648_119463672 | 91 |
| 569 | 3300026095 | Ga0207676_10000252 | Ga0207676_1000025230 | 91 |
| 570 | 3300026095 | Ga0207676_10032451 | Ga0207676_100324512 | 91 |
| 571 | 3300026095 | Ga0207676_12082278 | Ga0207676_120822781 | 91 |
| 572 | 3300026116 | Ga0207674_10000162 | Ga0207674_1000016229 | 91 |
| 573 | 3300026116 | Ga0207674_10085960 | Ga0207674_100859606 | 91 |
| 574 | 3300026116 | Ga0207674_10244013 | Ga0207674_102440134 | 91 |
| 575 | 3300026116 | Ga0207674_10766300 | Ga0207674_107663001 | 91 |
| 576 | 3300026118 | Ga0207675_100017450 | Ga0207675_1000174504 | 91 |
| 577 | 3300026121 | Ga0207683_10001306 | Ga0207683_1000130617 | 91 |
| 578 | 3300026121 | Ga0207683_10226238 | Ga0207683_102262382 | 91 |
| 579 | 3300026121 | Ga0207683_10725175 | Ga0207683_107251752 | 91 |
| 580 | 3300026142 | Ga0207698_10290702 | Ga0207698_102907022 | 91 |
| 581 | 3300026142 | Ga0207698_11759518 | Ga0207698_117595181 | 91 |
| 582 | 3300026142 | Ga0207698_12025110 | Ga0207698_120251101 | 91 |
| 583 | 3300027717 | Ga0209998_10046632 | Ga0209998_100466321 | 91 |
| 584 | 3300028379 | Ga0268266_10039280 | Ga0268266_100392803 | 91 |
| 585 | 3300028379 | Ga0268266_10118698 | Ga0268266_101186982 | 91 |
| 586 | 3300028379 | Ga0268266_11860746 | Ga0268266_118607461 | 91 |
| 587 | 3300028380 | Ga0268265_10004703 | Ga0268265_100047033 | 91 |
| 588 | 3300028381 | Ga0268264_10050987 | Ga0268264_100509875 | 91 |
| 589 | 3300028381 | Ga0268264_10107924 | Ga0268264_101079244 | 91 |
| 590 | 3300028381 | Ga0268264_12591801 | Ga0268264_125918012 | 91 |
| 591 | 3300028800 | Ga0265338_10134304 | Ga0265338_101343041 | 91 |
| 592 | 3300028800 | Ga0265338_11110356 | Ga0265338_111103562 | 91 |
| 593 | 3300031239 | Ga0265328_10039726 | Ga0265328_100397262 | 91 |
| 594 | 3300031239 | Ga0265328_10323709 | Ga0265328_103237091 | 91 |
| 595 | 3300031241 | Ga0265325_10005290 | Ga0265325_100052906 | 91 |
| 596 | 3300031241 | Ga0265325_10069646 | Ga0265325_100696461 | 91 |
| 597 | 3300031241 | Ga0265325_10402463 | Ga0265325_104024631 | 91 |
| 598 | 3300031247 | Ga0265340_10030554 | Ga0265340_100305544 | 91 |
| 599 | 3300031250 | Ga0265331_10009077 | Ga0265331_100090773 | 91 |
| 600 | 3300031250 | Ga0265331_10040471 | Ga0265331_100404713 | 91 |
| 601 | 3300031251 | Ga0265327_10054337 | Ga0265327_100543371 | 91 |
| 602 | 3300031344 | Ga0265316_10023396 | Ga0265316_100233966 | 91 |
| 603 | 3300031344 | Ga0265316_10068518 | Ga0265316_100685183 | 91 |
| 604 | 3300031344 | Ga0265316_10147654 | Ga0265316_101476542 | 91 |
| 605 | 3300031344 | Ga0265316_10740895 | Ga0265316_107408951 | 91 |
| 606 | 3300031548 | Ga0307408_100012830 | Ga0307408_1000128301 | 91 |
| 607 | 3300031595 | Ga0265313_10008949 | Ga0265313_100089491 | 91 |
| 608 | 3300031711 | Ga0265314_10024067 | Ga0265314_100240673 | 91 |
| 609 | 3300031731 | Ga0307405_10032987 | Ga0307405_100329872 | 91 |
| 610 | 3300031731 | Ga0307405_10602317 | Ga0307405_106023172 | 91 |
| 611 | 3300031824 | Ga0307413_10175803 | Ga0307413_101758032 | 91 |
| 612 | 3300031852 | Ga0307410_10004067 | Ga0307410_100040678 | 91 |
| 613 | 3300031903 | Ga0307407_10030849 | Ga0307407_100308495 | 91 |
| 614 | 3300031903 | Ga0307407_10857085 | Ga0307407_108570851 | 91 |
| 615 | 3300031911 | Ga0307412_10404596 | Ga0307412_104045961 | 91 |
| 616 | 3300031995 | Ga0307409_100223561 | Ga0307409_1002235613 | 91 |
| 617 | 3300032002 | Ga0307416_100072666 | Ga0307416_1000726663 | 91 |
| 618 | 3300032002 | Ga0307416_100156122 | Ga0307416_1001561224 | 91 |
| 619 | 3300032002 | Ga0307416_100367833 | Ga0307416_1003678331 | 91 |
| 620 | 3300032004 | Ga0307414_10597790 | Ga0307414_105977902 | 91 |
| 621 | 3300032005 | Ga0307411_10006952 | Ga0307411_100069521 | 91 |
| 622 | 3300032126 | Ga0307415_100273151 | Ga0307415_1002731513 | 91 |
| 623 | 3300032126 | Ga0307415_101457998 | Ga0307415_1014579981 | 91 |
| 624 | 3300034818 | Ga0373950_0041607 | Ga0373950_0041607_575_850 | 91 |
| 625 | 3300035083 | Ga0373926_0002055 | Ga0373926_0002055_130_405 | 91 |
| 626 | 3300035083 | Ga0373926_0121933 | Ga0373926_0121933_75_377 | 91 |
| 627 | 3300035086 | Ga0373934_0235300 | Ga0373934_0235300_74_349 | 91 |
| 628 | 3300035089 | Ga0373944_0023562 | Ga0373944_0023562_437_712 | 91 |
| 629 | 3300035089 | Ga0373944_0114371 | Ga0373944_0114371_399_674 | 91 |
| 630 | 3300035111 | Ga0373923_0039536 | Ga0373923_0039536_420_695 | 91 |
| 631 | 3300035111 | Ga0373923_0051294 | Ga0373923_0051294_1276_1551 | 91 |
| 632 | 3300035111 | Ga0373923_0095947 | Ga0373923_0095947_81_356 | 91 |
| 633 | 3300035111 | Ga0373923_0111481 | Ga0373923_0111481_481_756 | 91 |
| 634 | 3300035111 | Ga0373923_0212153 | Ga0373923_0212153_70_372 | 91 |
| 635 | 3300035113 | Ga0373936_0240612 | Ga0373936_0240612_413_688 | 91 |
| 636 | 3300035113 | Ga0373936_0506507 | Ga0373936_0506507_163_438 | 91 |
| 637 | 3300035113 | Ga0373936_0581361 | Ga0373936_0581361_116_391 | 91 |
| 638 | 3300035116 | Ga0373945_0001313 | Ga0373945_0001313_1828_2103 | 91 |
| 639 | 3300035116 | Ga0373945_0322350 | Ga0373945_0322350_69_344 | 91 |
| 640 | 3300035119 | Ga0373956_0234414 | Ga0373956_0234414_496_771 | 91 |
| 641 | 3300035170 | Ga0373943_0006731 | Ga0373943_0006731_502_777 | 91 |
| 642 | 3300035171 | Ga0373946_0012860 | Ga0373946_0012860_2237_2512 | 91 |
| 643 | 3300035172 | Ga0373955_0013343 | Ga0373955_0013343_272_547 | 91 |
| 644 | 3300035172 | Ga0373955_0324828 | Ga0373955_0324828_322_597 | 91 |
| 645 | 3300035172 | Ga0373955_1025560 | Ga0373955_1025560_102_377 | 91 |
| 646 | 3300035410 | Ga0373924_0000248 | Ga0373924_0000248_2558_2833 | 91 |
| 647 | 3300035410 | Ga0373924_0142201 | Ga0373924_0142201_149_424 | 91 |
| 648 | 3300035692 | Ga0373935_0003124 | Ga0373935_0003124_6292_6567 | 91 |
| 649 | 3300035692 | Ga0373935_0034467 | Ga0373935_0034467_1048_1323 | 91 |
| 650 | 3300035692 | Ga0373935_0048008 | Ga0373935_0048008_1083_1358 | 91 |
| 651 | 3300035692 | Ga0373935_0096713 | Ga0373935_0096713_805_1080 | 91 |
| 652 | 3300035692 | Ga0373935_0398230 | Ga0373935_0398230_241_516 | 91 |
| 653 | 3300035692 | Ga0373935_0609527 | Ga0373935_0609527_161_436 | 91 |
| 654 | 3300035692 | Ga0373935_1408267 | Ga0373935_1408267_235_510 | 91 |
| 655 | 3300035692 | Ga0373935_1452802 | Ga0373935_1452802_119_394 | 91 |
| 656 | 3300035695 | Ga0373927_0079790 | Ga0373927_0079790_1227_1502 | 91 |
| 657 | 3300035695 | Ga0373927_0080544 | Ga0373927_0080544_1259_1534 | 91 |
| 658 | 3300035695 | Ga0373927_0316908 | Ga0373927_0316908_715_990 | 91 |
| 659 | 3300035695 | Ga0373927_1115395 | Ga0373927_1115395_183_458 | 91 |
| 660 | 3300035724 | Ga0373933_0399813 | Ga0373933_0399813_90_365 | 91 |
| 661 | 3300035724 | Ga0373933_0664490 | Ga0373933_0664490_31_306 | 91 |
| 662 | 3300035724 | Ga0373933_0860179 | Ga0373933_0860179_191_466 | 91 |
| 663 | 3300035725 | Ga0373947_0017811 | Ga0373947_0017811_1435_1710 | 91 |
| 664 | 3300035725 | Ga0373947_0028162 | Ga0373947_0028162_2552_2827 | 91 |
| 665 | 3300035725 | Ga0373947_0122539 | Ga0373947_0122539_844_1122 | 91 |
| 666 | 3300036401 | Ga0373937_0000437 | Ga0373937_0000437_6608_6883 | 91 |
| 667 | 3300036401 | Ga0373937_0072227 | Ga0373937_0072227_2143_2418 | 91 |
| 668 | 3300036401 | Ga0373937_0173066 | Ga0373937_0173066_1188_1463 | 91 |
| 669 | 3300036401 | Ga0373937_0197899 | Ga0373937_0197899_1586_1861 | 91 |
| 670 | 3300036401 | Ga0373937_0455986 | Ga0373937_0455986_477_752 | 91 |
| 671 | 3300036401 | Ga0373937_0638659 | Ga0373937_0638659_110_388 | 91 |
| 672 | 3300036401 | Ga0373937_0641992 | Ga0373937_0641992_583_882 | 91 |
| 673 | 3300036401 | Ga0373937_0680383 | Ga0373937_0680383_599_874 | 91 |
| 674 | 3300036401 | Ga0373937_1454142 | Ga0373937_1454142_339_614 | 91 |
| 675 | 3300037068 | Ga0373925_0005732 | Ga0373925_0005732_6991_7266 | 91 |
| 676 | 3300037068 | Ga0373925_0043304 | Ga0373925_0043304_2021_2296 | 91 |
| 677 | 3300037068 | Ga0373925_1008285 | Ga0373925_1008285_216_491 | 91 |
| 678 | 3300037068 | Ga0373925_1368167 | Ga0373925_1368167_222_497 | 91 |
| 679 | 3300037068 | Ga0373925_1720913 | Ga0373925_1720913_31_306 | 91 |
| 680 | 3300037418 | Ga0395900_0119579 | Ga0395900_0119579_1252_1533 | 91 |
| 681 | 3300037466 | Ga0395898_0049727 | Ga0395898_0049727_1055_1330 | 91 |
| 682 | 3300037466 | Ga0395898_0744507 | Ga0395898_0744507_41_322 | 91 |
| 683 | 3300037466 | Ga0395898_1511931 | Ga0395898_1511931_312_587 | 91 |
| 684 | 3300037466 | Ga0395898_1572946 | Ga0395898_1572946_73_348 | 91 |
| 685 | 3300037466 | Ga0395898_1676973 | Ga0395898_1676973_190_465 | 91 |
| 686 | 3300038443 | Ga0395901_1992297 | Ga0395901_1992297_168_443 | 91 |
| 687 | 3300039437 | Ga0436365_0163368 | Ga0436365_0163368_666_941 | 91 |
| 688 | 3300039447 | Ga0436361_0488693 | Ga0436361_0488693_942_1274 | 91 |
| 689 | 3300039450 | Ga0436363_0501633 | Ga0436363_0501633_2687_2962 | 91 |
| 690 | 3300039450 | Ga0436363_0882976 | Ga0436363_0882976_237_512 | 91 |
| 691 | 3300039450 | Ga0436363_0921361 | Ga0436363_0921361_236_511 | 91 |
| 692 | 3300039450 | Ga0436363_1608620 | Ga0436363_1608620_1771_2046 | 91 |
| 693 | 3300039453 | Ga0436362_0763575 | Ga0436362_0763575_1217_1492 | 91 |
| 694 | 3300039453 | Ga0436362_0774876 | Ga0436362_0774876_69_344 | 91 |
| 695 | 3300041496 | Ga0451839_0856090 | Ga0451839_0856090_545_820 | 91 |
| 696 | 3300042876 | Ga0451577_0000054 | Ga0451577_0000054_1396_1671 | 91 |
| 697 | 3300042876 | Ga0451577_0804712 | Ga0451577_0804712_220_495 | 91 |
| 698 | 3300042876 | Ga0451577_1068579 | Ga0451577_1068579_253_528 | 91 |
| 699 | 3300042876 | Ga0451577_1855001 | Ga0451577_1855001_204_479 | 91 |
| 700 | 3300044673 | Ga0453683_0003233 | Ga0453683_0003233_561_836 | 91 |
| 701 | 3300044673 | Ga0453683_0203042 | Ga0453683_0203042_597_872 | 91 |
| 702 | 3300044684 | Ga0466966_0306187 | Ga0466966_0306187_71_346 | 91 |
| 703 | 3300044684 | Ga0466966_0705261 | Ga0466966_0705261_197_472 | 91 |
| 704 | 3300044694 | Ga0466963_0017484 | Ga0466963_0017484_2880_3155 | 91 |
| 705 | 3300044712 | Ga0453684_0000289 | Ga0453684_0000289_73733_74008 | 91 |
| 706 | 3300044712 | Ga0453684_0219315 | Ga0453684_0219315_1825_2100 | 91 |
| 707 | 3300044712 | Ga0453684_0527378 | Ga0453684_0527378_12_293 | 91 |
| 708 | 3300044712 | Ga0453684_0640634 | Ga0453684_0640634_776_1051 | 91 |
| 709 | 3300044712 | Ga0453684_1515091 | Ga0453684_1515091_232_507 | 91 |
| 710 | 3300044712 | Ga0453684_2109050 | Ga0453684_2109050_217_492 | 91 |
| 711 | 3300044735 | Ga0466968_0434700 | Ga0466968_0434700_297_572 | 91 |
| 712 | 3300044735 | Ga0466968_0591980 | Ga0466968_0591980_214_489 | 91 |
| 713 | 3300044765 | Ga0466970_0735198 | Ga0466970_0735198_238_519 | 91 |
| 714 | 3300044842 | Ga0466957_0000065 | Ga0466957_0000065_14550_14825 | 91 |
| 715 | 3300044842 | Ga0466957_0115257 | Ga0466957_0115257_1084_1359 | 91 |
| 716 | 3300044842 | Ga0466957_0672916 | Ga0466957_0672916_424_699 | 91 |
| 717 | 3300044842 | Ga0466957_1257174 | Ga0466957_1257174_205_480 | 91 |
| 718 | 3300045049 | Ga0466959_0016961 | Ga0466959_0016961_2712_2987 | 91 |
| 719 | 3300045051 | Ga0451576_0003350 | Ga0451576_0003350_20292_20567 | 91 |
| 720 | 3300045051 | Ga0451576_0133045 | Ga0451576_0133045_2047_2328 | 91 |
| 721 | 3300045051 | Ga0451576_0165179 | Ga0451576_0165179_1263_1538 | 91 |
| 722 | 3300045051 | Ga0451576_0456697 | Ga0451576_0456697_268_543 | 91 |
| 723 | 3300045051 | Ga0451576_0471208 | Ga0451576_0471208_618_893 | 91 |
| 724 | 3300045051 | Ga0451576_2317614 | Ga0451576_2317614_265_540 | 91 |
| 725 | 3300045051 | Ga0451576_2617154 | Ga0451576_2617154_166_441 | 91 |
| 726 | 3300045976 | Ga0466967_0055328 | Ga0466967_0055328_2872_3147 | 91 |
| 727 | 3300045976 | Ga0466967_0068117 | Ga0466967_0068117_1804_2079 | 91 |
| 728 | 3300045976 | Ga0466967_0623768 | Ga0466967_0623768_177_452 | 91 |
| 729 | 3300045976 | Ga0466967_1097650 | Ga0466967_1097650_482_757 | 91 |
| 730 | 3300045976 | Ga0466967_1784469 | Ga0466967_1784469_56_331 | 91 |
| 731 | 3300045976 | Ga0466967_2560717 | Ga0466967_2560717_41_316 | 91 |
| 732 | 3300046455 | Ga0495603_0547288 | Ga0495603_0547288_278_553 | 91 |
| 733 | 3300046462 | Ga0495651_0044034 | Ga0495651_0044034_2109_2387 | 91 |
| 734 | 3300046462 | Ga0495651_0273510 | Ga0495651_0273510_445_720 | 91 |
| 735 | 3300046462 | Ga0495651_0763501 | Ga0495651_0763501_285_560 | 91 |
| 736 | 3300046463 | Ga0495653_0680180 | Ga0495653_0680180_56_331 | 91 |
| 737 | 3300046472 | Ga0495580_0194241 | Ga0495580_0194241_216_491 | 91 |
| 738 | 3300046472 | Ga0495580_0341787 | Ga0495580_0341787_714_992 | 91 |
| 739 | 3300046472 | Ga0495580_0370711 | Ga0495580_0370711_76_351 | 91 |
| 740 | 3300046472 | Ga0495580_1023839 | Ga0495580_1023839_194_496 | 91 |
| 741 | 3300046473 | Ga0495582_0031880 | Ga0495582_0031880_1536_1811 | 91 |
| 742 | 3300046473 | Ga0495582_0698873 | Ga0495582_0698873_83_358 | 91 |
| 743 | 3300046475 | Ga0495639_0446603 | Ga0495639_0446603_224_499 | 91 |
| 744 | 3300046477 | Ga0495664_0919595 | Ga0495664_0919595_37_312 | 91 |
| 745 | 3300046499 | Ga0495594_0836129 | Ga0495594_0836129_71_346 | 91 |
| 746 | 3300046511 | Ga0495608_0035097 | Ga0495608_0035097_848_1123 | 91 |
| 747 | 3300046514 | Ga0495618_0871673 | Ga0495618_0871673_209_484 | 91 |
| 748 | 3300046517 | Ga0495630_0063439 | Ga0495630_0063439_2104_2379 | 91 |
| 749 | 3300046517 | Ga0495630_0609423 | Ga0495630_0609423_531_809 | 91 |
| 750 | 3300046522 | Ga0495643_0098609 | Ga0495643_0098609_957_1232 | 91 |
| 751 | 3300046528 | Ga0495642_0507901 | Ga0495642_0507901_182_457 | 91 |
| 752 | 3300046529 | Ga0495652_0136619 | Ga0495652_0136619_370_645 | 91 |
| 753 | 3300046531 | Ga0495665_0014305 | Ga0495665_0014305_2566_2841 | 91 |
| 754 | 3300046535 | Ga0495586_0160442 | Ga0495586_0160442_773_1048 | 91 |
| 755 | 3300046536 | Ga0495587_0787533 | Ga0495587_0787533_91_366 | 91 |
| 756 | 3300046559 | Ga0495667_0317686 | Ga0495667_0317686_517_792 | 91 |
| 757 | 3300046663 | Ga0495635_0031352 | Ga0495635_0031352_828_1103 | 91 |
| 758 | 3300046675 | Ga0495657_0077229 | Ga0495657_0077229_688_963 | 91 |
| 759 | 3300046678 | Ga0495599_0692187 | Ga0495599_0692187_145_420 | 91 |
| 760 | 3300046679 | Ga0495623_0046319 | Ga0495623_0046319_887_1162 | 91 |
| 761 | 3300046684 | Ga0495669_0005788 | Ga0495669_0005788_4697_4972 | 91 |
| 762 | 3300046684 | Ga0495669_0012701 | Ga0495669_0012701_1866_2141 | 91 |
| 763 | 3300046684 | Ga0495669_0016894 | Ga0495669_0016894_1062_1337 | 91 |
| 764 | 3300046684 | Ga0495669_0176818 | Ga0495669_0176818_166_441 | 91 |
| 765 | 3300046691 | Ga0495670_0574543 | Ga0495670_0574543_225_500 | 91 |
| 766 | 3300046694 | Ga0495649_0005004 | Ga0495649_0005004_6906_7181 | 91 |
| 767 | 3300047317 | Ga0495604_0148206 | Ga0495604_0148206_934_1212 | 91 |
| 768 | 3300047321 | Ga0495676_0968702 | Ga0495676_0968702_152_427 | 91 |
| 769 | 3300047443 | Ga0495687_066994 | Ga0495687_066994_690_965 | 91 |
| 770 | 3300047444 | Ga0495675_0200620 | Ga0495675_0200620_870_1145 | 91 |
| 771 | 3300047673 | Ga0495593_0409404 | Ga0495593_0409404_48_323 | 91 |
| 772 | 3300048088 | Ga0495602_0357183 | Ga0495602_0357183_240_518 | 91 |
| 773 | 3300048089 | Ga0495614_0267159 | Ga0495614_0267159_238_513 | 91 |
| 774 | 3300048089 | Ga0495614_0499263 | Ga0495614_0499263_188_463 | 91 |
| 775 | 3300048904 | Ga0496101_0540257 | Ga0496101_0540257_481_756 | 91 |
| 776 | 3300048904 | Ga0496101_0830291 | Ga0496101_0830291_381_656 | 91 |
| 777 | 3300048905 | Ga0496102_0028897 | Ga0496102_0028897_1285_1560 | 91 |
| 778 | 3300048905 | Ga0496102_0067618 | Ga0496102_0067618_2683_2958 | 91 |
| 779 | 3300048905 | Ga0496102_0131043 | Ga0496102_0131043_1858_2133 | 91 |
| 780 | 3300048905 | Ga0496102_0389044 | Ga0496102_0389044_809_1084 | 91 |
| 781 | 3300048905 | Ga0496102_0707015 | Ga0496102_0707015_376_651 | 91 |
| 782 | 3300048905 | Ga0496102_1564600 | Ga0496102_1564600_27_302 | 91 |
| 783 | 3300048906 | Ga0496103_0698399 | Ga0496103_0698399_124_399 | 91 |
| 784 | 3300048907 | Ga0496104_0258689 | Ga0496104_0258689_787_1062 | 91 |
| 785 | 3300048907 | Ga0496104_0273011 | Ga0496104_0273011_31_306 | 91 |
| 786 | 3300048907 | Ga0496104_0363592 | Ga0496104_0363592_43_318 | 91 |
| 787 | 3300048907 | Ga0496104_0503661 | Ga0496104_0503661_97_372 | 91 |
| 788 | 3300048907 | Ga0496104_0993073 | Ga0496104_0993073_352_627 | 91 |
| 789 | 3300048908 | Ga0496105_0004526 | Ga0496105_0004526_7177_7452 | 91 |
| 790 | 3300048908 | Ga0496105_0338256 | Ga0496105_0338256_359_634 | 91 |
| 791 | 3300048908 | Ga0496105_0468113 | Ga0496105_0468113_349_624 | 91 |
| 792 | 3300048908 | Ga0496105_1178935 | Ga0496105_1178935_28_303 | 91 |
| 793 | 3300048909 | Ga0496106_0129013 | Ga0496106_0129013_908_1183 | 91 |
| 794 | 3300048909 | Ga0496106_0145797 | Ga0496106_0145797_1529_1804 | 91 |
| 795 | 3300048910 | Ga0496107_0613047 | Ga0496107_0613047_435_710 | 91 |
| 796 | 3300048910 | Ga0496107_0980642 | Ga0496107_0980642_213_488 | 91 |
| 797 | 3300048910 | Ga0496107_1266857 | Ga0496107_1266857_102_377 | 91 |
| 798 | 3300048911 | Ga0496108_0000203 | Ga0496108_0000203_39616_39891 | 91 |
| 799 | 3300048911 | Ga0496108_0086225 | Ga0496108_0086225_199_474 | 91 |
| 800 | 3300048911 | Ga0496108_0238685 | Ga0496108_0238685_222_497 | 91 |
| 801 | 3300048912 | Ga0496109_0000228 | Ga0496109_0000228_48481_48756 | 91 |
| 802 | 3300048912 | Ga0496109_0031502 | Ga0496109_0031502_1159_1434 | 91 |
| 803 | 3300048912 | Ga0496109_0738114 | Ga0496109_0738114_59_334 | 91 |
| 804 | 3300048912 | Ga0496109_0856969 | Ga0496109_0856969_533_808 | 91 |
| 805 | 3300048912 | Ga0496109_1594183 | Ga0496109_1594183_134_409 | 91 |
| 806 | 3300048913 | Ga0496110_0000145 | Ga0496110_0000145_28626_28901 | 91 |
| 807 | 3300048913 | Ga0496110_0023501 | Ga0496110_0023501_3554_3829 | 91 |
| 808 | 3300048913 | Ga0496110_0076017 | Ga0496110_0076017_25_300 | 91 |
| 809 | 3300048913 | Ga0496110_0513892 | Ga0496110_0513892_17_292 | 91 |
| 810 | 3300048914 | Ga0496111_0023585 | Ga0496111_0023585_81_356 | 91 |
| 811 | 3300048914 | Ga0496111_0082490 | Ga0496111_0082490_583_858 | 91 |
| 812 | 3300048914 | Ga0496111_0114010 | Ga0496111_0114010_554_829 | 91 |
| 813 | 3300048915 | Ga0496112_0000048 | Ga0496112_0000048_48190_48465 | 91 |
| 814 | 3300048915 | Ga0496112_0008072 | Ga0496112_0008072_4256_4531 | 91 |
| 815 | 3300048915 | Ga0496112_0022754 | Ga0496112_0022754_5588_5863 | 91 |
| 816 | 3300048915 | Ga0496112_0063880 | Ga0496112_0063880_118_393 | 91 |
| 817 | 3300048915 | Ga0496112_0069992 | Ga0496112_0069992_2883_3158 | 91 |
| 818 | 3300048915 | Ga0496112_0166680 | Ga0496112_0166680_1143_1418 | 91 |
| 819 | 3300048915 | Ga0496112_0296451 | Ga0496112_0296451_193_468 | 91 |
| 820 | 3300048915 | Ga0496112_0308663 | Ga0496112_0308663_930_1205 | 91 |
| 821 | 3300048915 | Ga0496112_0605349 | Ga0496112_0605349_499_774 | 91 |
| 822 | 3300048915 | Ga0496112_1008330 | Ga0496112_1008330_310_585 | 91 |
| 823 | 3300048916 | Ga0496113_0000613 | Ga0496113_0000613_16580_16855 | 91 |
| 824 | 3300048916 | Ga0496113_0002484 | Ga0496113_0002484_9703_9978 | 91 |
| 825 | 3300048916 | Ga0496113_0160797 | Ga0496113_0160797_535_810 | 91 |
| 826 | 3300048916 | Ga0496113_0384461 | Ga0496113_0384461_144_419 | 91 |
| 827 | 3300048916 | Ga0496113_0395806 | Ga0496113_0395806_811_1086 | 91 |
| 828 | 3300048916 | Ga0496113_1026221 | Ga0496113_1026221_51_326 | 91 |
| 829 | 3300048918 | Ga0496115_0012247 | Ga0496115_0012247_599_874 | 91 |
| 830 | 3300048918 | Ga0496115_0097678 | Ga0496115_0097678_1426_1701 | 91 |
| 831 | 3300048918 | Ga0496115_1106422 | Ga0496115_1106422_14_289 | 91 |
| 832 | 3300048929 | Ga0496126_0342885 | Ga0496126_0342885_555_836 | 91 |
| 833 | 3300049513 | Ga0501290_051396 | Ga0501290_051396_330_605 | 91 |
| 834 | 3300049521 | Ga0501298_028735 | Ga0501298_028735_731_1066 | 91 |
| 835 | 3300049582 | Ga0501048_1222433 | Ga0501048_1222433_213_512 | 91 |
| 836 | 3300049586 | Ga0501070_0763463 | Ga0501070_0763463_217_495 | 91 |
| 837 | 3300049589 | Ga0501073_0924941 | Ga0501073_0924941_263_538 | 91 |
| 838 | 3300049685 | Ga0501256_020613 | Ga0501256_020613_23_358 | 91 |
| 839 | 3300049686 | Ga0501257_277804 | Ga0501257_277804_178_462 | 91 |
| 840 | 3300049688 | Ga0501259_058031 | Ga0501259_058031_471_755 | 91 |
| 841 | 3300049742 | Ga0501080_1068265 | Ga0501080_1068265_338_637 | 91 |
| 842 | 3300049779 | Ga0501283_018695 | Ga0501283_018695_331_666 | 91 |
| 843 | 3300050507 | nmdc:mga05p37_98700_c1 | nmdc:mga05p37_98700_c1_295_570 | 91 |
| 844 | 3300050512 | nmdc:mga0n895_1332383_c1 | nmdc:mga0n895_1332383_c1_248_523 | 91 |
| 845 | 3300050513 | nmdc:mga0rr50_402415_c1 | nmdc:mga0rr50_402415_c1_135_410 | 91 |
| 846 | 3300050514 | nmdc:mga08x19_195825_c1 | nmdc:mga08x19_195825_c1_241_516 | 91 |
| 847 | 3300050514 | nmdc:mga08x19_6208_c1 | nmdc:mga08x19_6208_c1_2758_3033 | 91 |
| 848 | 3300053077 | Ga0495601_0782841 | Ga0495601_0782841_171_446 | 91 |
| 849 | 3300053085 | Ga0495619_0292886 | Ga0495619_0292886_740_1015 | 91 |
| 850 | 3300054114 | Ga0501084_0545099 | Ga0501084_0545099_112_387 | 91 |
| 851 | 3300059647 | Ga0587079_063939 | Ga0587079_063939_456_731 | 91 |
| 852 | 3300061734 | Ga0530510_0599699 | Ga0530510_0599699_94_369 | 91 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3agy-assembly1.cif.gz_A | crystal structure of human hsp40 hdj1 peptide-binding domain complexed with a c-terminal peptide of hsp70 | 0.622 | 4 | 44 |
| 6rpp-assembly1.cif.gz_A | crystal structure of pabcdc21-1 intein | 0.5933 | 7 | 40 |
| 7dbi-assembly1.cif.gz_A | crystal structure of the peroxisomal acyl-coa hydrolase mpah | 0.5662 | 5 | 43 |
| 8fuv-assembly1.cif.gz_F | pseudomonas phage e217 extended sheath and tail tube | 0.5219 | 9 | 48 |
| 5nzi-assembly1.cif.gz_A | crystal structure of udp-glucose pyrophosphorylase s374f mutant from leishmania major in complex with udp-glucose | 0.5012 | 1 | 34 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VEX5_2_667_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.6629 | 8 | 35 | 3.40.50.410 |
| af_P37297_1539_1696_3.30.1010.10 | Alpha Beta;2-Layer Sandwich;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 | 0.6415 | 9 | 37 | 3.30.1010.10 |
| af_P47912_40_551_3.40.50.12780 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.6274 | 8 | 36 | 3.40.50.12780 |
| 6d04A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.626 | 8 | 42 | 3.40.630.10 |
| af_Q9NVM9_4_692_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.616 | 7 | 35 | 3.40.50.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2VEJ9-F1-model_v4 | Uncharacterized protein | 0.9879 | 1 | 91 |
|
| AF-A0A7W7ZTC8-F1-model_v4 | Uncharacterized protein | 0.977 | 1 | 91 |
|
| AF-A0A1Q7K0I8-F1-model_v4 | Uncharacterized protein | 0.9759 | 1 | 91 |
|
| AF-A0A7W7ZTC8-F1-model_v4 | Uncharacterized protein | 0.9666 | 1 | 91 |
|
| AF-A0A2V9ANF4-F1-model_v4 | Uncharacterized protein | 0.9638 | 1 | 91 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar