F483440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 850 | 385 | 1700 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_1025951|Ga0495619_1025951_101_460 |
| Length | 119 |
| Sequence | LRRLKTKNQEKNMAEKPRLKLPKEAKKGDVIEIKTLMPHIMESGQRKDKDGKPIPRKIINKFTAEFNGKPVFSANLEPAIAANPYMEFYAKVEESGMFKFSWTDDDGTVTTAEEKITVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 103 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 104 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 105 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 107 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 185 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 245 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 246 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 247 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 315 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 316 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 353 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 355 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 356 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 358 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 360 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 361 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 362 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 363 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 365 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 366 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 370 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 376 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 377 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 378 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 379 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 380 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 381 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 382 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 383 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 384 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 385 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.59 |
| Metatranscriptomes | 0.24 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.71 |
| Nodule | 0.47 |
| Rhizoplane | 8.47 |
| Rhizosphere | 82.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495619_1025951 | 3300053085 | Bacteria | 551 |
| 2 | RicEn_C6443 | 2010549000 | Bacteria | 1472 |
| 3 | ARcpr5oldR_c011814 | 3300000041 | Bacteria | 746 |
| 4 | JGI24750J21931_1020184 | 3300002070 | Bacteria | 928 |
| 5 | JGI25406J46586_10000138 | 3300003203 | Bacteria | 31765 |
| 6 | JGI25404J52841_10000288 | 3300003659 | Bacteria | 6507 |
| 7 | JGI25404J52841_10016633 | 3300003659 | Bacteria | 1595 |
| 8 | Ga0065165_1089247 | 3300005262 | Bacteria | 788 |
| 9 | Ga0065712_10806853 | 3300005290 | Bacteria | 510 |
| 10 | Ga0070658_10152408 | 3300005327 | Bacteria | 1936 |
| 11 | Ga0070658_10281288 | 3300005327 | Bacteria | 1416 |
| 12 | Ga0070658_11661314 | 3300005327 | Bacteria | 553 |
| 13 | Ga0070676_10066362 | 3300005328 | Bacteria | 2156 |
| 14 | Ga0070676_10206242 | 3300005328 | Bacteria | 1291 |
| 15 | Ga0070683_100566384 | 3300005329 | Bacteria | 1086 |
| 16 | Ga0070690_100035779 | 3300005330 | Bacteria | 3118 |
| 17 | Ga0070670_100085242 | 3300005331 | Bacteria | 2714 |
| 18 | Ga0068869_100944991 | 3300005334 | Bacteria | 748 |
| 19 | Ga0070666_10044947 | 3300005335 | Bacteria | 2960 |
| 20 | Ga0070666_10170100 | 3300005335 | Bacteria | 1526 |
| 21 | Ga0070680_100073406 | 3300005336 | Bacteria | 2814 |
| 22 | Ga0070682_100022461 | 3300005337 | Bacteria | 3737 |
| 23 | Ga0070682_100691382 | 3300005337 | Bacteria | 817 |
| 24 | Ga0068868_100023195 | 3300005338 | Bacteria | 4694 |
| 25 | Ga0068868_100302903 | 3300005338 | Bacteria | 1358 |
| 26 | Ga0070660_101517973 | 3300005339 | Bacteria | 570 |
| 27 | Ga0070689_100271674 | 3300005340 | Bacteria | 1404 |
| 28 | Ga0070691_10092647 | 3300005341 | Bacteria | 1492 |
| 29 | Ga0070687_100655484 | 3300005343 | Bacteria | 728 |
| 30 | Ga0070687_101266715 | 3300005343 | Bacteria | 546 |
| 31 | Ga0070661_100063833 | 3300005344 | Bacteria | 2705 |
| 32 | Ga0070661_100128827 | 3300005344 | Bacteria | 1900 |
| 33 | Ga0070668_100111063 | 3300005347 | Bacteria | 2182 |
| 34 | Ga0070669_100463638 | 3300005353 | Bacteria | 1046 |
| 35 | Ga0070669_101941653 | 3300005353 | Bacteria | 514 |
| 36 | Ga0070675_101292694 | 3300005354 | Bacteria | 672 |
| 37 | Ga0070671_100075228 | 3300005355 | Bacteria | 2821 |
| 38 | Ga0070671_100126562 | 3300005355 | Bacteria | 2151 |
| 39 | Ga0070674_100118540 | 3300005356 | Bacteria | 1956 |
| 40 | Ga0070674_100385100 | 3300005356 | Bacteria | 1142 |
| 41 | Ga0070673_100031259 | 3300005364 | Bacteria | 3993 |
| 42 | Ga0070673_100221129 | 3300005364 | Bacteria | 1639 |
| 43 | Ga0070673_101180251 | 3300005364 | Bacteria | 717 |
| 44 | Ga0070688_100016483 | 3300005365 | Bacteria | 4225 |
| 45 | Ga0070667_100096956 | 3300005367 | Bacteria | 2543 |
| 46 | Ga0070667_100277815 | 3300005367 | Bacteria | 1503 |
| 47 | Ga0070709_10000855 | 3300005434 | Bacteria | 17027 |
| 48 | Ga0070709_10004300 | 3300005434 | Bacteria | 7681 |
| 49 | Ga0070709_10022160 | 3300005434 | Bacteria | 3711 |
| 50 | Ga0070709_10023003 | 3300005434 | Bacteria | 3653 |
| 51 | Ga0070709_10229367 | 3300005434 | Bacteria | 1328 |
| 52 | Ga0070714_100431103 | 3300005435 | Bacteria | 1250 |
| 53 | Ga0070714_100474559 | 3300005435 | Bacteria | 1190 |
| 54 | Ga0070713_100002359 | 3300005436 | Bacteria | 12318 |
| 55 | Ga0070713_100004066 | 3300005436 | Bacteria | 9738 |
| 56 | Ga0070713_100031837 | 3300005436 | Bacteria | 4205 |
| 57 | Ga0070713_100149309 | 3300005436 | Bacteria | 2077 |
| 58 | Ga0070713_100306657 | 3300005436 | Bacteria | 1463 |
| 59 | Ga0070713_101195986 | 3300005436 | Bacteria | 736 |
| 60 | Ga0070710_10003385 | 3300005437 | Bacteria | 7554 |
| 61 | Ga0070710_10029684 | 3300005437 | Bacteria | 2935 |
| 62 | Ga0070710_10077078 | 3300005437 | Bacteria | 1936 |
| 63 | Ga0070710_10096625 | 3300005437 | Bacteria | 1751 |
| 64 | Ga0070710_10756435 | 3300005437 | Bacteria | 690 |
| 65 | Ga0070711_100017702 | 3300005439 | Bacteria | 4539 |
| 66 | Ga0070711_100017962 | 3300005439 | Bacteria | 4509 |
| 67 | Ga0070711_100088060 | 3300005439 | Bacteria | 2230 |
| 68 | Ga0070711_100128053 | 3300005439 | Bacteria | 1887 |
| 69 | Ga0070711_100209488 | 3300005439 | Bacteria | 1509 |
| 70 | Ga0070711_100506323 | 3300005439 | Bacteria | 996 |
| 71 | Ga0070711_100838504 | 3300005439 | Bacteria | 781 |
| 72 | Ga0070705_100221343 | 3300005440 | Bacteria | 1311 |
| 73 | Ga0070700_100532159 | 3300005441 | Bacteria | 910 |
| 74 | Ga0070700_101052240 | 3300005441 | Bacteria | 672 |
| 75 | Ga0070694_100356334 | 3300005444 | Bacteria | 1135 |
| 76 | Ga0070708_100206734 | 3300005445 | Bacteria | 1839 |
| 77 | Ga0070708_101359363 | 3300005445 | Bacteria | 663 |
| 78 | Ga0070663_100343464 | 3300005455 | Bacteria | 1207 |
| 79 | Ga0070663_100412822 | 3300005455 | Bacteria | 1106 |
| 80 | Ga0070678_100306263 | 3300005456 | Bacteria | 1352 |
| 81 | Ga0070662_100448422 | 3300005457 | Bacteria | 1071 |
| 82 | Ga0070681_10013271 | 3300005458 | Bacteria | 8185 |
| 83 | Ga0068867_100235985 | 3300005459 | Bacteria | 1481 |
| 84 | Ga0068867_100804167 | 3300005459 | Bacteria | 839 |
| 85 | Ga0070685_10153929 | 3300005466 | Bacteria | 1459 |
| 86 | Ga0070685_10281094 | 3300005466 | Bacteria | 1114 |
| 87 | Ga0070679_100085231 | 3300005530 | Bacteria | 3146 |
| 88 | Ga0070679_100122492 | 3300005530 | Bacteria | 2584 |
| 89 | Ga0070684_100525862 | 3300005535 | Bacteria | 1096 |
| 90 | Ga0070684_101177447 | 3300005535 | Bacteria | 721 |
| 91 | Ga0068853_100068998 | 3300005539 | Bacteria | 3074 |
| 92 | Ga0068853_100732708 | 3300005539 | Bacteria | 944 |
| 93 | Ga0068853_100960902 | 3300005539 | Bacteria | 822 |
| 94 | Ga0070686_100055931 | 3300005544 | Bacteria | 2529 |
| 95 | Ga0070695_100065695 | 3300005545 | Bacteria | 2363 |
| 96 | Ga0070695_100285865 | 3300005545 | Bacteria | 1214 |
| 97 | Ga0070696_100142454 | 3300005546 | Bacteria | 1753 |
| 98 | Ga0070696_100609966 | 3300005546 | Bacteria | 881 |
| 99 | Ga0070693_100058059 | 3300005547 | Bacteria | 2239 |
| 100 | Ga0070693_100248190 | 3300005547 | Bacteria | 1179 |
| 101 | Ga0070693_100523254 | 3300005547 | Bacteria | 845 |
| 102 | Ga0070693_100570628 | 3300005547 | Bacteria | 813 |
| 103 | Ga0070665_100053413 | 3300005548 | Bacteria | 4052 |
| 104 | Ga0070665_100069877 | 3300005548 | Bacteria | 3519 |
| 105 | Ga0070665_100806559 | 3300005548 | Bacteria | 952 |
| 106 | Ga0070704_101839071 | 3300005549 | Bacteria | 561 |
| 107 | Ga0068855_100187602 | 3300005563 | Bacteria | 2335 |
| 108 | Ga0068855_100677922 | 3300005563 | Bacteria | 1105 |
| 109 | Ga0070664_100038514 | 3300005564 | Bacteria | 4024 |
| 110 | Ga0070664_100523617 | 3300005564 | Bacteria | 1094 |
| 111 | Ga0068857_100291795 | 3300005577 | Bacteria | 1502 |
| 112 | Ga0068856_100084891 | 3300005614 | Bacteria | 3146 |
| 113 | Ga0068856_101698263 | 3300005614 | Bacteria | 644 |
| 114 | Ga0070702_100019143 | 3300005615 | Bacteria | 3563 |
| 115 | Ga0070702_100469588 | 3300005615 | Bacteria | 917 |
| 116 | Ga0068852_100348236 | 3300005616 | Bacteria | 1446 |
| 117 | Ga0068859_100071001 | 3300005617 | Bacteria | 3517 |
| 118 | Ga0068864_100088136 | 3300005618 | Bacteria | 2733 |
| 119 | Ga0068864_100316532 | 3300005618 | Bacteria | 1464 |
| 120 | Ga0068866_11269959 | 3300005718 | Bacteria | 534 |
| 121 | Ga0068861_100600781 | 3300005719 | Bacteria | 1010 |
| 122 | Ga0068861_101854549 | 3300005719 | Bacteria | 599 |
| 123 | Ga0068851_10366750 | 3300005834 | Bacteria | 841 |
| 124 | Ga0068863_100067439 | 3300005841 | Bacteria | 3384 |
| 125 | Ga0068863_100615180 | 3300005841 | Bacteria | 1076 |
| 126 | Ga0068858_100059299 | 3300005842 | Bacteria | 3537 |
| 127 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 128 | Ga0068860_100094153 | 3300005843 | Bacteria | 2855 |
| 129 | Ga0068860_102313443 | 3300005843 | Bacteria | 558 |
| 130 | Ga0068862_100500977 | 3300005844 | Bacteria | 1153 |
| 131 | Ga0081455_10551309 | 3300005937 | Bacteria | 762 |
| 132 | Ga0081540_1027303 | 3300005983 | Bacteria | 3238 |
| 133 | Ga0081540_1029140 | 3300005983 | Bacteria | 3082 |
| 134 | Ga0070717_10003328 | 3300006028 | Bacteria | 11477 |
| 135 | Ga0070717_10007544 | 3300006028 | Bacteria | 8083 |
| 136 | Ga0070717_10221253 | 3300006028 | Bacteria | 1664 |
| 137 | Ga0070717_10391088 | 3300006028 | Bacteria | 1248 |
| 138 | Ga0070717_10780830 | 3300006028 | Bacteria | 869 |
| 139 | Ga0070717_10904072 | 3300006028 | Bacteria | 804 |
| 140 | Ga0075365_10339531 | 3300006038 | Bacteria | 1058 |
| 141 | Ga0075364_10105653 | 3300006051 | Bacteria | 1876 |
| 142 | Ga0070715_10093139 | 3300006163 | Bacteria | 1391 |
| 143 | Ga0070715_10179947 | 3300006163 | Bacteria | 1059 |
| 144 | Ga0070715_10277313 | 3300006163 | Bacteria | 887 |
| 145 | Ga0070715_10595935 | 3300006163 | Bacteria | 647 |
| 146 | Ga0070716_100002233 | 3300006173 | Bacteria | 8923 |
| 147 | Ga0070716_100031117 | 3300006173 | Bacteria | 2900 |
| 148 | Ga0070712_100010775 | 3300006175 | Bacteria | 5779 |
| 149 | Ga0070712_100051207 | 3300006175 | Bacteria | 2876 |
| 150 | Ga0070712_100156648 | 3300006175 | Bacteria | 1755 |
| 151 | Ga0070712_100441075 | 3300006175 | Bacteria | 1083 |
| 152 | Ga0070712_100771012 | 3300006175 | Bacteria | 824 |
| 153 | Ga0097621_100008876 | 3300006237 | Bacteria | 7268 |
| 154 | Ga0097621_100026444 | 3300006237 | Bacteria | 4552 |
| 155 | Ga0097621_100359483 | 3300006237 | Bacteria | 1297 |
| 156 | Ga0097621_101183291 | 3300006237 | Bacteria | 720 |
| 157 | Ga0068871_100015537 | 3300006358 | Bacteria | 5702 |
| 158 | Ga0068871_100241467 | 3300006358 | Bacteria | 1571 |
| 159 | Ga0075433_10423626 | 3300006852 | Bacteria | 1174 |
| 160 | Ga0075434_100512931 | 3300006871 | Bacteria | 1219 |
| 161 | Ga0075434_100581087 | 3300006871 | Bacteria | 1139 |
| 162 | Ga0068865_100009015 | 3300006881 | Bacteria | 6171 |
| 163 | Ga0068865_100415311 | 3300006881 | Bacteria | 1105 |
| 164 | Ga0075436_100031219 | 3300006914 | Bacteria | 3668 |
| 165 | Ga0075436_100414882 | 3300006914 | Bacteria | 977 |
| 166 | Ga0097620_100071001 | 3300006931 | Bacteria | 3517 |
| 167 | Ga0075435_100492508 | 3300007076 | Bacteria | 1059 |
| 168 | Ga0099794_10252337 | 3300007265 | Bacteria | 910 |
| 169 | Ga0105251_10012262 | 3300009011 | Bacteria | 4857 |
| 170 | Ga0105245_10038270 | 3300009098 | Bacteria | 4268 |
| 171 | Ga0105245_10287853 | 3300009098 | Bacteria | 1608 |
| 172 | Ga0105245_11861990 | 3300009098 | Bacteria | 655 |
| 173 | Ga0105247_10079094 | 3300009101 | Bacteria | 2069 |
| 174 | Ga0105247_10086615 | 3300009101 | Bacteria | 1982 |
| 175 | Ga0105247_10295137 | 3300009101 | Bacteria | 1122 |
| 176 | Ga0105247_10390936 | 3300009101 | Bacteria | 988 |
| 177 | Ga0105247_11027366 | 3300009101 | Bacteria | 645 |
| 178 | Ga0105243_10080808 | 3300009148 | Bacteria | 2652 |
| 179 | Ga0105243_10374450 | 3300009148 | Bacteria | 1315 |
| 180 | Ga0105241_10037102 | 3300009174 | Bacteria | 3671 |
| 181 | Ga0105241_10141127 | 3300009174 | Bacteria | 1962 |
| 182 | Ga0105241_10358358 | 3300009174 | Bacteria | 1268 |
| 183 | Ga0105242_10006274 | 3300009176 | Bacteria | 9156 |
| 184 | Ga0105242_10059085 | 3300009176 | Bacteria | 3145 |
| 185 | Ga0105242_10408608 | 3300009176 | Bacteria | 1269 |
| 186 | Ga0105248_10065160 | 3300009177 | Bacteria | 4090 |
| 187 | Ga0105248_10207704 | 3300009177 | Bacteria | 2206 |
| 188 | Ga0105248_11436975 | 3300009177 | Bacteria | 781 |
| 189 | Ga0105237_10021234 | 3300009545 | Bacteria | 6678 |
| 190 | Ga0105237_10714057 | 3300009545 | Bacteria | 1009 |
| 191 | Ga0105237_10996490 | 3300009545 | Bacteria | 845 |
| 192 | Ga0105238_10027647 | 3300009551 | Bacteria | 5781 |
| 193 | Ga0105238_10373216 | 3300009551 | Bacteria | 1417 |
| 194 | Ga0105238_11148679 | 3300009551 | Bacteria | 800 |
| 195 | Ga0105238_12070457 | 3300009551 | Bacteria | 603 |
| 196 | Ga0105238_12678210 | 3300009551 | Bacteria | 535 |
| 197 | Ga0105249_11247695 | 3300009553 | Bacteria | 815 |
| 198 | Ga0105249_11523571 | 3300009553 | Bacteria | 741 |
| 199 | Ga0105249_12134949 | 3300009553 | Bacteria | 633 |
| 200 | Ga0105239_10074149 | 3300010375 | Bacteria | 3742 |
| 201 | Ga0105239_10267093 | 3300010375 | Bacteria | 1924 |
| 202 | Ga0105239_10304214 | 3300010375 | Bacteria | 1796 |
| 203 | Ga0105239_10599290 | 3300010375 | Bacteria | 1257 |
| 204 | Ga0105239_11040318 | 3300010375 | Bacteria | 942 |
| 205 | Ga0105239_11652668 | 3300010375 | Bacteria | 741 |
| 206 | Ga0105239_12356119 | 3300010375 | Bacteria | 620 |
| 207 | Ga0105246_10053735 | 3300011119 | Bacteria | 2773 |
| 208 | Ga0105246_10296493 | 3300011119 | Bacteria | 1303 |
| 209 | Ga0157336_1011918 | 3300012477 | Bacteria | 683 |
| 210 | Ga0157335_1000825 | 3300012492 | Bacteria | 1544 |
| 211 | Ga0157345_1019228 | 3300012498 | Bacteria | 681 |
| 212 | Ga0157314_1052637 | 3300012500 | Bacteria | 525 |
| 213 | Ga0157313_1026749 | 3300012503 | Bacteria | 628 |
| 214 | Ga0157324_1030507 | 3300012506 | Bacteria | 608 |
| 215 | Ga0157316_1027201 | 3300012510 | Bacteria | 669 |
| 216 | Ga0157338_1017731 | 3300012515 | Bacteria | 800 |
| 217 | Ga0157370_11778711 | 3300013104 | Bacteria | 553 |
| 218 | Ga0157374_10179291 | 3300013296 | Bacteria | 2069 |
| 219 | Ga0157374_10208823 | 3300013296 | Bacteria | 1914 |
| 220 | Ga0157378_10094941 | 3300013297 | Bacteria | 2716 |
| 221 | Ga0157378_10934671 | 3300013297 | Bacteria | 899 |
| 222 | Ga0157378_11010931 | 3300013297 | Bacteria | 866 |
| 223 | Ga0157378_12095805 | 3300013297 | Bacteria | 616 |
| 224 | Ga0163162_10108966 | 3300013306 | Bacteria | 2866 |
| 225 | Ga0163162_10246430 | 3300013306 | Bacteria | 1918 |
| 226 | Ga0163162_11121669 | 3300013306 | Bacteria | 891 |
| 227 | Ga0157372_10134988 | 3300013307 | Bacteria | 2841 |
| 228 | Ga0157372_12182728 | 3300013307 | Bacteria | 636 |
| 229 | Ga0157375_10135433 | 3300013308 | Bacteria | 2586 |
| 230 | Ga0157375_10329773 | 3300013308 | Bacteria | 1691 |
| 231 | Ga0157375_10852394 | 3300013308 | Bacteria | 1058 |
| 232 | Ga0163163_10335512 | 3300014325 | Bacteria | 1567 |
| 233 | Ga0163163_10753207 | 3300014325 | Bacteria | 1037 |
| 234 | Ga0157380_11841068 | 3300014326 | Bacteria | 665 |
| 235 | Ga0157379_10007831 | 3300014968 | Bacteria | 9252 |
| 236 | Ga0157379_10166035 | 3300014968 | Bacteria | 1992 |
| 237 | Ga0157379_10829249 | 3300014968 | Bacteria | 874 |
| 238 | Ga0157376_10448835 | 3300014969 | Bacteria | 1257 |
| 239 | Ga0157376_10873512 | 3300014969 | Bacteria | 916 |
| 240 | Ga0157376_10973157 | 3300014969 | Bacteria | 870 |
| 241 | Ga0163161_10026256 | 3300017792 | Bacteria | 4126 |
| 242 | Ga0163161_10068276 | 3300017792 | Bacteria | 2597 |
| 243 | Ga0213876_10179521 | 3300021384 | Bacteria | 1126 |
| 244 | Ga0213875_10477209 | 3300021388 | Bacteria | 598 |
| 245 | Ga0207697_10228483 | 3300025315 | Bacteria | 821 |
| 246 | Ga0207692_10005372 | 3300025898 | Bacteria | 5131 |
| 247 | Ga0207692_10069774 | 3300025898 | Bacteria | 1848 |
| 248 | Ga0207692_10340830 | 3300025898 | Bacteria | 922 |
| 249 | Ga0207692_10361122 | 3300025898 | Bacteria | 897 |
| 250 | Ga0207692_10564439 | 3300025898 | Bacteria | 728 |
| 251 | Ga0207642_10301087 | 3300025899 | Bacteria | 929 |
| 252 | Ga0207710_10046975 | 3300025900 | Bacteria | 1928 |
| 253 | Ga0207710_10050402 | 3300025900 | Bacteria | 1868 |
| 254 | Ga0207710_10072035 | 3300025900 | Bacteria | 1586 |
| 255 | Ga0207710_10162358 | 3300025900 | Bacteria | 1089 |
| 256 | Ga0207710_10359226 | 3300025900 | Bacteria | 743 |
| 257 | Ga0207710_10401078 | 3300025900 | Bacteria | 704 |
| 258 | Ga0207688_10391025 | 3300025901 | Bacteria | 861 |
| 259 | Ga0207680_10029075 | 3300025903 | Bacteria | 3100 |
| 260 | Ga0207685_10004129 | 3300025905 | Bacteria | 3644 |
| 261 | Ga0207685_10029551 | 3300025905 | Bacteria | 1941 |
| 262 | Ga0207685_10090429 | 3300025905 | Bacteria | 1287 |
| 263 | Ga0207685_10174449 | 3300025905 | Bacteria | 992 |
| 264 | Ga0207685_10179973 | 3300025905 | Bacteria | 979 |
| 265 | Ga0207699_10001161 | 3300025906 | Bacteria | 12456 |
| 266 | Ga0207699_10012349 | 3300025906 | Bacteria | 4344 |
| 267 | Ga0207699_10014207 | 3300025906 | Bacteria | 4097 |
| 268 | Ga0207699_10140066 | 3300025906 | Bacteria | 1589 |
| 269 | Ga0207699_10328840 | 3300025906 | Bacteria | 1074 |
| 270 | Ga0207699_10405139 | 3300025906 | Bacteria | 972 |
| 271 | Ga0207645_10023325 | 3300025907 | Bacteria | 4022 |
| 272 | Ga0207645_10528976 | 3300025907 | Bacteria | 799 |
| 273 | Ga0207705_11434259 | 3300025909 | Bacteria | 524 |
| 274 | Ga0207654_10043742 | 3300025911 | Bacteria | 2540 |
| 275 | Ga0207654_10066063 | 3300025911 | Bacteria | 2132 |
| 276 | Ga0207654_10235678 | 3300025911 | Bacteria | 1221 |
| 277 | Ga0207707_10026208 | 3300025912 | Bacteria | 5096 |
| 278 | Ga0207707_10340876 | 3300025912 | Bacteria | 1292 |
| 279 | Ga0207671_10245556 | 3300025914 | Bacteria | 1407 |
| 280 | Ga0207671_10642360 | 3300025914 | Bacteria | 845 |
| 281 | Ga0207693_10003131 | 3300025915 | Bacteria | 14229 |
| 282 | Ga0207693_10043770 | 3300025915 | Bacteria | 3520 |
| 283 | Ga0207693_10058351 | 3300025915 | Bacteria | 3024 |
| 284 | Ga0207693_10181380 | 3300025915 | Bacteria | 1657 |
| 285 | Ga0207693_10225292 | 3300025915 | Bacteria | 1473 |
| 286 | Ga0207663_10015462 | 3300025916 | Bacteria | 4210 |
| 287 | Ga0207663_10061185 | 3300025916 | Bacteria | 2388 |
| 288 | Ga0207663_10071436 | 3300025916 | Bacteria | 2240 |
| 289 | Ga0207663_10188456 | 3300025916 | Bacteria | 1479 |
| 290 | Ga0207663_10380554 | 3300025916 | Bacteria | 1075 |
| 291 | Ga0207660_10788538 | 3300025917 | Bacteria | 775 |
| 292 | Ga0207657_10162543 | 3300025919 | Bacteria | 1813 |
| 293 | Ga0207649_10148323 | 3300025920 | Bacteria | 1612 |
| 294 | Ga0207652_10098796 | 3300025921 | Bacteria | 2575 |
| 295 | Ga0207652_10246038 | 3300025921 | Bacteria | 1612 |
| 296 | Ga0207652_10599659 | 3300025921 | Bacteria | 988 |
| 297 | Ga0207681_10554856 | 3300025923 | Bacteria | 946 |
| 298 | Ga0207694_10040173 | 3300025924 | Bacteria | 3601 |
| 299 | Ga0207694_10150540 | 3300025924 | Bacteria | 1874 |
| 300 | Ga0207694_10633556 | 3300025924 | Bacteria | 900 |
| 301 | Ga0207650_10259172 | 3300025925 | Bacteria | 1410 |
| 302 | Ga0207659_11661661 | 3300025926 | Bacteria | 544 |
| 303 | Ga0207687_10012582 | 3300025927 | Bacteria | 5527 |
| 304 | Ga0207687_10033806 | 3300025927 | Bacteria | 3469 |
| 305 | Ga0207687_10757178 | 3300025927 | Bacteria | 827 |
| 306 | Ga0207700_10000917 | 3300025928 | Bacteria | 16892 |
| 307 | Ga0207700_10021942 | 3300025928 | Bacteria | 4372 |
| 308 | Ga0207700_10053149 | 3300025928 | Bacteria | 3033 |
| 309 | Ga0207700_10102651 | 3300025928 | Bacteria | 2285 |
| 310 | Ga0207700_10993708 | 3300025928 | Bacteria | 751 |
| 311 | Ga0207700_11438312 | 3300025928 | Bacteria | 612 |
| 312 | Ga0207664_10100523 | 3300025929 | Bacteria | 2388 |
| 313 | Ga0207664_10261339 | 3300025929 | Bacteria | 1514 |
| 314 | Ga0207664_10395828 | 3300025929 | Bacteria | 1228 |
| 315 | Ga0207664_10418862 | 3300025929 | Bacteria | 1193 |
| 316 | Ga0207664_11175493 | 3300025929 | Bacteria | 685 |
| 317 | Ga0207664_11915049 | 3300025929 | Bacteria | 516 |
| 318 | Ga0207644_10007559 | 3300025931 | Bacteria | 7084 |
| 319 | Ga0207644_10115945 | 3300025931 | Bacteria | 2032 |
| 320 | Ga0207644_11390102 | 3300025931 | Bacteria | 590 |
| 321 | Ga0207706_10014945 | 3300025933 | Bacteria | 7030 |
| 322 | Ga0207706_10189748 | 3300025933 | Bacteria | 1804 |
| 323 | Ga0207686_10011564 | 3300025934 | Bacteria | 4836 |
| 324 | Ga0207686_10507143 | 3300025934 | Bacteria | 937 |
| 325 | Ga0207686_10847197 | 3300025934 | Bacteria | 735 |
| 326 | Ga0207709_10125631 | 3300025935 | Bacteria | 1739 |
| 327 | Ga0207709_10459689 | 3300025935 | Bacteria | 986 |
| 328 | Ga0207709_10818320 | 3300025935 | Bacteria | 753 |
| 329 | Ga0207670_10017561 | 3300025936 | Bacteria | 4326 |
| 330 | Ga0207669_10767290 | 3300025937 | Bacteria | 797 |
| 331 | Ga0207669_11343895 | 3300025937 | Bacteria | 608 |
| 332 | Ga0207704_11180102 | 3300025938 | Bacteria | 652 |
| 333 | Ga0207704_11339485 | 3300025938 | Bacteria | 613 |
| 334 | Ga0207665_10000333 | 3300025939 | Bacteria | 32450 |
| 335 | Ga0207665_10021917 | 3300025939 | Bacteria | 4201 |
| 336 | Ga0207665_10111445 | 3300025939 | Bacteria | 1923 |
| 337 | Ga0207711_10086244 | 3300025941 | Bacteria | 2752 |
| 338 | Ga0207711_10107904 | 3300025941 | Bacteria | 2472 |
| 339 | Ga0207711_10988006 | 3300025941 | Bacteria | 781 |
| 340 | Ga0207689_10031849 | 3300025942 | Bacteria | 4386 |
| 341 | Ga0207661_10862847 | 3300025944 | Bacteria | 833 |
| 342 | Ga0207679_10701872 | 3300025945 | Bacteria | 918 |
| 343 | Ga0207679_10876866 | 3300025945 | Bacteria | 820 |
| 344 | Ga0207679_11669890 | 3300025945 | Bacteria | 583 |
| 345 | Ga0207667_10168621 | 3300025949 | Bacteria | 2250 |
| 346 | Ga0207667_10230228 | 3300025949 | Bacteria | 1898 |
| 347 | Ga0207667_10814489 | 3300025949 | Bacteria | 930 |
| 348 | Ga0207651_10072873 | 3300025960 | Bacteria | 2440 |
| 349 | Ga0207712_10538677 | 3300025961 | Bacteria | 1003 |
| 350 | Ga0207712_11132787 | 3300025961 | Bacteria | 697 |
| 351 | Ga0207658_10047022 | 3300025986 | Bacteria | 3155 |
| 352 | Ga0207658_10071512 | 3300025986 | Bacteria | 2627 |
| 353 | Ga0207677_10139446 | 3300026023 | Bacteria | 1854 |
| 354 | Ga0207677_11789826 | 3300026023 | Bacteria | 570 |
| 355 | Ga0207703_10139094 | 3300026035 | Bacteria | 2105 |
| 356 | Ga0207703_10333842 | 3300026035 | Bacteria | 1391 |
| 357 | Ga0207703_10921854 | 3300026035 | Bacteria | 837 |
| 358 | Ga0207703_11003981 | 3300026035 | Bacteria | 801 |
| 359 | Ga0207703_12020444 | 3300026035 | Bacteria | 553 |
| 360 | Ga0207639_10089016 | 3300026041 | Bacteria | 2465 |
| 361 | Ga0207639_10400976 | 3300026041 | Bacteria | 1236 |
| 362 | Ga0207639_10909645 | 3300026041 | Bacteria | 823 |
| 363 | Ga0207639_11390914 | 3300026041 | Bacteria | 659 |
| 364 | Ga0207678_10097972 | 3300026067 | Bacteria | 2505 |
| 365 | Ga0207678_10107195 | 3300026067 | Bacteria | 2383 |
| 366 | Ga0207678_10239787 | 3300026067 | Bacteria | 1553 |
| 367 | Ga0207708_10038595 | 3300026075 | Bacteria | 3638 |
| 368 | Ga0207708_10354172 | 3300026075 | Bacteria | 1205 |
| 369 | Ga0207702_10276224 | 3300026078 | Bacteria | 1586 |
| 370 | Ga0207702_11533230 | 3300026078 | Bacteria | 660 |
| 371 | Ga0207641_10212558 | 3300026088 | Bacteria | 1789 |
| 372 | Ga0207641_10750393 | 3300026088 | Bacteria | 963 |
| 373 | Ga0207641_11516139 | 3300026088 | Bacteria | 672 |
| 374 | Ga0207648_10124866 | 3300026089 | Bacteria | 2263 |
| 375 | Ga0207648_10186503 | 3300026089 | Bacteria | 1837 |
| 376 | Ga0207676_10186879 | 3300026095 | Bacteria | 1819 |
| 377 | Ga0207675_102137106 | 3300026118 | Bacteria | 576 |
| 378 | Ga0207683_10001447 | 3300026121 | Bacteria | 21461 |
| 379 | Ga0207683_10153592 | 3300026121 | Bacteria | 2078 |
| 380 | Ga0207683_10254310 | 3300026121 | Bacteria | 1603 |
| 381 | Ga0207698_10383176 | 3300026142 | Bacteria | 1338 |
| 382 | Ga0207698_10398539 | 3300026142 | Bacteria | 1315 |
| 383 | Ga0209971_1154606 | 3300027682 | Bacteria | 566 |
| 384 | Ga0209966_1014410 | 3300027695 | Bacteria | 1475 |
| 385 | Ga0209974_10036257 | 3300027876 | Bacteria | 1638 |
| 386 | Ga0265357_1020655 | 3300028023 | Bacteria | 720 |
| 387 | Ga0268266_10025953 | 3300028379 | Bacteria | 4984 |
| 388 | Ga0268266_10136477 | 3300028379 | Bacteria | 2198 |
| 389 | Ga0268266_10243092 | 3300028379 | Bacteria | 1662 |
| 390 | Ga0268265_12194390 | 3300028380 | Bacteria | 559 |
| 391 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 392 | Ga0268264_10483253 | 3300028381 | Bacteria | 1205 |
| 393 | Ga0268264_10656641 | 3300028381 | Bacteria | 1038 |
| 394 | Ga0265337_1001486 | 3300028556 | Bacteria | 11490 |
| 395 | Ga0265338_10247553 | 3300028800 | Bacteria | 1316 |
| 396 | Ga0265338_10306413 | 3300028800 | Bacteria | 1153 |
| 397 | Ga0307511_10107189 | 3300030521 | Bacteria | 1800 |
| 398 | Ga0265763_1005459 | 3300030763 | Bacteria | 1067 |
| 399 | Ga0265773_1031879 | 3300031018 | Bacteria | 570 |
| 400 | Ga0265332_10000899 | 3300031238 | Bacteria | 17859 |
| 401 | Ga0265332_10175142 | 3300031238 | Bacteria | 895 |
| 402 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 403 | Ga0265325_10083742 | 3300031241 | Bacteria | 1582 |
| 404 | Ga0265325_10242883 | 3300031241 | Bacteria | 818 |
| 405 | Ga0265329_10221386 | 3300031242 | Bacteria | 626 |
| 406 | Ga0265340_10005450 | 3300031247 | Bacteria | 7065 |
| 407 | Ga0265340_10166484 | 3300031247 | Bacteria | 1000 |
| 408 | Ga0265339_10058197 | 3300031249 | Bacteria | 2087 |
| 409 | Ga0265339_10210681 | 3300031249 | Bacteria | 955 |
| 410 | Ga0265331_10149249 | 3300031250 | Bacteria | 1062 |
| 411 | Ga0265316_10261497 | 3300031344 | Bacteria | 1269 |
| 412 | Ga0265316_10278153 | 3300031344 | Bacteria | 1223 |
| 413 | Ga0307509_10014245 | 3300031507 | Bacteria | 9362 |
| 414 | Ga0265313_10036963 | 3300031595 | Bacteria | 2447 |
| 415 | Ga0307508_10173191 | 3300031616 | Bacteria | 1761 |
| 416 | Ga0265314_10000784 | 3300031711 | Bacteria | 37699 |
| 417 | Ga0265314_10005953 | 3300031711 | Bacteria | 10894 |
| 418 | Ga0265314_10044806 | 3300031711 | Bacteria | 3132 |
| 419 | Ga0265342_10000392 | 3300031712 | Bacteria | 48362 |
| 420 | Ga0265342_10166027 | 3300031712 | Bacteria | 1218 |
| 421 | Ga0307516_10005995 | 3300031730 | Bacteria | 14363 |
| 422 | Ga0326468_10081748 | 3300031889 | Bacteria | 559 |
| 423 | Ga0307510_10283860 | 3300033180 | Bacteria | 1125 |
| 424 | Ga0373950_0018390 | 3300034818 | Bacteria | 1212 |
| 425 | Ga0373958_0085356 | 3300034819 | Bacteria | 720 |
| 426 | Ga0373959_0017137 | 3300034820 | Bacteria | 1350 |
| 427 | Ga0373959_0087871 | 3300034820 | Bacteria | 725 |
| 428 | Ga0373938_0008109 | 3300034957 | Bacteria | 1868 |
| 429 | Ga0373926_0006103 | 3300035083 | Bacteria | 3991 |
| 430 | Ga0373928_0004039 | 3300035084 | Bacteria | 2800 |
| 431 | Ga0373934_0022825 | 3300035086 | Bacteria | 2415 |
| 432 | Ga0373934_0120017 | 3300035086 | Bacteria | 1069 |
| 433 | Ga0373940_0167330 | 3300035088 | Bacteria | 709 |
| 434 | Ga0373949_0027055 | 3300035090 | Bacteria | 1347 |
| 435 | Ga0373951_0006562 | 3300035091 | Bacteria | 2660 |
| 436 | Ga0373952_0061984 | 3300035092 | Bacteria | 917 |
| 437 | Ga0373923_0078244 | 3300035111 | Bacteria | 1431 |
| 438 | Ga0373932_0003814 | 3300035112 | Bacteria | 3601 |
| 439 | Ga0373932_0181145 | 3300035112 | Bacteria | 739 |
| 440 | Ga0373939_0016078 | 3300035114 | Bacteria | 1968 |
| 441 | Ga0373941_0013677 | 3300035115 | Bacteria | 2152 |
| 442 | Ga0373945_0055006 | 3300035116 | Bacteria | 1472 |
| 443 | Ga0373953_0006441 | 3300035117 | Bacteria | 3868 |
| 444 | Ga0373953_0042214 | 3300035117 | Bacteria | 1817 |
| 445 | Ga0373953_0128359 | 3300035117 | Bacteria | 1080 |
| 446 | Ga0373954_0008900 | 3300035118 | Bacteria | 4417 |
| 447 | Ga0373954_0200643 | 3300035118 | Bacteria | 980 |
| 448 | Ga0373954_0224537 | 3300035118 | Bacteria | 924 |
| 449 | Ga0373956_0019629 | 3300035119 | Bacteria | 2868 |
| 450 | Ga0373956_0076710 | 3300035119 | Bacteria | 1530 |
| 451 | Ga0373956_0257183 | 3300035119 | Bacteria | 830 |
| 452 | Ga0373957_0341802 | 3300035120 | Bacteria | 638 |
| 453 | Ga0373957_0419885 | 3300035120 | Bacteria | 577 |
| 454 | Ga0373960_0004580 | 3300035121 | Bacteria | 3174 |
| 455 | Ga0373943_0138348 | 3300035170 | Bacteria | 1310 |
| 456 | Ga0373943_0374997 | 3300035170 | Bacteria | 818 |
| 457 | Ga0373943_0433959 | 3300035170 | Bacteria | 761 |
| 458 | Ga0373946_0022847 | 3300035171 | Bacteria | 2439 |
| 459 | Ga0373946_0059173 | 3300035171 | Bacteria | 1625 |
| 460 | Ga0373946_0178157 | 3300035171 | Bacteria | 1007 |
| 461 | Ga0373955_0024935 | 3300035172 | Bacteria | 3064 |
| 462 | Ga0373955_0144548 | 3300035172 | Bacteria | 1396 |
| 463 | Ga0373955_0194939 | 3300035172 | Bacteria | 1205 |
| 464 | Ga0373955_0615985 | 3300035172 | Bacteria | 665 |
| 465 | Ga0373942_0057053 | 3300035207 | Bacteria | 1110 |
| 466 | Ga0373961_0061888 | 3300035241 | Bacteria | 1138 |
| 467 | Ga0373962_0057562 | 3300035242 | Bacteria | 1134 |
| 468 | Ga0373962_0078344 | 3300035242 | Bacteria | 999 |
| 469 | Ga0316574_0791808 | 3300035398 | Bacteria | 577 |
| 470 | Ga0373924_0008024 | 3300035410 | Bacteria | 3821 |
| 471 | Ga0373924_0029447 | 3300035410 | Bacteria | 2195 |
| 472 | Ga0373924_0033955 | 3300035410 | Bacteria | 2063 |
| 473 | Ga0373924_0044023 | 3300035410 | Bacteria | 1834 |
| 474 | Ga0373931_0004569 | 3300035691 | Bacteria | 6331 |
| 475 | Ga0373935_0004548 | 3300035692 | Bacteria | 8158 |
| 476 | Ga0373935_0015490 | 3300035692 | Bacteria | 4609 |
| 477 | Ga0373935_0035574 | 3300035692 | Bacteria | 3109 |
| 478 | Ga0373935_0067946 | 3300035692 | Bacteria | 2293 |
| 479 | Ga0373935_0104396 | 3300035692 | Bacteria | 1873 |
| 480 | Ga0373935_0677034 | 3300035692 | Bacteria | 758 |
| 481 | Ga0373927_0017601 | 3300035695 | Bacteria | 4702 |
| 482 | Ga0373927_0184081 | 3300035695 | Bacteria | 1370 |
| 483 | Ga0373927_0211276 | 3300035695 | Bacteria | 1274 |
| 484 | Ga0373933_0002449 | 3300035724 | Bacteria | 10458 |
| 485 | Ga0373933_0260278 | 3300035724 | Bacteria | 1118 |
| 486 | Ga0373947_0005403 | 3300035725 | Bacteria | 7458 |
| 487 | Ga0373947_0018365 | 3300035725 | Bacteria | 4024 |
| 488 | Ga0373947_0119293 | 3300035725 | Bacteria | 1674 |
| 489 | Ga0373947_0124973 | 3300035725 | Bacteria | 1637 |
| 490 | Ga0373947_0202839 | 3300035725 | Bacteria | 1298 |
| 491 | Ga0373947_0473216 | 3300035725 | Bacteria | 850 |
| 492 | Ga0373937_0002996 | 3300036401 | Bacteria | 14164 |
| 493 | Ga0373937_0008068 | 3300036401 | Bacteria | 9135 |
| 494 | Ga0373937_0008991 | 3300036401 | Bacteria | 8673 |
| 495 | Ga0373937_0142283 | 3300036401 | Bacteria | 2245 |
| 496 | Ga0373937_0345221 | 3300036401 | Bacteria | 1410 |
| 497 | Ga0373937_0516898 | 3300036401 | Bacteria | 1134 |
| 498 | Ga0373937_0873754 | 3300036401 | Bacteria | 848 |
| 499 | Ga0373937_2008695 | 3300036401 | Bacteria | 524 |
| 500 | Ga0373925_0025234 | 3300037068 | Bacteria | 4340 |
| 501 | Ga0373925_0098740 | 3300037068 | Bacteria | 2241 |
| 502 | Ga0373925_0101593 | 3300037068 | Bacteria | 2211 |
| 503 | Ga0373925_0742294 | 3300037068 | Bacteria | 809 |
| 504 | Ga0373925_0759985 | 3300037068 | Bacteria | 799 |
| 505 | Ga0395898_0613059 | 3300037466 | Bacteria | 1031 |
| 506 | Ga0436364_0364973 | 3300037853 | Bacteria | 864 |
| 507 | Ga0436365_0090047 | 3300039437 | Bacteria | 3528 |
| 508 | Ga0436365_0390621 | 3300039437 | Bacteria | 505 |
| 509 | Ga0436360_0203691 | 3300039438 | Bacteria | 1773 |
| 510 | Ga0439465_0071611 | 3300041413 | Bacteria | 1163 |
| 511 | Ga0451802_0275182 | 3300041460 | Bacteria | 1388 |
| 512 | Ga0451841_0043378 | 3300041498 | Bacteria | 563 |
| 513 | Ga0451843_0333450 | 3300041509 | Bacteria | 625 |
| 514 | Ga0439455_0140561 | 3300042012 | Bacteria | 684 |
| 515 | Ga0439464_0120779 | 3300042439 | Bacteria | 807 |
| 516 | Ga0439464_0128357 | 3300042439 | Bacteria | 784 |
| 517 | Ga0466967_1019021 | 3300045976 | Bacteria | 824 |
| 518 | Ga0495592_0001840 | 3300046454 | Bacteria | 14914 |
| 519 | Ga0495592_0010619 | 3300046454 | Bacteria | 6945 |
| 520 | Ga0495592_0626729 | 3300046454 | Bacteria | 653 |
| 521 | Ga0495603_0011026 | 3300046455 | Bacteria | 5480 |
| 522 | Ga0495603_0037807 | 3300046455 | Bacteria | 2895 |
| 523 | Ga0495629_0000269 | 3300046459 | Bacteria | 45206 |
| 524 | Ga0495629_0069439 | 3300046459 | Bacteria | 2458 |
| 525 | Ga0495629_0089738 | 3300046459 | Bacteria | 2144 |
| 526 | Ga0495638_0040160 | 3300046460 | Bacteria | 2966 |
| 527 | Ga0495641_0026269 | 3300046461 | Bacteria | 2843 |
| 528 | Ga0495641_0042734 | 3300046461 | Bacteria | 2099 |
| 529 | Ga0495641_0150265 | 3300046461 | Bacteria | 1041 |
| 530 | Ga0495641_0317993 | 3300046461 | Unclassified | 702 |
| 531 | Ga0495651_0005718 | 3300046462 | Bacteria | 9477 |
| 532 | Ga0495651_0010406 | 3300046462 | Bacteria | 7147 |
| 533 | Ga0495651_0064265 | 3300046462 | Bacteria | 2805 |
| 534 | Ga0495651_0185639 | 3300046462 | Bacteria | 1468 |
| 535 | Ga0495651_0360559 | 3300046462 | Bacteria | 958 |
| 536 | Ga0495651_0460971 | 3300046462 | Bacteria | 820 |
| 537 | Ga0495653_0010063 | 3300046463 | Bacteria | 7736 |
| 538 | Ga0495653_0030364 | 3300046463 | Bacteria | 4306 |
| 539 | Ga0495653_0146642 | 3300046463 | Bacteria | 1653 |
| 540 | Ga0495653_0171215 | 3300046463 | Bacteria | 1499 |
| 541 | Ga0495653_0216780 | 3300046463 | Bacteria | 1289 |
| 542 | Ga0495653_0967615 | 3300046463 | Bacteria | 504 |
| 543 | Ga0495580_0243568 | 3300046472 | Bacteria | 1232 |
| 544 | Ga0495580_0560182 | 3300046472 | Bacteria | 758 |
| 545 | Ga0495580_0651674 | 3300046472 | Bacteria | 692 |
| 546 | Ga0495582_0003928 | 3300046473 | Bacteria | 8349 |
| 547 | Ga0495582_0109872 | 3300046473 | Bacteria | 1548 |
| 548 | Ga0495639_0396873 | 3300046475 | Bacteria | 696 |
| 549 | Ga0495662_0105186 | 3300046476 | Bacteria | 1381 |
| 550 | Ga0495662_0114856 | 3300046476 | Bacteria | 1320 |
| 551 | Ga0495664_0010264 | 3300046477 | Bacteria | 5254 |
| 552 | Ga0495664_0021710 | 3300046477 | Bacteria | 3709 |
| 553 | Ga0495664_0118438 | 3300046477 | Bacteria | 1601 |
| 554 | Ga0495664_0238448 | 3300046477 | Bacteria | 1100 |
| 555 | Ga0495594_0009788 | 3300046499 | Bacteria | 4963 |
| 556 | Ga0495594_0027976 | 3300046499 | Bacteria | 3040 |
| 557 | Ga0495608_0001268 | 3300046511 | Bacteria | 17936 |
| 558 | Ga0495608_0016256 | 3300046511 | Bacteria | 5147 |
| 559 | Ga0495608_0285310 | 3300046511 | Bacteria | 1024 |
| 560 | Ga0495610_0301084 | 3300046512 | Bacteria | 618 |
| 561 | Ga0495618_0037072 | 3300046514 | Bacteria | 3061 |
| 562 | Ga0495618_0088979 | 3300046514 | Bacteria | 1974 |
| 563 | Ga0495618_0254207 | 3300046514 | Bacteria | 1102 |
| 564 | Ga0495618_0331159 | 3300046514 | Bacteria | 941 |
| 565 | Ga0495618_0574481 | 3300046514 | Bacteria | 673 |
| 566 | Ga0495618_0597161 | 3300046514 | Bacteria | 657 |
| 567 | Ga0495628_0005226 | 3300046516 | Bacteria | 11394 |
| 568 | Ga0495628_0268395 | 3300046516 | Bacteria | 1270 |
| 569 | Ga0495630_0192162 | 3300046517 | Bacteria | 1557 |
| 570 | Ga0495630_0475487 | 3300046517 | Bacteria | 958 |
| 571 | Ga0495630_0638424 | 3300046517 | Bacteria | 816 |
| 572 | Ga0495666_0167651 | 3300046526 | Bacteria | 1016 |
| 573 | Ga0495652_0061818 | 3300046529 | Bacteria | 3160 |
| 574 | Ga0495652_0077885 | 3300046529 | Bacteria | 2746 |
| 575 | Ga0495652_0216037 | 3300046529 | Bacteria | 1444 |
| 576 | Ga0495652_0224929 | 3300046529 | Bacteria | 1407 |
| 577 | Ga0495640_0006352 | 3300046533 | Bacteria | 9365 |
| 578 | Ga0495640_0018005 | 3300046533 | Bacteria | 5252 |
| 579 | Ga0495640_0040789 | 3300046533 | Bacteria | 3248 |
| 580 | Ga0495640_0422869 | 3300046533 | Bacteria | 816 |
| 581 | Ga0495586_0011910 | 3300046535 | Bacteria | 4619 |
| 582 | Ga0495586_0171759 | 3300046535 | Bacteria | 1225 |
| 583 | Ga0495587_0000620 | 3300046536 | Bacteria | 24097 |
| 584 | Ga0495587_0058326 | 3300046536 | Bacteria | 2268 |
| 585 | Ga0495645_0000848 | 3300046543 | Bacteria | 20818 |
| 586 | Ga0495645_0008343 | 3300046543 | Bacteria | 7232 |
| 587 | Ga0495645_0393965 | 3300046543 | Bacteria | 884 |
| 588 | Ga0495645_0775211 | 3300046543 | Bacteria | 577 |
| 589 | Ga0495622_0043236 | 3300046557 | Bacteria | 2095 |
| 590 | Ga0495667_0001254 | 3300046559 | Bacteria | 16638 |
| 591 | Ga0495667_0022137 | 3300046559 | Bacteria | 4283 |
| 592 | Ga0495667_0097610 | 3300046559 | Bacteria | 1902 |
| 593 | Ga0495667_0104514 | 3300046559 | Bacteria | 1831 |
| 594 | Ga0495667_0105159 | 3300046559 | Bacteria | 1825 |
| 595 | Ga0495667_0113573 | 3300046559 | Unclassified | 1750 |
| 596 | Ga0495634_0017607 | 3300046642 | Bacteria | 5096 |
| 597 | Ga0495634_0019712 | 3300046642 | Bacteria | 4790 |
| 598 | Ga0495634_0266260 | 3300046642 | Bacteria | 1044 |
| 599 | Ga0495635_0005437 | 3300046663 | Bacteria | 8861 |
| 600 | Ga0495635_0036531 | 3300046663 | Bacteria | 3405 |
| 601 | Ga0495635_0090897 | 3300046663 | Bacteria | 2088 |
| 602 | Ga0495635_0091274 | 3300046663 | Bacteria | 2083 |
| 603 | Ga0495635_0146947 | 3300046663 | Bacteria | 1605 |
| 604 | Ga0495635_0346365 | 3300046663 | Bacteria | 992 |
| 605 | Ga0495635_0466719 | 3300046663 | Bacteria | 833 |
| 606 | Ga0495661_0165033 | 3300046665 | Bacteria | 1186 |
| 607 | Ga0495588_0067758 | 3300046674 | Bacteria | 1853 |
| 608 | Ga0495657_0002939 | 3300046675 | Bacteria | 14124 |
| 609 | Ga0495657_0032408 | 3300046675 | Bacteria | 3646 |
| 610 | Ga0495599_0062103 | 3300046678 | Bacteria | 2334 |
| 611 | Ga0495599_0214597 | 3300046678 | Bacteria | 1179 |
| 612 | Ga0495623_0026867 | 3300046679 | Bacteria | 3703 |
| 613 | Ga0495623_0035166 | 3300046679 | Bacteria | 3211 |
| 614 | Ga0495646_0000856 | 3300046680 | Bacteria | 17244 |
| 615 | Ga0495646_0083480 | 3300046680 | Bacteria | 1857 |
| 616 | Ga0495646_0202842 | 3300046680 | Bacteria | 1079 |
| 617 | Ga0495647_0053754 | 3300046681 | Bacteria | 1571 |
| 618 | Ga0495658_0004553 | 3300046683 | Bacteria | 6816 |
| 619 | Ga0495658_0810370 | 3300046683 | Bacteria | 599 |
| 620 | Ga0495613_0038188 | 3300046689 | Bacteria | 3559 |
| 621 | Ga0495613_0162962 | 3300046689 | Bacteria | 1585 |
| 622 | Ga0495613_0394572 | 3300046689 | Bacteria | 945 |
| 623 | Ga0495613_0430843 | 3300046689 | Unclassified | 896 |
| 624 | Ga0495624_0040542 | 3300046690 | Bacteria | 2982 |
| 625 | Ga0495624_0137836 | 3300046690 | Bacteria | 1495 |
| 626 | Ga0495624_0387213 | 3300046690 | Bacteria | 840 |
| 627 | Ga0495624_0956348 | 3300046690 | Bacteria | 503 |
| 628 | Ga0495600_0016667 | 3300046809 | Bacteria | 4669 |
| 629 | Ga0495600_0052308 | 3300046809 | Bacteria | 2667 |
| 630 | Ga0495600_0128219 | 3300046809 | Bacteria | 1649 |
| 631 | Ga0495600_0133793 | 3300046809 | Bacteria | 1611 |
| 632 | Ga0495600_0579557 | 3300046809 | Bacteria | 683 |
| 633 | Ga0495581_0036567 | 3300047315 | Bacteria | 2841 |
| 634 | Ga0495581_0101672 | 3300047315 | Bacteria | 1670 |
| 635 | Ga0495604_0005959 | 3300047317 | Bacteria | 9671 |
| 636 | Ga0495604_0027617 | 3300047317 | Bacteria | 4512 |
| 637 | Ga0495604_0056504 | 3300047317 | Bacteria | 3020 |
| 638 | Ga0495604_0103429 | 3300047317 | Bacteria | 2089 |
| 639 | Ga0495604_0591355 | 3300047317 | Bacteria | 712 |
| 640 | Ga0495674_0005637 | 3300047319 | Bacteria | 11992 |
| 641 | Ga0495674_0061401 | 3300047319 | Bacteria | 3275 |
| 642 | Ga0495676_0034516 | 3300047321 | Bacteria | 4244 |
| 643 | Ga0495676_0144308 | 3300047321 | Bacteria | 1702 |
| 644 | Ga0495680_0001472 | 3300047322 | Bacteria | 25404 |
| 645 | Ga0495680_0006777 | 3300047322 | Bacteria | 10581 |
| 646 | Ga0495680_0017612 | 3300047322 | Bacteria | 6090 |
| 647 | Ga0495680_0018210 | 3300047322 | Bacteria | 5971 |
| 648 | Ga0495680_0022232 | 3300047322 | Bacteria | 5290 |
| 649 | Ga0495680_0217882 | 3300047322 | Bacteria | 1364 |
| 650 | Ga0495680_0241607 | 3300047322 | Bacteria | 1282 |
| 651 | Ga0495675_0018016 | 3300047444 | Bacteria | 4477 |
| 652 | Ga0495675_0048151 | 3300047444 | Bacteria | 2712 |
| 653 | Ga0495675_0168024 | 3300047444 | Bacteria | 1348 |
| 654 | Ga0495684_0031095 | 3300047471 | Bacteria | 4098 |
| 655 | Ga0495684_0047729 | 3300047471 | Bacteria | 3275 |
| 656 | Ga0495684_0213504 | 3300047471 | Bacteria | 1418 |
| 657 | Ga0495684_0294075 | 3300047471 | Bacteria | 1168 |
| 658 | Ga0495684_0298325 | 3300047471 | Bacteria | 1158 |
| 659 | Ga0495684_0633406 | 3300047471 | Bacteria | 717 |
| 660 | Ga0495593_0009204 | 3300047673 | Bacteria | 5726 |
| 661 | Ga0495602_0002664 | 3300048088 | Bacteria | 18252 |
| 662 | Ga0495602_0013607 | 3300048088 | Bacteria | 8305 |
| 663 | Ga0495602_0128650 | 3300048088 | Bacteria | 2023 |
| 664 | Ga0495602_0183138 | 3300048088 | Bacteria | 1613 |
| 665 | Ga0495602_0515833 | 3300048088 | Bacteria | 833 |
| 666 | Ga0495614_0145476 | 3300048089 | Bacteria | 1055 |
| 667 | Ga0496100_0006554 | 3300048903 | Bacteria | 6356 |
| 668 | Ga0496100_0102455 | 3300048903 | Bacteria | 1975 |
| 669 | Ga0496100_0204967 | 3300048903 | Bacteria | 1439 |
| 670 | Ga0496100_0399268 | 3300048903 | Bacteria | 1047 |
| 671 | Ga0496101_0007659 | 3300048904 | Bacteria | 7011 |
| 672 | Ga0496101_0016572 | 3300048904 | Bacteria | 4982 |
| 673 | Ga0496101_0147253 | 3300048904 | Bacteria | 1799 |
| 674 | Ga0496101_0347632 | 3300048904 | Bacteria | 1165 |
| 675 | Ga0496101_0435107 | 3300048904 | Bacteria | 1034 |
| 676 | Ga0496102_0016358 | 3300048905 | Bacteria | 6479 |
| 677 | Ga0496102_0070115 | 3300048905 | Bacteria | 3218 |
| 678 | Ga0496102_0261230 | 3300048905 | Bacteria | 1632 |
| 679 | Ga0496102_0776671 | 3300048905 | Bacteria | 880 |
| 680 | Ga0496102_0812061 | 3300048905 | Bacteria | 857 |
| 681 | Ga0496102_1210976 | 3300048905 | Bacteria | 675 |
| 682 | Ga0496103_0107057 | 3300048906 | Bacteria | 1773 |
| 683 | Ga0496103_0280558 | 3300048906 | Bacteria | 1071 |
| 684 | Ga0496103_0316878 | 3300048906 | Bacteria | 1003 |
| 685 | Ga0496104_0000215 | 3300048907 | Bacteria | 50960 |
| 686 | Ga0496104_0005956 | 3300048907 | Bacteria | 10678 |
| 687 | Ga0496104_0097659 | 3300048907 | Bacteria | 2812 |
| 688 | Ga0496104_0243034 | 3300048907 | Bacteria | 1712 |
| 689 | Ga0496104_0374856 | 3300048907 | Bacteria | 1335 |
| 690 | Ga0496104_0498536 | 3300048907 | Bacteria | 1129 |
| 691 | Ga0496105_0007651 | 3300048908 | Bacteria | 8374 |
| 692 | Ga0496105_0020355 | 3300048908 | Bacteria | 5361 |
| 693 | Ga0496105_0157101 | 3300048908 | Bacteria | 1867 |
| 694 | Ga0496105_0242092 | 3300048908 | Bacteria | 1464 |
| 695 | Ga0496105_0429422 | 3300048908 | Bacteria | 1045 |
| 696 | Ga0496105_0515938 | 3300048908 | Bacteria | 936 |
| 697 | Ga0496106_0001857 | 3300048909 | Bacteria | 15809 |
| 698 | Ga0496106_0019937 | 3300048909 | Bacteria | 4973 |
| 699 | Ga0496106_0067503 | 3300048909 | Bacteria | 2726 |
| 700 | Ga0496107_0019768 | 3300048910 | Bacteria | 4754 |
| 701 | Ga0496107_0295593 | 3300048910 | Bacteria | 1205 |
| 702 | Ga0496107_0520826 | 3300048910 | Bacteria | 881 |
| 703 | Ga0496108_0056436 | 3300048911 | Bacteria | 3299 |
| 704 | Ga0496108_0057496 | 3300048911 | Bacteria | 3268 |
| 705 | Ga0496108_0241156 | 3300048911 | Bacteria | 1572 |
| 706 | Ga0496108_0448952 | 3300048911 | Bacteria | 1126 |
| 707 | Ga0496109_0133946 | 3300048912 | Bacteria | 2314 |
| 708 | Ga0496109_0156658 | 3300048912 | Bacteria | 2133 |
| 709 | Ga0496109_0389585 | 3300048912 | Bacteria | 1316 |
| 710 | Ga0496109_0401126 | 3300048912 | Bacteria | 1295 |
| 711 | Ga0496109_0961668 | 3300048912 | Bacteria | 792 |
| 712 | Ga0496109_1184394 | 3300048912 | Bacteria | 701 |
| 713 | Ga0496110_0022488 | 3300048913 | Bacteria | 5355 |
| 714 | Ga0496110_0302206 | 3300048913 | Bacteria | 1457 |
| 715 | Ga0496110_0356076 | 3300048913 | Bacteria | 1333 |
| 716 | Ga0496110_0368896 | 3300048913 | Bacteria | 1308 |
| 717 | Ga0496111_0084837 | 3300048914 | Bacteria | 2315 |
| 718 | Ga0496111_0317797 | 3300048914 | Bacteria | 1153 |
| 719 | Ga0496112_0193985 | 3300048915 | Bacteria | 1992 |
| 720 | Ga0496112_0195658 | 3300048915 | Bacteria | 1982 |
| 721 | Ga0496112_0570510 | 3300048915 | Bacteria | 1064 |
| 722 | Ga0496112_0830786 | 3300048915 | Bacteria | 848 |
| 723 | Ga0496112_1243055 | 3300048915 | Bacteria | 661 |
| 724 | Ga0496113_0251371 | 3300048916 | Bacteria | 1411 |
| 725 | Ga0496113_0427014 | 3300048916 | Bacteria | 1064 |
| 726 | Ga0496113_0436095 | 3300048916 | Bacteria | 1052 |
| 727 | Ga0496113_1451526 | 3300048916 | Bacteria | 530 |
| 728 | Ga0496114_0076223 | 3300048917 | Bacteria | 2825 |
| 729 | Ga0496114_0376999 | 3300048917 | Bacteria | 1256 |
| 730 | Ga0496114_1041826 | 3300048917 | Bacteria | 702 |
| 731 | Ga0496115_0013246 | 3300048918 | Bacteria | 6231 |
| 732 | Ga0496115_0073757 | 3300048918 | Bacteria | 2770 |
| 733 | Ga0496115_0099732 | 3300048918 | Bacteria | 2380 |
| 734 | Ga0496115_0582525 | 3300048918 | Bacteria | 891 |
| 735 | Ga0496115_0713092 | 3300048918 | Bacteria | 787 |
| 736 | Ga0496115_0759486 | 3300048918 | Bacteria | 757 |
| 737 | Ga0496115_1243551 | 3300048918 | Bacteria | 557 |
| 738 | Ga0496117_0010071 | 3300048920 | Bacteria | 8683 |
| 739 | Ga0496118_0008611 | 3300048921 | Bacteria | 10500 |
| 740 | Ga0496119_0145579 | 3300048922 | Bacteria | 1275 |
| 741 | Ga0496121_0002635 | 3300048924 | Bacteria | 27038 |
| 742 | Ga0496121_0166584 | 3300048924 | Bacteria | 1605 |
| 743 | Ga0496121_0450721 | 3300048924 | Bacteria | 829 |
| 744 | Ga0496122_0052608 | 3300048925 | Bacteria | 3080 |
| 745 | Ga0496124_0011581 | 3300048927 | Bacteria | 8801 |
| 746 | Ga0496124_0378319 | 3300048927 | Bacteria | 991 |
| 747 | Ga0496125_0000746 | 3300048928 | Bacteria | 53671 |
| 748 | Ga0496125_0131030 | 3300048928 | Bacteria | 1765 |
| 749 | Ga0496126_0002122 | 3300048929 | Bacteria | 27701 |
| 750 | Ga0496126_0038000 | 3300048929 | Bacteria | 4482 |
| 751 | Ga0496126_0108022 | 3300048929 | Bacteria | 2426 |
| 752 | Ga0496126_0157082 | 3300048929 | Bacteria | 1946 |
| 753 | Ga0496126_0208556 | 3300048929 | Bacteria | 1646 |
| 754 | Ga0496126_0430274 | 3300048929 | Bacteria | 1065 |
| 755 | Ga0496126_0661143 | 3300048929 | Bacteria | 816 |
| 756 | Ga0501031_0255750 | 3300049568 | Bacteria | 1138 |
| 757 | Ga0501034_0182998 | 3300049571 | Bacteria | 2060 |
| 758 | Ga0501036_0114702 | 3300049572 | Bacteria | 2277 |
| 759 | Ga0501039_1344434 | 3300049575 | Bacteria | 551 |
| 760 | Ga0501042_0286813 | 3300049578 | Bacteria | 1189 |
| 761 | Ga0501043_0448869 | 3300049579 | Bacteria | 969 |
| 762 | Ga0501043_1083288 | 3300049579 | Bacteria | 567 |
| 763 | Ga0501047_0008787 | 3300049581 | Bacteria | 9533 |
| 764 | Ga0501047_0611642 | 3300049581 | Bacteria | 911 |
| 765 | Ga0501067_0711546 | 3300049583 | Bacteria | 565 |
| 766 | Ga0501068_0691835 | 3300049584 | Bacteria | 667 |
| 767 | Ga0501070_0367305 | 3300049586 | Bacteria | 1167 |
| 768 | Ga0501073_0034839 | 3300049589 | Bacteria | 3581 |
| 769 | Ga0501075_0734248 | 3300049591 | Bacteria | 752 |
| 770 | Ga0501076_0220426 | 3300049592 | Bacteria | 1550 |
| 771 | Ga0501079_0565858 | 3300049741 | Bacteria | 894 |
| 772 | Ga0501080_1170424 | 3300049742 | Bacteria | 662 |
| 773 | Ga0501081_0672417 | 3300049743 | Bacteria | 777 |
| 774 | Ga0501083_0023331 | 3300049744 | Bacteria | 4292 |
| 775 | Ga0501035_0657975 | 3300049822 | Bacteria | 849 |
| 776 | Ga0501044_0103888 | 3300049823 | Bacteria | 2856 |
| 777 | Ga0501044_0118153 | 3300049823 | Bacteria | 2655 |
| 778 | nmdc:mga03n38_684651_c1 | 3300050490 | Bacteria | 590 |
| 779 | nmdc:mga00v17_900844_c1 | 3300050491 | Bacteria | 560 |
| 780 | nmdc:mga0yw44_16709_c1 | 3300050492 | Bacteria | 3973 |
| 781 | nmdc:mga0yw44_945281_c1 | 3300050492 | Bacteria | 584 |
| 782 | nmdc:mga0n895_141846_c1 | 3300050512 | Bacteria | 2431 |
| 783 | nmdc:mga0n895_161587_c1 | 3300050512 | Bacteria | 695 |
| 784 | nmdc:mga0rr50_134685_c1 | 3300050513 | Bacteria | 1982 |
| 785 | nmdc:mga08x19_27777_c1 | 3300050514 | Bacteria | 3541 |
| 786 | nmdc:mga08x19_580259_c1 | 3300050514 | Bacteria | 794 |
| 787 | nmdc:mga0sz30_281867_c1 | 3300050516 | Bacteria | 740 |
| 788 | Ga0495601_0000109 | 3300053077 | Bacteria | 45069 |
| 789 | Ga0495601_0002506 | 3300053077 | Bacteria | 10450 |
| 790 | Ga0495601_0006125 | 3300053077 | Bacteria | 7019 |
| 791 | Ga0495601_0009758 | 3300053077 | Bacteria | 5677 |
| 792 | Ga0495601_0053399 | 3300053077 | Bacteria | 2554 |
| 793 | Ga0495601_0059733 | 3300053077 | Bacteria | 2418 |
| 794 | Ga0495612_0000953 | 3300053078 | Bacteria | 11879 |
| 795 | Ga0495612_0002655 | 3300053078 | Bacteria | 7376 |
| 796 | Ga0495612_0006674 | 3300053078 | Bacteria | 4733 |
| 797 | Ga0500635_0015242 | 3300053080 | Bacteria | 2267 |
| 798 | Ga0495595_0001271 | 3300053084 | Bacteria | 9824 |
| 799 | Ga0495595_0005318 | 3300053084 | Bacteria | 5205 |
| 800 | Ga0495595_0005872 | 3300053084 | Bacteria | 4976 |
| 801 | Ga0495595_0019136 | 3300053084 | Bacteria | 2968 |
| 802 | Ga0495595_0033835 | 3300053084 | Bacteria | 2308 |
| 803 | Ga0495619_0000289 | 3300053085 | Bacteria | 35778 |
| 804 | Ga0495619_0000662 | 3300053085 | Bacteria | 22563 |
| 805 | Ga0495619_0002507 | 3300053085 | Bacteria | 12025 |
| 806 | Ga0495619_0004938 | 3300053085 | Bacteria | 8470 |
| 807 | Ga0495619_0015439 | 3300053085 | Bacteria | 4832 |
| 808 | Ga0495619_0376229 | 3300053085 | Bacteria | 981 |
| 809 | Ga0500643_002483 | 3300053087 | Bacteria | 9484 |
| 810 | Ga0500644_0000860 | 3300053088 | Bacteria | 9944 |
| 811 | Ga0500646_0025028 | 3300053090 | Bacteria | 1610 |
| 812 | Ga0500651_0156758 | 3300053093 | Bacteria | 1364 |
| 813 | Ga0500651_0721863 | 3300053093 | Bacteria | 531 |
| 814 | Ga0500566_0072243 | 3300053094 | Bacteria | 1935 |
| 815 | Ga0500566_0436952 | 3300053094 | Bacteria | 576 |
| 816 | Ga0500648_097400 | 3300053097 | Bacteria | 1640 |
| 817 | Ga0500650_0451371 | 3300053098 | Bacteria | 551 |
| 818 | Ga0500595_000062 | 3300053119 | Bacteria | 77506 |
| 819 | Ga0500595_016246 | 3300053119 | Bacteria | 2776 |
| 820 | Ga0500595_055576 | 3300053119 | Bacteria | 1212 |
| 821 | Ga0500652_033278 | 3300053131 | Bacteria | 2036 |
| 822 | Ga0500655_084049 | 3300053133 | Bacteria | 657 |
| 823 | Ga0500559_0094578 | 3300053136 | Bacteria | 1371 |
| 824 | Ga0500559_0262266 | 3300053136 | Bacteria | 813 |
| 825 | Ga0500564_234759 | 3300053138 | Bacteria | 735 |
| 826 | Ga0500573_0104422 | 3300053140 | Bacteria | 1591 |
| 827 | Ga0500590_091329 | 3300053148 | Bacteria | 1478 |
| 828 | Ga0500590_108729 | 3300053148 | Bacteria | 1319 |
| 829 | Ga0500603_014973 | 3300053150 | Bacteria | 1819 |
| 830 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 831 | Ga0500638_168116 | 3300053162 | Bacteria | 958 |
| 832 | Ga0500639_028570 | 3300053163 | Bacteria | 2947 |
| 833 | Ga0500639_157943 | 3300053163 | Bacteria | 1036 |
| 834 | Ga0500636_0175949 | 3300053177 | Bacteria | 1153 |
| 835 | Ga0500637_0056548 | 3300053178 | Bacteria | 2241 |
| 836 | Ga0500637_0082391 | 3300053178 | Bacteria | 1859 |
| 837 | Ga0500645_000101 | 3300053730 | Bacteria | 68128 |
| 838 | Ga0500596_005660 | 3300053735 | Bacteria | 2174 |
| 839 | Ga0501082_0067452 | 3300060353 | Bacteria | 3081 |
| 840 | Ga0530510_0471912 | 3300061734 | Bacteria | 950 |
| 841 | 2513700651 | 2513237102 | Bacteria | 7703324 |
| 842 | 2824622032 | 2824617872 | Bacteria | 8814715 |
| 843 | 2824629296 | 2824626560 | Bacteria | 8813858 |
| 844 | 2824639171 | 2824635225 | Bacteria | 8785348 |
| 845 | 2824652638 | 2824644064 | Bacteria | 8743947 |
| 846 | 2824723190 | 2824714736 | Bacteria | 8717648 |
| 847 | 2824731758 | 2824723954 | Bacteria | 8758240 |
| 848 | 2904698944 | 2904690495 | Bacteria | 9412302 |
| 849 | 2908758741 | 2908756301 | Bacteria | 8864324 |
| 850 | 643605219 | 643348564 | Bacteria | 8839022 |
| 851 | Ga0495619_1025951 | |||
| 852 | RicEn_C6443 | |||
| 853 | ARcpr5oldR_c011814 | |||
| 854 | JGI24750J21931_1020184 | |||
| 855 | JGI25406J46586_10000138 | |||
| 856 | JGI25404J52841_10000288 | |||
| 857 | JGI25404J52841_10016633 | |||
| 858 | Ga0065165_1089247 | |||
| 859 | Ga0065712_10806853 | |||
| 860 | Ga0070658_10152408 | |||
| 861 | Ga0070658_10281288 | |||
| 862 | Ga0070658_11661314 | |||
| 863 | Ga0070676_10066362 | |||
| 864 | Ga0070676_10206242 | |||
| 865 | Ga0070683_100566384 | |||
| 866 | Ga0070690_100035779 | |||
| 867 | Ga0070670_100085242 | |||
| 868 | Ga0068869_100944991 | |||
| 869 | Ga0070666_10044947 | |||
| 870 | Ga0070666_10170100 | |||
| 871 | Ga0070680_100073406 | |||
| 872 | Ga0070682_100022461 | |||
| 873 | Ga0070682_100691382 | |||
| 874 | Ga0068868_100023195 | |||
| 875 | Ga0068868_100302903 | |||
| 876 | Ga0070660_101517973 | |||
| 877 | Ga0070689_100271674 | |||
| 878 | Ga0070691_10092647 | |||
| 879 | Ga0070687_100655484 | |||
| 880 | Ga0070687_101266715 | |||
| 881 | Ga0070661_100063833 | |||
| 882 | Ga0070661_100128827 | |||
| 883 | Ga0070668_100111063 | |||
| 884 | Ga0070669_100463638 | |||
| 885 | Ga0070669_101941653 | |||
| 886 | Ga0070675_101292694 | |||
| 887 | Ga0070671_100075228 | |||
| 888 | Ga0070671_100126562 | |||
| 889 | Ga0070674_100118540 | |||
| 890 | Ga0070674_100385100 | |||
| 891 | Ga0070673_100031259 | |||
| 892 | Ga0070673_100221129 | |||
| 893 | Ga0070673_101180251 | |||
| 894 | Ga0070688_100016483 | |||
| 895 | Ga0070667_100096956 | |||
| 896 | Ga0070667_100277815 | |||
| 897 | Ga0070709_10000855 | |||
| 898 | Ga0070709_10004300 | |||
| 899 | Ga0070709_10022160 | |||
| 900 | Ga0070709_10023003 | |||
| 901 | Ga0070709_10229367 | |||
| 902 | Ga0070714_100431103 | |||
| 903 | Ga0070714_100474559 | |||
| 904 | Ga0070713_100002359 | |||
| 905 | Ga0070713_100004066 | |||
| 906 | Ga0070713_100031837 | |||
| 907 | Ga0070713_100149309 | |||
| 908 | Ga0070713_100306657 | |||
| 909 | Ga0070713_101195986 | |||
| 910 | Ga0070710_10003385 | |||
| 911 | Ga0070710_10029684 | |||
| 912 | Ga0070710_10077078 | |||
| 913 | Ga0070710_10096625 | |||
| 914 | Ga0070710_10756435 | |||
| 915 | Ga0070711_100017702 | |||
| 916 | Ga0070711_100017962 | |||
| 917 | Ga0070711_100088060 | |||
| 918 | Ga0070711_100128053 | |||
| 919 | Ga0070711_100209488 | |||
| 920 | Ga0070711_100506323 | |||
| 921 | Ga0070711_100838504 | |||
| 922 | Ga0070705_100221343 | |||
| 923 | Ga0070700_100532159 | |||
| 924 | Ga0070700_101052240 | |||
| 925 | Ga0070694_100356334 | |||
| 926 | Ga0070708_100206734 | |||
| 927 | Ga0070708_101359363 | |||
| 928 | Ga0070663_100343464 | |||
| 929 | Ga0070663_100412822 | |||
| 930 | Ga0070678_100306263 | |||
| 931 | Ga0070662_100448422 | |||
| 932 | Ga0070681_10013271 | |||
| 933 | Ga0068867_100235985 | |||
| 934 | Ga0068867_100804167 | |||
| 935 | Ga0070685_10153929 | |||
| 936 | Ga0070685_10281094 | |||
| 937 | Ga0070679_100085231 | |||
| 938 | Ga0070679_100122492 | |||
| 939 | Ga0070684_100525862 | |||
| 940 | Ga0070684_101177447 | |||
| 941 | Ga0068853_100068998 | |||
| 942 | Ga0068853_100732708 | |||
| 943 | Ga0068853_100960902 | |||
| 944 | Ga0070686_100055931 | |||
| 945 | Ga0070695_100065695 | |||
| 946 | Ga0070695_100285865 | |||
| 947 | Ga0070696_100142454 | |||
| 948 | Ga0070696_100609966 | |||
| 949 | Ga0070693_100058059 | |||
| 950 | Ga0070693_100248190 | |||
| 951 | Ga0070693_100523254 | |||
| 952 | Ga0070693_100570628 | |||
| 953 | Ga0070665_100053413 | |||
| 954 | Ga0070665_100069877 | |||
| 955 | Ga0070665_100806559 | |||
| 956 | Ga0070704_101839071 | |||
| 957 | Ga0068855_100187602 | |||
| 958 | Ga0068855_100677922 | |||
| 959 | Ga0070664_100038514 | |||
| 960 | Ga0070664_100523617 | |||
| 961 | Ga0068857_100291795 | |||
| 962 | Ga0068856_100084891 | |||
| 963 | Ga0068856_101698263 | |||
| 964 | Ga0070702_100019143 | |||
| 965 | Ga0070702_100469588 | |||
| 966 | Ga0068852_100348236 | |||
| 967 | Ga0068859_100071001 | |||
| 968 | Ga0068864_100088136 | |||
| 969 | Ga0068864_100316532 | |||
| 970 | Ga0068866_11269959 | |||
| 971 | Ga0068861_100600781 | |||
| 972 | Ga0068861_101854549 | |||
| 973 | Ga0068851_10366750 | |||
| 974 | Ga0068863_100067439 | |||
| 975 | Ga0068863_100615180 | |||
| 976 | Ga0068858_100059299 | |||
| 977 | Ga0068860_100000360 | |||
| 978 | Ga0068860_100094153 | |||
| 979 | Ga0068860_102313443 | |||
| 980 | Ga0068862_100500977 | |||
| 981 | Ga0081455_10551309 | |||
| 982 | Ga0081540_1027303 | |||
| 983 | Ga0081540_1029140 | |||
| 984 | Ga0070717_10003328 | |||
| 985 | Ga0070717_10007544 | |||
| 986 | Ga0070717_10221253 | |||
| 987 | Ga0070717_10391088 | |||
| 988 | Ga0070717_10780830 | |||
| 989 | Ga0070717_10904072 | |||
| 990 | Ga0075365_10339531 | |||
| 991 | Ga0075364_10105653 | |||
| 992 | Ga0070715_10093139 | |||
| 993 | Ga0070715_10179947 | |||
| 994 | Ga0070715_10277313 | |||
| 995 | Ga0070715_10595935 | |||
| 996 | Ga0070716_100002233 | |||
| 997 | Ga0070716_100031117 | |||
| 998 | Ga0070712_100010775 | |||
| 999 | Ga0070712_100051207 | |||
| 1000 | Ga0070712_100156648 | |||
| 1001 | Ga0070712_100441075 | |||
| 1002 | Ga0070712_100771012 | |||
| 1003 | Ga0097621_100008876 | |||
| 1004 | Ga0097621_100026444 | |||
| 1005 | Ga0097621_100359483 | |||
| 1006 | Ga0097621_101183291 | |||
| 1007 | Ga0068871_100015537 | |||
| 1008 | Ga0068871_100241467 | |||
| 1009 | Ga0075433_10423626 | |||
| 1010 | Ga0075434_100512931 | |||
| 1011 | Ga0075434_100581087 | |||
| 1012 | Ga0068865_100009015 | |||
| 1013 | Ga0068865_100415311 | |||
| 1014 | Ga0075436_100031219 | |||
| 1015 | Ga0075436_100414882 | |||
| 1016 | Ga0097620_100071001 | |||
| 1017 | Ga0075435_100492508 | |||
| 1018 | Ga0099794_10252337 | |||
| 1019 | Ga0105251_10012262 | |||
| 1020 | Ga0105245_10038270 | |||
| 1021 | Ga0105245_10287853 | |||
| 1022 | Ga0105245_11861990 | |||
| 1023 | Ga0105247_10079094 | |||
| 1024 | Ga0105247_10086615 | |||
| 1025 | Ga0105247_10295137 | |||
| 1026 | Ga0105247_10390936 | |||
| 1027 | Ga0105247_11027366 | |||
| 1028 | Ga0105243_10080808 | |||
| 1029 | Ga0105243_10374450 | |||
| 1030 | Ga0105241_10037102 | |||
| 1031 | Ga0105241_10141127 | |||
| 1032 | Ga0105241_10358358 | |||
| 1033 | Ga0105242_10006274 | |||
| 1034 | Ga0105242_10059085 | |||
| 1035 | Ga0105242_10408608 | |||
| 1036 | Ga0105248_10065160 | |||
| 1037 | Ga0105248_10207704 | |||
| 1038 | Ga0105248_11436975 | |||
| 1039 | Ga0105237_10021234 | |||
| 1040 | Ga0105237_10714057 | |||
| 1041 | Ga0105237_10996490 | |||
| 1042 | Ga0105238_10027647 | |||
| 1043 | Ga0105238_10373216 | |||
| 1044 | Ga0105238_11148679 | |||
| 1045 | Ga0105238_12070457 | |||
| 1046 | Ga0105238_12678210 | |||
| 1047 | Ga0105249_11247695 | |||
| 1048 | Ga0105249_11523571 | |||
| 1049 | Ga0105249_12134949 | |||
| 1050 | Ga0105239_10074149 | |||
| 1051 | Ga0105239_10267093 | |||
| 1052 | Ga0105239_10304214 | |||
| 1053 | Ga0105239_10599290 | |||
| 1054 | Ga0105239_11040318 | |||
| 1055 | Ga0105239_11652668 | |||
| 1056 | Ga0105239_12356119 | |||
| 1057 | Ga0105246_10053735 | |||
| 1058 | Ga0105246_10296493 | |||
| 1059 | Ga0157336_1011918 | |||
| 1060 | Ga0157335_1000825 | |||
| 1061 | Ga0157345_1019228 | |||
| 1062 | Ga0157314_1052637 | |||
| 1063 | Ga0157313_1026749 | |||
| 1064 | Ga0157324_1030507 | |||
| 1065 | Ga0157316_1027201 | |||
| 1066 | Ga0157338_1017731 | |||
| 1067 | Ga0157370_11778711 | |||
| 1068 | Ga0157374_10179291 | |||
| 1069 | Ga0157374_10208823 | |||
| 1070 | Ga0157378_10094941 | |||
| 1071 | Ga0157378_10934671 | |||
| 1072 | Ga0157378_11010931 | |||
| 1073 | Ga0157378_12095805 | |||
| 1074 | Ga0163162_10108966 | |||
| 1075 | Ga0163162_10246430 | |||
| 1076 | Ga0163162_11121669 | |||
| 1077 | Ga0157372_10134988 | |||
| 1078 | Ga0157372_12182728 | |||
| 1079 | Ga0157375_10135433 | |||
| 1080 | Ga0157375_10329773 | |||
| 1081 | Ga0157375_10852394 | |||
| 1082 | Ga0163163_10335512 | |||
| 1083 | Ga0163163_10753207 | |||
| 1084 | Ga0157380_11841068 | |||
| 1085 | Ga0157379_10007831 | |||
| 1086 | Ga0157379_10166035 | |||
| 1087 | Ga0157379_10829249 | |||
| 1088 | Ga0157376_10448835 | |||
| 1089 | Ga0157376_10873512 | |||
| 1090 | Ga0157376_10973157 | |||
| 1091 | Ga0163161_10026256 | |||
| 1092 | Ga0163161_10068276 | |||
| 1093 | Ga0213876_10179521 | |||
| 1094 | Ga0213875_10477209 | |||
| 1095 | Ga0207697_10228483 | |||
| 1096 | Ga0207692_10005372 | |||
| 1097 | Ga0207692_10069774 | |||
| 1098 | Ga0207692_10340830 | |||
| 1099 | Ga0207692_10361122 | |||
| 1100 | Ga0207692_10564439 | |||
| 1101 | Ga0207642_10301087 | |||
| 1102 | Ga0207710_10046975 | |||
| 1103 | Ga0207710_10050402 | |||
| 1104 | Ga0207710_10072035 | |||
| 1105 | Ga0207710_10162358 | |||
| 1106 | Ga0207710_10359226 | |||
| 1107 | Ga0207710_10401078 | |||
| 1108 | Ga0207688_10391025 | |||
| 1109 | Ga0207680_10029075 | |||
| 1110 | Ga0207685_10004129 | |||
| 1111 | Ga0207685_10029551 | |||
| 1112 | Ga0207685_10090429 | |||
| 1113 | Ga0207685_10174449 | |||
| 1114 | Ga0207685_10179973 | |||
| 1115 | Ga0207699_10001161 | |||
| 1116 | Ga0207699_10012349 | |||
| 1117 | Ga0207699_10014207 | |||
| 1118 | Ga0207699_10140066 | |||
| 1119 | Ga0207699_10328840 | |||
| 1120 | Ga0207699_10405139 | |||
| 1121 | Ga0207645_10023325 | |||
| 1122 | Ga0207645_10528976 | |||
| 1123 | Ga0207705_11434259 | |||
| 1124 | Ga0207654_10043742 | |||
| 1125 | Ga0207654_10066063 | |||
| 1126 | Ga0207654_10235678 | |||
| 1127 | Ga0207707_10026208 | |||
| 1128 | Ga0207707_10340876 | |||
| 1129 | Ga0207671_10245556 | |||
| 1130 | Ga0207671_10642360 | |||
| 1131 | Ga0207693_10003131 | |||
| 1132 | Ga0207693_10043770 | |||
| 1133 | Ga0207693_10058351 | |||
| 1134 | Ga0207693_10181380 | |||
| 1135 | Ga0207693_10225292 | |||
| 1136 | Ga0207663_10015462 | |||
| 1137 | Ga0207663_10061185 | |||
| 1138 | Ga0207663_10071436 | |||
| 1139 | Ga0207663_10188456 | |||
| 1140 | Ga0207663_10380554 | |||
| 1141 | Ga0207660_10788538 | |||
| 1142 | Ga0207657_10162543 | |||
| 1143 | Ga0207649_10148323 | |||
| 1144 | Ga0207652_10098796 | |||
| 1145 | Ga0207652_10246038 | |||
| 1146 | Ga0207652_10599659 | |||
| 1147 | Ga0207681_10554856 | |||
| 1148 | Ga0207694_10040173 | |||
| 1149 | Ga0207694_10150540 | |||
| 1150 | Ga0207694_10633556 | |||
| 1151 | Ga0207650_10259172 | |||
| 1152 | Ga0207659_11661661 | |||
| 1153 | Ga0207687_10012582 | |||
| 1154 | Ga0207687_10033806 | |||
| 1155 | Ga0207687_10757178 | |||
| 1156 | Ga0207700_10000917 | |||
| 1157 | Ga0207700_10021942 | |||
| 1158 | Ga0207700_10053149 | |||
| 1159 | Ga0207700_10102651 | |||
| 1160 | Ga0207700_10993708 | |||
| 1161 | Ga0207700_11438312 | |||
| 1162 | Ga0207664_10100523 | |||
| 1163 | Ga0207664_10261339 | |||
| 1164 | Ga0207664_10395828 | |||
| 1165 | Ga0207664_10418862 | |||
| 1166 | Ga0207664_11175493 | |||
| 1167 | Ga0207664_11915049 | |||
| 1168 | Ga0207644_10007559 | |||
| 1169 | Ga0207644_10115945 | |||
| 1170 | Ga0207644_11390102 | |||
| 1171 | Ga0207706_10014945 | |||
| 1172 | Ga0207706_10189748 | |||
| 1173 | Ga0207686_10011564 | |||
| 1174 | Ga0207686_10507143 | |||
| 1175 | Ga0207686_10847197 | |||
| 1176 | Ga0207709_10125631 | |||
| 1177 | Ga0207709_10459689 | |||
| 1178 | Ga0207709_10818320 | |||
| 1179 | Ga0207670_10017561 | |||
| 1180 | Ga0207669_10767290 | |||
| 1181 | Ga0207669_11343895 | |||
| 1182 | Ga0207704_11180102 | |||
| 1183 | Ga0207704_11339485 | |||
| 1184 | Ga0207665_10000333 | |||
| 1185 | Ga0207665_10021917 | |||
| 1186 | Ga0207665_10111445 | |||
| 1187 | Ga0207711_10086244 | |||
| 1188 | Ga0207711_10107904 | |||
| 1189 | Ga0207711_10988006 | |||
| 1190 | Ga0207689_10031849 | |||
| 1191 | Ga0207661_10862847 | |||
| 1192 | Ga0207679_10701872 | |||
| 1193 | Ga0207679_10876866 | |||
| 1194 | Ga0207679_11669890 | |||
| 1195 | Ga0207667_10168621 | |||
| 1196 | Ga0207667_10230228 | |||
| 1197 | Ga0207667_10814489 | |||
| 1198 | Ga0207651_10072873 | |||
| 1199 | Ga0207712_10538677 | |||
| 1200 | Ga0207712_11132787 | |||
| 1201 | Ga0207658_10047022 | |||
| 1202 | Ga0207658_10071512 | |||
| 1203 | Ga0207677_10139446 | |||
| 1204 | Ga0207677_11789826 | |||
| 1205 | Ga0207703_10139094 | |||
| 1206 | Ga0207703_10333842 | |||
| 1207 | Ga0207703_10921854 | |||
| 1208 | Ga0207703_11003981 | |||
| 1209 | Ga0207703_12020444 | |||
| 1210 | Ga0207639_10089016 | |||
| 1211 | Ga0207639_10400976 | |||
| 1212 | Ga0207639_10909645 | |||
| 1213 | Ga0207639_11390914 | |||
| 1214 | Ga0207678_10097972 | |||
| 1215 | Ga0207678_10107195 | |||
| 1216 | Ga0207678_10239787 | |||
| 1217 | Ga0207708_10038595 | |||
| 1218 | Ga0207708_10354172 | |||
| 1219 | Ga0207702_10276224 | |||
| 1220 | Ga0207702_11533230 | |||
| 1221 | Ga0207641_10212558 | |||
| 1222 | Ga0207641_10750393 | |||
| 1223 | Ga0207641_11516139 | |||
| 1224 | Ga0207648_10124866 | |||
| 1225 | Ga0207648_10186503 | |||
| 1226 | Ga0207676_10186879 | |||
| 1227 | Ga0207675_102137106 | |||
| 1228 | Ga0207683_10001447 | |||
| 1229 | Ga0207683_10153592 | |||
| 1230 | Ga0207683_10254310 | |||
| 1231 | Ga0207698_10383176 | |||
| 1232 | Ga0207698_10398539 | |||
| 1233 | Ga0209971_1154606 | |||
| 1234 | Ga0209966_1014410 | |||
| 1235 | Ga0209974_10036257 | |||
| 1236 | Ga0265357_1020655 | |||
| 1237 | Ga0268266_10025953 | |||
| 1238 | Ga0268266_10136477 | |||
| 1239 | Ga0268266_10243092 | |||
| 1240 | Ga0268265_12194390 | |||
| 1241 | Ga0268264_10000030 | |||
| 1242 | Ga0268264_10483253 | |||
| 1243 | Ga0268264_10656641 | |||
| 1244 | Ga0265337_1001486 | |||
| 1245 | Ga0265338_10247553 | |||
| 1246 | Ga0265338_10306413 | |||
| 1247 | Ga0307511_10107189 | |||
| 1248 | Ga0265763_1005459 | |||
| 1249 | Ga0265773_1031879 | |||
| 1250 | Ga0265332_10000899 | |||
| 1251 | Ga0265332_10175142 | |||
| 1252 | Ga0265325_10000049 | |||
| 1253 | Ga0265325_10083742 | |||
| 1254 | Ga0265325_10242883 | |||
| 1255 | Ga0265329_10221386 | |||
| 1256 | Ga0265340_10005450 | |||
| 1257 | Ga0265340_10166484 | |||
| 1258 | Ga0265339_10058197 | |||
| 1259 | Ga0265339_10210681 | |||
| 1260 | Ga0265331_10149249 | |||
| 1261 | Ga0265316_10261497 | |||
| 1262 | Ga0265316_10278153 | |||
| 1263 | Ga0307509_10014245 | |||
| 1264 | Ga0265313_10036963 | |||
| 1265 | Ga0307508_10173191 | |||
| 1266 | Ga0265314_10000784 | |||
| 1267 | Ga0265314_10005953 | |||
| 1268 | Ga0265314_10044806 | |||
| 1269 | Ga0265342_10000392 | |||
| 1270 | Ga0265342_10166027 | |||
| 1271 | Ga0307516_10005995 | |||
| 1272 | Ga0326468_10081748 | |||
| 1273 | Ga0307510_10283860 | |||
| 1274 | Ga0373950_0018390 | |||
| 1275 | Ga0373958_0085356 | |||
| 1276 | Ga0373959_0017137 | |||
| 1277 | Ga0373959_0087871 | |||
| 1278 | Ga0373938_0008109 | |||
| 1279 | Ga0373926_0006103 | |||
| 1280 | Ga0373928_0004039 | |||
| 1281 | Ga0373934_0022825 | |||
| 1282 | Ga0373934_0120017 | |||
| 1283 | Ga0373940_0167330 | |||
| 1284 | Ga0373949_0027055 | |||
| 1285 | Ga0373951_0006562 | |||
| 1286 | Ga0373952_0061984 | |||
| 1287 | Ga0373923_0078244 | |||
| 1288 | Ga0373932_0003814 | |||
| 1289 | Ga0373932_0181145 | |||
| 1290 | Ga0373939_0016078 | |||
| 1291 | Ga0373941_0013677 | |||
| 1292 | Ga0373945_0055006 | |||
| 1293 | Ga0373953_0006441 | |||
| 1294 | Ga0373953_0042214 | |||
| 1295 | Ga0373953_0128359 | |||
| 1296 | Ga0373954_0008900 | |||
| 1297 | Ga0373954_0200643 | |||
| 1298 | Ga0373954_0224537 | |||
| 1299 | Ga0373956_0019629 | |||
| 1300 | Ga0373956_0076710 | |||
| 1301 | Ga0373956_0257183 | |||
| 1302 | Ga0373957_0341802 | |||
| 1303 | Ga0373957_0419885 | |||
| 1304 | Ga0373960_0004580 | |||
| 1305 | Ga0373943_0138348 | |||
| 1306 | Ga0373943_0374997 | |||
| 1307 | Ga0373943_0433959 | |||
| 1308 | Ga0373946_0022847 | |||
| 1309 | Ga0373946_0059173 | |||
| 1310 | Ga0373946_0178157 | |||
| 1311 | Ga0373955_0024935 | |||
| 1312 | Ga0373955_0144548 | |||
| 1313 | Ga0373955_0194939 | |||
| 1314 | Ga0373955_0615985 | |||
| 1315 | Ga0373942_0057053 | |||
| 1316 | Ga0373961_0061888 | |||
| 1317 | Ga0373962_0057562 | |||
| 1318 | Ga0373962_0078344 | |||
| 1319 | Ga0316574_0791808 | |||
| 1320 | Ga0373924_0008024 | |||
| 1321 | Ga0373924_0029447 | |||
| 1322 | Ga0373924_0033955 | |||
| 1323 | Ga0373924_0044023 | |||
| 1324 | Ga0373931_0004569 | |||
| 1325 | Ga0373935_0004548 | |||
| 1326 | Ga0373935_0015490 | |||
| 1327 | Ga0373935_0035574 | |||
| 1328 | Ga0373935_0067946 | |||
| 1329 | Ga0373935_0104396 | |||
| 1330 | Ga0373935_0677034 | |||
| 1331 | Ga0373927_0017601 | |||
| 1332 | Ga0373927_0184081 | |||
| 1333 | Ga0373927_0211276 | |||
| 1334 | Ga0373933_0002449 | |||
| 1335 | Ga0373933_0260278 | |||
| 1336 | Ga0373947_0005403 | |||
| 1337 | Ga0373947_0018365 | |||
| 1338 | Ga0373947_0119293 | |||
| 1339 | Ga0373947_0124973 | |||
| 1340 | Ga0373947_0202839 | |||
| 1341 | Ga0373947_0473216 | |||
| 1342 | Ga0373937_0002996 | |||
| 1343 | Ga0373937_0008068 | |||
| 1344 | Ga0373937_0008991 | |||
| 1345 | Ga0373937_0142283 | |||
| 1346 | Ga0373937_0345221 | |||
| 1347 | Ga0373937_0516898 | |||
| 1348 | Ga0373937_0873754 | |||
| 1349 | Ga0373937_2008695 | |||
| 1350 | Ga0373925_0025234 | |||
| 1351 | Ga0373925_0098740 | |||
| 1352 | Ga0373925_0101593 | |||
| 1353 | Ga0373925_0742294 | |||
| 1354 | Ga0373925_0759985 | |||
| 1355 | Ga0395898_0613059 | |||
| 1356 | Ga0436364_0364973 | |||
| 1357 | Ga0436365_0090047 | |||
| 1358 | Ga0436365_0390621 | |||
| 1359 | Ga0436360_0203691 | |||
| 1360 | Ga0439465_0071611 | |||
| 1361 | Ga0451802_0275182 | |||
| 1362 | Ga0451841_0043378 | |||
| 1363 | Ga0451843_0333450 | |||
| 1364 | Ga0439455_0140561 | |||
| 1365 | Ga0439464_0120779 | |||
| 1366 | Ga0439464_0128357 | |||
| 1367 | Ga0466967_1019021 | |||
| 1368 | Ga0495592_0001840 | |||
| 1369 | Ga0495592_0010619 | |||
| 1370 | Ga0495592_0626729 | |||
| 1371 | Ga0495603_0011026 | |||
| 1372 | Ga0495603_0037807 | |||
| 1373 | Ga0495629_0000269 | |||
| 1374 | Ga0495629_0069439 | |||
| 1375 | Ga0495629_0089738 | |||
| 1376 | Ga0495638_0040160 | |||
| 1377 | Ga0495641_0026269 | |||
| 1378 | Ga0495641_0042734 | |||
| 1379 | Ga0495641_0150265 | |||
| 1380 | Ga0495641_0317993 | |||
| 1381 | Ga0495651_0005718 | |||
| 1382 | Ga0495651_0010406 | |||
| 1383 | Ga0495651_0064265 | |||
| 1384 | Ga0495651_0185639 | |||
| 1385 | Ga0495651_0360559 | |||
| 1386 | Ga0495651_0460971 | |||
| 1387 | Ga0495653_0010063 | |||
| 1388 | Ga0495653_0030364 | |||
| 1389 | Ga0495653_0146642 | |||
| 1390 | Ga0495653_0171215 | |||
| 1391 | Ga0495653_0216780 | |||
| 1392 | Ga0495653_0967615 | |||
| 1393 | Ga0495580_0243568 | |||
| 1394 | Ga0495580_0560182 | |||
| 1395 | Ga0495580_0651674 | |||
| 1396 | Ga0495582_0003928 | |||
| 1397 | Ga0495582_0109872 | |||
| 1398 | Ga0495639_0396873 | |||
| 1399 | Ga0495662_0105186 | |||
| 1400 | Ga0495662_0114856 | |||
| 1401 | Ga0495664_0010264 | |||
| 1402 | Ga0495664_0021710 | |||
| 1403 | Ga0495664_0118438 | |||
| 1404 | Ga0495664_0238448 | |||
| 1405 | Ga0495594_0009788 | |||
| 1406 | Ga0495594_0027976 | |||
| 1407 | Ga0495608_0001268 | |||
| 1408 | Ga0495608_0016256 | |||
| 1409 | Ga0495608_0285310 | |||
| 1410 | Ga0495610_0301084 | |||
| 1411 | Ga0495618_0037072 | |||
| 1412 | Ga0495618_0088979 | |||
| 1413 | Ga0495618_0254207 | |||
| 1414 | Ga0495618_0331159 | |||
| 1415 | Ga0495618_0574481 | |||
| 1416 | Ga0495618_0597161 | |||
| 1417 | Ga0495628_0005226 | |||
| 1418 | Ga0495628_0268395 | |||
| 1419 | Ga0495630_0192162 | |||
| 1420 | Ga0495630_0475487 | |||
| 1421 | Ga0495630_0638424 | |||
| 1422 | Ga0495666_0167651 | |||
| 1423 | Ga0495652_0061818 | |||
| 1424 | Ga0495652_0077885 | |||
| 1425 | Ga0495652_0216037 | |||
| 1426 | Ga0495652_0224929 | |||
| 1427 | Ga0495640_0006352 | |||
| 1428 | Ga0495640_0018005 | |||
| 1429 | Ga0495640_0040789 | |||
| 1430 | Ga0495640_0422869 | |||
| 1431 | Ga0495586_0011910 | |||
| 1432 | Ga0495586_0171759 | |||
| 1433 | Ga0495587_0000620 | |||
| 1434 | Ga0495587_0058326 | |||
| 1435 | Ga0495645_0000848 | |||
| 1436 | Ga0495645_0008343 | |||
| 1437 | Ga0495645_0393965 | |||
| 1438 | Ga0495645_0775211 | |||
| 1439 | Ga0495622_0043236 | |||
| 1440 | Ga0495667_0001254 | |||
| 1441 | Ga0495667_0022137 | |||
| 1442 | Ga0495667_0097610 | |||
| 1443 | Ga0495667_0104514 | |||
| 1444 | Ga0495667_0105159 | |||
| 1445 | Ga0495667_0113573 | |||
| 1446 | Ga0495634_0017607 | |||
| 1447 | Ga0495634_0019712 | |||
| 1448 | Ga0495634_0266260 | |||
| 1449 | Ga0495635_0005437 | |||
| 1450 | Ga0495635_0036531 | |||
| 1451 | Ga0495635_0090897 | |||
| 1452 | Ga0495635_0091274 | |||
| 1453 | Ga0495635_0146947 | |||
| 1454 | Ga0495635_0346365 | |||
| 1455 | Ga0495635_0466719 | |||
| 1456 | Ga0495661_0165033 | |||
| 1457 | Ga0495588_0067758 | |||
| 1458 | Ga0495657_0002939 | |||
| 1459 | Ga0495657_0032408 | |||
| 1460 | Ga0495599_0062103 | |||
| 1461 | Ga0495599_0214597 | |||
| 1462 | Ga0495623_0026867 | |||
| 1463 | Ga0495623_0035166 | |||
| 1464 | Ga0495646_0000856 | |||
| 1465 | Ga0495646_0083480 | |||
| 1466 | Ga0495646_0202842 | |||
| 1467 | Ga0495647_0053754 | |||
| 1468 | Ga0495658_0004553 | |||
| 1469 | Ga0495658_0810370 | |||
| 1470 | Ga0495613_0038188 | |||
| 1471 | Ga0495613_0162962 | |||
| 1472 | Ga0495613_0394572 | |||
| 1473 | Ga0495613_0430843 | |||
| 1474 | Ga0495624_0040542 | |||
| 1475 | Ga0495624_0137836 | |||
| 1476 | Ga0495624_0387213 | |||
| 1477 | Ga0495624_0956348 | |||
| 1478 | Ga0495600_0016667 | |||
| 1479 | Ga0495600_0052308 | |||
| 1480 | Ga0495600_0128219 | |||
| 1481 | Ga0495600_0133793 | |||
| 1482 | Ga0495600_0579557 | |||
| 1483 | Ga0495581_0036567 | |||
| 1484 | Ga0495581_0101672 | |||
| 1485 | Ga0495604_0005959 | |||
| 1486 | Ga0495604_0027617 | |||
| 1487 | Ga0495604_0056504 | |||
| 1488 | Ga0495604_0103429 | |||
| 1489 | Ga0495604_0591355 | |||
| 1490 | Ga0495674_0005637 | |||
| 1491 | Ga0495674_0061401 | |||
| 1492 | Ga0495676_0034516 | |||
| 1493 | Ga0495676_0144308 | |||
| 1494 | Ga0495680_0001472 | |||
| 1495 | Ga0495680_0006777 | |||
| 1496 | Ga0495680_0017612 | |||
| 1497 | Ga0495680_0018210 | |||
| 1498 | Ga0495680_0022232 | |||
| 1499 | Ga0495680_0217882 | |||
| 1500 | Ga0495680_0241607 | |||
| 1501 | Ga0495675_0018016 | |||
| 1502 | Ga0495675_0048151 | |||
| 1503 | Ga0495675_0168024 | |||
| 1504 | Ga0495684_0031095 | |||
| 1505 | Ga0495684_0047729 | |||
| 1506 | Ga0495684_0213504 | |||
| 1507 | Ga0495684_0294075 | |||
| 1508 | Ga0495684_0298325 | |||
| 1509 | Ga0495684_0633406 | |||
| 1510 | Ga0495593_0009204 | |||
| 1511 | Ga0495602_0002664 | |||
| 1512 | Ga0495602_0013607 | |||
| 1513 | Ga0495602_0128650 | |||
| 1514 | Ga0495602_0183138 | |||
| 1515 | Ga0495602_0515833 | |||
| 1516 | Ga0495614_0145476 | |||
| 1517 | Ga0496100_0006554 | |||
| 1518 | Ga0496100_0102455 | |||
| 1519 | Ga0496100_0204967 | |||
| 1520 | Ga0496100_0399268 | |||
| 1521 | Ga0496101_0007659 | |||
| 1522 | Ga0496101_0016572 | |||
| 1523 | Ga0496101_0147253 | |||
| 1524 | Ga0496101_0347632 | |||
| 1525 | Ga0496101_0435107 | |||
| 1526 | Ga0496102_0016358 | |||
| 1527 | Ga0496102_0070115 | |||
| 1528 | Ga0496102_0261230 | |||
| 1529 | Ga0496102_0776671 | |||
| 1530 | Ga0496102_0812061 | |||
| 1531 | Ga0496102_1210976 | |||
| 1532 | Ga0496103_0107057 | |||
| 1533 | Ga0496103_0280558 | |||
| 1534 | Ga0496103_0316878 | |||
| 1535 | Ga0496104_0000215 | |||
| 1536 | Ga0496104_0005956 | |||
| 1537 | Ga0496104_0097659 | |||
| 1538 | Ga0496104_0243034 | |||
| 1539 | Ga0496104_0374856 | |||
| 1540 | Ga0496104_0498536 | |||
| 1541 | Ga0496105_0007651 | |||
| 1542 | Ga0496105_0020355 | |||
| 1543 | Ga0496105_0157101 | |||
| 1544 | Ga0496105_0242092 | |||
| 1545 | Ga0496105_0429422 | |||
| 1546 | Ga0496105_0515938 | |||
| 1547 | Ga0496106_0001857 | |||
| 1548 | Ga0496106_0019937 | |||
| 1549 | Ga0496106_0067503 | |||
| 1550 | Ga0496107_0019768 | |||
| 1551 | Ga0496107_0295593 | |||
| 1552 | Ga0496107_0520826 | |||
| 1553 | Ga0496108_0056436 | |||
| 1554 | Ga0496108_0057496 | |||
| 1555 | Ga0496108_0241156 | |||
| 1556 | Ga0496108_0448952 | |||
| 1557 | Ga0496109_0133946 | |||
| 1558 | Ga0496109_0156658 | |||
| 1559 | Ga0496109_0389585 | |||
| 1560 | Ga0496109_0401126 | |||
| 1561 | Ga0496109_0961668 | |||
| 1562 | Ga0496109_1184394 | |||
| 1563 | Ga0496110_0022488 | |||
| 1564 | Ga0496110_0302206 | |||
| 1565 | Ga0496110_0356076 | |||
| 1566 | Ga0496110_0368896 | |||
| 1567 | Ga0496111_0084837 | |||
| 1568 | Ga0496111_0317797 | |||
| 1569 | Ga0496112_0193985 | |||
| 1570 | Ga0496112_0195658 | |||
| 1571 | Ga0496112_0570510 | |||
| 1572 | Ga0496112_0830786 | |||
| 1573 | Ga0496112_1243055 | |||
| 1574 | Ga0496113_0251371 | |||
| 1575 | Ga0496113_0427014 | |||
| 1576 | Ga0496113_0436095 | |||
| 1577 | Ga0496113_1451526 | |||
| 1578 | Ga0496114_0076223 | |||
| 1579 | Ga0496114_0376999 | |||
| 1580 | Ga0496114_1041826 | |||
| 1581 | Ga0496115_0013246 | |||
| 1582 | Ga0496115_0073757 | |||
| 1583 | Ga0496115_0099732 | |||
| 1584 | Ga0496115_0582525 | |||
| 1585 | Ga0496115_0713092 | |||
| 1586 | Ga0496115_0759486 | |||
| 1587 | Ga0496115_1243551 | |||
| 1588 | Ga0496117_0010071 | |||
| 1589 | Ga0496118_0008611 | |||
| 1590 | Ga0496119_0145579 | |||
| 1591 | Ga0496121_0002635 | |||
| 1592 | Ga0496121_0166584 | |||
| 1593 | Ga0496121_0450721 | |||
| 1594 | Ga0496122_0052608 | |||
| 1595 | Ga0496124_0011581 | |||
| 1596 | Ga0496124_0378319 | |||
| 1597 | Ga0496125_0000746 | |||
| 1598 | Ga0496125_0131030 | |||
| 1599 | Ga0496126_0002122 | |||
| 1600 | Ga0496126_0038000 | |||
| 1601 | Ga0496126_0108022 | |||
| 1602 | Ga0496126_0157082 | |||
| 1603 | Ga0496126_0208556 | |||
| 1604 | Ga0496126_0430274 | |||
| 1605 | Ga0496126_0661143 | |||
| 1606 | Ga0501031_0255750 | |||
| 1607 | Ga0501034_0182998 | |||
| 1608 | Ga0501036_0114702 | |||
| 1609 | Ga0501039_1344434 | |||
| 1610 | Ga0501042_0286813 | |||
| 1611 | Ga0501043_0448869 | |||
| 1612 | Ga0501043_1083288 | |||
| 1613 | Ga0501047_0008787 | |||
| 1614 | Ga0501047_0611642 | |||
| 1615 | Ga0501067_0711546 | |||
| 1616 | Ga0501068_0691835 | |||
| 1617 | Ga0501070_0367305 | |||
| 1618 | Ga0501073_0034839 | |||
| 1619 | Ga0501075_0734248 | |||
| 1620 | Ga0501076_0220426 | |||
| 1621 | Ga0501079_0565858 | |||
| 1622 | Ga0501080_1170424 | |||
| 1623 | Ga0501081_0672417 | |||
| 1624 | Ga0501083_0023331 | |||
| 1625 | Ga0501035_0657975 | |||
| 1626 | Ga0501044_0103888 | |||
| 1627 | Ga0501044_0118153 | |||
| 1628 | nmdc:mga03n38_684651_c1 | |||
| 1629 | nmdc:mga00v17_900844_c1 | |||
| 1630 | nmdc:mga0yw44_16709_c1 | |||
| 1631 | nmdc:mga0yw44_945281_c1 | |||
| 1632 | nmdc:mga0n895_141846_c1 | |||
| 1633 | nmdc:mga0n895_161587_c1 | |||
| 1634 | nmdc:mga0rr50_134685_c1 | |||
| 1635 | nmdc:mga08x19_27777_c1 | |||
| 1636 | nmdc:mga08x19_580259_c1 | |||
| 1637 | nmdc:mga0sz30_281867_c1 | |||
| 1638 | Ga0495601_0000109 | |||
| 1639 | Ga0495601_0002506 | |||
| 1640 | Ga0495601_0006125 | |||
| 1641 | Ga0495601_0009758 | |||
| 1642 | Ga0495601_0053399 | |||
| 1643 | Ga0495601_0059733 | |||
| 1644 | Ga0495612_0000953 | |||
| 1645 | Ga0495612_0002655 | |||
| 1646 | Ga0495612_0006674 | |||
| 1647 | Ga0500635_0015242 | |||
| 1648 | Ga0495595_0001271 | |||
| 1649 | Ga0495595_0005318 | |||
| 1650 | Ga0495595_0005872 | |||
| 1651 | Ga0495595_0019136 | |||
| 1652 | Ga0495595_0033835 | |||
| 1653 | Ga0495619_0000289 | |||
| 1654 | Ga0495619_0000662 | |||
| 1655 | Ga0495619_0002507 | |||
| 1656 | Ga0495619_0004938 | |||
| 1657 | Ga0495619_0015439 | |||
| 1658 | Ga0495619_0376229 | |||
| 1659 | Ga0500643_002483 | |||
| 1660 | Ga0500644_0000860 | |||
| 1661 | Ga0500646_0025028 | |||
| 1662 | Ga0500651_0156758 | |||
| 1663 | Ga0500651_0721863 | |||
| 1664 | Ga0500566_0072243 | |||
| 1665 | Ga0500566_0436952 | |||
| 1666 | Ga0500648_097400 | |||
| 1667 | Ga0500650_0451371 | |||
| 1668 | Ga0500595_000062 | |||
| 1669 | Ga0500595_016246 | |||
| 1670 | Ga0500595_055576 | |||
| 1671 | Ga0500652_033278 | |||
| 1672 | Ga0500655_084049 | |||
| 1673 | Ga0500559_0094578 | |||
| 1674 | Ga0500559_0262266 | |||
| 1675 | Ga0500564_234759 | |||
| 1676 | Ga0500573_0104422 | |||
| 1677 | Ga0500590_091329 | |||
| 1678 | Ga0500590_108729 | |||
| 1679 | Ga0500603_014973 | |||
| 1680 | Ga0500616_0000006 | |||
| 1681 | Ga0500638_168116 | |||
| 1682 | Ga0500639_028570 | |||
| 1683 | Ga0500639_157943 | |||
| 1684 | Ga0500636_0175949 | |||
| 1685 | Ga0500637_0056548 | |||
| 1686 | Ga0500637_0082391 | |||
| 1687 | Ga0500645_000101 | |||
| 1688 | Ga0500596_005660 | |||
| 1689 | Ga0501082_0067452 | |||
| 1690 | Ga0530510_0471912 | |||
| 1691 | 2513700651 | |||
| 1692 | 2824622032 | |||
| 1693 | 2824629296 | |||
| 1694 | 2824639171 | |||
| 1695 | 2824652638 | |||
| 1696 | 2824723190 | |||
| 1697 | 2824731758 | |||
| 1698 | 2904698944 | |||
| 1699 | 2908758741 | |||
| 1700 | 643605219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.9211 | 2 | 105 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.9173 | 2 | 105 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.9118 | 2 | 104 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8912 | 2 | 105 |
| 2oxh-assembly1.cif.gz_Z | the soxyz complex of paracoccus pantotrophus | 0.8892 | 3 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9173 | 2 | 105 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8912 | 2 | 105 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8415 | 3 | 103 | 2.60.40.10 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8163 | 1 | 105 | 2.60.40.2470 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7989 | 3 | 103 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1B118-F1-model_v4 | deleted | 0.9377 | 40 | 105 |
|
| AF-A0A6L8GCQ2-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9318 | 2 | 105 |
|
| AF-A0A484H5H5-F1-model_v4 | Sulfur oxidation protein SoxZ | 0.9295 | 3 | 105 |
|
| AF-A0A7V8ISW7-F1-model_v4 | deleted | 0.9293 | 2 | 105 |
|
| AF-A0A3B8RJ57-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9286 | 3 | 105 |
|