F483440

General Info

Members Datasets Scaffolds Average Seq Length
850 385 1700 107

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_1025951|Ga0495619_1025951_101_460
Length 119
Sequence LRRLKTKNQEKNMAEKPRLKLPKEAKKGDVIEIKTLMPHIMESGQRKDKDGKPIPRKIINKFTAEFNGKPVFSANLEPAIAANPYMEFYAKVEESGMFKFSWTDDDGTVTTAEEKITVG

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
101 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
102 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
103 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
104 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
105 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
106 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
107 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
244 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
355 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
356 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
357 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
358 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
362 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
363 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
364 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
369 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
376 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
377 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
378 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
379 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
380 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
381 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
382 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
383 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
384 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
385 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.24
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0.47
Rhizoplane 8.47
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_1025951 3300053085 Bacteria 551
2 RicEn_C6443 2010549000 Bacteria 1472
3 ARcpr5oldR_c011814 3300000041 Bacteria 746
4 JGI24750J21931_1020184 3300002070 Bacteria 928
5 JGI25406J46586_10000138 3300003203 Bacteria 31765
6 JGI25404J52841_10000288 3300003659 Bacteria 6507
7 JGI25404J52841_10016633 3300003659 Bacteria 1595
8 Ga0065165_1089247 3300005262 Bacteria 788
9 Ga0065712_10806853 3300005290 Bacteria 510
10 Ga0070658_10152408 3300005327 Bacteria 1936
11 Ga0070658_10281288 3300005327 Bacteria 1416
12 Ga0070658_11661314 3300005327 Bacteria 553
13 Ga0070676_10066362 3300005328 Bacteria 2156
14 Ga0070676_10206242 3300005328 Bacteria 1291
15 Ga0070683_100566384 3300005329 Bacteria 1086
16 Ga0070690_100035779 3300005330 Bacteria 3118
17 Ga0070670_100085242 3300005331 Bacteria 2714
18 Ga0068869_100944991 3300005334 Bacteria 748
19 Ga0070666_10044947 3300005335 Bacteria 2960
20 Ga0070666_10170100 3300005335 Bacteria 1526
21 Ga0070680_100073406 3300005336 Bacteria 2814
22 Ga0070682_100022461 3300005337 Bacteria 3737
23 Ga0070682_100691382 3300005337 Bacteria 817
24 Ga0068868_100023195 3300005338 Bacteria 4694
25 Ga0068868_100302903 3300005338 Bacteria 1358
26 Ga0070660_101517973 3300005339 Bacteria 570
27 Ga0070689_100271674 3300005340 Bacteria 1404
28 Ga0070691_10092647 3300005341 Bacteria 1492
29 Ga0070687_100655484 3300005343 Bacteria 728
30 Ga0070687_101266715 3300005343 Bacteria 546
31 Ga0070661_100063833 3300005344 Bacteria 2705
32 Ga0070661_100128827 3300005344 Bacteria 1900
33 Ga0070668_100111063 3300005347 Bacteria 2182
34 Ga0070669_100463638 3300005353 Bacteria 1046
35 Ga0070669_101941653 3300005353 Bacteria 514
36 Ga0070675_101292694 3300005354 Bacteria 672
37 Ga0070671_100075228 3300005355 Bacteria 2821
38 Ga0070671_100126562 3300005355 Bacteria 2151
39 Ga0070674_100118540 3300005356 Bacteria 1956
40 Ga0070674_100385100 3300005356 Bacteria 1142
41 Ga0070673_100031259 3300005364 Bacteria 3993
42 Ga0070673_100221129 3300005364 Bacteria 1639
43 Ga0070673_101180251 3300005364 Bacteria 717
44 Ga0070688_100016483 3300005365 Bacteria 4225
45 Ga0070667_100096956 3300005367 Bacteria 2543
46 Ga0070667_100277815 3300005367 Bacteria 1503
47 Ga0070709_10000855 3300005434 Bacteria 17027
48 Ga0070709_10004300 3300005434 Bacteria 7681
49 Ga0070709_10022160 3300005434 Bacteria 3711
50 Ga0070709_10023003 3300005434 Bacteria 3653
51 Ga0070709_10229367 3300005434 Bacteria 1328
52 Ga0070714_100431103 3300005435 Bacteria 1250
53 Ga0070714_100474559 3300005435 Bacteria 1190
54 Ga0070713_100002359 3300005436 Bacteria 12318
55 Ga0070713_100004066 3300005436 Bacteria 9738
56 Ga0070713_100031837 3300005436 Bacteria 4205
57 Ga0070713_100149309 3300005436 Bacteria 2077
58 Ga0070713_100306657 3300005436 Bacteria 1463
59 Ga0070713_101195986 3300005436 Bacteria 736
60 Ga0070710_10003385 3300005437 Bacteria 7554
61 Ga0070710_10029684 3300005437 Bacteria 2935
62 Ga0070710_10077078 3300005437 Bacteria 1936
63 Ga0070710_10096625 3300005437 Bacteria 1751
64 Ga0070710_10756435 3300005437 Bacteria 690
65 Ga0070711_100017702 3300005439 Bacteria 4539
66 Ga0070711_100017962 3300005439 Bacteria 4509
67 Ga0070711_100088060 3300005439 Bacteria 2230
68 Ga0070711_100128053 3300005439 Bacteria 1887
69 Ga0070711_100209488 3300005439 Bacteria 1509
70 Ga0070711_100506323 3300005439 Bacteria 996
71 Ga0070711_100838504 3300005439 Bacteria 781
72 Ga0070705_100221343 3300005440 Bacteria 1311
73 Ga0070700_100532159 3300005441 Bacteria 910
74 Ga0070700_101052240 3300005441 Bacteria 672
75 Ga0070694_100356334 3300005444 Bacteria 1135
76 Ga0070708_100206734 3300005445 Bacteria 1839
77 Ga0070708_101359363 3300005445 Bacteria 663
78 Ga0070663_100343464 3300005455 Bacteria 1207
79 Ga0070663_100412822 3300005455 Bacteria 1106
80 Ga0070678_100306263 3300005456 Bacteria 1352
81 Ga0070662_100448422 3300005457 Bacteria 1071
82 Ga0070681_10013271 3300005458 Bacteria 8185
83 Ga0068867_100235985 3300005459 Bacteria 1481
84 Ga0068867_100804167 3300005459 Bacteria 839
85 Ga0070685_10153929 3300005466 Bacteria 1459
86 Ga0070685_10281094 3300005466 Bacteria 1114
87 Ga0070679_100085231 3300005530 Bacteria 3146
88 Ga0070679_100122492 3300005530 Bacteria 2584
89 Ga0070684_100525862 3300005535 Bacteria 1096
90 Ga0070684_101177447 3300005535 Bacteria 721
91 Ga0068853_100068998 3300005539 Bacteria 3074
92 Ga0068853_100732708 3300005539 Bacteria 944
93 Ga0068853_100960902 3300005539 Bacteria 822
94 Ga0070686_100055931 3300005544 Bacteria 2529
95 Ga0070695_100065695 3300005545 Bacteria 2363
96 Ga0070695_100285865 3300005545 Bacteria 1214
97 Ga0070696_100142454 3300005546 Bacteria 1753
98 Ga0070696_100609966 3300005546 Bacteria 881
99 Ga0070693_100058059 3300005547 Bacteria 2239
100 Ga0070693_100248190 3300005547 Bacteria 1179
101 Ga0070693_100523254 3300005547 Bacteria 845
102 Ga0070693_100570628 3300005547 Bacteria 813
103 Ga0070665_100053413 3300005548 Bacteria 4052
104 Ga0070665_100069877 3300005548 Bacteria 3519
105 Ga0070665_100806559 3300005548 Bacteria 952
106 Ga0070704_101839071 3300005549 Bacteria 561
107 Ga0068855_100187602 3300005563 Bacteria 2335
108 Ga0068855_100677922 3300005563 Bacteria 1105
109 Ga0070664_100038514 3300005564 Bacteria 4024
110 Ga0070664_100523617 3300005564 Bacteria 1094
111 Ga0068857_100291795 3300005577 Bacteria 1502
112 Ga0068856_100084891 3300005614 Bacteria 3146
113 Ga0068856_101698263 3300005614 Bacteria 644
114 Ga0070702_100019143 3300005615 Bacteria 3563
115 Ga0070702_100469588 3300005615 Bacteria 917
116 Ga0068852_100348236 3300005616 Bacteria 1446
117 Ga0068859_100071001 3300005617 Bacteria 3517
118 Ga0068864_100088136 3300005618 Bacteria 2733
119 Ga0068864_100316532 3300005618 Bacteria 1464
120 Ga0068866_11269959 3300005718 Bacteria 534
121 Ga0068861_100600781 3300005719 Bacteria 1010
122 Ga0068861_101854549 3300005719 Bacteria 599
123 Ga0068851_10366750 3300005834 Bacteria 841
124 Ga0068863_100067439 3300005841 Bacteria 3384
125 Ga0068863_100615180 3300005841 Bacteria 1076
126 Ga0068858_100059299 3300005842 Bacteria 3537
127 Ga0068860_100000360 3300005843 Bacteria 60297
128 Ga0068860_100094153 3300005843 Bacteria 2855
129 Ga0068860_102313443 3300005843 Bacteria 558
130 Ga0068862_100500977 3300005844 Bacteria 1153
131 Ga0081455_10551309 3300005937 Bacteria 762
132 Ga0081540_1027303 3300005983 Bacteria 3238
133 Ga0081540_1029140 3300005983 Bacteria 3082
134 Ga0070717_10003328 3300006028 Bacteria 11477
135 Ga0070717_10007544 3300006028 Bacteria 8083
136 Ga0070717_10221253 3300006028 Bacteria 1664
137 Ga0070717_10391088 3300006028 Bacteria 1248
138 Ga0070717_10780830 3300006028 Bacteria 869
139 Ga0070717_10904072 3300006028 Bacteria 804
140 Ga0075365_10339531 3300006038 Bacteria 1058
141 Ga0075364_10105653 3300006051 Bacteria 1876
142 Ga0070715_10093139 3300006163 Bacteria 1391
143 Ga0070715_10179947 3300006163 Bacteria 1059
144 Ga0070715_10277313 3300006163 Bacteria 887
145 Ga0070715_10595935 3300006163 Bacteria 647
146 Ga0070716_100002233 3300006173 Bacteria 8923
147 Ga0070716_100031117 3300006173 Bacteria 2900
148 Ga0070712_100010775 3300006175 Bacteria 5779
149 Ga0070712_100051207 3300006175 Bacteria 2876
150 Ga0070712_100156648 3300006175 Bacteria 1755
151 Ga0070712_100441075 3300006175 Bacteria 1083
152 Ga0070712_100771012 3300006175 Bacteria 824
153 Ga0097621_100008876 3300006237 Bacteria 7268
154 Ga0097621_100026444 3300006237 Bacteria 4552
155 Ga0097621_100359483 3300006237 Bacteria 1297
156 Ga0097621_101183291 3300006237 Bacteria 720
157 Ga0068871_100015537 3300006358 Bacteria 5702
158 Ga0068871_100241467 3300006358 Bacteria 1571
159 Ga0075433_10423626 3300006852 Bacteria 1174
160 Ga0075434_100512931 3300006871 Bacteria 1219
161 Ga0075434_100581087 3300006871 Bacteria 1139
162 Ga0068865_100009015 3300006881 Bacteria 6171
163 Ga0068865_100415311 3300006881 Bacteria 1105
164 Ga0075436_100031219 3300006914 Bacteria 3668
165 Ga0075436_100414882 3300006914 Bacteria 977
166 Ga0097620_100071001 3300006931 Bacteria 3517
167 Ga0075435_100492508 3300007076 Bacteria 1059
168 Ga0099794_10252337 3300007265 Bacteria 910
169 Ga0105251_10012262 3300009011 Bacteria 4857
170 Ga0105245_10038270 3300009098 Bacteria 4268
171 Ga0105245_10287853 3300009098 Bacteria 1608
172 Ga0105245_11861990 3300009098 Bacteria 655
173 Ga0105247_10079094 3300009101 Bacteria 2069
174 Ga0105247_10086615 3300009101 Bacteria 1982
175 Ga0105247_10295137 3300009101 Bacteria 1122
176 Ga0105247_10390936 3300009101 Bacteria 988
177 Ga0105247_11027366 3300009101 Bacteria 645
178 Ga0105243_10080808 3300009148 Bacteria 2652
179 Ga0105243_10374450 3300009148 Bacteria 1315
180 Ga0105241_10037102 3300009174 Bacteria 3671
181 Ga0105241_10141127 3300009174 Bacteria 1962
182 Ga0105241_10358358 3300009174 Bacteria 1268
183 Ga0105242_10006274 3300009176 Bacteria 9156
184 Ga0105242_10059085 3300009176 Bacteria 3145
185 Ga0105242_10408608 3300009176 Bacteria 1269
186 Ga0105248_10065160 3300009177 Bacteria 4090
187 Ga0105248_10207704 3300009177 Bacteria 2206
188 Ga0105248_11436975 3300009177 Bacteria 781
189 Ga0105237_10021234 3300009545 Bacteria 6678
190 Ga0105237_10714057 3300009545 Bacteria 1009
191 Ga0105237_10996490 3300009545 Bacteria 845
192 Ga0105238_10027647 3300009551 Bacteria 5781
193 Ga0105238_10373216 3300009551 Bacteria 1417
194 Ga0105238_11148679 3300009551 Bacteria 800
195 Ga0105238_12070457 3300009551 Bacteria 603
196 Ga0105238_12678210 3300009551 Bacteria 535
197 Ga0105249_11247695 3300009553 Bacteria 815
198 Ga0105249_11523571 3300009553 Bacteria 741
199 Ga0105249_12134949 3300009553 Bacteria 633
200 Ga0105239_10074149 3300010375 Bacteria 3742
201 Ga0105239_10267093 3300010375 Bacteria 1924
202 Ga0105239_10304214 3300010375 Bacteria 1796
203 Ga0105239_10599290 3300010375 Bacteria 1257
204 Ga0105239_11040318 3300010375 Bacteria 942
205 Ga0105239_11652668 3300010375 Bacteria 741
206 Ga0105239_12356119 3300010375 Bacteria 620
207 Ga0105246_10053735 3300011119 Bacteria 2773
208 Ga0105246_10296493 3300011119 Bacteria 1303
209 Ga0157336_1011918 3300012477 Bacteria 683
210 Ga0157335_1000825 3300012492 Bacteria 1544
211 Ga0157345_1019228 3300012498 Bacteria 681
212 Ga0157314_1052637 3300012500 Bacteria 525
213 Ga0157313_1026749 3300012503 Bacteria 628
214 Ga0157324_1030507 3300012506 Bacteria 608
215 Ga0157316_1027201 3300012510 Bacteria 669
216 Ga0157338_1017731 3300012515 Bacteria 800
217 Ga0157370_11778711 3300013104 Bacteria 553
218 Ga0157374_10179291 3300013296 Bacteria 2069
219 Ga0157374_10208823 3300013296 Bacteria 1914
220 Ga0157378_10094941 3300013297 Bacteria 2716
221 Ga0157378_10934671 3300013297 Bacteria 899
222 Ga0157378_11010931 3300013297 Bacteria 866
223 Ga0157378_12095805 3300013297 Bacteria 616
224 Ga0163162_10108966 3300013306 Bacteria 2866
225 Ga0163162_10246430 3300013306 Bacteria 1918
226 Ga0163162_11121669 3300013306 Bacteria 891
227 Ga0157372_10134988 3300013307 Bacteria 2841
228 Ga0157372_12182728 3300013307 Bacteria 636
229 Ga0157375_10135433 3300013308 Bacteria 2586
230 Ga0157375_10329773 3300013308 Bacteria 1691
231 Ga0157375_10852394 3300013308 Bacteria 1058
232 Ga0163163_10335512 3300014325 Bacteria 1567
233 Ga0163163_10753207 3300014325 Bacteria 1037
234 Ga0157380_11841068 3300014326 Bacteria 665
235 Ga0157379_10007831 3300014968 Bacteria 9252
236 Ga0157379_10166035 3300014968 Bacteria 1992
237 Ga0157379_10829249 3300014968 Bacteria 874
238 Ga0157376_10448835 3300014969 Bacteria 1257
239 Ga0157376_10873512 3300014969 Bacteria 916
240 Ga0157376_10973157 3300014969 Bacteria 870
241 Ga0163161_10026256 3300017792 Bacteria 4126
242 Ga0163161_10068276 3300017792 Bacteria 2597
243 Ga0213876_10179521 3300021384 Bacteria 1126
244 Ga0213875_10477209 3300021388 Bacteria 598
245 Ga0207697_10228483 3300025315 Bacteria 821
246 Ga0207692_10005372 3300025898 Bacteria 5131
247 Ga0207692_10069774 3300025898 Bacteria 1848
248 Ga0207692_10340830 3300025898 Bacteria 922
249 Ga0207692_10361122 3300025898 Bacteria 897
250 Ga0207692_10564439 3300025898 Bacteria 728
251 Ga0207642_10301087 3300025899 Bacteria 929
252 Ga0207710_10046975 3300025900 Bacteria 1928
253 Ga0207710_10050402 3300025900 Bacteria 1868
254 Ga0207710_10072035 3300025900 Bacteria 1586
255 Ga0207710_10162358 3300025900 Bacteria 1089
256 Ga0207710_10359226 3300025900 Bacteria 743
257 Ga0207710_10401078 3300025900 Bacteria 704
258 Ga0207688_10391025 3300025901 Bacteria 861
259 Ga0207680_10029075 3300025903 Bacteria 3100
260 Ga0207685_10004129 3300025905 Bacteria 3644
261 Ga0207685_10029551 3300025905 Bacteria 1941
262 Ga0207685_10090429 3300025905 Bacteria 1287
263 Ga0207685_10174449 3300025905 Bacteria 992
264 Ga0207685_10179973 3300025905 Bacteria 979
265 Ga0207699_10001161 3300025906 Bacteria 12456
266 Ga0207699_10012349 3300025906 Bacteria 4344
267 Ga0207699_10014207 3300025906 Bacteria 4097
268 Ga0207699_10140066 3300025906 Bacteria 1589
269 Ga0207699_10328840 3300025906 Bacteria 1074
270 Ga0207699_10405139 3300025906 Bacteria 972
271 Ga0207645_10023325 3300025907 Bacteria 4022
272 Ga0207645_10528976 3300025907 Bacteria 799
273 Ga0207705_11434259 3300025909 Bacteria 524
274 Ga0207654_10043742 3300025911 Bacteria 2540
275 Ga0207654_10066063 3300025911 Bacteria 2132
276 Ga0207654_10235678 3300025911 Bacteria 1221
277 Ga0207707_10026208 3300025912 Bacteria 5096
278 Ga0207707_10340876 3300025912 Bacteria 1292
279 Ga0207671_10245556 3300025914 Bacteria 1407
280 Ga0207671_10642360 3300025914 Bacteria 845
281 Ga0207693_10003131 3300025915 Bacteria 14229
282 Ga0207693_10043770 3300025915 Bacteria 3520
283 Ga0207693_10058351 3300025915 Bacteria 3024
284 Ga0207693_10181380 3300025915 Bacteria 1657
285 Ga0207693_10225292 3300025915 Bacteria 1473
286 Ga0207663_10015462 3300025916 Bacteria 4210
287 Ga0207663_10061185 3300025916 Bacteria 2388
288 Ga0207663_10071436 3300025916 Bacteria 2240
289 Ga0207663_10188456 3300025916 Bacteria 1479
290 Ga0207663_10380554 3300025916 Bacteria 1075
291 Ga0207660_10788538 3300025917 Bacteria 775
292 Ga0207657_10162543 3300025919 Bacteria 1813
293 Ga0207649_10148323 3300025920 Bacteria 1612
294 Ga0207652_10098796 3300025921 Bacteria 2575
295 Ga0207652_10246038 3300025921 Bacteria 1612
296 Ga0207652_10599659 3300025921 Bacteria 988
297 Ga0207681_10554856 3300025923 Bacteria 946
298 Ga0207694_10040173 3300025924 Bacteria 3601
299 Ga0207694_10150540 3300025924 Bacteria 1874
300 Ga0207694_10633556 3300025924 Bacteria 900
301 Ga0207650_10259172 3300025925 Bacteria 1410
302 Ga0207659_11661661 3300025926 Bacteria 544
303 Ga0207687_10012582 3300025927 Bacteria 5527
304 Ga0207687_10033806 3300025927 Bacteria 3469
305 Ga0207687_10757178 3300025927 Bacteria 827
306 Ga0207700_10000917 3300025928 Bacteria 16892
307 Ga0207700_10021942 3300025928 Bacteria 4372
308 Ga0207700_10053149 3300025928 Bacteria 3033
309 Ga0207700_10102651 3300025928 Bacteria 2285
310 Ga0207700_10993708 3300025928 Bacteria 751
311 Ga0207700_11438312 3300025928 Bacteria 612
312 Ga0207664_10100523 3300025929 Bacteria 2388
313 Ga0207664_10261339 3300025929 Bacteria 1514
314 Ga0207664_10395828 3300025929 Bacteria 1228
315 Ga0207664_10418862 3300025929 Bacteria 1193
316 Ga0207664_11175493 3300025929 Bacteria 685
317 Ga0207664_11915049 3300025929 Bacteria 516
318 Ga0207644_10007559 3300025931 Bacteria 7084
319 Ga0207644_10115945 3300025931 Bacteria 2032
320 Ga0207644_11390102 3300025931 Bacteria 590
321 Ga0207706_10014945 3300025933 Bacteria 7030
322 Ga0207706_10189748 3300025933 Bacteria 1804
323 Ga0207686_10011564 3300025934 Bacteria 4836
324 Ga0207686_10507143 3300025934 Bacteria 937
325 Ga0207686_10847197 3300025934 Bacteria 735
326 Ga0207709_10125631 3300025935 Bacteria 1739
327 Ga0207709_10459689 3300025935 Bacteria 986
328 Ga0207709_10818320 3300025935 Bacteria 753
329 Ga0207670_10017561 3300025936 Bacteria 4326
330 Ga0207669_10767290 3300025937 Bacteria 797
331 Ga0207669_11343895 3300025937 Bacteria 608
332 Ga0207704_11180102 3300025938 Bacteria 652
333 Ga0207704_11339485 3300025938 Bacteria 613
334 Ga0207665_10000333 3300025939 Bacteria 32450
335 Ga0207665_10021917 3300025939 Bacteria 4201
336 Ga0207665_10111445 3300025939 Bacteria 1923
337 Ga0207711_10086244 3300025941 Bacteria 2752
338 Ga0207711_10107904 3300025941 Bacteria 2472
339 Ga0207711_10988006 3300025941 Bacteria 781
340 Ga0207689_10031849 3300025942 Bacteria 4386
341 Ga0207661_10862847 3300025944 Bacteria 833
342 Ga0207679_10701872 3300025945 Bacteria 918
343 Ga0207679_10876866 3300025945 Bacteria 820
344 Ga0207679_11669890 3300025945 Bacteria 583
345 Ga0207667_10168621 3300025949 Bacteria 2250
346 Ga0207667_10230228 3300025949 Bacteria 1898
347 Ga0207667_10814489 3300025949 Bacteria 930
348 Ga0207651_10072873 3300025960 Bacteria 2440
349 Ga0207712_10538677 3300025961 Bacteria 1003
350 Ga0207712_11132787 3300025961 Bacteria 697
351 Ga0207658_10047022 3300025986 Bacteria 3155
352 Ga0207658_10071512 3300025986 Bacteria 2627
353 Ga0207677_10139446 3300026023 Bacteria 1854
354 Ga0207677_11789826 3300026023 Bacteria 570
355 Ga0207703_10139094 3300026035 Bacteria 2105
356 Ga0207703_10333842 3300026035 Bacteria 1391
357 Ga0207703_10921854 3300026035 Bacteria 837
358 Ga0207703_11003981 3300026035 Bacteria 801
359 Ga0207703_12020444 3300026035 Bacteria 553
360 Ga0207639_10089016 3300026041 Bacteria 2465
361 Ga0207639_10400976 3300026041 Bacteria 1236
362 Ga0207639_10909645 3300026041 Bacteria 823
363 Ga0207639_11390914 3300026041 Bacteria 659
364 Ga0207678_10097972 3300026067 Bacteria 2505
365 Ga0207678_10107195 3300026067 Bacteria 2383
366 Ga0207678_10239787 3300026067 Bacteria 1553
367 Ga0207708_10038595 3300026075 Bacteria 3638
368 Ga0207708_10354172 3300026075 Bacteria 1205
369 Ga0207702_10276224 3300026078 Bacteria 1586
370 Ga0207702_11533230 3300026078 Bacteria 660
371 Ga0207641_10212558 3300026088 Bacteria 1789
372 Ga0207641_10750393 3300026088 Bacteria 963
373 Ga0207641_11516139 3300026088 Bacteria 672
374 Ga0207648_10124866 3300026089 Bacteria 2263
375 Ga0207648_10186503 3300026089 Bacteria 1837
376 Ga0207676_10186879 3300026095 Bacteria 1819
377 Ga0207675_102137106 3300026118 Bacteria 576
378 Ga0207683_10001447 3300026121 Bacteria 21461
379 Ga0207683_10153592 3300026121 Bacteria 2078
380 Ga0207683_10254310 3300026121 Bacteria 1603
381 Ga0207698_10383176 3300026142 Bacteria 1338
382 Ga0207698_10398539 3300026142 Bacteria 1315
383 Ga0209971_1154606 3300027682 Bacteria 566
384 Ga0209966_1014410 3300027695 Bacteria 1475
385 Ga0209974_10036257 3300027876 Bacteria 1638
386 Ga0265357_1020655 3300028023 Bacteria 720
387 Ga0268266_10025953 3300028379 Bacteria 4984
388 Ga0268266_10136477 3300028379 Bacteria 2198
389 Ga0268266_10243092 3300028379 Bacteria 1662
390 Ga0268265_12194390 3300028380 Bacteria 559
391 Ga0268264_10000030 3300028381 Bacteria 418542
392 Ga0268264_10483253 3300028381 Bacteria 1205
393 Ga0268264_10656641 3300028381 Bacteria 1038
394 Ga0265337_1001486 3300028556 Bacteria 11490
395 Ga0265338_10247553 3300028800 Bacteria 1316
396 Ga0265338_10306413 3300028800 Bacteria 1153
397 Ga0307511_10107189 3300030521 Bacteria 1800
398 Ga0265763_1005459 3300030763 Bacteria 1067
399 Ga0265773_1031879 3300031018 Bacteria 570
400 Ga0265332_10000899 3300031238 Bacteria 17859
401 Ga0265332_10175142 3300031238 Bacteria 895
402 Ga0265325_10000049 3300031241 Bacteria 80854
403 Ga0265325_10083742 3300031241 Bacteria 1582
404 Ga0265325_10242883 3300031241 Bacteria 818
405 Ga0265329_10221386 3300031242 Bacteria 626
406 Ga0265340_10005450 3300031247 Bacteria 7065
407 Ga0265340_10166484 3300031247 Bacteria 1000
408 Ga0265339_10058197 3300031249 Bacteria 2087
409 Ga0265339_10210681 3300031249 Bacteria 955
410 Ga0265331_10149249 3300031250 Bacteria 1062
411 Ga0265316_10261497 3300031344 Bacteria 1269
412 Ga0265316_10278153 3300031344 Bacteria 1223
413 Ga0307509_10014245 3300031507 Bacteria 9362
414 Ga0265313_10036963 3300031595 Bacteria 2447
415 Ga0307508_10173191 3300031616 Bacteria 1761
416 Ga0265314_10000784 3300031711 Bacteria 37699
417 Ga0265314_10005953 3300031711 Bacteria 10894
418 Ga0265314_10044806 3300031711 Bacteria 3132
419 Ga0265342_10000392 3300031712 Bacteria 48362
420 Ga0265342_10166027 3300031712 Bacteria 1218
421 Ga0307516_10005995 3300031730 Bacteria 14363
422 Ga0326468_10081748 3300031889 Bacteria 559
423 Ga0307510_10283860 3300033180 Bacteria 1125
424 Ga0373950_0018390 3300034818 Bacteria 1212
425 Ga0373958_0085356 3300034819 Bacteria 720
426 Ga0373959_0017137 3300034820 Bacteria 1350
427 Ga0373959_0087871 3300034820 Bacteria 725
428 Ga0373938_0008109 3300034957 Bacteria 1868
429 Ga0373926_0006103 3300035083 Bacteria 3991
430 Ga0373928_0004039 3300035084 Bacteria 2800
431 Ga0373934_0022825 3300035086 Bacteria 2415
432 Ga0373934_0120017 3300035086 Bacteria 1069
433 Ga0373940_0167330 3300035088 Bacteria 709
434 Ga0373949_0027055 3300035090 Bacteria 1347
435 Ga0373951_0006562 3300035091 Bacteria 2660
436 Ga0373952_0061984 3300035092 Bacteria 917
437 Ga0373923_0078244 3300035111 Bacteria 1431
438 Ga0373932_0003814 3300035112 Bacteria 3601
439 Ga0373932_0181145 3300035112 Bacteria 739
440 Ga0373939_0016078 3300035114 Bacteria 1968
441 Ga0373941_0013677 3300035115 Bacteria 2152
442 Ga0373945_0055006 3300035116 Bacteria 1472
443 Ga0373953_0006441 3300035117 Bacteria 3868
444 Ga0373953_0042214 3300035117 Bacteria 1817
445 Ga0373953_0128359 3300035117 Bacteria 1080
446 Ga0373954_0008900 3300035118 Bacteria 4417
447 Ga0373954_0200643 3300035118 Bacteria 980
448 Ga0373954_0224537 3300035118 Bacteria 924
449 Ga0373956_0019629 3300035119 Bacteria 2868
450 Ga0373956_0076710 3300035119 Bacteria 1530
451 Ga0373956_0257183 3300035119 Bacteria 830
452 Ga0373957_0341802 3300035120 Bacteria 638
453 Ga0373957_0419885 3300035120 Bacteria 577
454 Ga0373960_0004580 3300035121 Bacteria 3174
455 Ga0373943_0138348 3300035170 Bacteria 1310
456 Ga0373943_0374997 3300035170 Bacteria 818
457 Ga0373943_0433959 3300035170 Bacteria 761
458 Ga0373946_0022847 3300035171 Bacteria 2439
459 Ga0373946_0059173 3300035171 Bacteria 1625
460 Ga0373946_0178157 3300035171 Bacteria 1007
461 Ga0373955_0024935 3300035172 Bacteria 3064
462 Ga0373955_0144548 3300035172 Bacteria 1396
463 Ga0373955_0194939 3300035172 Bacteria 1205
464 Ga0373955_0615985 3300035172 Bacteria 665
465 Ga0373942_0057053 3300035207 Bacteria 1110
466 Ga0373961_0061888 3300035241 Bacteria 1138
467 Ga0373962_0057562 3300035242 Bacteria 1134
468 Ga0373962_0078344 3300035242 Bacteria 999
469 Ga0316574_0791808 3300035398 Bacteria 577
470 Ga0373924_0008024 3300035410 Bacteria 3821
471 Ga0373924_0029447 3300035410 Bacteria 2195
472 Ga0373924_0033955 3300035410 Bacteria 2063
473 Ga0373924_0044023 3300035410 Bacteria 1834
474 Ga0373931_0004569 3300035691 Bacteria 6331
475 Ga0373935_0004548 3300035692 Bacteria 8158
476 Ga0373935_0015490 3300035692 Bacteria 4609
477 Ga0373935_0035574 3300035692 Bacteria 3109
478 Ga0373935_0067946 3300035692 Bacteria 2293
479 Ga0373935_0104396 3300035692 Bacteria 1873
480 Ga0373935_0677034 3300035692 Bacteria 758
481 Ga0373927_0017601 3300035695 Bacteria 4702
482 Ga0373927_0184081 3300035695 Bacteria 1370
483 Ga0373927_0211276 3300035695 Bacteria 1274
484 Ga0373933_0002449 3300035724 Bacteria 10458
485 Ga0373933_0260278 3300035724 Bacteria 1118
486 Ga0373947_0005403 3300035725 Bacteria 7458
487 Ga0373947_0018365 3300035725 Bacteria 4024
488 Ga0373947_0119293 3300035725 Bacteria 1674
489 Ga0373947_0124973 3300035725 Bacteria 1637
490 Ga0373947_0202839 3300035725 Bacteria 1298
491 Ga0373947_0473216 3300035725 Bacteria 850
492 Ga0373937_0002996 3300036401 Bacteria 14164
493 Ga0373937_0008068 3300036401 Bacteria 9135
494 Ga0373937_0008991 3300036401 Bacteria 8673
495 Ga0373937_0142283 3300036401 Bacteria 2245
496 Ga0373937_0345221 3300036401 Bacteria 1410
497 Ga0373937_0516898 3300036401 Bacteria 1134
498 Ga0373937_0873754 3300036401 Bacteria 848
499 Ga0373937_2008695 3300036401 Bacteria 524
500 Ga0373925_0025234 3300037068 Bacteria 4340
501 Ga0373925_0098740 3300037068 Bacteria 2241
502 Ga0373925_0101593 3300037068 Bacteria 2211
503 Ga0373925_0742294 3300037068 Bacteria 809
504 Ga0373925_0759985 3300037068 Bacteria 799
505 Ga0395898_0613059 3300037466 Bacteria 1031
506 Ga0436364_0364973 3300037853 Bacteria 864
507 Ga0436365_0090047 3300039437 Bacteria 3528
508 Ga0436365_0390621 3300039437 Bacteria 505
509 Ga0436360_0203691 3300039438 Bacteria 1773
510 Ga0439465_0071611 3300041413 Bacteria 1163
511 Ga0451802_0275182 3300041460 Bacteria 1388
512 Ga0451841_0043378 3300041498 Bacteria 563
513 Ga0451843_0333450 3300041509 Bacteria 625
514 Ga0439455_0140561 3300042012 Bacteria 684
515 Ga0439464_0120779 3300042439 Bacteria 807
516 Ga0439464_0128357 3300042439 Bacteria 784
517 Ga0466967_1019021 3300045976 Bacteria 824
518 Ga0495592_0001840 3300046454 Bacteria 14914
519 Ga0495592_0010619 3300046454 Bacteria 6945
520 Ga0495592_0626729 3300046454 Bacteria 653
521 Ga0495603_0011026 3300046455 Bacteria 5480
522 Ga0495603_0037807 3300046455 Bacteria 2895
523 Ga0495629_0000269 3300046459 Bacteria 45206
524 Ga0495629_0069439 3300046459 Bacteria 2458
525 Ga0495629_0089738 3300046459 Bacteria 2144
526 Ga0495638_0040160 3300046460 Bacteria 2966
527 Ga0495641_0026269 3300046461 Bacteria 2843
528 Ga0495641_0042734 3300046461 Bacteria 2099
529 Ga0495641_0150265 3300046461 Bacteria 1041
530 Ga0495641_0317993 3300046461 Unclassified 702
531 Ga0495651_0005718 3300046462 Bacteria 9477
532 Ga0495651_0010406 3300046462 Bacteria 7147
533 Ga0495651_0064265 3300046462 Bacteria 2805
534 Ga0495651_0185639 3300046462 Bacteria 1468
535 Ga0495651_0360559 3300046462 Bacteria 958
536 Ga0495651_0460971 3300046462 Bacteria 820
537 Ga0495653_0010063 3300046463 Bacteria 7736
538 Ga0495653_0030364 3300046463 Bacteria 4306
539 Ga0495653_0146642 3300046463 Bacteria 1653
540 Ga0495653_0171215 3300046463 Bacteria 1499
541 Ga0495653_0216780 3300046463 Bacteria 1289
542 Ga0495653_0967615 3300046463 Bacteria 504
543 Ga0495580_0243568 3300046472 Bacteria 1232
544 Ga0495580_0560182 3300046472 Bacteria 758
545 Ga0495580_0651674 3300046472 Bacteria 692
546 Ga0495582_0003928 3300046473 Bacteria 8349
547 Ga0495582_0109872 3300046473 Bacteria 1548
548 Ga0495639_0396873 3300046475 Bacteria 696
549 Ga0495662_0105186 3300046476 Bacteria 1381
550 Ga0495662_0114856 3300046476 Bacteria 1320
551 Ga0495664_0010264 3300046477 Bacteria 5254
552 Ga0495664_0021710 3300046477 Bacteria 3709
553 Ga0495664_0118438 3300046477 Bacteria 1601
554 Ga0495664_0238448 3300046477 Bacteria 1100
555 Ga0495594_0009788 3300046499 Bacteria 4963
556 Ga0495594_0027976 3300046499 Bacteria 3040
557 Ga0495608_0001268 3300046511 Bacteria 17936
558 Ga0495608_0016256 3300046511 Bacteria 5147
559 Ga0495608_0285310 3300046511 Bacteria 1024
560 Ga0495610_0301084 3300046512 Bacteria 618
561 Ga0495618_0037072 3300046514 Bacteria 3061
562 Ga0495618_0088979 3300046514 Bacteria 1974
563 Ga0495618_0254207 3300046514 Bacteria 1102
564 Ga0495618_0331159 3300046514 Bacteria 941
565 Ga0495618_0574481 3300046514 Bacteria 673
566 Ga0495618_0597161 3300046514 Bacteria 657
567 Ga0495628_0005226 3300046516 Bacteria 11394
568 Ga0495628_0268395 3300046516 Bacteria 1270
569 Ga0495630_0192162 3300046517 Bacteria 1557
570 Ga0495630_0475487 3300046517 Bacteria 958
571 Ga0495630_0638424 3300046517 Bacteria 816
572 Ga0495666_0167651 3300046526 Bacteria 1016
573 Ga0495652_0061818 3300046529 Bacteria 3160
574 Ga0495652_0077885 3300046529 Bacteria 2746
575 Ga0495652_0216037 3300046529 Bacteria 1444
576 Ga0495652_0224929 3300046529 Bacteria 1407
577 Ga0495640_0006352 3300046533 Bacteria 9365
578 Ga0495640_0018005 3300046533 Bacteria 5252
579 Ga0495640_0040789 3300046533 Bacteria 3248
580 Ga0495640_0422869 3300046533 Bacteria 816
581 Ga0495586_0011910 3300046535 Bacteria 4619
582 Ga0495586_0171759 3300046535 Bacteria 1225
583 Ga0495587_0000620 3300046536 Bacteria 24097
584 Ga0495587_0058326 3300046536 Bacteria 2268
585 Ga0495645_0000848 3300046543 Bacteria 20818
586 Ga0495645_0008343 3300046543 Bacteria 7232
587 Ga0495645_0393965 3300046543 Bacteria 884
588 Ga0495645_0775211 3300046543 Bacteria 577
589 Ga0495622_0043236 3300046557 Bacteria 2095
590 Ga0495667_0001254 3300046559 Bacteria 16638
591 Ga0495667_0022137 3300046559 Bacteria 4283
592 Ga0495667_0097610 3300046559 Bacteria 1902
593 Ga0495667_0104514 3300046559 Bacteria 1831
594 Ga0495667_0105159 3300046559 Bacteria 1825
595 Ga0495667_0113573 3300046559 Unclassified 1750
596 Ga0495634_0017607 3300046642 Bacteria 5096
597 Ga0495634_0019712 3300046642 Bacteria 4790
598 Ga0495634_0266260 3300046642 Bacteria 1044
599 Ga0495635_0005437 3300046663 Bacteria 8861
600 Ga0495635_0036531 3300046663 Bacteria 3405
601 Ga0495635_0090897 3300046663 Bacteria 2088
602 Ga0495635_0091274 3300046663 Bacteria 2083
603 Ga0495635_0146947 3300046663 Bacteria 1605
604 Ga0495635_0346365 3300046663 Bacteria 992
605 Ga0495635_0466719 3300046663 Bacteria 833
606 Ga0495661_0165033 3300046665 Bacteria 1186
607 Ga0495588_0067758 3300046674 Bacteria 1853
608 Ga0495657_0002939 3300046675 Bacteria 14124
609 Ga0495657_0032408 3300046675 Bacteria 3646
610 Ga0495599_0062103 3300046678 Bacteria 2334
611 Ga0495599_0214597 3300046678 Bacteria 1179
612 Ga0495623_0026867 3300046679 Bacteria 3703
613 Ga0495623_0035166 3300046679 Bacteria 3211
614 Ga0495646_0000856 3300046680 Bacteria 17244
615 Ga0495646_0083480 3300046680 Bacteria 1857
616 Ga0495646_0202842 3300046680 Bacteria 1079
617 Ga0495647_0053754 3300046681 Bacteria 1571
618 Ga0495658_0004553 3300046683 Bacteria 6816
619 Ga0495658_0810370 3300046683 Bacteria 599
620 Ga0495613_0038188 3300046689 Bacteria 3559
621 Ga0495613_0162962 3300046689 Bacteria 1585
622 Ga0495613_0394572 3300046689 Bacteria 945
623 Ga0495613_0430843 3300046689 Unclassified 896
624 Ga0495624_0040542 3300046690 Bacteria 2982
625 Ga0495624_0137836 3300046690 Bacteria 1495
626 Ga0495624_0387213 3300046690 Bacteria 840
627 Ga0495624_0956348 3300046690 Bacteria 503
628 Ga0495600_0016667 3300046809 Bacteria 4669
629 Ga0495600_0052308 3300046809 Bacteria 2667
630 Ga0495600_0128219 3300046809 Bacteria 1649
631 Ga0495600_0133793 3300046809 Bacteria 1611
632 Ga0495600_0579557 3300046809 Bacteria 683
633 Ga0495581_0036567 3300047315 Bacteria 2841
634 Ga0495581_0101672 3300047315 Bacteria 1670
635 Ga0495604_0005959 3300047317 Bacteria 9671
636 Ga0495604_0027617 3300047317 Bacteria 4512
637 Ga0495604_0056504 3300047317 Bacteria 3020
638 Ga0495604_0103429 3300047317 Bacteria 2089
639 Ga0495604_0591355 3300047317 Bacteria 712
640 Ga0495674_0005637 3300047319 Bacteria 11992
641 Ga0495674_0061401 3300047319 Bacteria 3275
642 Ga0495676_0034516 3300047321 Bacteria 4244
643 Ga0495676_0144308 3300047321 Bacteria 1702
644 Ga0495680_0001472 3300047322 Bacteria 25404
645 Ga0495680_0006777 3300047322 Bacteria 10581
646 Ga0495680_0017612 3300047322 Bacteria 6090
647 Ga0495680_0018210 3300047322 Bacteria 5971
648 Ga0495680_0022232 3300047322 Bacteria 5290
649 Ga0495680_0217882 3300047322 Bacteria 1364
650 Ga0495680_0241607 3300047322 Bacteria 1282
651 Ga0495675_0018016 3300047444 Bacteria 4477
652 Ga0495675_0048151 3300047444 Bacteria 2712
653 Ga0495675_0168024 3300047444 Bacteria 1348
654 Ga0495684_0031095 3300047471 Bacteria 4098
655 Ga0495684_0047729 3300047471 Bacteria 3275
656 Ga0495684_0213504 3300047471 Bacteria 1418
657 Ga0495684_0294075 3300047471 Bacteria 1168
658 Ga0495684_0298325 3300047471 Bacteria 1158
659 Ga0495684_0633406 3300047471 Bacteria 717
660 Ga0495593_0009204 3300047673 Bacteria 5726
661 Ga0495602_0002664 3300048088 Bacteria 18252
662 Ga0495602_0013607 3300048088 Bacteria 8305
663 Ga0495602_0128650 3300048088 Bacteria 2023
664 Ga0495602_0183138 3300048088 Bacteria 1613
665 Ga0495602_0515833 3300048088 Bacteria 833
666 Ga0495614_0145476 3300048089 Bacteria 1055
667 Ga0496100_0006554 3300048903 Bacteria 6356
668 Ga0496100_0102455 3300048903 Bacteria 1975
669 Ga0496100_0204967 3300048903 Bacteria 1439
670 Ga0496100_0399268 3300048903 Bacteria 1047
671 Ga0496101_0007659 3300048904 Bacteria 7011
672 Ga0496101_0016572 3300048904 Bacteria 4982
673 Ga0496101_0147253 3300048904 Bacteria 1799
674 Ga0496101_0347632 3300048904 Bacteria 1165
675 Ga0496101_0435107 3300048904 Bacteria 1034
676 Ga0496102_0016358 3300048905 Bacteria 6479
677 Ga0496102_0070115 3300048905 Bacteria 3218
678 Ga0496102_0261230 3300048905 Bacteria 1632
679 Ga0496102_0776671 3300048905 Bacteria 880
680 Ga0496102_0812061 3300048905 Bacteria 857
681 Ga0496102_1210976 3300048905 Bacteria 675
682 Ga0496103_0107057 3300048906 Bacteria 1773
683 Ga0496103_0280558 3300048906 Bacteria 1071
684 Ga0496103_0316878 3300048906 Bacteria 1003
685 Ga0496104_0000215 3300048907 Bacteria 50960
686 Ga0496104_0005956 3300048907 Bacteria 10678
687 Ga0496104_0097659 3300048907 Bacteria 2812
688 Ga0496104_0243034 3300048907 Bacteria 1712
689 Ga0496104_0374856 3300048907 Bacteria 1335
690 Ga0496104_0498536 3300048907 Bacteria 1129
691 Ga0496105_0007651 3300048908 Bacteria 8374
692 Ga0496105_0020355 3300048908 Bacteria 5361
693 Ga0496105_0157101 3300048908 Bacteria 1867
694 Ga0496105_0242092 3300048908 Bacteria 1464
695 Ga0496105_0429422 3300048908 Bacteria 1045
696 Ga0496105_0515938 3300048908 Bacteria 936
697 Ga0496106_0001857 3300048909 Bacteria 15809
698 Ga0496106_0019937 3300048909 Bacteria 4973
699 Ga0496106_0067503 3300048909 Bacteria 2726
700 Ga0496107_0019768 3300048910 Bacteria 4754
701 Ga0496107_0295593 3300048910 Bacteria 1205
702 Ga0496107_0520826 3300048910 Bacteria 881
703 Ga0496108_0056436 3300048911 Bacteria 3299
704 Ga0496108_0057496 3300048911 Bacteria 3268
705 Ga0496108_0241156 3300048911 Bacteria 1572
706 Ga0496108_0448952 3300048911 Bacteria 1126
707 Ga0496109_0133946 3300048912 Bacteria 2314
708 Ga0496109_0156658 3300048912 Bacteria 2133
709 Ga0496109_0389585 3300048912 Bacteria 1316
710 Ga0496109_0401126 3300048912 Bacteria 1295
711 Ga0496109_0961668 3300048912 Bacteria 792
712 Ga0496109_1184394 3300048912 Bacteria 701
713 Ga0496110_0022488 3300048913 Bacteria 5355
714 Ga0496110_0302206 3300048913 Bacteria 1457
715 Ga0496110_0356076 3300048913 Bacteria 1333
716 Ga0496110_0368896 3300048913 Bacteria 1308
717 Ga0496111_0084837 3300048914 Bacteria 2315
718 Ga0496111_0317797 3300048914 Bacteria 1153
719 Ga0496112_0193985 3300048915 Bacteria 1992
720 Ga0496112_0195658 3300048915 Bacteria 1982
721 Ga0496112_0570510 3300048915 Bacteria 1064
722 Ga0496112_0830786 3300048915 Bacteria 848
723 Ga0496112_1243055 3300048915 Bacteria 661
724 Ga0496113_0251371 3300048916 Bacteria 1411
725 Ga0496113_0427014 3300048916 Bacteria 1064
726 Ga0496113_0436095 3300048916 Bacteria 1052
727 Ga0496113_1451526 3300048916 Bacteria 530
728 Ga0496114_0076223 3300048917 Bacteria 2825
729 Ga0496114_0376999 3300048917 Bacteria 1256
730 Ga0496114_1041826 3300048917 Bacteria 702
731 Ga0496115_0013246 3300048918 Bacteria 6231
732 Ga0496115_0073757 3300048918 Bacteria 2770
733 Ga0496115_0099732 3300048918 Bacteria 2380
734 Ga0496115_0582525 3300048918 Bacteria 891
735 Ga0496115_0713092 3300048918 Bacteria 787
736 Ga0496115_0759486 3300048918 Bacteria 757
737 Ga0496115_1243551 3300048918 Bacteria 557
738 Ga0496117_0010071 3300048920 Bacteria 8683
739 Ga0496118_0008611 3300048921 Bacteria 10500
740 Ga0496119_0145579 3300048922 Bacteria 1275
741 Ga0496121_0002635 3300048924 Bacteria 27038
742 Ga0496121_0166584 3300048924 Bacteria 1605
743 Ga0496121_0450721 3300048924 Bacteria 829
744 Ga0496122_0052608 3300048925 Bacteria 3080
745 Ga0496124_0011581 3300048927 Bacteria 8801
746 Ga0496124_0378319 3300048927 Bacteria 991
747 Ga0496125_0000746 3300048928 Bacteria 53671
748 Ga0496125_0131030 3300048928 Bacteria 1765
749 Ga0496126_0002122 3300048929 Bacteria 27701
750 Ga0496126_0038000 3300048929 Bacteria 4482
751 Ga0496126_0108022 3300048929 Bacteria 2426
752 Ga0496126_0157082 3300048929 Bacteria 1946
753 Ga0496126_0208556 3300048929 Bacteria 1646
754 Ga0496126_0430274 3300048929 Bacteria 1065
755 Ga0496126_0661143 3300048929 Bacteria 816
756 Ga0501031_0255750 3300049568 Bacteria 1138
757 Ga0501034_0182998 3300049571 Bacteria 2060
758 Ga0501036_0114702 3300049572 Bacteria 2277
759 Ga0501039_1344434 3300049575 Bacteria 551
760 Ga0501042_0286813 3300049578 Bacteria 1189
761 Ga0501043_0448869 3300049579 Bacteria 969
762 Ga0501043_1083288 3300049579 Bacteria 567
763 Ga0501047_0008787 3300049581 Bacteria 9533
764 Ga0501047_0611642 3300049581 Bacteria 911
765 Ga0501067_0711546 3300049583 Bacteria 565
766 Ga0501068_0691835 3300049584 Bacteria 667
767 Ga0501070_0367305 3300049586 Bacteria 1167
768 Ga0501073_0034839 3300049589 Bacteria 3581
769 Ga0501075_0734248 3300049591 Bacteria 752
770 Ga0501076_0220426 3300049592 Bacteria 1550
771 Ga0501079_0565858 3300049741 Bacteria 894
772 Ga0501080_1170424 3300049742 Bacteria 662
773 Ga0501081_0672417 3300049743 Bacteria 777
774 Ga0501083_0023331 3300049744 Bacteria 4292
775 Ga0501035_0657975 3300049822 Bacteria 849
776 Ga0501044_0103888 3300049823 Bacteria 2856
777 Ga0501044_0118153 3300049823 Bacteria 2655
778 nmdc:mga03n38_684651_c1 3300050490 Bacteria 590
779 nmdc:mga00v17_900844_c1 3300050491 Bacteria 560
780 nmdc:mga0yw44_16709_c1 3300050492 Bacteria 3973
781 nmdc:mga0yw44_945281_c1 3300050492 Bacteria 584
782 nmdc:mga0n895_141846_c1 3300050512 Bacteria 2431
783 nmdc:mga0n895_161587_c1 3300050512 Bacteria 695
784 nmdc:mga0rr50_134685_c1 3300050513 Bacteria 1982
785 nmdc:mga08x19_27777_c1 3300050514 Bacteria 3541
786 nmdc:mga08x19_580259_c1 3300050514 Bacteria 794
787 nmdc:mga0sz30_281867_c1 3300050516 Bacteria 740
788 Ga0495601_0000109 3300053077 Bacteria 45069
789 Ga0495601_0002506 3300053077 Bacteria 10450
790 Ga0495601_0006125 3300053077 Bacteria 7019
791 Ga0495601_0009758 3300053077 Bacteria 5677
792 Ga0495601_0053399 3300053077 Bacteria 2554
793 Ga0495601_0059733 3300053077 Bacteria 2418
794 Ga0495612_0000953 3300053078 Bacteria 11879
795 Ga0495612_0002655 3300053078 Bacteria 7376
796 Ga0495612_0006674 3300053078 Bacteria 4733
797 Ga0500635_0015242 3300053080 Bacteria 2267
798 Ga0495595_0001271 3300053084 Bacteria 9824
799 Ga0495595_0005318 3300053084 Bacteria 5205
800 Ga0495595_0005872 3300053084 Bacteria 4976
801 Ga0495595_0019136 3300053084 Bacteria 2968
802 Ga0495595_0033835 3300053084 Bacteria 2308
803 Ga0495619_0000289 3300053085 Bacteria 35778
804 Ga0495619_0000662 3300053085 Bacteria 22563
805 Ga0495619_0002507 3300053085 Bacteria 12025
806 Ga0495619_0004938 3300053085 Bacteria 8470
807 Ga0495619_0015439 3300053085 Bacteria 4832
808 Ga0495619_0376229 3300053085 Bacteria 981
809 Ga0500643_002483 3300053087 Bacteria 9484
810 Ga0500644_0000860 3300053088 Bacteria 9944
811 Ga0500646_0025028 3300053090 Bacteria 1610
812 Ga0500651_0156758 3300053093 Bacteria 1364
813 Ga0500651_0721863 3300053093 Bacteria 531
814 Ga0500566_0072243 3300053094 Bacteria 1935
815 Ga0500566_0436952 3300053094 Bacteria 576
816 Ga0500648_097400 3300053097 Bacteria 1640
817 Ga0500650_0451371 3300053098 Bacteria 551
818 Ga0500595_000062 3300053119 Bacteria 77506
819 Ga0500595_016246 3300053119 Bacteria 2776
820 Ga0500595_055576 3300053119 Bacteria 1212
821 Ga0500652_033278 3300053131 Bacteria 2036
822 Ga0500655_084049 3300053133 Bacteria 657
823 Ga0500559_0094578 3300053136 Bacteria 1371
824 Ga0500559_0262266 3300053136 Bacteria 813
825 Ga0500564_234759 3300053138 Bacteria 735
826 Ga0500573_0104422 3300053140 Bacteria 1591
827 Ga0500590_091329 3300053148 Bacteria 1478
828 Ga0500590_108729 3300053148 Bacteria 1319
829 Ga0500603_014973 3300053150 Bacteria 1819
830 Ga0500616_0000006 3300053153 Bacteria 944738
831 Ga0500638_168116 3300053162 Bacteria 958
832 Ga0500639_028570 3300053163 Bacteria 2947
833 Ga0500639_157943 3300053163 Bacteria 1036
834 Ga0500636_0175949 3300053177 Bacteria 1153
835 Ga0500637_0056548 3300053178 Bacteria 2241
836 Ga0500637_0082391 3300053178 Bacteria 1859
837 Ga0500645_000101 3300053730 Bacteria 68128
838 Ga0500596_005660 3300053735 Bacteria 2174
839 Ga0501082_0067452 3300060353 Bacteria 3081
840 Ga0530510_0471912 3300061734 Bacteria 950
841 2513700651 2513237102 Bacteria 7703324
842 2824622032 2824617872 Bacteria 8814715
843 2824629296 2824626560 Bacteria 8813858
844 2824639171 2824635225 Bacteria 8785348
845 2824652638 2824644064 Bacteria 8743947
846 2824723190 2824714736 Bacteria 8717648
847 2824731758 2824723954 Bacteria 8758240
848 2904698944 2904690495 Bacteria 9412302
849 2908758741 2908756301 Bacteria 8864324
850 643605219 643348564 Bacteria 8839022
851 Ga0495619_1025951
852 RicEn_C6443
853 ARcpr5oldR_c011814
854 JGI24750J21931_1020184
855 JGI25406J46586_10000138
856 JGI25404J52841_10000288
857 JGI25404J52841_10016633
858 Ga0065165_1089247
859 Ga0065712_10806853
860 Ga0070658_10152408
861 Ga0070658_10281288
862 Ga0070658_11661314
863 Ga0070676_10066362
864 Ga0070676_10206242
865 Ga0070683_100566384
866 Ga0070690_100035779
867 Ga0070670_100085242
868 Ga0068869_100944991
869 Ga0070666_10044947
870 Ga0070666_10170100
871 Ga0070680_100073406
872 Ga0070682_100022461
873 Ga0070682_100691382
874 Ga0068868_100023195
875 Ga0068868_100302903
876 Ga0070660_101517973
877 Ga0070689_100271674
878 Ga0070691_10092647
879 Ga0070687_100655484
880 Ga0070687_101266715
881 Ga0070661_100063833
882 Ga0070661_100128827
883 Ga0070668_100111063
884 Ga0070669_100463638
885 Ga0070669_101941653
886 Ga0070675_101292694
887 Ga0070671_100075228
888 Ga0070671_100126562
889 Ga0070674_100118540
890 Ga0070674_100385100
891 Ga0070673_100031259
892 Ga0070673_100221129
893 Ga0070673_101180251
894 Ga0070688_100016483
895 Ga0070667_100096956
896 Ga0070667_100277815
897 Ga0070709_10000855
898 Ga0070709_10004300
899 Ga0070709_10022160
900 Ga0070709_10023003
901 Ga0070709_10229367
902 Ga0070714_100431103
903 Ga0070714_100474559
904 Ga0070713_100002359
905 Ga0070713_100004066
906 Ga0070713_100031837
907 Ga0070713_100149309
908 Ga0070713_100306657
909 Ga0070713_101195986
910 Ga0070710_10003385
911 Ga0070710_10029684
912 Ga0070710_10077078
913 Ga0070710_10096625
914 Ga0070710_10756435
915 Ga0070711_100017702
916 Ga0070711_100017962
917 Ga0070711_100088060
918 Ga0070711_100128053
919 Ga0070711_100209488
920 Ga0070711_100506323
921 Ga0070711_100838504
922 Ga0070705_100221343
923 Ga0070700_100532159
924 Ga0070700_101052240
925 Ga0070694_100356334
926 Ga0070708_100206734
927 Ga0070708_101359363
928 Ga0070663_100343464
929 Ga0070663_100412822
930 Ga0070678_100306263
931 Ga0070662_100448422
932 Ga0070681_10013271
933 Ga0068867_100235985
934 Ga0068867_100804167
935 Ga0070685_10153929
936 Ga0070685_10281094
937 Ga0070679_100085231
938 Ga0070679_100122492
939 Ga0070684_100525862
940 Ga0070684_101177447
941 Ga0068853_100068998
942 Ga0068853_100732708
943 Ga0068853_100960902
944 Ga0070686_100055931
945 Ga0070695_100065695
946 Ga0070695_100285865
947 Ga0070696_100142454
948 Ga0070696_100609966
949 Ga0070693_100058059
950 Ga0070693_100248190
951 Ga0070693_100523254
952 Ga0070693_100570628
953 Ga0070665_100053413
954 Ga0070665_100069877
955 Ga0070665_100806559
956 Ga0070704_101839071
957 Ga0068855_100187602
958 Ga0068855_100677922
959 Ga0070664_100038514
960 Ga0070664_100523617
961 Ga0068857_100291795
962 Ga0068856_100084891
963 Ga0068856_101698263
964 Ga0070702_100019143
965 Ga0070702_100469588
966 Ga0068852_100348236
967 Ga0068859_100071001
968 Ga0068864_100088136
969 Ga0068864_100316532
970 Ga0068866_11269959
971 Ga0068861_100600781
972 Ga0068861_101854549
973 Ga0068851_10366750
974 Ga0068863_100067439
975 Ga0068863_100615180
976 Ga0068858_100059299
977 Ga0068860_100000360
978 Ga0068860_100094153
979 Ga0068860_102313443
980 Ga0068862_100500977
981 Ga0081455_10551309
982 Ga0081540_1027303
983 Ga0081540_1029140
984 Ga0070717_10003328
985 Ga0070717_10007544
986 Ga0070717_10221253
987 Ga0070717_10391088
988 Ga0070717_10780830
989 Ga0070717_10904072
990 Ga0075365_10339531
991 Ga0075364_10105653
992 Ga0070715_10093139
993 Ga0070715_10179947
994 Ga0070715_10277313
995 Ga0070715_10595935
996 Ga0070716_100002233
997 Ga0070716_100031117
998 Ga0070712_100010775
999 Ga0070712_100051207
1000 Ga0070712_100156648
1001 Ga0070712_100441075
1002 Ga0070712_100771012
1003 Ga0097621_100008876
1004 Ga0097621_100026444
1005 Ga0097621_100359483
1006 Ga0097621_101183291
1007 Ga0068871_100015537
1008 Ga0068871_100241467
1009 Ga0075433_10423626
1010 Ga0075434_100512931
1011 Ga0075434_100581087
1012 Ga0068865_100009015
1013 Ga0068865_100415311
1014 Ga0075436_100031219
1015 Ga0075436_100414882
1016 Ga0097620_100071001
1017 Ga0075435_100492508
1018 Ga0099794_10252337
1019 Ga0105251_10012262
1020 Ga0105245_10038270
1021 Ga0105245_10287853
1022 Ga0105245_11861990
1023 Ga0105247_10079094
1024 Ga0105247_10086615
1025 Ga0105247_10295137
1026 Ga0105247_10390936
1027 Ga0105247_11027366
1028 Ga0105243_10080808
1029 Ga0105243_10374450
1030 Ga0105241_10037102
1031 Ga0105241_10141127
1032 Ga0105241_10358358
1033 Ga0105242_10006274
1034 Ga0105242_10059085
1035 Ga0105242_10408608
1036 Ga0105248_10065160
1037 Ga0105248_10207704
1038 Ga0105248_11436975
1039 Ga0105237_10021234
1040 Ga0105237_10714057
1041 Ga0105237_10996490
1042 Ga0105238_10027647
1043 Ga0105238_10373216
1044 Ga0105238_11148679
1045 Ga0105238_12070457
1046 Ga0105238_12678210
1047 Ga0105249_11247695
1048 Ga0105249_11523571
1049 Ga0105249_12134949
1050 Ga0105239_10074149
1051 Ga0105239_10267093
1052 Ga0105239_10304214
1053 Ga0105239_10599290
1054 Ga0105239_11040318
1055 Ga0105239_11652668
1056 Ga0105239_12356119
1057 Ga0105246_10053735
1058 Ga0105246_10296493
1059 Ga0157336_1011918
1060 Ga0157335_1000825
1061 Ga0157345_1019228
1062 Ga0157314_1052637
1063 Ga0157313_1026749
1064 Ga0157324_1030507
1065 Ga0157316_1027201
1066 Ga0157338_1017731
1067 Ga0157370_11778711
1068 Ga0157374_10179291
1069 Ga0157374_10208823
1070 Ga0157378_10094941
1071 Ga0157378_10934671
1072 Ga0157378_11010931
1073 Ga0157378_12095805
1074 Ga0163162_10108966
1075 Ga0163162_10246430
1076 Ga0163162_11121669
1077 Ga0157372_10134988
1078 Ga0157372_12182728
1079 Ga0157375_10135433
1080 Ga0157375_10329773
1081 Ga0157375_10852394
1082 Ga0163163_10335512
1083 Ga0163163_10753207
1084 Ga0157380_11841068
1085 Ga0157379_10007831
1086 Ga0157379_10166035
1087 Ga0157379_10829249
1088 Ga0157376_10448835
1089 Ga0157376_10873512
1090 Ga0157376_10973157
1091 Ga0163161_10026256
1092 Ga0163161_10068276
1093 Ga0213876_10179521
1094 Ga0213875_10477209
1095 Ga0207697_10228483
1096 Ga0207692_10005372
1097 Ga0207692_10069774
1098 Ga0207692_10340830
1099 Ga0207692_10361122
1100 Ga0207692_10564439
1101 Ga0207642_10301087
1102 Ga0207710_10046975
1103 Ga0207710_10050402
1104 Ga0207710_10072035
1105 Ga0207710_10162358
1106 Ga0207710_10359226
1107 Ga0207710_10401078
1108 Ga0207688_10391025
1109 Ga0207680_10029075
1110 Ga0207685_10004129
1111 Ga0207685_10029551
1112 Ga0207685_10090429
1113 Ga0207685_10174449
1114 Ga0207685_10179973
1115 Ga0207699_10001161
1116 Ga0207699_10012349
1117 Ga0207699_10014207
1118 Ga0207699_10140066
1119 Ga0207699_10328840
1120 Ga0207699_10405139
1121 Ga0207645_10023325
1122 Ga0207645_10528976
1123 Ga0207705_11434259
1124 Ga0207654_10043742
1125 Ga0207654_10066063
1126 Ga0207654_10235678
1127 Ga0207707_10026208
1128 Ga0207707_10340876
1129 Ga0207671_10245556
1130 Ga0207671_10642360
1131 Ga0207693_10003131
1132 Ga0207693_10043770
1133 Ga0207693_10058351
1134 Ga0207693_10181380
1135 Ga0207693_10225292
1136 Ga0207663_10015462
1137 Ga0207663_10061185
1138 Ga0207663_10071436
1139 Ga0207663_10188456
1140 Ga0207663_10380554
1141 Ga0207660_10788538
1142 Ga0207657_10162543
1143 Ga0207649_10148323
1144 Ga0207652_10098796
1145 Ga0207652_10246038
1146 Ga0207652_10599659
1147 Ga0207681_10554856
1148 Ga0207694_10040173
1149 Ga0207694_10150540
1150 Ga0207694_10633556
1151 Ga0207650_10259172
1152 Ga0207659_11661661
1153 Ga0207687_10012582
1154 Ga0207687_10033806
1155 Ga0207687_10757178
1156 Ga0207700_10000917
1157 Ga0207700_10021942
1158 Ga0207700_10053149
1159 Ga0207700_10102651
1160 Ga0207700_10993708
1161 Ga0207700_11438312
1162 Ga0207664_10100523
1163 Ga0207664_10261339
1164 Ga0207664_10395828
1165 Ga0207664_10418862
1166 Ga0207664_11175493
1167 Ga0207664_11915049
1168 Ga0207644_10007559
1169 Ga0207644_10115945
1170 Ga0207644_11390102
1171 Ga0207706_10014945
1172 Ga0207706_10189748
1173 Ga0207686_10011564
1174 Ga0207686_10507143
1175 Ga0207686_10847197
1176 Ga0207709_10125631
1177 Ga0207709_10459689
1178 Ga0207709_10818320
1179 Ga0207670_10017561
1180 Ga0207669_10767290
1181 Ga0207669_11343895
1182 Ga0207704_11180102
1183 Ga0207704_11339485
1184 Ga0207665_10000333
1185 Ga0207665_10021917
1186 Ga0207665_10111445
1187 Ga0207711_10086244
1188 Ga0207711_10107904
1189 Ga0207711_10988006
1190 Ga0207689_10031849
1191 Ga0207661_10862847
1192 Ga0207679_10701872
1193 Ga0207679_10876866
1194 Ga0207679_11669890
1195 Ga0207667_10168621
1196 Ga0207667_10230228
1197 Ga0207667_10814489
1198 Ga0207651_10072873
1199 Ga0207712_10538677
1200 Ga0207712_11132787
1201 Ga0207658_10047022
1202 Ga0207658_10071512
1203 Ga0207677_10139446
1204 Ga0207677_11789826
1205 Ga0207703_10139094
1206 Ga0207703_10333842
1207 Ga0207703_10921854
1208 Ga0207703_11003981
1209 Ga0207703_12020444
1210 Ga0207639_10089016
1211 Ga0207639_10400976
1212 Ga0207639_10909645
1213 Ga0207639_11390914
1214 Ga0207678_10097972
1215 Ga0207678_10107195
1216 Ga0207678_10239787
1217 Ga0207708_10038595
1218 Ga0207708_10354172
1219 Ga0207702_10276224
1220 Ga0207702_11533230
1221 Ga0207641_10212558
1222 Ga0207641_10750393
1223 Ga0207641_11516139
1224 Ga0207648_10124866
1225 Ga0207648_10186503
1226 Ga0207676_10186879
1227 Ga0207675_102137106
1228 Ga0207683_10001447
1229 Ga0207683_10153592
1230 Ga0207683_10254310
1231 Ga0207698_10383176
1232 Ga0207698_10398539
1233 Ga0209971_1154606
1234 Ga0209966_1014410
1235 Ga0209974_10036257
1236 Ga0265357_1020655
1237 Ga0268266_10025953
1238 Ga0268266_10136477
1239 Ga0268266_10243092
1240 Ga0268265_12194390
1241 Ga0268264_10000030
1242 Ga0268264_10483253
1243 Ga0268264_10656641
1244 Ga0265337_1001486
1245 Ga0265338_10247553
1246 Ga0265338_10306413
1247 Ga0307511_10107189
1248 Ga0265763_1005459
1249 Ga0265773_1031879
1250 Ga0265332_10000899
1251 Ga0265332_10175142
1252 Ga0265325_10000049
1253 Ga0265325_10083742
1254 Ga0265325_10242883
1255 Ga0265329_10221386
1256 Ga0265340_10005450
1257 Ga0265340_10166484
1258 Ga0265339_10058197
1259 Ga0265339_10210681
1260 Ga0265331_10149249
1261 Ga0265316_10261497
1262 Ga0265316_10278153
1263 Ga0307509_10014245
1264 Ga0265313_10036963
1265 Ga0307508_10173191
1266 Ga0265314_10000784
1267 Ga0265314_10005953
1268 Ga0265314_10044806
1269 Ga0265342_10000392
1270 Ga0265342_10166027
1271 Ga0307516_10005995
1272 Ga0326468_10081748
1273 Ga0307510_10283860
1274 Ga0373950_0018390
1275 Ga0373958_0085356
1276 Ga0373959_0017137
1277 Ga0373959_0087871
1278 Ga0373938_0008109
1279 Ga0373926_0006103
1280 Ga0373928_0004039
1281 Ga0373934_0022825
1282 Ga0373934_0120017
1283 Ga0373940_0167330
1284 Ga0373949_0027055
1285 Ga0373951_0006562
1286 Ga0373952_0061984
1287 Ga0373923_0078244
1288 Ga0373932_0003814
1289 Ga0373932_0181145
1290 Ga0373939_0016078
1291 Ga0373941_0013677
1292 Ga0373945_0055006
1293 Ga0373953_0006441
1294 Ga0373953_0042214
1295 Ga0373953_0128359
1296 Ga0373954_0008900
1297 Ga0373954_0200643
1298 Ga0373954_0224537
1299 Ga0373956_0019629
1300 Ga0373956_0076710
1301 Ga0373956_0257183
1302 Ga0373957_0341802
1303 Ga0373957_0419885
1304 Ga0373960_0004580
1305 Ga0373943_0138348
1306 Ga0373943_0374997
1307 Ga0373943_0433959
1308 Ga0373946_0022847
1309 Ga0373946_0059173
1310 Ga0373946_0178157
1311 Ga0373955_0024935
1312 Ga0373955_0144548
1313 Ga0373955_0194939
1314 Ga0373955_0615985
1315 Ga0373942_0057053
1316 Ga0373961_0061888
1317 Ga0373962_0057562
1318 Ga0373962_0078344
1319 Ga0316574_0791808
1320 Ga0373924_0008024
1321 Ga0373924_0029447
1322 Ga0373924_0033955
1323 Ga0373924_0044023
1324 Ga0373931_0004569
1325 Ga0373935_0004548
1326 Ga0373935_0015490
1327 Ga0373935_0035574
1328 Ga0373935_0067946
1329 Ga0373935_0104396
1330 Ga0373935_0677034
1331 Ga0373927_0017601
1332 Ga0373927_0184081
1333 Ga0373927_0211276
1334 Ga0373933_0002449
1335 Ga0373933_0260278
1336 Ga0373947_0005403
1337 Ga0373947_0018365
1338 Ga0373947_0119293
1339 Ga0373947_0124973
1340 Ga0373947_0202839
1341 Ga0373947_0473216
1342 Ga0373937_0002996
1343 Ga0373937_0008068
1344 Ga0373937_0008991
1345 Ga0373937_0142283
1346 Ga0373937_0345221
1347 Ga0373937_0516898
1348 Ga0373937_0873754
1349 Ga0373937_2008695
1350 Ga0373925_0025234
1351 Ga0373925_0098740
1352 Ga0373925_0101593
1353 Ga0373925_0742294
1354 Ga0373925_0759985
1355 Ga0395898_0613059
1356 Ga0436364_0364973
1357 Ga0436365_0090047
1358 Ga0436365_0390621
1359 Ga0436360_0203691
1360 Ga0439465_0071611
1361 Ga0451802_0275182
1362 Ga0451841_0043378
1363 Ga0451843_0333450
1364 Ga0439455_0140561
1365 Ga0439464_0120779
1366 Ga0439464_0128357
1367 Ga0466967_1019021
1368 Ga0495592_0001840
1369 Ga0495592_0010619
1370 Ga0495592_0626729
1371 Ga0495603_0011026
1372 Ga0495603_0037807
1373 Ga0495629_0000269
1374 Ga0495629_0069439
1375 Ga0495629_0089738
1376 Ga0495638_0040160
1377 Ga0495641_0026269
1378 Ga0495641_0042734
1379 Ga0495641_0150265
1380 Ga0495641_0317993
1381 Ga0495651_0005718
1382 Ga0495651_0010406
1383 Ga0495651_0064265
1384 Ga0495651_0185639
1385 Ga0495651_0360559
1386 Ga0495651_0460971
1387 Ga0495653_0010063
1388 Ga0495653_0030364
1389 Ga0495653_0146642
1390 Ga0495653_0171215
1391 Ga0495653_0216780
1392 Ga0495653_0967615
1393 Ga0495580_0243568
1394 Ga0495580_0560182
1395 Ga0495580_0651674
1396 Ga0495582_0003928
1397 Ga0495582_0109872
1398 Ga0495639_0396873
1399 Ga0495662_0105186
1400 Ga0495662_0114856
1401 Ga0495664_0010264
1402 Ga0495664_0021710
1403 Ga0495664_0118438
1404 Ga0495664_0238448
1405 Ga0495594_0009788
1406 Ga0495594_0027976
1407 Ga0495608_0001268
1408 Ga0495608_0016256
1409 Ga0495608_0285310
1410 Ga0495610_0301084
1411 Ga0495618_0037072
1412 Ga0495618_0088979
1413 Ga0495618_0254207
1414 Ga0495618_0331159
1415 Ga0495618_0574481
1416 Ga0495618_0597161
1417 Ga0495628_0005226
1418 Ga0495628_0268395
1419 Ga0495630_0192162
1420 Ga0495630_0475487
1421 Ga0495630_0638424
1422 Ga0495666_0167651
1423 Ga0495652_0061818
1424 Ga0495652_0077885
1425 Ga0495652_0216037
1426 Ga0495652_0224929
1427 Ga0495640_0006352
1428 Ga0495640_0018005
1429 Ga0495640_0040789
1430 Ga0495640_0422869
1431 Ga0495586_0011910
1432 Ga0495586_0171759
1433 Ga0495587_0000620
1434 Ga0495587_0058326
1435 Ga0495645_0000848
1436 Ga0495645_0008343
1437 Ga0495645_0393965
1438 Ga0495645_0775211
1439 Ga0495622_0043236
1440 Ga0495667_0001254
1441 Ga0495667_0022137
1442 Ga0495667_0097610
1443 Ga0495667_0104514
1444 Ga0495667_0105159
1445 Ga0495667_0113573
1446 Ga0495634_0017607
1447 Ga0495634_0019712
1448 Ga0495634_0266260
1449 Ga0495635_0005437
1450 Ga0495635_0036531
1451 Ga0495635_0090897
1452 Ga0495635_0091274
1453 Ga0495635_0146947
1454 Ga0495635_0346365
1455 Ga0495635_0466719
1456 Ga0495661_0165033
1457 Ga0495588_0067758
1458 Ga0495657_0002939
1459 Ga0495657_0032408
1460 Ga0495599_0062103
1461 Ga0495599_0214597
1462 Ga0495623_0026867
1463 Ga0495623_0035166
1464 Ga0495646_0000856
1465 Ga0495646_0083480
1466 Ga0495646_0202842
1467 Ga0495647_0053754
1468 Ga0495658_0004553
1469 Ga0495658_0810370
1470 Ga0495613_0038188
1471 Ga0495613_0162962
1472 Ga0495613_0394572
1473 Ga0495613_0430843
1474 Ga0495624_0040542
1475 Ga0495624_0137836
1476 Ga0495624_0387213
1477 Ga0495624_0956348
1478 Ga0495600_0016667
1479 Ga0495600_0052308
1480 Ga0495600_0128219
1481 Ga0495600_0133793
1482 Ga0495600_0579557
1483 Ga0495581_0036567
1484 Ga0495581_0101672
1485 Ga0495604_0005959
1486 Ga0495604_0027617
1487 Ga0495604_0056504
1488 Ga0495604_0103429
1489 Ga0495604_0591355
1490 Ga0495674_0005637
1491 Ga0495674_0061401
1492 Ga0495676_0034516
1493 Ga0495676_0144308
1494 Ga0495680_0001472
1495 Ga0495680_0006777
1496 Ga0495680_0017612
1497 Ga0495680_0018210
1498 Ga0495680_0022232
1499 Ga0495680_0217882
1500 Ga0495680_0241607
1501 Ga0495675_0018016
1502 Ga0495675_0048151
1503 Ga0495675_0168024
1504 Ga0495684_0031095
1505 Ga0495684_0047729
1506 Ga0495684_0213504
1507 Ga0495684_0294075
1508 Ga0495684_0298325
1509 Ga0495684_0633406
1510 Ga0495593_0009204
1511 Ga0495602_0002664
1512 Ga0495602_0013607
1513 Ga0495602_0128650
1514 Ga0495602_0183138
1515 Ga0495602_0515833
1516 Ga0495614_0145476
1517 Ga0496100_0006554
1518 Ga0496100_0102455
1519 Ga0496100_0204967
1520 Ga0496100_0399268
1521 Ga0496101_0007659
1522 Ga0496101_0016572
1523 Ga0496101_0147253
1524 Ga0496101_0347632
1525 Ga0496101_0435107
1526 Ga0496102_0016358
1527 Ga0496102_0070115
1528 Ga0496102_0261230
1529 Ga0496102_0776671
1530 Ga0496102_0812061
1531 Ga0496102_1210976
1532 Ga0496103_0107057
1533 Ga0496103_0280558
1534 Ga0496103_0316878
1535 Ga0496104_0000215
1536 Ga0496104_0005956
1537 Ga0496104_0097659
1538 Ga0496104_0243034
1539 Ga0496104_0374856
1540 Ga0496104_0498536
1541 Ga0496105_0007651
1542 Ga0496105_0020355
1543 Ga0496105_0157101
1544 Ga0496105_0242092
1545 Ga0496105_0429422
1546 Ga0496105_0515938
1547 Ga0496106_0001857
1548 Ga0496106_0019937
1549 Ga0496106_0067503
1550 Ga0496107_0019768
1551 Ga0496107_0295593
1552 Ga0496107_0520826
1553 Ga0496108_0056436
1554 Ga0496108_0057496
1555 Ga0496108_0241156
1556 Ga0496108_0448952
1557 Ga0496109_0133946
1558 Ga0496109_0156658
1559 Ga0496109_0389585
1560 Ga0496109_0401126
1561 Ga0496109_0961668
1562 Ga0496109_1184394
1563 Ga0496110_0022488
1564 Ga0496110_0302206
1565 Ga0496110_0356076
1566 Ga0496110_0368896
1567 Ga0496111_0084837
1568 Ga0496111_0317797
1569 Ga0496112_0193985
1570 Ga0496112_0195658
1571 Ga0496112_0570510
1572 Ga0496112_0830786
1573 Ga0496112_1243055
1574 Ga0496113_0251371
1575 Ga0496113_0427014
1576 Ga0496113_0436095
1577 Ga0496113_1451526
1578 Ga0496114_0076223
1579 Ga0496114_0376999
1580 Ga0496114_1041826
1581 Ga0496115_0013246
1582 Ga0496115_0073757
1583 Ga0496115_0099732
1584 Ga0496115_0582525
1585 Ga0496115_0713092
1586 Ga0496115_0759486
1587 Ga0496115_1243551
1588 Ga0496117_0010071
1589 Ga0496118_0008611
1590 Ga0496119_0145579
1591 Ga0496121_0002635
1592 Ga0496121_0166584
1593 Ga0496121_0450721
1594 Ga0496122_0052608
1595 Ga0496124_0011581
1596 Ga0496124_0378319
1597 Ga0496125_0000746
1598 Ga0496125_0131030
1599 Ga0496126_0002122
1600 Ga0496126_0038000
1601 Ga0496126_0108022
1602 Ga0496126_0157082
1603 Ga0496126_0208556
1604 Ga0496126_0430274
1605 Ga0496126_0661143
1606 Ga0501031_0255750
1607 Ga0501034_0182998
1608 Ga0501036_0114702
1609 Ga0501039_1344434
1610 Ga0501042_0286813
1611 Ga0501043_0448869
1612 Ga0501043_1083288
1613 Ga0501047_0008787
1614 Ga0501047_0611642
1615 Ga0501067_0711546
1616 Ga0501068_0691835
1617 Ga0501070_0367305
1618 Ga0501073_0034839
1619 Ga0501075_0734248
1620 Ga0501076_0220426
1621 Ga0501079_0565858
1622 Ga0501080_1170424
1623 Ga0501081_0672417
1624 Ga0501083_0023331
1625 Ga0501035_0657975
1626 Ga0501044_0103888
1627 Ga0501044_0118153
1628 nmdc:mga03n38_684651_c1
1629 nmdc:mga00v17_900844_c1
1630 nmdc:mga0yw44_16709_c1
1631 nmdc:mga0yw44_945281_c1
1632 nmdc:mga0n895_141846_c1
1633 nmdc:mga0n895_161587_c1
1634 nmdc:mga0rr50_134685_c1
1635 nmdc:mga08x19_27777_c1
1636 nmdc:mga08x19_580259_c1
1637 nmdc:mga0sz30_281867_c1
1638 Ga0495601_0000109
1639 Ga0495601_0002506
1640 Ga0495601_0006125
1641 Ga0495601_0009758
1642 Ga0495601_0053399
1643 Ga0495601_0059733
1644 Ga0495612_0000953
1645 Ga0495612_0002655
1646 Ga0495612_0006674
1647 Ga0500635_0015242
1648 Ga0495595_0001271
1649 Ga0495595_0005318
1650 Ga0495595_0005872
1651 Ga0495595_0019136
1652 Ga0495595_0033835
1653 Ga0495619_0000289
1654 Ga0495619_0000662
1655 Ga0495619_0002507
1656 Ga0495619_0004938
1657 Ga0495619_0015439
1658 Ga0495619_0376229
1659 Ga0500643_002483
1660 Ga0500644_0000860
1661 Ga0500646_0025028
1662 Ga0500651_0156758
1663 Ga0500651_0721863
1664 Ga0500566_0072243
1665 Ga0500566_0436952
1666 Ga0500648_097400
1667 Ga0500650_0451371
1668 Ga0500595_000062
1669 Ga0500595_016246
1670 Ga0500595_055576
1671 Ga0500652_033278
1672 Ga0500655_084049
1673 Ga0500559_0094578
1674 Ga0500559_0262266
1675 Ga0500564_234759
1676 Ga0500573_0104422
1677 Ga0500590_091329
1678 Ga0500590_108729
1679 Ga0500603_014973
1680 Ga0500616_0000006
1681 Ga0500638_168116
1682 Ga0500639_028570
1683 Ga0500639_157943
1684 Ga0500636_0175949
1685 Ga0500637_0056548
1686 Ga0500637_0082391
1687 Ga0500645_000101
1688 Ga0500596_005660
1689 Ga0501082_0067452
1690 Ga0530510_0471912
1691 2513700651
1692 2824622032
1693 2824629296
1694 2824639171
1695 2824652638
1696 2824723190
1697 2824731758
1698 2904698944
1699 2908758741
1700 643605219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

19

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9211 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9173 2 105
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9118 2 104
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8912 2 105
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.8892 3 104
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9173 2 105 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8912 2 105 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8415 3 103 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8163 1 105 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7989 3 103 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6P1B118-F1-model_v4 deleted 0.9377 40 105
AF-A0A6L8GCQ2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9318 2 105
AF-A0A484H5H5-F1-model_v4 Sulfur oxidation protein SoxZ 0.9295 3 105
AF-A0A7V8ISW7-F1-model_v4 deleted 0.9293 2 105
AF-A0A3B8RJ57-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9286 3 105

Map