F483373
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 848 | 253 | 848 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0394845|Ga0466960_0394845_443_694 |
| Length | 83 |
| Sequence | MTPRPRLLAAAMLIPACTGCISVKTPEKPIEINLNVAIRQEVLVRMQRDVENLINQNPDAFPQGQQPAATRPAQPARTPGSSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 92 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 188 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 189 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 190 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 191 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 192 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 193 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 194 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 195 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 233 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 235 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 238 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 239 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 246 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 4.83 |
| Rhizosphere | 94.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1009794 | 3300000532 | Bacteria | 637 |
| 2 | JGI24736J21556_1063138 | 3300001904 | Bacteria | 574 |
| 3 | JGI24740J21852_10136104 | 3300001979 | Bacteria | 612 |
| 4 | JGI24739J22299_10153601 | 3300001989 | Unclassified | 680 |
| 5 | JGI24737J22298_10032027 | 3300001990 | Bacteria | 1640 |
| 6 | JGI24737J22298_10246022 | 3300001990 | Bacteria | 528 |
| 7 | JGI24735J21928_10008884 | 3300002067 | Bacteria | 3241 |
| 8 | JGI24735J21928_10018161 | 3300002067 | Bacteria | 2170 |
| 9 | rootH1_10233400 | 3300003323 | Unclassified | 1727 |
| 10 | Ga0070658_10048462 | 3300005327 | Bacteria | 3441 |
| 11 | Ga0070658_10139741 | 3300005327 | Bacteria | 2023 |
| 12 | Ga0070658_10374215 | 3300005327 | Bacteria | 1221 |
| 13 | Ga0070658_10712416 | 3300005327 | Bacteria | 871 |
| 14 | Ga0070658_10756568 | 3300005327 | Bacteria | 844 |
| 15 | Ga0070658_11312374 | 3300005327 | Bacteria | 628 |
| 16 | Ga0070676_10000509 | 3300005328 | Bacteria | 18636 |
| 17 | Ga0070676_10018872 | 3300005328 | Bacteria | 3829 |
| 18 | Ga0070676_10104474 | 3300005328 | Bacteria | 1755 |
| 19 | Ga0070676_10224342 | 3300005328 | Bacteria | 1243 |
| 20 | Ga0070676_10348171 | 3300005328 | Bacteria | 1018 |
| 21 | Ga0070683_100096580 | 3300005329 | Bacteria | 2779 |
| 22 | Ga0070683_100697847 | 3300005329 | Bacteria | 972 |
| 23 | Ga0070683_101118406 | 3300005329 | Bacteria | 757 |
| 24 | Ga0070690_100557112 | 3300005330 | Bacteria | 865 |
| 25 | Ga0070690_100987582 | 3300005330 | Bacteria | 663 |
| 26 | Ga0070670_100008324 | 3300005331 | Bacteria | 8840 |
| 27 | Ga0070670_100090749 | 3300005331 | Bacteria | 2626 |
| 28 | Ga0070670_100116328 | 3300005331 | Bacteria | 2306 |
| 29 | Ga0070670_100257627 | 3300005331 | Bacteria | 1520 |
| 30 | Ga0070670_100831531 | 3300005331 | Bacteria | 835 |
| 31 | Ga0070670_101999614 | 3300005331 | Bacteria | 534 |
| 32 | Ga0070677_10555225 | 3300005333 | Bacteria | 630 |
| 33 | Ga0070677_10602858 | 3300005333 | Bacteria | 608 |
| 34 | Ga0070677_10721637 | 3300005333 | Bacteria | 563 |
| 35 | Ga0068869_100028374 | 3300005334 | Bacteria | 3910 |
| 36 | Ga0068869_100075541 | 3300005334 | Bacteria | 2504 |
| 37 | Ga0068869_100567022 | 3300005334 | Bacteria | 956 |
| 38 | Ga0070666_10275760 | 3300005335 | Bacteria | 1195 |
| 39 | Ga0070666_10532349 | 3300005335 | Bacteria | 854 |
| 40 | Ga0070666_11227282 | 3300005335 | Bacteria | 559 |
| 41 | Ga0070680_100260887 | 3300005336 | Bacteria | 1466 |
| 42 | Ga0070680_100324275 | 3300005336 | Bacteria | 1307 |
| 43 | Ga0070680_101666829 | 3300005336 | Bacteria | 552 |
| 44 | Ga0070682_100056000 | 3300005337 | Bacteria | 2478 |
| 45 | Ga0070682_100203586 | 3300005337 | Bacteria | 1398 |
| 46 | Ga0070682_100354453 | 3300005337 | Bacteria | 1095 |
| 47 | Ga0068868_100616083 | 3300005338 | Bacteria | 963 |
| 48 | Ga0070660_100059424 | 3300005339 | Bacteria | 2964 |
| 49 | Ga0070660_100075646 | 3300005339 | Bacteria | 2636 |
| 50 | Ga0070660_100078186 | 3300005339 | Bacteria | 2594 |
| 51 | Ga0070660_100212206 | 3300005339 | Bacteria | 1572 |
| 52 | Ga0070660_100358965 | 3300005339 | Bacteria | 1201 |
| 53 | Ga0070660_100574384 | 3300005339 | Bacteria | 941 |
| 54 | Ga0070660_101366808 | 3300005339 | Bacteria | 601 |
| 55 | Ga0070691_10114126 | 3300005341 | Bacteria | 1354 |
| 56 | Ga0070687_100769781 | 3300005343 | Bacteria | 679 |
| 57 | Ga0070661_100009966 | 3300005344 | Bacteria | 6592 |
| 58 | Ga0070661_100147216 | 3300005344 | Bacteria | 1779 |
| 59 | Ga0070661_100243216 | 3300005344 | Bacteria | 1386 |
| 60 | Ga0070661_100296444 | 3300005344 | Bacteria | 1258 |
| 61 | Ga0070661_100876166 | 3300005344 | Bacteria | 740 |
| 62 | Ga0070661_100980028 | 3300005344 | Bacteria | 701 |
| 63 | Ga0070692_10043292 | 3300005345 | Bacteria | 2314 |
| 64 | Ga0070692_11177350 | 3300005345 | Bacteria | 545 |
| 65 | Ga0070668_100004342 | 3300005347 | Bacteria | 10512 |
| 66 | Ga0070668_100112350 | 3300005347 | Bacteria | 2170 |
| 67 | Ga0070668_100136264 | 3300005347 | Bacteria | 1975 |
| 68 | Ga0070669_100016249 | 3300005353 | Bacteria | 5308 |
| 69 | Ga0070669_100091495 | 3300005353 | Bacteria | 2281 |
| 70 | Ga0070675_100499029 | 3300005354 | Bacteria | 1096 |
| 71 | Ga0070675_101475654 | 3300005354 | Bacteria | 627 |
| 72 | Ga0070675_102013202 | 3300005354 | Bacteria | 533 |
| 73 | Ga0070671_100002896 | 3300005355 | Bacteria | 13357 |
| 74 | Ga0070671_100003087 | 3300005355 | Bacteria | 12960 |
| 75 | Ga0070671_100027435 | 3300005355 | Bacteria | 4688 |
| 76 | Ga0070671_100059138 | 3300005355 | Bacteria | 3189 |
| 77 | Ga0070671_100059877 | 3300005355 | Bacteria | 3169 |
| 78 | Ga0070671_100066201 | 3300005355 | Bacteria | 3011 |
| 79 | Ga0070671_100178201 | 3300005355 | Bacteria | 1799 |
| 80 | Ga0070671_100313495 | 3300005355 | Bacteria | 1336 |
| 81 | Ga0070671_100380928 | 3300005355 | Bacteria | 1206 |
| 82 | Ga0070671_101299618 | 3300005355 | Unclassified | 641 |
| 83 | Ga0070674_100011647 | 3300005356 | Bacteria | 5361 |
| 84 | Ga0070674_100081176 | 3300005356 | Bacteria | 2317 |
| 85 | Ga0070674_100097187 | 3300005356 | Bacteria | 2138 |
| 86 | Ga0070674_100119938 | 3300005356 | Bacteria | 1946 |
| 87 | Ga0070674_100339870 | 3300005356 | Bacteria | 1209 |
| 88 | Ga0070674_101731501 | 3300005356 | Bacteria | 566 |
| 89 | Ga0070673_100011053 | 3300005364 | Bacteria | 6149 |
| 90 | Ga0070673_100022961 | 3300005364 | Bacteria | 4551 |
| 91 | Ga0070673_100104094 | 3300005364 | Bacteria | 2343 |
| 92 | Ga0070673_100371344 | 3300005364 | Bacteria | 1274 |
| 93 | Ga0070673_100696162 | 3300005364 | Bacteria | 933 |
| 94 | Ga0070673_101392564 | 3300005364 | Bacteria | 660 |
| 95 | Ga0070673_102318906 | 3300005364 | Bacteria | 510 |
| 96 | Ga0070659_100006023 | 3300005366 | Bacteria | 8743 |
| 97 | Ga0070659_100014006 | 3300005366 | Bacteria | 5985 |
| 98 | Ga0070659_100015331 | 3300005366 | Bacteria | 5740 |
| 99 | Ga0070659_100030454 | 3300005366 | Bacteria | 4177 |
| 100 | Ga0070659_100174859 | 3300005366 | Bacteria | 1760 |
| 101 | Ga0070659_100223854 | 3300005366 | Bacteria | 1554 |
| 102 | Ga0070659_100551485 | 3300005366 | Bacteria | 987 |
| 103 | Ga0070659_101140756 | 3300005366 | Bacteria | 688 |
| 104 | Ga0070667_100011528 | 3300005367 | Bacteria | 7308 |
| 105 | Ga0070667_100116248 | 3300005367 | Bacteria | 2323 |
| 106 | Ga0070667_100319020 | 3300005367 | Bacteria | 1402 |
| 107 | Ga0070667_100415702 | 3300005367 | Bacteria | 1225 |
| 108 | Ga0070667_100795898 | 3300005367 | Bacteria | 878 |
| 109 | Ga0070667_101816406 | 3300005367 | Unclassified | 574 |
| 110 | Ga0070703_10528058 | 3300005406 | Bacteria | 535 |
| 111 | Ga0070714_100038969 | 3300005435 | Bacteria | 3999 |
| 112 | Ga0070713_102276255 | 3300005436 | Bacteria | 524 |
| 113 | Ga0070705_100248088 | 3300005440 | Bacteria | 1248 |
| 114 | Ga0070700_100484158 | 3300005441 | Bacteria | 948 |
| 115 | Ga0070663_100030392 | 3300005455 | Bacteria | 3701 |
| 116 | Ga0070663_100080310 | 3300005455 | Bacteria | 2395 |
| 117 | Ga0070663_100138281 | 3300005455 | Bacteria | 1857 |
| 118 | Ga0070663_100138820 | 3300005455 | Bacteria | 1853 |
| 119 | Ga0070663_100492254 | 3300005455 | Bacteria | 1017 |
| 120 | Ga0070663_100568611 | 3300005455 | Bacteria | 950 |
| 121 | Ga0070663_100587933 | 3300005455 | Bacteria | 935 |
| 122 | Ga0070663_100828172 | 3300005455 | Bacteria | 795 |
| 123 | Ga0070663_101177204 | 3300005455 | Bacteria | 673 |
| 124 | Ga0070678_100003214 | 3300005456 | Bacteria | 9068 |
| 125 | Ga0070678_100052107 | 3300005456 | Bacteria | 2970 |
| 126 | Ga0070678_100763206 | 3300005456 | Bacteria | 875 |
| 127 | Ga0070662_100008232 | 3300005457 | Bacteria | 6790 |
| 128 | Ga0070662_100027862 | 3300005457 | Bacteria | 3928 |
| 129 | Ga0070662_100047133 | 3300005457 | Bacteria | 3099 |
| 130 | Ga0070662_100050854 | 3300005457 | Bacteria | 2990 |
| 131 | Ga0070662_100116544 | 3300005457 | Bacteria | 2042 |
| 132 | Ga0070662_100127093 | 3300005457 | Bacteria | 1961 |
| 133 | Ga0070662_100149126 | 3300005457 | Bacteria | 1819 |
| 134 | Ga0070662_100469831 | 3300005457 | Bacteria | 1046 |
| 135 | Ga0070662_100753904 | 3300005457 | Bacteria | 826 |
| 136 | Ga0070662_100955457 | 3300005457 | Bacteria | 733 |
| 137 | Ga0070662_100957471 | 3300005457 | Bacteria | 732 |
| 138 | Ga0070662_101449773 | 3300005457 | Bacteria | 592 |
| 139 | Ga0070681_10034249 | 3300005458 | Bacteria | 5101 |
| 140 | Ga0070681_10216233 | 3300005458 | Bacteria | 1832 |
| 141 | Ga0070681_10244658 | 3300005458 | Bacteria | 1707 |
| 142 | Ga0068867_100003727 | 3300005459 | Bacteria | 10724 |
| 143 | Ga0068867_100009758 | 3300005459 | Bacteria | 6765 |
| 144 | Ga0068867_100011300 | 3300005459 | Bacteria | 6298 |
| 145 | Ga0068867_100301555 | 3300005459 | Bacteria | 1321 |
| 146 | Ga0068867_100500657 | 3300005459 | Bacteria | 1044 |
| 147 | Ga0070706_100209129 | 3300005467 | Bacteria | 1822 |
| 148 | Ga0070679_100336185 | 3300005530 | Bacteria | 1458 |
| 149 | Ga0070679_100582314 | 3300005530 | Bacteria | 1063 |
| 150 | Ga0070679_100974055 | 3300005530 | Bacteria | 792 |
| 151 | Ga0070679_101247843 | 3300005530 | Bacteria | 689 |
| 152 | Ga0070679_101520204 | 3300005530 | Bacteria | 616 |
| 153 | Ga0070684_100433456 | 3300005535 | Bacteria | 1214 |
| 154 | Ga0068853_100050171 | 3300005539 | Bacteria | 3589 |
| 155 | Ga0068853_100487239 | 3300005539 | Bacteria | 1163 |
| 156 | Ga0068853_100888068 | 3300005539 | Bacteria | 856 |
| 157 | Ga0068853_101672803 | 3300005539 | Unclassified | 617 |
| 158 | Ga0070672_100052655 | 3300005543 | Bacteria | 3179 |
| 159 | Ga0070672_100431764 | 3300005543 | Bacteria | 1133 |
| 160 | Ga0070672_100476246 | 3300005543 | Bacteria | 1078 |
| 161 | Ga0070672_100866842 | 3300005543 | Bacteria | 797 |
| 162 | Ga0070695_100011170 | 3300005545 | Bacteria | 5370 |
| 163 | Ga0070696_100004394 | 3300005546 | Bacteria | 9405 |
| 164 | Ga0070696_100020112 | 3300005546 | Bacteria | 4526 |
| 165 | Ga0070696_100222395 | 3300005546 | Bacteria | 1417 |
| 166 | Ga0070696_101372408 | 3300005546 | Bacteria | 602 |
| 167 | Ga0070693_100017586 | 3300005547 | Bacteria | 3720 |
| 168 | Ga0070693_100092633 | 3300005547 | Bacteria | 1825 |
| 169 | Ga0070693_100118954 | 3300005547 | Bacteria | 1636 |
| 170 | Ga0070665_100000785 | 3300005548 | Bacteria | 41798 |
| 171 | Ga0070665_100079619 | 3300005548 | Bacteria | 3282 |
| 172 | Ga0070665_100374571 | 3300005548 | Bacteria | 1431 |
| 173 | Ga0070665_101738469 | 3300005548 | Bacteria | 631 |
| 174 | Ga0070665_102224485 | 3300005548 | Bacteria | 552 |
| 175 | Ga0068855_100229792 | 3300005563 | Bacteria | 2078 |
| 176 | Ga0068855_100394417 | 3300005563 | Bacteria | 1518 |
| 177 | Ga0068855_100429950 | 3300005563 | Bacteria | 1443 |
| 178 | Ga0068855_101975258 | 3300005563 | Bacteria | 590 |
| 179 | Ga0068855_102509242 | 3300005563 | Bacteria | 513 |
| 180 | Ga0070664_100003416 | 3300005564 | Bacteria | 12825 |
| 181 | Ga0070664_100005620 | 3300005564 | Bacteria | 10089 |
| 182 | Ga0070664_100007027 | 3300005564 | Bacteria | 9084 |
| 183 | Ga0070664_100100671 | 3300005564 | Bacteria | 2512 |
| 184 | Ga0070664_100162660 | 3300005564 | Bacteria | 1975 |
| 185 | Ga0070664_100215194 | 3300005564 | Bacteria | 1718 |
| 186 | Ga0070664_100358586 | 3300005564 | Bacteria | 1327 |
| 187 | Ga0070664_100534784 | 3300005564 | Bacteria | 1083 |
| 188 | Ga0070664_100662015 | 3300005564 | Bacteria | 971 |
| 189 | Ga0070664_100734325 | 3300005564 | Bacteria | 921 |
| 190 | Ga0070664_101595611 | 3300005564 | Bacteria | 618 |
| 191 | Ga0068857_100006626 | 3300005577 | Bacteria | 9948 |
| 192 | Ga0068857_100010757 | 3300005577 | Bacteria | 7963 |
| 193 | Ga0068857_100033123 | 3300005577 | Bacteria | 4569 |
| 194 | Ga0068857_100213748 | 3300005577 | Bacteria | 1760 |
| 195 | Ga0068854_100035685 | 3300005578 | Bacteria | 3482 |
| 196 | Ga0068854_100046422 | 3300005578 | Bacteria | 3092 |
| 197 | Ga0068854_100136917 | 3300005578 | Bacteria | 1875 |
| 198 | Ga0068854_100787303 | 3300005578 | Bacteria | 828 |
| 199 | Ga0068854_102132559 | 3300005578 | Bacteria | 518 |
| 200 | Ga0068856_100134549 | 3300005614 | Bacteria | 2477 |
| 201 | Ga0068856_100758017 | 3300005614 | Bacteria | 991 |
| 202 | Ga0068856_101175507 | 3300005614 | Bacteria | 784 |
| 203 | Ga0070702_100496965 | 3300005615 | Bacteria | 895 |
| 204 | Ga0068852_100122539 | 3300005616 | Bacteria | 2383 |
| 205 | Ga0068852_100323390 | 3300005616 | Bacteria | 1498 |
| 206 | Ga0068852_100330037 | 3300005616 | Bacteria | 1484 |
| 207 | Ga0068852_100984474 | 3300005616 | Bacteria | 862 |
| 208 | Ga0068859_100031616 | 3300005617 | Bacteria | 5315 |
| 209 | Ga0068859_100162511 | 3300005617 | Bacteria | 2312 |
| 210 | Ga0068859_100243984 | 3300005617 | Bacteria | 1886 |
| 211 | Ga0068859_101729035 | 3300005617 | Bacteria | 691 |
| 212 | Ga0068859_101913516 | 3300005617 | Bacteria | 655 |
| 213 | Ga0068864_100015969 | 3300005618 | Bacteria | 6247 |
| 214 | Ga0068864_100025846 | 3300005618 | Bacteria | 4947 |
| 215 | Ga0068864_100253660 | 3300005618 | Bacteria | 1634 |
| 216 | Ga0068864_100271429 | 3300005618 | Bacteria | 1581 |
| 217 | Ga0068864_100314354 | 3300005618 | Bacteria | 1469 |
| 218 | Ga0068864_100544848 | 3300005618 | Bacteria | 1121 |
| 219 | Ga0068864_100733877 | 3300005618 | Bacteria | 967 |
| 220 | Ga0068864_101207447 | 3300005618 | Bacteria | 755 |
| 221 | Ga0068866_10098353 | 3300005718 | Bacteria | 1609 |
| 222 | Ga0068861_100630403 | 3300005719 | Bacteria | 988 |
| 223 | Ga0068851_10009479 | 3300005834 | Bacteria | 4529 |
| 224 | Ga0068851_10042686 | 3300005834 | Bacteria | 2284 |
| 225 | Ga0068851_10084160 | 3300005834 | Bacteria | 1665 |
| 226 | Ga0068851_10118403 | 3300005834 | Bacteria | 1421 |
| 227 | Ga0068851_10357712 | 3300005834 | Bacteria | 851 |
| 228 | Ga0068863_100003894 | 3300005841 | Bacteria | 14746 |
| 229 | Ga0068863_100035175 | 3300005841 | Bacteria | 4772 |
| 230 | Ga0068863_100282732 | 3300005841 | Bacteria | 1608 |
| 231 | Ga0068863_101019038 | 3300005841 | Bacteria | 831 |
| 232 | Ga0068863_101286743 | 3300005841 | Bacteria | 738 |
| 233 | Ga0068858_100020526 | 3300005842 | Bacteria | 6174 |
| 234 | Ga0068858_100433525 | 3300005842 | Bacteria | 1265 |
| 235 | Ga0068858_100589575 | 3300005842 | Bacteria | 1078 |
| 236 | Ga0068858_101391846 | 3300005842 | Bacteria | 691 |
| 237 | Ga0068860_100027502 | 3300005843 | Bacteria | 5478 |
| 238 | Ga0068860_100194469 | 3300005843 | Bacteria | 1964 |
| 239 | Ga0068860_100283493 | 3300005843 | Bacteria | 1620 |
| 240 | Ga0068860_102115491 | 3300005843 | Bacteria | 584 |
| 241 | Ga0068862_100011622 | 3300005844 | Bacteria | 7264 |
| 242 | Ga0068862_100025302 | 3300005844 | Bacteria | 4983 |
| 243 | Ga0068862_100041195 | 3300005844 | Bacteria | 3930 |
| 244 | Ga0068862_100516465 | 3300005844 | Bacteria | 1136 |
| 245 | Ga0068862_100638174 | 3300005844 | Bacteria | 1026 |
| 246 | Ga0068862_101360095 | 3300005844 | Bacteria | 713 |
| 247 | Ga0068862_102707587 | 3300005844 | Unclassified | 507 |
| 248 | Ga0081539_10024274 | 3300005985 | Bacteria | 3939 |
| 249 | Ga0081539_10111840 | 3300005985 | Bacteria | 1373 |
| 250 | Ga0081539_10215398 | 3300005985 | Bacteria | 877 |
| 251 | Ga0070717_10089264 | 3300006028 | Bacteria | 2599 |
| 252 | Ga0070715_10502398 | 3300006163 | Bacteria | 694 |
| 253 | Ga0070716_100392697 | 3300006173 | Bacteria | 995 |
| 254 | Ga0075369_10166144 | 3300006186 | Unclassified | 1012 |
| 255 | Ga0097621_100012388 | 3300006237 | Bacteria | 6319 |
| 256 | Ga0097621_100017678 | 3300006237 | Bacteria | 5422 |
| 257 | Ga0097621_100751589 | 3300006237 | Bacteria | 901 |
| 258 | Ga0068871_100018700 | 3300006358 | Bacteria | 5276 |
| 259 | Ga0068871_100198259 | 3300006358 | Bacteria | 1732 |
| 260 | Ga0068871_100220973 | 3300006358 | Bacteria | 1641 |
| 261 | Ga0068871_100815928 | 3300006358 | Bacteria | 861 |
| 262 | Ga0068871_101288497 | 3300006358 | Bacteria | 687 |
| 263 | Ga0068871_101368608 | 3300006358 | Bacteria | 667 |
| 264 | Ga0075428_101641064 | 3300006844 | Bacteria | 672 |
| 265 | Ga0075429_100210845 | 3300006880 | Bacteria | 1702 |
| 266 | Ga0068865_100090054 | 3300006881 | Bacteria | 2223 |
| 267 | Ga0068865_100265185 | 3300006881 | Bacteria | 1361 |
| 268 | Ga0068865_100632247 | 3300006881 | Bacteria | 908 |
| 269 | Ga0097620_100031616 | 3300006931 | Bacteria | 5315 |
| 270 | Ga0097620_100162519 | 3300006931 | Bacteria | 2312 |
| 271 | Ga0097620_100243965 | 3300006931 | Bacteria | 1886 |
| 272 | Ga0097620_101728715 | 3300006931 | Bacteria | 691 |
| 273 | Ga0097620_101913692 | 3300006931 | Bacteria | 655 |
| 274 | Ga0105251_10038441 | 3300009011 | Bacteria | 2344 |
| 275 | Ga0111539_10058536 | 3300009094 | Bacteria | 4571 |
| 276 | Ga0105245_12591162 | 3300009098 | Bacteria | 560 |
| 277 | Ga0105247_10115081 | 3300009101 | Bacteria | 1735 |
| 278 | Ga0105247_11764509 | 3300009101 | Bacteria | 514 |
| 279 | Ga0105243_10014560 | 3300009148 | Bacteria | 5951 |
| 280 | Ga0105243_10161300 | 3300009148 | Bacteria | 1933 |
| 281 | Ga0105243_12705856 | 3300009148 | Bacteria | 536 |
| 282 | Ga0105241_10065092 | 3300009174 | Bacteria | 2816 |
| 283 | Ga0105242_10863468 | 3300009176 | Bacteria | 902 |
| 284 | Ga0105242_11004428 | 3300009176 | Bacteria | 842 |
| 285 | Ga0105248_10012350 | 3300009177 | Bacteria | 9425 |
| 286 | Ga0105248_10022027 | 3300009177 | Bacteria | 7061 |
| 287 | Ga0105248_10055018 | 3300009177 | Bacteria | 4463 |
| 288 | Ga0105248_10136957 | 3300009177 | Bacteria | 2762 |
| 289 | Ga0105248_10165154 | 3300009177 | Bacteria | 2496 |
| 290 | Ga0105248_10694864 | 3300009177 | Bacteria | 1148 |
| 291 | Ga0105248_11109947 | 3300009177 | Bacteria | 894 |
| 292 | Ga0105248_11481423 | 3300009177 | Bacteria | 768 |
| 293 | Ga0105248_11529196 | 3300009177 | Bacteria | 756 |
| 294 | Ga0105248_13149114 | 3300009177 | Bacteria | 525 |
| 295 | Ga0105237_10027499 | 3300009545 | Bacteria | 5805 |
| 296 | Ga0105238_10262621 | 3300009551 | Bacteria | 1706 |
| 297 | Ga0105238_10397575 | 3300009551 | Bacteria | 1371 |
| 298 | Ga0105238_10619381 | 3300009551 | Bacteria | 1091 |
| 299 | Ga0105249_10121432 | 3300009553 | Bacteria | 2483 |
| 300 | Ga0105249_10620954 | 3300009553 | Bacteria | 1137 |
| 301 | Ga0105239_12964624 | 3300010375 | Bacteria | 553 |
| 302 | Ga0105246_10485246 | 3300011119 | Bacteria | 1046 |
| 303 | Ga0157319_1021488 | 3300012497 | Bacteria | 631 |
| 304 | Ga0157327_1033179 | 3300012512 | Unclassified | 656 |
| 305 | Ga0157327_1052598 | 3300012512 | Bacteria | 584 |
| 306 | Ga0157373_10115471 | 3300013100 | Bacteria | 1887 |
| 307 | Ga0157373_10127536 | 3300013100 | Bacteria | 1789 |
| 308 | Ga0157373_10281258 | 3300013100 | Bacteria | 1179 |
| 309 | Ga0157373_10291242 | 3300013100 | Bacteria | 1158 |
| 310 | Ga0157373_10606145 | 3300013100 | Bacteria | 797 |
| 311 | Ga0157373_10649093 | 3300013100 | Bacteria | 771 |
| 312 | Ga0157373_10828818 | 3300013100 | Bacteria | 683 |
| 313 | Ga0157373_11073364 | 3300013100 | Bacteria | 603 |
| 314 | Ga0157373_11556013 | 3300013100 | Bacteria | 506 |
| 315 | Ga0157371_10409949 | 3300013102 | Bacteria | 992 |
| 316 | Ga0157371_10487610 | 3300013102 | Bacteria | 909 |
| 317 | Ga0157371_10529056 | 3300013102 | Bacteria | 872 |
| 318 | Ga0157371_10551216 | 3300013102 | Bacteria | 855 |
| 319 | Ga0157371_11300961 | 3300013102 | Bacteria | 562 |
| 320 | Ga0157370_10111211 | 3300013104 | Bacteria | 2561 |
| 321 | Ga0157370_10201071 | 3300013104 | Bacteria | 1848 |
| 322 | Ga0157369_10382418 | 3300013105 | Bacteria | 1461 |
| 323 | Ga0157369_10590332 | 3300013105 | Bacteria | 1147 |
| 324 | Ga0157374_10122097 | 3300013296 | Bacteria | 2515 |
| 325 | Ga0157374_12130581 | 3300013296 | Bacteria | 588 |
| 326 | Ga0163162_10081734 | 3300013306 | Bacteria | 3302 |
| 327 | Ga0163162_10589954 | 3300013306 | Bacteria | 1238 |
| 328 | Ga0163162_10641825 | 3300013306 | Bacteria | 1186 |
| 329 | Ga0163162_11531835 | 3300013306 | Bacteria | 760 |
| 330 | Ga0157372_10142218 | 3300013307 | Bacteria | 2765 |
| 331 | Ga0157372_10196510 | 3300013307 | Bacteria | 2336 |
| 332 | Ga0157372_10935308 | 3300013307 | Bacteria | 1005 |
| 333 | Ga0157372_10961001 | 3300013307 | Bacteria | 990 |
| 334 | Ga0157372_11074758 | 3300013307 | Bacteria | 931 |
| 335 | Ga0157372_11960692 | 3300013307 | Bacteria | 673 |
| 336 | Ga0157372_12610635 | 3300013307 | Unclassified | 580 |
| 337 | Ga0157375_10396925 | 3300013308 | Unclassified | 1546 |
| 338 | Ga0157375_11058544 | 3300013308 | Bacteria | 948 |
| 339 | Ga0163163_10173671 | 3300014325 | Bacteria | 2201 |
| 340 | Ga0163163_10274780 | 3300014325 | Bacteria | 1736 |
| 341 | Ga0157380_10010723 | 3300014326 | Bacteria | 6604 |
| 342 | Ga0182008_10045746 | 3300014497 | Bacteria | 2176 |
| 343 | Ga0157377_10153597 | 3300014745 | Bacteria | 1425 |
| 344 | Ga0157377_10594837 | 3300014745 | Bacteria | 788 |
| 345 | Ga0157377_11726193 | 3300014745 | Unclassified | 506 |
| 346 | Ga0157379_10006649 | 3300014968 | Bacteria | 9978 |
| 347 | Ga0157379_10753369 | 3300014968 | Bacteria | 917 |
| 348 | Ga0157379_10866178 | 3300014968 | Bacteria | 855 |
| 349 | Ga0182006_1202542 | 3300015261 | Bacteria | 657 |
| 350 | Ga0163161_10160190 | 3300017792 | Bacteria | 1716 |
| 351 | Ga0163161_11131492 | 3300017792 | Bacteria | 674 |
| 352 | Ga0213876_10361112 | 3300021384 | Bacteria | 772 |
| 353 | Ga0207697_10034932 | 3300025315 | Bacteria | 2057 |
| 354 | Ga0207697_10112929 | 3300025315 | Bacteria | 1164 |
| 355 | Ga0207697_10392672 | 3300025315 | Bacteria | 616 |
| 356 | Ga0207656_10002893 | 3300025321 | Bacteria | 5850 |
| 357 | Ga0207656_10012184 | 3300025321 | Bacteria | 3265 |
| 358 | Ga0207656_10256000 | 3300025321 | Bacteria | 859 |
| 359 | Ga0207656_10748480 | 3300025321 | Bacteria | 501 |
| 360 | Ga0207713_1207201 | 3300025735 | Bacteria | 598 |
| 361 | Ga0207682_10436197 | 3300025893 | Bacteria | 620 |
| 362 | Ga0207682_10490048 | 3300025893 | Bacteria | 582 |
| 363 | Ga0207682_10518707 | 3300025893 | Bacteria | 564 |
| 364 | Ga0207642_10062750 | 3300025899 | Bacteria | 1735 |
| 365 | Ga0207710_10068091 | 3300025900 | Bacteria | 1627 |
| 366 | Ga0207688_10842127 | 3300025901 | Bacteria | 581 |
| 367 | Ga0207680_10144651 | 3300025903 | Bacteria | 1579 |
| 368 | Ga0207680_10843903 | 3300025903 | Bacteria | 657 |
| 369 | Ga0207647_10026662 | 3300025904 | Bacteria | 3777 |
| 370 | Ga0207647_10046560 | 3300025904 | Bacteria | 2702 |
| 371 | Ga0207647_10089230 | 3300025904 | Bacteria | 1840 |
| 372 | Ga0207647_10328211 | 3300025904 | Unclassified | 868 |
| 373 | Ga0207645_10000896 | 3300025907 | Bacteria | 24720 |
| 374 | Ga0207645_10014320 | 3300025907 | Bacteria | 5311 |
| 375 | Ga0207645_10287122 | 3300025907 | Bacteria | 1093 |
| 376 | Ga0207645_10332604 | 3300025907 | Bacteria | 1015 |
| 377 | Ga0207643_10428470 | 3300025908 | Bacteria | 839 |
| 378 | Ga0207705_10001965 | 3300025909 | Bacteria | 16037 |
| 379 | Ga0207705_10024198 | 3300025909 | Bacteria | 4334 |
| 380 | Ga0207705_10061994 | 3300025909 | Bacteria | 2701 |
| 381 | Ga0207705_10064531 | 3300025909 | Bacteria | 2646 |
| 382 | Ga0207705_10086178 | 3300025909 | Bacteria | 2295 |
| 383 | Ga0207705_10093412 | 3300025909 | Bacteria | 2205 |
| 384 | Ga0207705_10105612 | 3300025909 | Bacteria | 2076 |
| 385 | Ga0207705_10385583 | 3300025909 | Bacteria | 1083 |
| 386 | Ga0207705_10546995 | 3300025909 | Bacteria | 900 |
| 387 | Ga0207705_10924239 | 3300025909 | Bacteria | 675 |
| 388 | Ga0207684_10278038 | 3300025910 | Bacteria | 1444 |
| 389 | Ga0207654_10119268 | 3300025911 | Bacteria | 1654 |
| 390 | Ga0207654_10249995 | 3300025911 | Bacteria | 1188 |
| 391 | Ga0207707_10981200 | 3300025912 | Bacteria | 694 |
| 392 | Ga0207707_10988102 | 3300025912 | Bacteria | 691 |
| 393 | Ga0207707_11599366 | 3300025912 | Bacteria | 513 |
| 394 | Ga0207671_10129455 | 3300025914 | Bacteria | 1936 |
| 395 | Ga0207660_10073102 | 3300025917 | Bacteria | 2499 |
| 396 | Ga0207660_11613543 | 3300025917 | Bacteria | 523 |
| 397 | Ga0207662_10033903 | 3300025918 | Bacteria | 2979 |
| 398 | Ga0207662_10853135 | 3300025918 | Bacteria | 643 |
| 399 | Ga0207657_10007272 | 3300025919 | Bacteria | 11370 |
| 400 | Ga0207657_10024029 | 3300025919 | Bacteria | 5659 |
| 401 | Ga0207657_10044314 | 3300025919 | Bacteria | 3911 |
| 402 | Ga0207657_10159436 | 3300025919 | Bacteria | 1833 |
| 403 | Ga0207657_10809192 | 3300025919 | Bacteria | 724 |
| 404 | Ga0207649_10007872 | 3300025920 | Bacteria | 5799 |
| 405 | Ga0207649_10017923 | 3300025920 | Bacteria | 4016 |
| 406 | Ga0207649_10255400 | 3300025920 | Bacteria | 1264 |
| 407 | Ga0207649_11182494 | 3300025920 | Bacteria | 604 |
| 408 | Ga0207649_11476306 | 3300025920 | Bacteria | 538 |
| 409 | Ga0207652_10195944 | 3300025921 | Bacteria | 1817 |
| 410 | Ga0207652_10539151 | 3300025921 | Bacteria | 1049 |
| 411 | Ga0207681_10005902 | 3300025923 | Bacteria | 7509 |
| 412 | Ga0207681_10065848 | 3300025923 | Bacteria | 2506 |
| 413 | Ga0207681_10091891 | 3300025923 | Bacteria | 2169 |
| 414 | Ga0207681_10399550 | 3300025923 | Bacteria | 1110 |
| 415 | Ga0207681_10732046 | 3300025923 | Bacteria | 824 |
| 416 | Ga0207681_10765765 | 3300025923 | Bacteria | 805 |
| 417 | Ga0207650_10048831 | 3300025925 | Bacteria | 3122 |
| 418 | Ga0207650_10081807 | 3300025925 | Bacteria | 2450 |
| 419 | Ga0207650_10483622 | 3300025925 | Bacteria | 1033 |
| 420 | Ga0207650_10700098 | 3300025925 | Bacteria | 856 |
| 421 | Ga0207650_10858081 | 3300025925 | Bacteria | 770 |
| 422 | Ga0207650_10984972 | 3300025925 | Bacteria | 717 |
| 423 | Ga0207659_10145992 | 3300025926 | Bacteria | 1842 |
| 424 | Ga0207659_10388818 | 3300025926 | Bacteria | 1165 |
| 425 | Ga0207659_11290601 | 3300025926 | Bacteria | 627 |
| 426 | Ga0207659_11579333 | 3300025926 | Bacteria | 560 |
| 427 | Ga0207700_10051185 | 3300025928 | Bacteria | 3081 |
| 428 | Ga0207664_10108634 | 3300025929 | Bacteria | 2303 |
| 429 | Ga0207644_10009935 | 3300025931 | Bacteria | 6261 |
| 430 | Ga0207644_10078292 | 3300025931 | Bacteria | 2436 |
| 431 | Ga0207644_10189458 | 3300025931 | Bacteria | 1616 |
| 432 | Ga0207644_10377694 | 3300025931 | Bacteria | 1155 |
| 433 | Ga0207644_10681091 | 3300025931 | Bacteria | 857 |
| 434 | Ga0207644_11223885 | 3300025931 | Bacteria | 631 |
| 435 | Ga0207644_11260195 | 3300025931 | Unclassified | 621 |
| 436 | Ga0207690_10024491 | 3300025932 | Bacteria | 3780 |
| 437 | Ga0207690_10069444 | 3300025932 | Bacteria | 2424 |
| 438 | Ga0207690_10098069 | 3300025932 | Bacteria | 2087 |
| 439 | Ga0207690_10110271 | 3300025932 | Bacteria | 1981 |
| 440 | Ga0207690_10150582 | 3300025932 | Bacteria | 1724 |
| 441 | Ga0207690_10208131 | 3300025932 | Bacteria | 1490 |
| 442 | Ga0207690_10301700 | 3300025932 | Bacteria | 1253 |
| 443 | Ga0207690_10613980 | 3300025932 | Bacteria | 889 |
| 444 | Ga0207706_10002920 | 3300025933 | Bacteria | 16518 |
| 445 | Ga0207706_10016973 | 3300025933 | Bacteria | 6568 |
| 446 | Ga0207706_10038549 | 3300025933 | Bacteria | 4239 |
| 447 | Ga0207706_10059182 | 3300025933 | Bacteria | 3374 |
| 448 | Ga0207706_10073838 | 3300025933 | Bacteria | 2999 |
| 449 | Ga0207706_10155651 | 3300025933 | Bacteria | 2010 |
| 450 | Ga0207706_10327685 | 3300025933 | Bacteria | 1332 |
| 451 | Ga0207706_10411954 | 3300025933 | Bacteria | 1171 |
| 452 | Ga0207706_11175213 | 3300025933 | Bacteria | 638 |
| 453 | Ga0207706_11265900 | 3300025933 | Bacteria | 611 |
| 454 | Ga0207706_11437268 | 3300025933 | Unclassified | 565 |
| 455 | Ga0207706_11571973 | 3300025933 | Bacteria | 534 |
| 456 | Ga0207709_10110073 | 3300025935 | Bacteria | 1840 |
| 457 | Ga0207709_10290075 | 3300025935 | Bacteria | 1212 |
| 458 | Ga0207669_10043744 | 3300025937 | Bacteria | 2625 |
| 459 | Ga0207669_10090941 | 3300025937 | Bacteria | 1986 |
| 460 | Ga0207669_10399535 | 3300025937 | Bacteria | 1076 |
| 461 | Ga0207704_10360987 | 3300025938 | Bacteria | 1134 |
| 462 | Ga0207704_10380619 | 3300025938 | Unclassified | 1108 |
| 463 | Ga0207704_10485232 | 3300025938 | Bacteria | 993 |
| 464 | Ga0207704_10640618 | 3300025938 | Bacteria | 874 |
| 465 | Ga0207665_10373449 | 3300025939 | Bacteria | 1081 |
| 466 | Ga0207691_10061771 | 3300025940 | Bacteria | 3403 |
| 467 | Ga0207691_10140129 | 3300025940 | Bacteria | 2132 |
| 468 | Ga0207691_10463185 | 3300025940 | Bacteria | 1078 |
| 469 | Ga0207691_10491554 | 3300025940 | Bacteria | 1042 |
| 470 | Ga0207711_10032298 | 3300025941 | Bacteria | 4426 |
| 471 | Ga0207711_10079401 | 3300025941 | Bacteria | 2864 |
| 472 | Ga0207711_10779090 | 3300025941 | Bacteria | 891 |
| 473 | Ga0207711_10782851 | 3300025941 | Bacteria | 889 |
| 474 | Ga0207711_11888227 | 3300025941 | Bacteria | 540 |
| 475 | Ga0207689_10073436 | 3300025942 | Bacteria | 2810 |
| 476 | Ga0207689_10150703 | 3300025942 | Bacteria | 1917 |
| 477 | Ga0207689_10196854 | 3300025942 | Bacteria | 1663 |
| 478 | Ga0207689_11366308 | 3300025942 | Bacteria | 594 |
| 479 | Ga0207661_10546516 | 3300025944 | Bacteria | 1061 |
| 480 | Ga0207661_10799291 | 3300025944 | Bacteria | 868 |
| 481 | Ga0207679_10012302 | 3300025945 | Bacteria | 5576 |
| 482 | Ga0207679_10018820 | 3300025945 | Bacteria | 4633 |
| 483 | Ga0207679_10081752 | 3300025945 | Bacteria | 2471 |
| 484 | Ga0207679_10084641 | 3300025945 | Bacteria | 2434 |
| 485 | Ga0207679_10168770 | 3300025945 | Bacteria | 1799 |
| 486 | Ga0207679_10318644 | 3300025945 | Bacteria | 1346 |
| 487 | Ga0207679_11062291 | 3300025945 | Unclassified | 743 |
| 488 | Ga0207679_11811151 | 3300025945 | Bacteria | 558 |
| 489 | Ga0207679_12066526 | 3300025945 | Bacteria | 518 |
| 490 | Ga0207667_10264237 | 3300025949 | Bacteria | 1760 |
| 491 | Ga0207667_10719321 | 3300025949 | Bacteria | 1000 |
| 492 | Ga0207651_10006856 | 3300025960 | Bacteria | 6012 |
| 493 | Ga0207651_10727003 | 3300025960 | Bacteria | 876 |
| 494 | Ga0207651_10924344 | 3300025960 | Unclassified | 777 |
| 495 | Ga0207651_11100033 | 3300025960 | Bacteria | 712 |
| 496 | Ga0207651_11442595 | 3300025960 | Bacteria | 620 |
| 497 | Ga0207668_10000070 | 3300025972 | Bacteria | 78666 |
| 498 | Ga0207668_10237129 | 3300025972 | Bacteria | 1474 |
| 499 | Ga0207668_11243370 | 3300025972 | Bacteria | 670 |
| 500 | Ga0207668_11263272 | 3300025972 | Bacteria | 664 |
| 501 | Ga0207668_11726148 | 3300025972 | Bacteria | 565 |
| 502 | Ga0207640_10035015 | 3300025981 | Bacteria | 3139 |
| 503 | Ga0207640_10959695 | 3300025981 | Bacteria | 750 |
| 504 | Ga0207658_10004581 | 3300025986 | Bacteria | 9596 |
| 505 | Ga0207658_10035124 | 3300025986 | Bacteria | 3588 |
| 506 | Ga0207658_10044969 | 3300025986 | Bacteria | 3216 |
| 507 | Ga0207658_11081175 | 3300025986 | Bacteria | 732 |
| 508 | Ga0207677_10630678 | 3300026023 | Bacteria | 944 |
| 509 | Ga0207677_12248673 | 3300026023 | Unclassified | 507 |
| 510 | Ga0207703_10146263 | 3300026035 | Bacteria | 2056 |
| 511 | Ga0207703_10163523 | 3300026035 | Bacteria | 1951 |
| 512 | Ga0207639_10166842 | 3300026041 | Bacteria | 1861 |
| 513 | Ga0207639_10305987 | 3300026041 | Bacteria | 1407 |
| 514 | Ga0207639_10655743 | 3300026041 | Bacteria | 971 |
| 515 | Ga0207678_10015045 | 3300026067 | Bacteria | 6807 |
| 516 | Ga0207678_10148222 | 3300026067 | Bacteria | 2003 |
| 517 | Ga0207678_10181273 | 3300026067 | Bacteria | 1798 |
| 518 | Ga0207678_10400274 | 3300026067 | Bacteria | 1189 |
| 519 | Ga0207678_10554615 | 3300026067 | Bacteria | 1005 |
| 520 | Ga0207678_10583045 | 3300026067 | Bacteria | 980 |
| 521 | Ga0207678_10856055 | 3300026067 | Bacteria | 803 |
| 522 | Ga0207702_10005600 | 3300026078 | Bacteria | 10963 |
| 523 | Ga0207702_10809414 | 3300026078 | Bacteria | 926 |
| 524 | Ga0207641_10073932 | 3300026088 | Bacteria | 2938 |
| 525 | Ga0207641_10097779 | 3300026088 | Bacteria | 2580 |
| 526 | Ga0207641_10987317 | 3300026088 | Bacteria | 838 |
| 527 | Ga0207641_11509909 | 3300026088 | Bacteria | 673 |
| 528 | Ga0207641_11602943 | 3300026088 | Bacteria | 653 |
| 529 | Ga0207648_10001147 | 3300026089 | Bacteria | 29705 |
| 530 | Ga0207648_10013848 | 3300026089 | Bacteria | 7481 |
| 531 | Ga0207648_10028525 | 3300026089 | Bacteria | 4947 |
| 532 | Ga0207648_10237468 | 3300026089 | Bacteria | 1622 |
| 533 | Ga0207648_11899547 | 3300026089 | Bacteria | 557 |
| 534 | Ga0207676_10010550 | 3300026095 | Bacteria | 6584 |
| 535 | Ga0207676_10180833 | 3300026095 | Bacteria | 1846 |
| 536 | Ga0207676_10248481 | 3300026095 | Bacteria | 1600 |
| 537 | Ga0207676_11844958 | 3300026095 | Bacteria | 603 |
| 538 | Ga0207676_12231303 | 3300026095 | Bacteria | 545 |
| 539 | Ga0207674_10000308 | 3300026116 | Bacteria | 62120 |
| 540 | Ga0207674_10002878 | 3300026116 | Bacteria | 21384 |
| 541 | Ga0207674_10009470 | 3300026116 | Bacteria | 11125 |
| 542 | Ga0207674_10066032 | 3300026116 | Bacteria | 3645 |
| 543 | Ga0207674_10238069 | 3300026116 | Bacteria | 1767 |
| 544 | Ga0207675_100257119 | 3300026118 | Bacteria | 1692 |
| 545 | Ga0207683_10024070 | 3300026121 | Bacteria | 5240 |
| 546 | Ga0207683_10101882 | 3300026121 | Bacteria | 2563 |
| 547 | Ga0207683_10114046 | 3300026121 | Bacteria | 2421 |
| 548 | Ga0207683_10156523 | 3300026121 | Bacteria | 2058 |
| 549 | Ga0207698_10201097 | 3300026142 | Bacteria | 1784 |
| 550 | Ga0207698_11056276 | 3300026142 | Bacteria | 824 |
| 551 | Ga0207698_11107684 | 3300026142 | Bacteria | 805 |
| 552 | Ga0209974_10083763 | 3300027876 | Bacteria | 1100 |
| 553 | Ga0268266_10000315 | 3300028379 | Bacteria | 76532 |
| 554 | Ga0268266_10732274 | 3300028379 | Bacteria | 954 |
| 555 | Ga0268266_10766762 | 3300028379 | Bacteria | 931 |
| 556 | Ga0268266_10909639 | 3300028379 | Bacteria | 851 |
| 557 | Ga0268266_11579413 | 3300028379 | Bacteria | 631 |
| 558 | Ga0268265_10066103 | 3300028380 | Bacteria | 2794 |
| 559 | Ga0268265_10079746 | 3300028380 | Bacteria | 2579 |
| 560 | Ga0268265_10827079 | 3300028380 | Bacteria | 904 |
| 561 | Ga0268265_10863786 | 3300028380 | Bacteria | 886 |
| 562 | Ga0268264_10066329 | 3300028381 | Bacteria | 3043 |
| 563 | Ga0268264_11786100 | 3300028381 | Bacteria | 625 |
| 564 | Ga0307408_100011889 | 3300031548 | Bacteria | 5759 |
| 565 | Ga0307408_100029310 | 3300031548 | Bacteria | 3812 |
| 566 | Ga0307408_100401901 | 3300031548 | Bacteria | 1176 |
| 567 | Ga0307408_100724948 | 3300031548 | Bacteria | 896 |
| 568 | Ga0307408_101297580 | 3300031548 | Bacteria | 682 |
| 569 | Ga0307405_10065406 | 3300031731 | Bacteria | 2314 |
| 570 | Ga0307405_10173684 | 3300031731 | Bacteria | 1540 |
| 571 | Ga0307405_10382513 | 3300031731 | Bacteria | 1096 |
| 572 | Ga0307405_10400061 | 3300031731 | Bacteria | 1075 |
| 573 | Ga0307405_10526524 | 3300031731 | Bacteria | 952 |
| 574 | Ga0307405_10604455 | 3300031731 | Bacteria | 895 |
| 575 | Ga0307405_11314789 | 3300031731 | Bacteria | 629 |
| 576 | Ga0307413_10008886 | 3300031824 | Bacteria | 4773 |
| 577 | Ga0307413_10018307 | 3300031824 | Bacteria | 3672 |
| 578 | Ga0307413_10041265 | 3300031824 | Bacteria | 2700 |
| 579 | Ga0307413_10060096 | 3300031824 | Bacteria | 2338 |
| 580 | Ga0307413_10062051 | 3300031824 | Bacteria | 2310 |
| 581 | Ga0307413_10068638 | 3300031824 | Bacteria | 2221 |
| 582 | Ga0307413_10090035 | 3300031824 | Bacteria | 1995 |
| 583 | Ga0307413_10093811 | 3300031824 | Bacteria | 1963 |
| 584 | Ga0307413_10094504 | 3300031824 | Bacteria | 1957 |
| 585 | Ga0307413_10140627 | 3300031824 | Bacteria | 1667 |
| 586 | Ga0307413_10214573 | 3300031824 | Bacteria | 1400 |
| 587 | Ga0307413_10460547 | 3300031824 | Bacteria | 1011 |
| 588 | Ga0307413_10494498 | 3300031824 | Bacteria | 981 |
| 589 | Ga0307413_10570072 | 3300031824 | Bacteria | 921 |
| 590 | Ga0307413_11577875 | 3300031824 | Bacteria | 582 |
| 591 | Ga0307413_12193465 | 3300031824 | Bacteria | 501 |
| 592 | Ga0307410_10012027 | 3300031852 | Bacteria | 4981 |
| 593 | Ga0307410_10035962 | 3300031852 | Bacteria | 3221 |
| 594 | Ga0307410_10058215 | 3300031852 | Bacteria | 2634 |
| 595 | Ga0307410_10059315 | 3300031852 | Bacteria | 2612 |
| 596 | Ga0307410_10082864 | 3300031852 | Bacteria | 2257 |
| 597 | Ga0307410_10153595 | 3300031852 | Bacteria | 1716 |
| 598 | Ga0307410_10189258 | 3300031852 | Bacteria | 1564 |
| 599 | Ga0307410_10433732 | 3300031852 | Bacteria | 1068 |
| 600 | Ga0307410_10437324 | 3300031852 | Bacteria | 1064 |
| 601 | Ga0307410_10467600 | 3300031852 | Bacteria | 1032 |
| 602 | Ga0307410_10660891 | 3300031852 | Bacteria | 877 |
| 603 | Ga0307410_11381946 | 3300031852 | Unclassified | 618 |
| 604 | Ga0307410_11670068 | 3300031852 | Bacteria | 564 |
| 605 | Ga0307406_10018474 | 3300031901 | Bacteria | 4075 |
| 606 | Ga0307406_10043702 | 3300031901 | Bacteria | 2803 |
| 607 | Ga0307406_10087952 | 3300031901 | Bacteria | 2084 |
| 608 | Ga0307406_10298540 | 3300031901 | Bacteria | 1236 |
| 609 | Ga0307406_10309011 | 3300031901 | Bacteria | 1218 |
| 610 | Ga0307406_11731092 | 3300031901 | Bacteria | 554 |
| 611 | Ga0307407_10025709 | 3300031903 | Bacteria | 3107 |
| 612 | Ga0307407_10059415 | 3300031903 | Bacteria | 2227 |
| 613 | Ga0307407_10088709 | 3300031903 | Bacteria | 1890 |
| 614 | Ga0307407_10162004 | 3300031903 | Bacteria | 1465 |
| 615 | Ga0307407_10397250 | 3300031903 | Bacteria | 988 |
| 616 | Ga0307412_10133334 | 3300031911 | Bacteria | 1808 |
| 617 | Ga0307412_10172699 | 3300031911 | Bacteria | 1617 |
| 618 | Ga0307412_10374289 | 3300031911 | Unclassified | 1151 |
| 619 | Ga0307412_10714590 | 3300031911 | Bacteria | 861 |
| 620 | Ga0307412_10726617 | 3300031911 | Bacteria | 855 |
| 621 | Ga0307412_11029944 | 3300031911 | Bacteria | 729 |
| 622 | Ga0307412_11176782 | 3300031911 | Bacteria | 685 |
| 623 | Ga0307412_11216157 | 3300031911 | Unclassified | 675 |
| 624 | Ga0307412_11534390 | 3300031911 | Bacteria | 606 |
| 625 | Ga0307409_100166809 | 3300031995 | Bacteria | 1933 |
| 626 | Ga0307409_100188014 | 3300031995 | Bacteria | 1835 |
| 627 | Ga0307409_100215525 | 3300031995 | Bacteria | 1729 |
| 628 | Ga0307409_100216374 | 3300031995 | Bacteria | 1726 |
| 629 | Ga0307409_100316452 | 3300031995 | Bacteria | 1459 |
| 630 | Ga0307409_100342244 | 3300031995 | Bacteria | 1408 |
| 631 | Ga0307409_100432532 | 3300031995 | Bacteria | 1265 |
| 632 | Ga0307409_100662179 | 3300031995 | Bacteria | 1039 |
| 633 | Ga0307409_100698213 | 3300031995 | Bacteria | 1013 |
| 634 | Ga0307409_101211804 | 3300031995 | Bacteria | 778 |
| 635 | Ga0307409_101218245 | 3300031995 | Bacteria | 776 |
| 636 | Ga0307409_101369310 | 3300031995 | Bacteria | 733 |
| 637 | Ga0307409_101459233 | 3300031995 | Bacteria | 711 |
| 638 | Ga0307409_101646304 | 3300031995 | Unclassified | 670 |
| 639 | Ga0307409_101796060 | 3300031995 | Bacteria | 642 |
| 640 | Ga0307409_102175955 | 3300031995 | Bacteria | 584 |
| 641 | Ga0307416_100011951 | 3300032002 | Bacteria | 5824 |
| 642 | Ga0307416_100012629 | 3300032002 | Bacteria | 5700 |
| 643 | Ga0307416_100124183 | 3300032002 | Bacteria | 2309 |
| 644 | Ga0307416_100208353 | 3300032002 | Bacteria | 1862 |
| 645 | Ga0307416_100323553 | 3300032002 | Bacteria | 1546 |
| 646 | Ga0307416_100357784 | 3300032002 | Bacteria | 1480 |
| 647 | Ga0307416_100414379 | 3300032002 | Bacteria | 1389 |
| 648 | Ga0307416_100420958 | 3300032002 | Unclassified | 1380 |
| 649 | Ga0307416_100835229 | 3300032002 | Bacteria | 1019 |
| 650 | Ga0307416_100990658 | 3300032002 | Bacteria | 943 |
| 651 | Ga0307416_102651869 | 3300032002 | Bacteria | 598 |
| 652 | Ga0307416_103085616 | 3300032002 | Unclassified | 557 |
| 653 | Ga0307414_10003689 | 3300032004 | Bacteria | 8209 |
| 654 | Ga0307414_10027762 | 3300032004 | Bacteria | 3662 |
| 655 | Ga0307414_10096978 | 3300032004 | Bacteria | 2207 |
| 656 | Ga0307414_10189122 | 3300032004 | Bacteria | 1664 |
| 657 | Ga0307414_10195532 | 3300032004 | Bacteria | 1640 |
| 658 | Ga0307414_10229875 | 3300032004 | Bacteria | 1528 |
| 659 | Ga0307414_10238328 | 3300032004 | Bacteria | 1504 |
| 660 | Ga0307414_10276398 | 3300032004 | Bacteria | 1409 |
| 661 | Ga0307414_10332344 | 3300032004 | Bacteria | 1298 |
| 662 | Ga0307414_10524743 | 3300032004 | Bacteria | 1051 |
| 663 | Ga0307414_10631204 | 3300032004 | Unclassified | 964 |
| 664 | Ga0307414_11063029 | 3300032004 | Bacteria | 746 |
| 665 | Ga0307414_12070186 | 3300032004 | Bacteria | 531 |
| 666 | Ga0307414_12108842 | 3300032004 | Bacteria | 526 |
| 667 | Ga0307411_10001276 | 3300032005 | Bacteria | 10094 |
| 668 | Ga0307411_10012473 | 3300032005 | Bacteria | 4639 |
| 669 | Ga0307411_10032088 | 3300032005 | Bacteria | 3241 |
| 670 | Ga0307411_10037558 | 3300032005 | Bacteria | 3046 |
| 671 | Ga0307411_10066526 | 3300032005 | Bacteria | 2421 |
| 672 | Ga0307411_10069353 | 3300032005 | Bacteria | 2380 |
| 673 | Ga0307411_10077866 | 3300032005 | Bacteria | 2271 |
| 674 | Ga0307411_10121562 | 3300032005 | Bacteria | 1890 |
| 675 | Ga0307411_10256952 | 3300032005 | Bacteria | 1377 |
| 676 | Ga0307411_10283152 | 3300032005 | Bacteria | 1320 |
| 677 | Ga0307411_10433125 | 3300032005 | Bacteria | 1095 |
| 678 | Ga0307411_10778678 | 3300032005 | Bacteria | 840 |
| 679 | Ga0307411_10801155 | 3300032005 | Bacteria | 829 |
| 680 | Ga0307411_10927361 | 3300032005 | Bacteria | 775 |
| 681 | Ga0307411_11013980 | 3300032005 | Bacteria | 744 |
| 682 | Ga0307411_11017938 | 3300032005 | Bacteria | 742 |
| 683 | Ga0307411_11174542 | 3300032005 | Bacteria | 695 |
| 684 | Ga0307415_100042173 | 3300032126 | Bacteria | 3035 |
| 685 | Ga0307415_100058166 | 3300032126 | Bacteria | 2660 |
| 686 | Ga0307415_100065070 | 3300032126 | Bacteria | 2539 |
| 687 | Ga0307415_100126970 | 3300032126 | Unclassified | 1924 |
| 688 | Ga0307415_100150070 | 3300032126 | Bacteria | 1793 |
| 689 | Ga0307415_100233595 | 3300032126 | Bacteria | 1482 |
| 690 | Ga0307415_100385674 | 3300032126 | Bacteria | 1191 |
| 691 | Ga0307415_100541826 | 3300032126 | Bacteria | 1025 |
| 692 | Ga0307415_101824770 | 3300032126 | Bacteria | 589 |
| 693 | Ga0373959_0140115 | 3300034820 | Bacteria | 605 |
| 694 | Ga0395899_0136060 | 3300037312 | Unclassified | 1751 |
| 695 | Ga0395899_0432078 | 3300037312 | Unclassified | 866 |
| 696 | Ga0395899_0454091 | 3300037312 | Bacteria | 839 |
| 697 | Ga0395899_0585588 | 3300037312 | Bacteria | 712 |
| 698 | Ga0395899_0875507 | 3300037312 | Unclassified | 549 |
| 699 | Ga0395900_0000325 | 3300037418 | Bacteria | 70579 |
| 700 | Ga0395900_0026676 | 3300037418 | Bacteria | 5914 |
| 701 | Ga0395900_0083036 | 3300037418 | Bacteria | 3291 |
| 702 | Ga0395900_0187845 | 3300037418 | Bacteria | 2097 |
| 703 | Ga0395900_0224583 | 3300037418 | Bacteria | 1891 |
| 704 | Ga0395900_0323105 | 3300037418 | Bacteria | 1523 |
| 705 | Ga0395900_0353400 | 3300037418 | Bacteria | 1443 |
| 706 | Ga0395900_0422645 | 3300037418 | Bacteria | 1293 |
| 707 | Ga0395898_0059038 | 3300037466 | Bacteria | 3734 |
| 708 | Ga0395905_0000218 | 3300037471 | Bacteria | 87745 |
| 709 | Ga0395905_0002116 | 3300037471 | Bacteria | 22546 |
| 710 | Ga0395905_0024115 | 3300037471 | Bacteria | 5741 |
| 711 | Ga0395905_0045805 | 3300037471 | Bacteria | 4102 |
| 712 | Ga0395905_0071455 | 3300037471 | Bacteria | 3253 |
| 713 | Ga0395905_0125488 | 3300037471 | Bacteria | 2413 |
| 714 | Ga0395905_0218635 | 3300037471 | Bacteria | 1783 |
| 715 | Ga0395905_0340328 | 3300037471 | Bacteria | 1391 |
| 716 | Ga0395905_0583364 | 3300037471 | Bacteria | 1019 |
| 717 | Ga0395905_0638584 | 3300037471 | Bacteria | 966 |
| 718 | Ga0395905_0775783 | 3300037471 | Bacteria | 861 |
| 719 | Ga0395905_1158123 | 3300037471 | Bacteria | 677 |
| 720 | Ga0395905_1627359 | 3300037471 | Bacteria | 551 |
| 721 | Ga0395901_0000962 | 3300038443 | Bacteria | 31358 |
| 722 | Ga0395901_0059700 | 3300038443 | Bacteria | 3968 |
| 723 | Ga0395901_0114055 | 3300038443 | Unclassified | 2838 |
| 724 | Ga0395901_0163469 | 3300038443 | Bacteria | 2337 |
| 725 | Ga0395901_0280439 | 3300038443 | Bacteria | 1731 |
| 726 | Ga0395901_0356774 | 3300038443 | Bacteria | 1508 |
| 727 | Ga0395901_0449364 | 3300038443 | Bacteria | 1318 |
| 728 | Ga0395901_1247514 | 3300038443 | Bacteria | 707 |
| 729 | Ga0395901_1986034 | 3300038443 | Bacteria | 528 |
| 730 | Ga0436365_1446270 | 3300039437 | Bacteria | 1293 |
| 731 | Ga0439436_0092581 | 3300041404 | Bacteria | 842 |
| 732 | Ga0439436_0263724 | 3300041404 | Bacteria | 502 |
| 733 | Ga0439447_080412 | 3300041407 | Unclassified | 753 |
| 734 | Ga0439461_0113694 | 3300041410 | Bacteria | 671 |
| 735 | Ga0450890_003198 | 3300042127 | Bacteria | 2187 |
| 736 | Ga0450902_080904 | 3300042137 | Bacteria | 571 |
| 737 | Ga0450905_001426 | 3300042142 | Bacteria | 3052 |
| 738 | Ga0450889_001073 | 3300042144 | Bacteria | 2870 |
| 739 | Ga0439464_0001273 | 3300042439 | Bacteria | 5861 |
| 740 | Ga0439460_0285751 | 3300042461 | Bacteria | 575 |
| 741 | Ga0466972_0172332 | 3300044658 | Bacteria | 1015 |
| 742 | Ga0466965_0408229 | 3300044683 | Bacteria | 751 |
| 743 | Ga0466965_0869016 | 3300044683 | Bacteria | 525 |
| 744 | Ga0466957_1102527 | 3300044842 | Bacteria | 572 |
| 745 | Ga0466960_0079354 | 3300044901 | Bacteria | 1650 |
| 746 | Ga0466960_0394845 | 3300044901 | Bacteria | 796 |
| 747 | Ga0495629_0959256 | 3300046459 | Bacteria | 558 |
| 748 | Ga0495596_0070445 | 3300046500 | Bacteria | 1359 |
| 749 | Ga0495596_0179050 | 3300046500 | Unclassified | 824 |
| 750 | Ga0495663_0030415 | 3300046525 | Bacteria | 1600 |
| 751 | Ga0495663_0043479 | 3300046525 | Bacteria | 1372 |
| 752 | Ga0495663_0065241 | 3300046525 | Bacteria | 1150 |
| 753 | Ga0495663_0097656 | 3300046525 | Bacteria | 964 |
| 754 | Ga0495598_0163450 | 3300046537 | Bacteria | 785 |
| 755 | Ga0495621_0007454 | 3300046539 | Bacteria | 3240 |
| 756 | Ga0495621_0060120 | 3300046539 | Bacteria | 1377 |
| 757 | Ga0495621_0512259 | 3300046539 | Bacteria | 518 |
| 758 | Ga0495633_0006238 | 3300046558 | Bacteria | 7118 |
| 759 | Ga0495656_0776576 | 3300046615 | Bacteria | 517 |
| 760 | Ga0495668_0012970 | 3300046616 | Bacteria | 4933 |
| 761 | Ga0495668_0361688 | 3300046616 | Bacteria | 797 |
| 762 | Ga0495659_0022463 | 3300046664 | Bacteria | 2135 |
| 763 | Ga0495669_0001299 | 3300046684 | Bacteria | 10357 |
| 764 | Ga0495669_0042121 | 3300046684 | Bacteria | 2029 |
| 765 | Ga0495669_0126167 | 3300046684 | Bacteria | 1202 |
| 766 | Ga0495669_0160775 | 3300046684 | Bacteria | 1066 |
| 767 | Ga0495669_0295848 | 3300046684 | Bacteria | 780 |
| 768 | Ga0495670_0015020 | 3300046691 | Bacteria | 3810 |
| 769 | Ga0495670_0102544 | 3300046691 | Bacteria | 1474 |
| 770 | Ga0495670_0466437 | 3300046691 | Bacteria | 685 |
| 771 | Ga0495636_0613997 | 3300047318 | Bacteria | 532 |
| 772 | Ga0495677_0046311 | 3300047445 | Bacteria | 1596 |
| 773 | Ga0495677_0051784 | 3300047445 | Bacteria | 1512 |
| 774 | Ga0495685_197201 | 3300047447 | Bacteria | 646 |
| 775 | Ga0495685_198761 | 3300047447 | Bacteria | 643 |
| 776 | Ga0496100_0099324 | 3300048903 | Bacteria | 2003 |
| 777 | Ga0496100_1105223 | 3300048903 | Bacteria | 625 |
| 778 | Ga0496101_0775627 | 3300048904 | Bacteria | 756 |
| 779 | Ga0496101_0940404 | 3300048904 | Bacteria | 680 |
| 780 | Ga0496102_0116691 | 3300048905 | Bacteria | 2491 |
| 781 | Ga0496102_0565731 | 3300048905 | Bacteria | 1059 |
| 782 | Ga0496103_0007362 | 3300048906 | Bacteria | 6560 |
| 783 | Ga0496103_0209985 | 3300048906 | Bacteria | 1252 |
| 784 | Ga0496103_0254231 | 3300048906 | Bacteria | 1131 |
| 785 | Ga0496104_0166791 | 3300048907 | Bacteria | 2112 |
| 786 | Ga0496104_0623810 | 3300048907 | Bacteria | 988 |
| 787 | Ga0496104_1089069 | 3300048907 | Bacteria | 703 |
| 788 | Ga0496104_1108729 | 3300048907 | Unclassified | 695 |
| 789 | Ga0496105_0251475 | 3300048908 | Bacteria | 1432 |
| 790 | Ga0496105_0787608 | 3300048908 | Bacteria | 724 |
| 791 | Ga0496105_1217246 | 3300048908 | Bacteria | 554 |
| 792 | Ga0496106_0482926 | 3300048909 | Unclassified | 995 |
| 793 | Ga0496107_0043298 | 3300048910 | Bacteria | 3234 |
| 794 | Ga0496107_0149558 | 3300048910 | Bacteria | 1727 |
| 795 | Ga0496107_0488575 | 3300048910 | Bacteria | 913 |
| 796 | Ga0496107_0883511 | 3300048910 | Bacteria | 652 |
| 797 | Ga0496108_0010565 | 3300048911 | Bacteria | 7495 |
| 798 | Ga0496108_0039973 | 3300048911 | Bacteria | 3908 |
| 799 | Ga0496108_0906935 | 3300048911 | Bacteria | 756 |
| 800 | Ga0496109_0008469 | 3300048912 | Bacteria | 8743 |
| 801 | Ga0496109_0045704 | 3300048912 | Bacteria | 3974 |
| 802 | Ga0496109_1858705 | 3300048912 | Bacteria | 535 |
| 803 | Ga0496110_0002515 | 3300048913 | Bacteria | 13774 |
| 804 | Ga0496110_0023537 | 3300048913 | Bacteria | 5240 |
| 805 | Ga0496110_0070841 | 3300048913 | Bacteria | 3090 |
| 806 | Ga0496110_0475117 | 3300048913 | Bacteria | 1139 |
| 807 | Ga0496111_0003916 | 3300048914 | Bacteria | 9331 |
| 808 | Ga0496111_0007201 | 3300048914 | Bacteria | 7273 |
| 809 | Ga0496111_0063305 | 3300048914 | Bacteria | 2682 |
| 810 | Ga0496112_0003787 | 3300048915 | Bacteria | 12636 |
| 811 | Ga0496112_0066201 | 3300048915 | Bacteria | 3565 |
| 812 | Ga0496112_0067093 | 3300048915 | Bacteria | 3540 |
| 813 | Ga0496112_0756531 | 3300048915 | Bacteria | 898 |
| 814 | Ga0496112_0876435 | 3300048915 | Bacteria | 820 |
| 815 | Ga0496112_0940316 | 3300048915 | Bacteria | 785 |
| 816 | Ga0496113_0002425 | 3300048916 | Bacteria | 10840 |
| 817 | Ga0501067_0033983 | 3300049583 | Bacteria | 2830 |
| 818 | Ga0501067_0826484 | 3300049583 | Bacteria | 522 |
| 819 | Ga0501068_0876301 | 3300049584 | Bacteria | 590 |
| 820 | Ga0501069_0486446 | 3300049585 | Bacteria | 735 |
| 821 | Ga0501202_039918 | 3300049652 | Bacteria | 1010 |
| 822 | Ga0501207_106283 | 3300049654 | Bacteria | 569 |
| 823 | Ga0501209_021727 | 3300049656 | Bacteria | 1530 |
| 824 | Ga0501216_191078 | 3300049660 | Bacteria | 503 |
| 825 | Ga0501235_010718 | 3300049669 | Bacteria | 2004 |
| 826 | Ga0501235_037664 | 3300049669 | Bacteria | 1101 |
| 827 | Ga0501242_014640 | 3300049674 | Bacteria | 972 |
| 828 | Ga0501253_123161 | 3300049683 | Bacteria | 630 |
| 829 | Ga0501257_041658 | 3300049686 | Unclassified | 1129 |
| 830 | Ga0501258_061312 | 3300049687 | Bacteria | 544 |
| 831 | Ga0501259_206948 | 3300049688 | Bacteria | 504 |
| 832 | Ga0501221_012393 | 3300049704 | Bacteria | 1551 |
| 833 | Ga0501221_216071 | 3300049704 | Bacteria | 539 |
| 834 | Ga0501225_0041815 | 3300049705 | Bacteria | 1265 |
| 835 | Ga0501225_0345578 | 3300049705 | Bacteria | 514 |
| 836 | Ga0501268_008468 | 3300049765 | Bacteria | 1559 |
| 837 | Ga0501272_023855 | 3300049769 | Bacteria | 747 |
| 838 | Ga0501273_030918 | 3300049770 | Bacteria | 762 |
| 839 | Ga0501279_078600 | 3300049775 | Bacteria | 566 |
| 840 | nmdc:mga05p37_1177585_c1 | 3300050507 | Bacteria | 794 |
| 841 | nmdc:mga09592_161265_c1 | 3300050508 | Bacteria | 1937 |
| 842 | nmdc:mga09592_971207_c1 | 3300050508 | Bacteria | 711 |
| 843 | nmdc:mga08y16_133627_c1 | 3300050511 | Bacteria | 2579 |
| 844 | nmdc:mga08y16_752069_c1 | 3300050511 | Bacteria | 971 |
| 845 | nmdc:mga0n895_1974672_c1 | 3300050512 | Bacteria | 541 |
| 846 | nmdc:mga0rr50_1018523_c1 | 3300050513 | Bacteria | 705 |
| 847 | nmdc:mga0sz30_152865_c1 | 3300050516 | Unclassified | 1021 |
| 848 | Ga0500658_0000041 | 3300053134 | Bacteria | 77435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0408229 | Ga0466965_0408229_14_232 | 58 |
| 2 | 3300005335 | Ga0070666_10275760 | Ga0070666_102757603 | 65 |
| 3 | 3300005355 | Ga0070671_100059877 | Ga0070671_1000598773 | 65 |
| 4 | 3300005367 | Ga0070667_100319020 | Ga0070667_1003190203 | 65 |
| 5 | 3300006358 | Ga0068871_100815928 | Ga0068871_1008159282 | 65 |
| 6 | 3300013102 | Ga0157371_10409949 | Ga0157371_104099492 | 65 |
| 7 | 3300048905 | Ga0496102_0116691 | Ga0496102_0116691_1250_1465 | 65 |
| 8 | 3300048906 | Ga0496103_0209985 | Ga0496103_0209985_188_403 | 65 |
| 9 | 3300048907 | Ga0496104_1108729 | Ga0496104_1108729_220_435 | 65 |
| 10 | 3300048908 | Ga0496105_0787608 | Ga0496105_0787608_81_296 | 65 |
| 11 | 3300005563 | Ga0068855_102509242 | Ga0068855_1025092422 | 66 |
| 12 | 3300009177 | Ga0105248_11529196 | Ga0105248_115291962 | 66 |
| 13 | 3300025918 | Ga0207662_10033903 | Ga0207662_100339037 | 66 |
| 14 | 3300031852 | Ga0307410_10437324 | Ga0307410_104373242 | 66 |
| 15 | 3300032004 | Ga0307414_10332344 | Ga0307414_103323443 | 66 |
| 16 | 3300001904 | JGI24736J21556_1063138 | JGI24736J21556_10631382 | 67 |
| 17 | 3300001989 | JGI24739J22299_10153601 | JGI24739J22299_101536012 | 67 |
| 18 | 3300001990 | JGI24737J22298_10032027 | JGI24737J22298_100320271 | 67 |
| 19 | 3300002067 | JGI24735J21928_10018161 | JGI24735J21928_100181612 | 67 |
| 20 | 3300005331 | Ga0070670_100090749 | Ga0070670_1000907491 | 67 |
| 21 | 3300005331 | Ga0070670_100116328 | Ga0070670_1001163282 | 67 |
| 22 | 3300005331 | Ga0070670_101999614 | Ga0070670_1019996141 | 67 |
| 23 | 3300005339 | Ga0070660_100075646 | Ga0070660_1000756463 | 67 |
| 24 | 3300005339 | Ga0070660_100212206 | Ga0070660_1002122063 | 67 |
| 25 | 3300005341 | Ga0070691_10114126 | Ga0070691_101141262 | 67 |
| 26 | 3300005345 | Ga0070692_11177350 | Ga0070692_111773502 | 67 |
| 27 | 3300005355 | Ga0070671_100027435 | Ga0070671_1000274352 | 67 |
| 28 | 3300005355 | Ga0070671_100066201 | Ga0070671_1000662015 | 67 |
| 29 | 3300005356 | Ga0070674_100011647 | Ga0070674_1000116477 | 67 |
| 30 | 3300005364 | Ga0070673_100022961 | Ga0070673_1000229612 | 67 |
| 31 | 3300005366 | Ga0070659_100014006 | Ga0070659_1000140064 | 67 |
| 32 | 3300005457 | Ga0070662_100008232 | Ga0070662_1000082324 | 67 |
| 33 | 3300005458 | Ga0070681_10034249 | Ga0070681_100342493 | 67 |
| 34 | 3300005539 | Ga0068853_101672803 | Ga0068853_1016728032 | 67 |
| 35 | 3300005546 | Ga0070696_100222395 | Ga0070696_1002223952 | 67 |
| 36 | 3300005547 | Ga0070693_100118954 | Ga0070693_1001189542 | 67 |
| 37 | 3300005564 | Ga0070664_100007027 | Ga0070664_10000702712 | 67 |
| 38 | 3300005564 | Ga0070664_100662015 | Ga0070664_1006620152 | 67 |
| 39 | 3300005564 | Ga0070664_100734325 | Ga0070664_1007343252 | 67 |
| 40 | 3300005577 | Ga0068857_100033123 | Ga0068857_1000331239 | 67 |
| 41 | 3300005578 | Ga0068854_100035685 | Ga0068854_1000356852 | 67 |
| 42 | 3300005614 | Ga0068856_100134549 | Ga0068856_1001345495 | 67 |
| 43 | 3300005616 | Ga0068852_100330037 | Ga0068852_1003300372 | 67 |
| 44 | 3300005618 | Ga0068864_100025846 | Ga0068864_1000258462 | 67 |
| 45 | 3300005834 | Ga0068851_10357712 | Ga0068851_103577122 | 67 |
| 46 | 3300005841 | Ga0068863_100035175 | Ga0068863_1000351752 | 67 |
| 47 | 3300005841 | Ga0068863_101286743 | Ga0068863_1012867432 | 67 |
| 48 | 3300005842 | Ga0068858_100589575 | Ga0068858_1005895752 | 67 |
| 49 | 3300005985 | Ga0081539_10024274 | Ga0081539_100242742 | 67 |
| 50 | 3300005985 | Ga0081539_10111840 | Ga0081539_101118402 | 67 |
| 51 | 3300006358 | Ga0068871_100198259 | Ga0068871_1001982593 | 67 |
| 52 | 3300009148 | Ga0105243_12705856 | Ga0105243_127058562 | 67 |
| 53 | 3300009177 | Ga0105248_10136957 | Ga0105248_101369572 | 67 |
| 54 | 3300012512 | Ga0157327_1033179 | Ga0157327_10331792 | 67 |
| 55 | 3300013100 | Ga0157373_10606145 | Ga0157373_106061452 | 67 |
| 56 | 3300013102 | Ga0157371_11300961 | Ga0157371_113009612 | 67 |
| 57 | 3300013306 | Ga0163162_10081734 | Ga0163162_100817345 | 67 |
| 58 | 3300013307 | Ga0157372_11074758 | Ga0157372_110747582 | 67 |
| 59 | 3300013307 | Ga0157372_12610635 | Ga0157372_126106352 | 67 |
| 60 | 3300013308 | Ga0157375_10396925 | Ga0157375_103969252 | 67 |
| 61 | 3300025909 | Ga0207705_10924239 | Ga0207705_109242392 | 67 |
| 62 | 3300025917 | Ga0207660_11613543 | Ga0207660_116135432 | 67 |
| 63 | 3300025919 | Ga0207657_10044314 | Ga0207657_100443142 | 67 |
| 64 | 3300025920 | Ga0207649_10017923 | Ga0207649_100179235 | 67 |
| 65 | 3300025925 | Ga0207650_10048831 | Ga0207650_100488312 | 67 |
| 66 | 3300025925 | Ga0207650_10984972 | Ga0207650_109849722 | 67 |
| 67 | 3300025932 | Ga0207690_10098069 | Ga0207690_100980694 | 67 |
| 68 | 3300025949 | Ga0207667_10719321 | Ga0207667_107193212 | 67 |
| 69 | 3300025972 | Ga0207668_11726148 | Ga0207668_117261482 | 67 |
| 70 | 3300026067 | Ga0207678_10856055 | Ga0207678_108560552 | 67 |
| 71 | 3300026078 | Ga0207702_10809414 | Ga0207702_108094142 | 67 |
| 72 | 3300026116 | Ga0207674_10066032 | Ga0207674_100660322 | 67 |
| 73 | 3300031731 | Ga0307405_10173684 | Ga0307405_101736842 | 67 |
| 74 | 3300031824 | Ga0307413_10008886 | Ga0307413_100088869 | 67 |
| 75 | 3300031824 | Ga0307413_12193465 | Ga0307413_121934652 | 67 |
| 76 | 3300031852 | Ga0307410_10058215 | Ga0307410_100582152 | 67 |
| 77 | 3300031852 | Ga0307410_11670068 | Ga0307410_116700682 | 67 |
| 78 | 3300031901 | Ga0307406_10309011 | Ga0307406_103090112 | 67 |
| 79 | 3300031903 | Ga0307407_10397250 | Ga0307407_103972502 | 67 |
| 80 | 3300031911 | Ga0307412_10714590 | Ga0307412_107145902 | 67 |
| 81 | 3300031995 | Ga0307409_100215525 | Ga0307409_1002155252 | 67 |
| 82 | 3300031995 | Ga0307409_102175955 | Ga0307409_1021759552 | 67 |
| 83 | 3300032002 | Ga0307416_100011951 | Ga0307416_1000119519 | 67 |
| 84 | 3300032004 | Ga0307414_10189122 | Ga0307414_101891222 | 67 |
| 85 | 3300032005 | Ga0307411_10256952 | Ga0307411_102569523 | 67 |
| 86 | 3300032126 | Ga0307415_100058166 | Ga0307415_1000581662 | 67 |
| 87 | 3300037418 | Ga0395900_0353400 | Ga0395900_0353400_821_1033 | 67 |
| 88 | 3300037471 | Ga0395905_0775783 | Ga0395905_0775783_561_773 | 67 |
| 89 | 3300037471 | Ga0395905_1627359 | Ga0395905_1627359_329_535 | 67 |
| 90 | 3300046684 | Ga0495669_0042121 | Ga0495669_0042121_1717_1935 | 67 |
| 91 | 3300048905 | Ga0496102_0565731 | Ga0496102_0565731_306_518 | 67 |
| 92 | 3300048907 | Ga0496104_0623810 | Ga0496104_0623810_381_593 | 67 |
| 93 | 3300048913 | Ga0496110_0475117 | Ga0496110_0475117_493_705 | 67 |
| 94 | 3300048915 | Ga0496112_0876435 | Ga0496112_0876435_240_452 | 67 |
| 95 | 3300049669 | Ga0501235_037664 | Ga0501235_037664_452_667 | 67 |
| 96 | 3300049705 | Ga0501225_0345578 | Ga0501225_0345578_275_490 | 67 |
| 97 | 3300001979 | JGI24740J21852_10136104 | JGI24740J21852_101361042 | 68 |
| 98 | 3300001990 | JGI24737J22298_10246022 | JGI24737J22298_102460222 | 68 |
| 99 | 3300002067 | JGI24735J21928_10008884 | JGI24735J21928_100088845 | 68 |
| 100 | 3300003323 | rootH1_10233400 | rootH1_102334003 | 68 |
| 101 | 3300005327 | Ga0070658_10048462 | Ga0070658_100484622 | 68 |
| 102 | 3300005327 | Ga0070658_10374215 | Ga0070658_103742152 | 68 |
| 103 | 3300005327 | Ga0070658_10712416 | Ga0070658_107124162 | 68 |
| 104 | 3300005327 | Ga0070658_10756568 | Ga0070658_107565682 | 68 |
| 105 | 3300005327 | Ga0070658_11312374 | Ga0070658_113123742 | 68 |
| 106 | 3300005328 | Ga0070676_10104474 | Ga0070676_101044744 | 68 |
| 107 | 3300005328 | Ga0070676_10348171 | Ga0070676_103481712 | 68 |
| 108 | 3300005329 | Ga0070683_100096580 | Ga0070683_1000965803 | 68 |
| 109 | 3300005329 | Ga0070683_101118406 | Ga0070683_1011184062 | 68 |
| 110 | 3300005330 | Ga0070690_100557112 | Ga0070690_1005571121 | 68 |
| 111 | 3300005331 | Ga0070670_100008324 | Ga0070670_1000083247 | 68 |
| 112 | 3300005331 | Ga0070670_100257627 | Ga0070670_1002576272 | 68 |
| 113 | 3300005333 | Ga0070677_10555225 | Ga0070677_105552252 | 68 |
| 114 | 3300005334 | Ga0068869_100567022 | Ga0068869_1005670222 | 68 |
| 115 | 3300005335 | Ga0070666_10532349 | Ga0070666_105323492 | 68 |
| 116 | 3300005336 | Ga0070680_100260887 | Ga0070680_1002608873 | 68 |
| 117 | 3300005336 | Ga0070680_100324275 | Ga0070680_1003242753 | 68 |
| 118 | 3300005336 | Ga0070680_101666829 | Ga0070680_1016668292 | 68 |
| 119 | 3300005337 | Ga0070682_100203586 | Ga0070682_1002035863 | 68 |
| 120 | 3300005339 | Ga0070660_100059424 | Ga0070660_1000594242 | 68 |
| 121 | 3300005339 | Ga0070660_100078186 | Ga0070660_1000781862 | 68 |
| 122 | 3300005339 | Ga0070660_100358965 | Ga0070660_1003589652 | 68 |
| 123 | 3300005339 | Ga0070660_100574384 | Ga0070660_1005743842 | 68 |
| 124 | 3300005339 | Ga0070660_101366808 | Ga0070660_1013668082 | 68 |
| 125 | 3300005344 | Ga0070661_100009966 | Ga0070661_1000099662 | 68 |
| 126 | 3300005344 | Ga0070661_100243216 | Ga0070661_1002432163 | 68 |
| 127 | 3300005344 | Ga0070661_100876166 | Ga0070661_1008761662 | 68 |
| 128 | 3300005344 | Ga0070661_100980028 | Ga0070661_1009800282 | 68 |
| 129 | 3300005345 | Ga0070692_10043292 | Ga0070692_100432923 | 68 |
| 130 | 3300005347 | Ga0070668_100136264 | Ga0070668_1001362642 | 68 |
| 131 | 3300005354 | Ga0070675_102013202 | Ga0070675_1020132021 | 68 |
| 132 | 3300005355 | Ga0070671_100002896 | Ga0070671_1000028968 | 68 |
| 133 | 3300005355 | Ga0070671_100003087 | Ga0070671_10000308715 | 68 |
| 134 | 3300005355 | Ga0070671_100059138 | Ga0070671_1000591382 | 68 |
| 135 | 3300005355 | Ga0070671_100178201 | Ga0070671_1001782012 | 68 |
| 136 | 3300005356 | Ga0070674_100097187 | Ga0070674_1000971874 | 68 |
| 137 | 3300005356 | Ga0070674_100119938 | Ga0070674_1001199383 | 68 |
| 138 | 3300005364 | Ga0070673_100104094 | Ga0070673_1001040942 | 68 |
| 139 | 3300005364 | Ga0070673_102318906 | Ga0070673_1023189061 | 68 |
| 140 | 3300005366 | Ga0070659_100006023 | Ga0070659_10000602312 | 68 |
| 141 | 3300005366 | Ga0070659_100030454 | Ga0070659_1000304542 | 68 |
| 142 | 3300005366 | Ga0070659_100174859 | Ga0070659_1001748592 | 68 |
| 143 | 3300005366 | Ga0070659_100223854 | Ga0070659_1002238542 | 68 |
| 144 | 3300005367 | Ga0070667_100011528 | Ga0070667_1000115282 | 68 |
| 145 | 3300005367 | Ga0070667_101816406 | Ga0070667_1018164061 | 68 |
| 146 | 3300005406 | Ga0070703_10528058 | Ga0070703_105280581 | 68 |
| 147 | 3300005455 | Ga0070663_100080310 | Ga0070663_1000803102 | 68 |
| 148 | 3300005455 | Ga0070663_100138820 | Ga0070663_1001388202 | 68 |
| 149 | 3300005455 | Ga0070663_100492254 | Ga0070663_1004922541 | 68 |
| 150 | 3300005455 | Ga0070663_100568611 | Ga0070663_1005686112 | 68 |
| 151 | 3300005455 | Ga0070663_100587933 | Ga0070663_1005879332 | 68 |
| 152 | 3300005455 | Ga0070663_100828172 | Ga0070663_1008281721 | 68 |
| 153 | 3300005455 | Ga0070663_101177204 | Ga0070663_1011772042 | 68 |
| 154 | 3300005456 | Ga0070678_100003214 | Ga0070678_1000032147 | 68 |
| 155 | 3300005456 | Ga0070678_100052107 | Ga0070678_1000521074 | 68 |
| 156 | 3300005457 | Ga0070662_100027862 | Ga0070662_1000278622 | 68 |
| 157 | 3300005457 | Ga0070662_100047133 | Ga0070662_1000471334 | 68 |
| 158 | 3300005457 | Ga0070662_100050854 | Ga0070662_1000508543 | 68 |
| 159 | 3300005457 | Ga0070662_100116544 | Ga0070662_1001165442 | 68 |
| 160 | 3300005457 | Ga0070662_100149126 | Ga0070662_1001491263 | 68 |
| 161 | 3300005457 | Ga0070662_100955457 | Ga0070662_1009554572 | 68 |
| 162 | 3300005457 | Ga0070662_101449773 | Ga0070662_1014497732 | 68 |
| 163 | 3300005458 | Ga0070681_10216233 | Ga0070681_102162332 | 68 |
| 164 | 3300005458 | Ga0070681_10244658 | Ga0070681_102446582 | 68 |
| 165 | 3300005459 | Ga0068867_100003727 | Ga0068867_10000372715 | 68 |
| 166 | 3300005459 | Ga0068867_100011300 | Ga0068867_10001130010 | 68 |
| 167 | 3300005467 | Ga0070706_100209129 | Ga0070706_1002091294 | 68 |
| 168 | 3300005530 | Ga0070679_100336185 | Ga0070679_1003361852 | 68 |
| 169 | 3300005530 | Ga0070679_100974055 | Ga0070679_1009740552 | 68 |
| 170 | 3300005530 | Ga0070679_101247843 | Ga0070679_1012478432 | 68 |
| 171 | 3300005530 | Ga0070679_101520204 | Ga0070679_1015202042 | 68 |
| 172 | 3300005535 | Ga0070684_100433456 | Ga0070684_1004334563 | 68 |
| 173 | 3300005539 | Ga0068853_100050171 | Ga0068853_1000501712 | 68 |
| 174 | 3300005539 | Ga0068853_100487239 | Ga0068853_1004872393 | 68 |
| 175 | 3300005539 | Ga0068853_100888068 | Ga0068853_1008880682 | 68 |
| 176 | 3300005543 | Ga0070672_100431764 | Ga0070672_1004317643 | 68 |
| 177 | 3300005543 | Ga0070672_100866842 | Ga0070672_1008668422 | 68 |
| 178 | 3300005545 | Ga0070695_100011170 | Ga0070695_1000111702 | 68 |
| 179 | 3300005546 | Ga0070696_100020112 | Ga0070696_1000201129 | 68 |
| 180 | 3300005547 | Ga0070693_100092633 | Ga0070693_1000926334 | 68 |
| 181 | 3300005548 | Ga0070665_100000785 | Ga0070665_1000007852 | 68 |
| 182 | 3300005548 | Ga0070665_100079619 | Ga0070665_1000796197 | 68 |
| 183 | 3300005548 | Ga0070665_100374571 | Ga0070665_1003745712 | 68 |
| 184 | 3300005563 | Ga0068855_100229792 | Ga0068855_1002297921 | 68 |
| 185 | 3300005563 | Ga0068855_100394417 | Ga0068855_1003944172 | 68 |
| 186 | 3300005563 | Ga0068855_100429950 | Ga0068855_1004299503 | 68 |
| 187 | 3300005563 | Ga0068855_101975258 | Ga0068855_1019752582 | 68 |
| 188 | 3300005564 | Ga0070664_100003416 | Ga0070664_10000341613 | 68 |
| 189 | 3300005564 | Ga0070664_100100671 | Ga0070664_1001006712 | 68 |
| 190 | 3300005564 | Ga0070664_100215194 | Ga0070664_1002151942 | 68 |
| 191 | 3300005564 | Ga0070664_100358586 | Ga0070664_1003585862 | 68 |
| 192 | 3300005564 | Ga0070664_100534784 | Ga0070664_1005347842 | 68 |
| 193 | 3300005577 | Ga0068857_100006626 | Ga0068857_1000066262 | 68 |
| 194 | 3300005577 | Ga0068857_100010757 | Ga0068857_1000107573 | 68 |
| 195 | 3300005577 | Ga0068857_100213748 | Ga0068857_1002137483 | 68 |
| 196 | 3300005578 | Ga0068854_100046422 | Ga0068854_1000464222 | 68 |
| 197 | 3300005578 | Ga0068854_100136917 | Ga0068854_1001369172 | 68 |
| 198 | 3300005578 | Ga0068854_100787303 | Ga0068854_1007873032 | 68 |
| 199 | 3300005578 | Ga0068854_102132559 | Ga0068854_1021325592 | 68 |
| 200 | 3300005614 | Ga0068856_100758017 | Ga0068856_1007580173 | 68 |
| 201 | 3300005614 | Ga0068856_101175507 | Ga0068856_1011755072 | 68 |
| 202 | 3300005616 | Ga0068852_100122539 | Ga0068852_1001225393 | 68 |
| 203 | 3300005616 | Ga0068852_100323390 | Ga0068852_1003233903 | 68 |
| 204 | 3300005617 | Ga0068859_100243984 | Ga0068859_1002439843 | 68 |
| 205 | 3300005617 | Ga0068859_101729035 | Ga0068859_1017290352 | 68 |
| 206 | 3300005618 | Ga0068864_100015969 | Ga0068864_1000159699 | 68 |
| 207 | 3300005618 | Ga0068864_100271429 | Ga0068864_1002714294 | 68 |
| 208 | 3300005618 | Ga0068864_100544848 | Ga0068864_1005448482 | 68 |
| 209 | 3300005618 | Ga0068864_100733877 | Ga0068864_1007338773 | 68 |
| 210 | 3300005618 | Ga0068864_101207447 | Ga0068864_1012074472 | 68 |
| 211 | 3300005834 | Ga0068851_10009479 | Ga0068851_100094792 | 68 |
| 212 | 3300005834 | Ga0068851_10084160 | Ga0068851_100841602 | 68 |
| 213 | 3300005834 | Ga0068851_10118403 | Ga0068851_101184033 | 68 |
| 214 | 3300005841 | Ga0068863_100003894 | Ga0068863_1000038946 | 68 |
| 215 | 3300005842 | Ga0068858_101391846 | Ga0068858_1013918462 | 68 |
| 216 | 3300005843 | Ga0068860_100194469 | Ga0068860_1001944693 | 68 |
| 217 | 3300005843 | Ga0068860_102115491 | Ga0068860_1021154912 | 68 |
| 218 | 3300005844 | Ga0068862_100516465 | Ga0068862_1005164653 | 68 |
| 219 | 3300006186 | Ga0075369_10166144 | Ga0075369_101661443 | 68 |
| 220 | 3300006237 | Ga0097621_100012388 | Ga0097621_1000123889 | 68 |
| 221 | 3300006237 | Ga0097621_100751589 | Ga0097621_1007515893 | 68 |
| 222 | 3300006358 | Ga0068871_100018700 | Ga0068871_1000187006 | 68 |
| 223 | 3300006358 | Ga0068871_101288497 | Ga0068871_1012884972 | 68 |
| 224 | 3300006358 | Ga0068871_101368608 | Ga0068871_1013686082 | 68 |
| 225 | 3300006844 | Ga0075428_101641064 | Ga0075428_1016410642 | 68 |
| 226 | 3300006880 | Ga0075429_100210845 | Ga0075429_1002108452 | 68 |
| 227 | 3300006881 | Ga0068865_100090054 | Ga0068865_1000900544 | 68 |
| 228 | 3300006931 | Ga0097620_100243965 | Ga0097620_1002439653 | 68 |
| 229 | 3300006931 | Ga0097620_101728715 | Ga0097620_1017287152 | 68 |
| 230 | 3300009011 | Ga0105251_10038441 | Ga0105251_100384415 | 68 |
| 231 | 3300009094 | Ga0111539_10058536 | Ga0111539_100585362 | 68 |
| 232 | 3300009098 | Ga0105245_12591162 | Ga0105245_125911622 | 68 |
| 233 | 3300009101 | Ga0105247_10115081 | Ga0105247_101150812 | 68 |
| 234 | 3300009174 | Ga0105241_10065092 | Ga0105241_100650922 | 68 |
| 235 | 3300009177 | Ga0105248_10012350 | Ga0105248_100123505 | 68 |
| 236 | 3300009177 | Ga0105248_10165154 | Ga0105248_101651542 | 68 |
| 237 | 3300009177 | Ga0105248_11481423 | Ga0105248_114814232 | 68 |
| 238 | 3300009177 | Ga0105248_13149114 | Ga0105248_131491142 | 68 |
| 239 | 3300009545 | Ga0105237_10027499 | Ga0105237_100274992 | 68 |
| 240 | 3300009551 | Ga0105238_10262621 | Ga0105238_102626213 | 68 |
| 241 | 3300009551 | Ga0105238_10397575 | Ga0105238_103975752 | 68 |
| 242 | 3300010375 | Ga0105239_12964624 | Ga0105239_129646242 | 68 |
| 243 | 3300011119 | Ga0105246_10485246 | Ga0105246_104852463 | 68 |
| 244 | 3300012497 | Ga0157319_1021488 | Ga0157319_10214882 | 68 |
| 245 | 3300012512 | Ga0157327_1052598 | Ga0157327_10525982 | 68 |
| 246 | 3300013100 | Ga0157373_10281258 | Ga0157373_102812583 | 68 |
| 247 | 3300013100 | Ga0157373_10649093 | Ga0157373_106490932 | 68 |
| 248 | 3300013100 | Ga0157373_10828818 | Ga0157373_108288182 | 68 |
| 249 | 3300013100 | Ga0157373_11073364 | Ga0157373_110733642 | 68 |
| 250 | 3300013100 | Ga0157373_11556013 | Ga0157373_115560132 | 68 |
| 251 | 3300013102 | Ga0157371_10487610 | Ga0157371_104876102 | 68 |
| 252 | 3300013102 | Ga0157371_10529056 | Ga0157371_105290563 | 68 |
| 253 | 3300013104 | Ga0157370_10111211 | Ga0157370_101112112 | 68 |
| 254 | 3300013104 | Ga0157370_10201071 | Ga0157370_102010711 | 68 |
| 255 | 3300013105 | Ga0157369_10382418 | Ga0157369_103824182 | 68 |
| 256 | 3300013105 | Ga0157369_10590332 | Ga0157369_105903322 | 68 |
| 257 | 3300013296 | Ga0157374_12130581 | Ga0157374_121305812 | 68 |
| 258 | 3300013306 | Ga0163162_10589954 | Ga0163162_105899542 | 68 |
| 259 | 3300013306 | Ga0163162_10641825 | Ga0163162_106418253 | 68 |
| 260 | 3300013307 | Ga0157372_10142218 | Ga0157372_101422184 | 68 |
| 261 | 3300013307 | Ga0157372_10196510 | Ga0157372_101965102 | 68 |
| 262 | 3300013307 | Ga0157372_10935308 | Ga0157372_109353082 | 68 |
| 263 | 3300013307 | Ga0157372_10961001 | Ga0157372_109610011 | 68 |
| 264 | 3300013307 | Ga0157372_11960692 | Ga0157372_119606922 | 68 |
| 265 | 3300014325 | Ga0163163_10173671 | Ga0163163_101736713 | 68 |
| 266 | 3300014497 | Ga0182008_10045746 | Ga0182008_100457462 | 68 |
| 267 | 3300014745 | Ga0157377_10594837 | Ga0157377_105948372 | 68 |
| 268 | 3300014745 | Ga0157377_11726193 | Ga0157377_117261932 | 68 |
| 269 | 3300014968 | Ga0157379_10006649 | Ga0157379_100066496 | 68 |
| 270 | 3300017792 | Ga0163161_10160190 | Ga0163161_101601902 | 68 |
| 271 | 3300017792 | Ga0163161_11131492 | Ga0163161_111314922 | 68 |
| 272 | 3300021384 | Ga0213876_10361112 | Ga0213876_103611122 | 68 |
| 273 | 3300025315 | Ga0207697_10034932 | Ga0207697_100349322 | 68 |
| 274 | 3300025315 | Ga0207697_10392672 | Ga0207697_103926722 | 68 |
| 275 | 3300025321 | Ga0207656_10002893 | Ga0207656_100028932 | 68 |
| 276 | 3300025321 | Ga0207656_10256000 | Ga0207656_102560002 | 68 |
| 277 | 3300025321 | Ga0207656_10748480 | Ga0207656_107484801 | 68 |
| 278 | 3300025735 | Ga0207713_1207201 | Ga0207713_12072012 | 68 |
| 279 | 3300025893 | Ga0207682_10518707 | Ga0207682_105187072 | 68 |
| 280 | 3300025900 | Ga0207710_10068091 | Ga0207710_100680912 | 68 |
| 281 | 3300025903 | Ga0207680_10144651 | Ga0207680_101446512 | 68 |
| 282 | 3300025903 | Ga0207680_10843903 | Ga0207680_108439032 | 68 |
| 283 | 3300025904 | Ga0207647_10026662 | Ga0207647_100266624 | 68 |
| 284 | 3300025904 | Ga0207647_10046560 | Ga0207647_100465602 | 68 |
| 285 | 3300025904 | Ga0207647_10328211 | Ga0207647_103282112 | 68 |
| 286 | 3300025907 | Ga0207645_10332604 | Ga0207645_103326042 | 68 |
| 287 | 3300025908 | Ga0207643_10428470 | Ga0207643_104284703 | 68 |
| 288 | 3300025909 | Ga0207705_10024198 | Ga0207705_100241988 | 68 |
| 289 | 3300025909 | Ga0207705_10064531 | Ga0207705_100645312 | 68 |
| 290 | 3300025909 | Ga0207705_10086178 | Ga0207705_100861782 | 68 |
| 291 | 3300025909 | Ga0207705_10093412 | Ga0207705_100934122 | 68 |
| 292 | 3300025909 | Ga0207705_10105612 | Ga0207705_101056122 | 68 |
| 293 | 3300025909 | Ga0207705_10546995 | Ga0207705_105469952 | 68 |
| 294 | 3300025910 | Ga0207684_10278038 | Ga0207684_102780382 | 68 |
| 295 | 3300025911 | Ga0207654_10119268 | Ga0207654_101192683 | 68 |
| 296 | 3300025911 | Ga0207654_10249995 | Ga0207654_102499952 | 68 |
| 297 | 3300025912 | Ga0207707_10988102 | Ga0207707_109881022 | 68 |
| 298 | 3300025912 | Ga0207707_11599366 | Ga0207707_115993662 | 68 |
| 299 | 3300025914 | Ga0207671_10129455 | Ga0207671_101294554 | 68 |
| 300 | 3300025917 | Ga0207660_10073102 | Ga0207660_100731025 | 68 |
| 301 | 3300025919 | Ga0207657_10024029 | Ga0207657_100240293 | 68 |
| 302 | 3300025919 | Ga0207657_10159436 | Ga0207657_101594364 | 68 |
| 303 | 3300025919 | Ga0207657_10809192 | Ga0207657_108091922 | 68 |
| 304 | 3300025920 | Ga0207649_10007872 | Ga0207649_100078722 | 68 |
| 305 | 3300025920 | Ga0207649_11182494 | Ga0207649_111824942 | 68 |
| 306 | 3300025920 | Ga0207649_11476306 | Ga0207649_114763062 | 68 |
| 307 | 3300025921 | Ga0207652_10195944 | Ga0207652_101959442 | 68 |
| 308 | 3300025921 | Ga0207652_10539151 | Ga0207652_105391512 | 68 |
| 309 | 3300025923 | Ga0207681_10732046 | Ga0207681_107320461 | 68 |
| 310 | 3300025925 | Ga0207650_10081807 | Ga0207650_100818072 | 68 |
| 311 | 3300025925 | Ga0207650_10483622 | Ga0207650_104836222 | 68 |
| 312 | 3300025925 | Ga0207650_10858081 | Ga0207650_108580812 | 68 |
| 313 | 3300025926 | Ga0207659_10388818 | Ga0207659_103888182 | 68 |
| 314 | 3300025931 | Ga0207644_10009935 | Ga0207644_100099352 | 68 |
| 315 | 3300025931 | Ga0207644_10078292 | Ga0207644_100782925 | 68 |
| 316 | 3300025931 | Ga0207644_10377694 | Ga0207644_103776943 | 68 |
| 317 | 3300025931 | Ga0207644_10681091 | Ga0207644_106810912 | 68 |
| 318 | 3300025931 | Ga0207644_11223885 | Ga0207644_112238852 | 68 |
| 319 | 3300025932 | Ga0207690_10110271 | Ga0207690_101102714 | 68 |
| 320 | 3300025932 | Ga0207690_10150582 | Ga0207690_101505823 | 68 |
| 321 | 3300025932 | Ga0207690_10208131 | Ga0207690_102081314 | 68 |
| 322 | 3300025932 | Ga0207690_10301700 | Ga0207690_103017002 | 68 |
| 323 | 3300025933 | Ga0207706_10002920 | Ga0207706_100029203 | 68 |
| 324 | 3300025933 | Ga0207706_10016973 | Ga0207706_100169733 | 68 |
| 325 | 3300025933 | Ga0207706_10038549 | Ga0207706_100385494 | 68 |
| 326 | 3300025933 | Ga0207706_10073838 | Ga0207706_100738382 | 68 |
| 327 | 3300025933 | Ga0207706_10411954 | Ga0207706_104119542 | 68 |
| 328 | 3300025933 | Ga0207706_11265900 | Ga0207706_112659002 | 68 |
| 329 | 3300025933 | Ga0207706_11571973 | Ga0207706_115719732 | 68 |
| 330 | 3300025937 | Ga0207669_10090941 | Ga0207669_100909412 | 68 |
| 331 | 3300025937 | Ga0207669_10399535 | Ga0207669_103995353 | 68 |
| 332 | 3300025940 | Ga0207691_10140129 | Ga0207691_101401293 | 68 |
| 333 | 3300025940 | Ga0207691_10491554 | Ga0207691_104915542 | 68 |
| 334 | 3300025941 | Ga0207711_10032298 | Ga0207711_100322985 | 68 |
| 335 | 3300025941 | Ga0207711_10779090 | Ga0207711_107790902 | 68 |
| 336 | 3300025942 | Ga0207689_10150703 | Ga0207689_101507032 | 68 |
| 337 | 3300025942 | Ga0207689_11366308 | Ga0207689_113663082 | 68 |
| 338 | 3300025944 | Ga0207661_10799291 | Ga0207661_107992912 | 68 |
| 339 | 3300025945 | Ga0207679_10012302 | Ga0207679_100123022 | 68 |
| 340 | 3300025945 | Ga0207679_10168770 | Ga0207679_101687702 | 68 |
| 341 | 3300025945 | Ga0207679_10318644 | Ga0207679_103186443 | 68 |
| 342 | 3300025945 | Ga0207679_11062291 | Ga0207679_110622911 | 68 |
| 343 | 3300025949 | Ga0207667_10264237 | Ga0207667_102642371 | 68 |
| 344 | 3300025960 | Ga0207651_10727003 | Ga0207651_107270032 | 68 |
| 345 | 3300025960 | Ga0207651_10924344 | Ga0207651_109243442 | 68 |
| 346 | 3300025960 | Ga0207651_11442595 | Ga0207651_114425952 | 68 |
| 347 | 3300025972 | Ga0207668_10237129 | Ga0207668_102371292 | 68 |
| 348 | 3300025981 | Ga0207640_10035015 | Ga0207640_100350152 | 68 |
| 349 | 3300025981 | Ga0207640_10959695 | Ga0207640_109596952 | 68 |
| 350 | 3300025986 | Ga0207658_10004581 | Ga0207658_1000458110 | 68 |
| 351 | 3300026023 | Ga0207677_12248673 | Ga0207677_122486731 | 68 |
| 352 | 3300026041 | Ga0207639_10166842 | Ga0207639_101668422 | 68 |
| 353 | 3300026041 | Ga0207639_10655743 | Ga0207639_106557432 | 68 |
| 354 | 3300026067 | Ga0207678_10015045 | Ga0207678_100150455 | 68 |
| 355 | 3300026067 | Ga0207678_10181273 | Ga0207678_101812732 | 68 |
| 356 | 3300026067 | Ga0207678_10400274 | Ga0207678_104002742 | 68 |
| 357 | 3300026067 | Ga0207678_10583045 | Ga0207678_105830452 | 68 |
| 358 | 3300026078 | Ga0207702_10005600 | Ga0207702_100056009 | 68 |
| 359 | 3300026088 | Ga0207641_10073932 | Ga0207641_100739325 | 68 |
| 360 | 3300026088 | Ga0207641_11602943 | Ga0207641_116029432 | 68 |
| 361 | 3300026089 | Ga0207648_10013848 | Ga0207648_100138485 | 68 |
| 362 | 3300026089 | Ga0207648_10237468 | Ga0207648_102374683 | 68 |
| 363 | 3300026089 | Ga0207648_11899547 | Ga0207648_118995471 | 68 |
| 364 | 3300026095 | Ga0207676_10180833 | Ga0207676_101808334 | 68 |
| 365 | 3300026095 | Ga0207676_10248481 | Ga0207676_102484812 | 68 |
| 366 | 3300026095 | Ga0207676_11844958 | Ga0207676_118449582 | 68 |
| 367 | 3300026095 | Ga0207676_12231303 | Ga0207676_122313032 | 68 |
| 368 | 3300026116 | Ga0207674_10000308 | Ga0207674_100003087 | 68 |
| 369 | 3300026116 | Ga0207674_10002878 | Ga0207674_1000287815 | 68 |
| 370 | 3300026116 | Ga0207674_10009470 | Ga0207674_100094705 | 68 |
| 371 | 3300026116 | Ga0207674_10238069 | Ga0207674_102380693 | 68 |
| 372 | 3300026121 | Ga0207683_10024070 | Ga0207683_100240704 | 68 |
| 373 | 3300026121 | Ga0207683_10101882 | Ga0207683_101018822 | 68 |
| 374 | 3300026121 | Ga0207683_10114046 | Ga0207683_101140462 | 68 |
| 375 | 3300026142 | Ga0207698_10201097 | Ga0207698_102010973 | 68 |
| 376 | 3300026142 | Ga0207698_11056276 | Ga0207698_110562762 | 68 |
| 377 | 3300026142 | Ga0207698_11107684 | Ga0207698_111076842 | 68 |
| 378 | 3300028379 | Ga0268266_10000315 | Ga0268266_1000031543 | 68 |
| 379 | 3300028379 | Ga0268266_10732274 | Ga0268266_107322742 | 68 |
| 380 | 3300028379 | Ga0268266_10909639 | Ga0268266_109096392 | 68 |
| 381 | 3300028379 | Ga0268266_11579413 | Ga0268266_115794132 | 68 |
| 382 | 3300028381 | Ga0268264_11786100 | Ga0268264_117861002 | 68 |
| 383 | 3300031548 | Ga0307408_100401901 | Ga0307408_1004019012 | 68 |
| 384 | 3300031548 | Ga0307408_100724948 | Ga0307408_1007249482 | 68 |
| 385 | 3300031731 | Ga0307405_10604455 | Ga0307405_106044552 | 68 |
| 386 | 3300031731 | Ga0307405_11314789 | Ga0307405_113147892 | 68 |
| 387 | 3300031824 | Ga0307413_10090035 | Ga0307413_100900351 | 68 |
| 388 | 3300031824 | Ga0307413_10093811 | Ga0307413_100938112 | 68 |
| 389 | 3300031824 | Ga0307413_10214573 | Ga0307413_102145734 | 68 |
| 390 | 3300031824 | Ga0307413_10494498 | Ga0307413_104944983 | 68 |
| 391 | 3300031824 | Ga0307413_10570072 | Ga0307413_105700722 | 68 |
| 392 | 3300031852 | Ga0307410_10012027 | Ga0307410_100120273 | 68 |
| 393 | 3300031852 | Ga0307410_10153595 | Ga0307410_101535954 | 68 |
| 394 | 3300031852 | Ga0307410_10189258 | Ga0307410_101892582 | 68 |
| 395 | 3300031852 | Ga0307410_11381946 | Ga0307410_113819462 | 68 |
| 396 | 3300031901 | Ga0307406_10298540 | Ga0307406_102985402 | 68 |
| 397 | 3300031901 | Ga0307406_11731092 | Ga0307406_117310922 | 68 |
| 398 | 3300031903 | Ga0307407_10088709 | Ga0307407_100887092 | 68 |
| 399 | 3300031911 | Ga0307412_11029944 | Ga0307412_110299442 | 68 |
| 400 | 3300031911 | Ga0307412_11176782 | Ga0307412_111767822 | 68 |
| 401 | 3300031911 | Ga0307412_11534390 | Ga0307412_115343902 | 68 |
| 402 | 3300031995 | Ga0307409_100166809 | Ga0307409_1001668092 | 68 |
| 403 | 3300031995 | Ga0307409_100188014 | Ga0307409_1001880142 | 68 |
| 404 | 3300031995 | Ga0307409_100342244 | Ga0307409_1003422442 | 68 |
| 405 | 3300031995 | Ga0307409_101369310 | Ga0307409_1013693102 | 68 |
| 406 | 3300032002 | Ga0307416_100208353 | Ga0307416_1002083532 | 68 |
| 407 | 3300032002 | Ga0307416_100323553 | Ga0307416_1003235532 | 68 |
| 408 | 3300032002 | Ga0307416_100357784 | Ga0307416_1003577842 | 68 |
| 409 | 3300032002 | Ga0307416_100990658 | Ga0307416_1009906581 | 68 |
| 410 | 3300032004 | Ga0307414_10096978 | Ga0307414_100969781 | 68 |
| 411 | 3300032004 | Ga0307414_10276398 | Ga0307414_102763982 | 68 |
| 412 | 3300032005 | Ga0307411_10001276 | Ga0307411_100012767 | 68 |
| 413 | 3300032005 | Ga0307411_10032088 | Ga0307411_100320882 | 68 |
| 414 | 3300032005 | Ga0307411_10778678 | Ga0307411_107786783 | 68 |
| 415 | 3300032005 | Ga0307411_11013980 | Ga0307411_110139802 | 68 |
| 416 | 3300032005 | Ga0307411_11017938 | Ga0307411_110179382 | 68 |
| 417 | 3300032126 | Ga0307415_100042173 | Ga0307415_1000421732 | 68 |
| 418 | 3300032126 | Ga0307415_100150070 | Ga0307415_1001500702 | 68 |
| 419 | 3300032126 | Ga0307415_100541826 | Ga0307415_1005418262 | 68 |
| 420 | 3300034820 | Ga0373959_0140115 | Ga0373959_0140115_93_305 | 68 |
| 421 | 3300037312 | Ga0395899_0136060 | Ga0395899_0136060_19_234 | 68 |
| 422 | 3300037312 | Ga0395899_0432078 | Ga0395899_0432078_420_629 | 68 |
| 423 | 3300037312 | Ga0395899_0585588 | Ga0395899_0585588_11_226 | 68 |
| 424 | 3300037312 | Ga0395899_0875507 | Ga0395899_0875507_292_507 | 68 |
| 425 | 3300037418 | Ga0395900_0026676 | Ga0395900_0026676_1103_1318 | 68 |
| 426 | 3300037418 | Ga0395900_0083036 | Ga0395900_0083036_450_665 | 68 |
| 427 | 3300037418 | Ga0395900_0224583 | Ga0395900_0224583_564_779 | 68 |
| 428 | 3300037418 | Ga0395900_0323105 | Ga0395900_0323105_595_807 | 68 |
| 429 | 3300037418 | Ga0395900_0422645 | Ga0395900_0422645_781_990 | 68 |
| 430 | 3300037466 | Ga0395898_0059038 | Ga0395898_0059038_657_872 | 68 |
| 431 | 3300037471 | Ga0395905_0002116 | Ga0395905_0002116_17689_17898 | 68 |
| 432 | 3300037471 | Ga0395905_0045805 | Ga0395905_0045805_1434_1649 | 68 |
| 433 | 3300037471 | Ga0395905_0071455 | Ga0395905_0071455_737_952 | 68 |
| 434 | 3300037471 | Ga0395905_0218635 | Ga0395905_0218635_1103_1318 | 68 |
| 435 | 3300037471 | Ga0395905_0583364 | Ga0395905_0583364_387_602 | 68 |
| 436 | 3300037471 | Ga0395905_0638584 | Ga0395905_0638584_706_921 | 68 |
| 437 | 3300037471 | Ga0395905_1158123 | Ga0395905_1158123_100_309 | 68 |
| 438 | 3300038443 | Ga0395901_0059700 | Ga0395901_0059700_828_1037 | 68 |
| 439 | 3300038443 | Ga0395901_0114055 | Ga0395901_0114055_1190_1405 | 68 |
| 440 | 3300038443 | Ga0395901_0163469 | Ga0395901_0163469_812_1027 | 68 |
| 441 | 3300038443 | Ga0395901_0280439 | Ga0395901_0280439_289_504 | 68 |
| 442 | 3300038443 | Ga0395901_0356774 | Ga0395901_0356774_211_432 | 68 |
| 443 | 3300038443 | Ga0395901_1247514 | Ga0395901_1247514_66_287 | 68 |
| 444 | 3300038443 | Ga0395901_1986034 | Ga0395901_1986034_250_462 | 68 |
| 445 | 3300039437 | Ga0436365_1446270 | Ga0436365_1446270_532_744 | 68 |
| 446 | 3300041404 | Ga0439436_0092581 | Ga0439436_0092581_322_564 | 68 |
| 447 | 3300041407 | Ga0439447_080412 | Ga0439447_080412_200_442 | 68 |
| 448 | 3300041410 | Ga0439461_0113694 | Ga0439461_0113694_375_617 | 68 |
| 449 | 3300042127 | Ga0450890_003198 | Ga0450890_003198_607_834 | 68 |
| 450 | 3300042137 | Ga0450902_080904 | Ga0450902_080904_315_542 | 68 |
| 451 | 3300042142 | Ga0450905_001426 | Ga0450905_001426_2197_2424 | 68 |
| 452 | 3300042144 | Ga0450889_001073 | Ga0450889_001073_2452_2679 | 68 |
| 453 | 3300044658 | Ga0466972_0172332 | Ga0466972_0172332_33_248 | 68 |
| 454 | 3300044683 | Ga0466965_0869016 | Ga0466965_0869016_267_482 | 68 |
| 455 | 3300044842 | Ga0466957_1102527 | Ga0466957_1102527_26_244 | 68 |
| 456 | 3300044901 | Ga0466960_0079354 | Ga0466960_0079354_220_435 | 68 |
| 457 | 3300046525 | Ga0495663_0043479 | Ga0495663_0043479_1076_1288 | 68 |
| 458 | 3300046525 | Ga0495663_0097656 | Ga0495663_0097656_729_944 | 68 |
| 459 | 3300046684 | Ga0495669_0001299 | Ga0495669_0001299_1336_1548 | 68 |
| 460 | 3300047445 | Ga0495677_0051784 | Ga0495677_0051784_1107_1319 | 68 |
| 461 | 3300047447 | Ga0495685_198761 | Ga0495685_198761_287_499 | 68 |
| 462 | 3300048903 | Ga0496100_0099324 | Ga0496100_0099324_1352_1567 | 68 |
| 463 | 3300048904 | Ga0496101_0775627 | Ga0496101_0775627_43_255 | 68 |
| 464 | 3300048906 | Ga0496103_0007362 | Ga0496103_0007362_2112_2327 | 68 |
| 465 | 3300048906 | Ga0496103_0254231 | Ga0496103_0254231_701_913 | 68 |
| 466 | 3300048907 | Ga0496104_0166791 | Ga0496104_0166791_82_297 | 68 |
| 467 | 3300048907 | Ga0496104_1089069 | Ga0496104_1089069_252_470 | 68 |
| 468 | 3300048908 | Ga0496105_1217246 | Ga0496105_1217246_85_300 | 68 |
| 469 | 3300048910 | Ga0496107_0488575 | Ga0496107_0488575_234_449 | 68 |
| 470 | 3300048911 | Ga0496108_0010565 | Ga0496108_0010565_5364_5579 | 68 |
| 471 | 3300048911 | Ga0496108_0906935 | Ga0496108_0906935_431_652 | 68 |
| 472 | 3300048912 | Ga0496109_0008469 | Ga0496109_0008469_6387_6602 | 68 |
| 473 | 3300048912 | Ga0496109_1858705 | Ga0496109_1858705_300_515 | 68 |
| 474 | 3300048913 | Ga0496110_0023537 | Ga0496110_0023537_4990_5205 | 68 |
| 475 | 3300048913 | Ga0496110_0070841 | Ga0496110_0070841_86_295 | 68 |
| 476 | 3300048914 | Ga0496111_0007201 | Ga0496111_0007201_189_404 | 68 |
| 477 | 3300048914 | Ga0496111_0063305 | Ga0496111_0063305_64_279 | 68 |
| 478 | 3300048915 | Ga0496112_0003787 | Ga0496112_0003787_5055_5270 | 68 |
| 479 | 3300048915 | Ga0496112_0066201 | Ga0496112_0066201_1977_2198 | 68 |
| 480 | 3300048915 | Ga0496112_0756531 | Ga0496112_0756531_590_808 | 68 |
| 481 | 3300048916 | Ga0496113_0002425 | Ga0496113_0002425_8326_8541 | 68 |
| 482 | 3300049583 | Ga0501067_0033983 | Ga0501067_0033983_431_649 | 68 |
| 483 | 3300049583 | Ga0501067_0826484 | Ga0501067_0826484_165_374 | 68 |
| 484 | 3300049584 | Ga0501068_0876301 | Ga0501068_0876301_273_494 | 68 |
| 485 | 3300049585 | Ga0501069_0486446 | Ga0501069_0486446_434_652 | 68 |
| 486 | 3300050507 | nmdc:mga05p37_1177585_c1 | nmdc:mga05p37_1177585_c1_508_735 | 68 |
| 487 | 3300050508 | nmdc:mga09592_161265_c1 | nmdc:mga09592_161265_c1_1300_1527 | 68 |
| 488 | 3300050508 | nmdc:mga09592_971207_c1 | nmdc:mga09592_971207_c1_55_282 | 68 |
| 489 | 3300050511 | nmdc:mga08y16_133627_c1 | nmdc:mga08y16_133627_c1_264_491 | 68 |
| 490 | 3300050513 | nmdc:mga0rr50_1018523_c1 | nmdc:mga0rr50_1018523_c1_459_674 | 68 |
| 491 | 3300050516 | nmdc:mga0sz30_152865_c1 | nmdc:mga0sz30_152865_c1_456_665 | 68 |
| 492 | 3300005327 | Ga0070658_10139741 | Ga0070658_101397412 | 69 |
| 493 | 3300005328 | Ga0070676_10018872 | Ga0070676_100188724 | 69 |
| 494 | 3300005329 | Ga0070683_100697847 | Ga0070683_1006978472 | 69 |
| 495 | 3300005330 | Ga0070690_100987582 | Ga0070690_1009875821 | 69 |
| 496 | 3300005331 | Ga0070670_100831531 | Ga0070670_1008315312 | 69 |
| 497 | 3300005337 | Ga0070682_100354453 | Ga0070682_1003544532 | 69 |
| 498 | 3300005347 | Ga0070668_100112350 | Ga0070668_1001123502 | 69 |
| 499 | 3300005354 | Ga0070675_101475654 | Ga0070675_1014756542 | 69 |
| 500 | 3300005355 | Ga0070671_100380928 | Ga0070671_1003809283 | 69 |
| 501 | 3300005356 | Ga0070674_101731501 | Ga0070674_1017315012 | 69 |
| 502 | 3300005364 | Ga0070673_100371344 | Ga0070673_1003713442 | 69 |
| 503 | 3300005364 | Ga0070673_100696162 | Ga0070673_1006961622 | 69 |
| 504 | 3300005366 | Ga0070659_100015331 | Ga0070659_1000153319 | 69 |
| 505 | 3300005366 | Ga0070659_100551485 | Ga0070659_1005514852 | 69 |
| 506 | 3300005366 | Ga0070659_101140756 | Ga0070659_1011407561 | 69 |
| 507 | 3300005367 | Ga0070667_100116248 | Ga0070667_1001162482 | 69 |
| 508 | 3300005435 | Ga0070714_100038969 | Ga0070714_1000389692 | 69 |
| 509 | 3300005436 | Ga0070713_102276255 | Ga0070713_1022762551 | 69 |
| 510 | 3300005440 | Ga0070705_100248088 | Ga0070705_1002480882 | 69 |
| 511 | 3300005455 | Ga0070663_100138281 | Ga0070663_1001382812 | 69 |
| 512 | 3300005457 | Ga0070662_100753904 | Ga0070662_1007539042 | 69 |
| 513 | 3300005459 | Ga0068867_100301555 | Ga0068867_1003015552 | 69 |
| 514 | 3300005459 | Ga0068867_100500657 | Ga0068867_1005006572 | 69 |
| 515 | 3300005530 | Ga0070679_100582314 | Ga0070679_1005823141 | 69 |
| 516 | 3300005543 | Ga0070672_100476246 | Ga0070672_1004762462 | 69 |
| 517 | 3300005546 | Ga0070696_100004394 | Ga0070696_10000439413 | 69 |
| 518 | 3300005546 | Ga0070696_101372408 | Ga0070696_1013724081 | 69 |
| 519 | 3300005547 | Ga0070693_100017586 | Ga0070693_1000175868 | 69 |
| 520 | 3300005548 | Ga0070665_101738469 | Ga0070665_1017384692 | 69 |
| 521 | 3300005564 | Ga0070664_100005620 | Ga0070664_1000056205 | 69 |
| 522 | 3300005617 | Ga0068859_100031616 | Ga0068859_1000316162 | 69 |
| 523 | 3300005718 | Ga0068866_10098353 | Ga0068866_100983532 | 69 |
| 524 | 3300005719 | Ga0068861_100630403 | Ga0068861_1006304032 | 69 |
| 525 | 3300005834 | Ga0068851_10042686 | Ga0068851_100426862 | 69 |
| 526 | 3300005841 | Ga0068863_100282732 | Ga0068863_1002827322 | 69 |
| 527 | 3300005842 | Ga0068858_100433525 | Ga0068858_1004335253 | 69 |
| 528 | 3300005843 | Ga0068860_100027502 | Ga0068860_1000275027 | 69 |
| 529 | 3300005844 | Ga0068862_100041195 | Ga0068862_1000411954 | 69 |
| 530 | 3300005844 | Ga0068862_100638174 | Ga0068862_1006381742 | 69 |
| 531 | 3300005985 | Ga0081539_10215398 | Ga0081539_102153982 | 69 |
| 532 | 3300006028 | Ga0070717_10089264 | Ga0070717_100892644 | 69 |
| 533 | 3300006173 | Ga0070716_100392697 | Ga0070716_1003926972 | 69 |
| 534 | 3300006881 | Ga0068865_100632247 | Ga0068865_1006322473 | 69 |
| 535 | 3300006931 | Ga0097620_100031616 | Ga0097620_1000316162 | 69 |
| 536 | 3300009101 | Ga0105247_11764509 | Ga0105247_117645091 | 69 |
| 537 | 3300009148 | Ga0105243_10014560 | Ga0105243_100145602 | 69 |
| 538 | 3300009176 | Ga0105242_11004428 | Ga0105242_110044282 | 69 |
| 539 | 3300009177 | Ga0105248_10022027 | Ga0105248_100220279 | 69 |
| 540 | 3300009551 | Ga0105238_10619381 | Ga0105238_106193812 | 69 |
| 541 | 3300009553 | Ga0105249_10620954 | Ga0105249_106209542 | 69 |
| 542 | 3300013100 | Ga0157373_10115471 | Ga0157373_101154712 | 69 |
| 543 | 3300013100 | Ga0157373_10127536 | Ga0157373_101275362 | 69 |
| 544 | 3300013308 | Ga0157375_11058544 | Ga0157375_110585442 | 69 |
| 545 | 3300014326 | Ga0157380_10010723 | Ga0157380_100107234 | 69 |
| 546 | 3300014968 | Ga0157379_10866178 | Ga0157379_108661783 | 69 |
| 547 | 3300025321 | Ga0207656_10012184 | Ga0207656_100121842 | 69 |
| 548 | 3300025901 | Ga0207688_10842127 | Ga0207688_108421272 | 69 |
| 549 | 3300025907 | Ga0207645_10014320 | Ga0207645_100143204 | 69 |
| 550 | 3300025907 | Ga0207645_10287122 | Ga0207645_102871223 | 69 |
| 551 | 3300025909 | Ga0207705_10061994 | Ga0207705_100619943 | 69 |
| 552 | 3300025909 | Ga0207705_10385583 | Ga0207705_103855833 | 69 |
| 553 | 3300025919 | Ga0207657_10007272 | Ga0207657_100072724 | 69 |
| 554 | 3300025923 | Ga0207681_10005902 | Ga0207681_100059022 | 69 |
| 555 | 3300025923 | Ga0207681_10091891 | Ga0207681_100918914 | 69 |
| 556 | 3300025925 | Ga0207650_10700098 | Ga0207650_107000982 | 69 |
| 557 | 3300025926 | Ga0207659_11290601 | Ga0207659_112906012 | 69 |
| 558 | 3300025928 | Ga0207700_10051185 | Ga0207700_100511856 | 69 |
| 559 | 3300025929 | Ga0207664_10108634 | Ga0207664_101086342 | 69 |
| 560 | 3300025932 | Ga0207690_10024491 | Ga0207690_100244918 | 69 |
| 561 | 3300025932 | Ga0207690_10613980 | Ga0207690_106139802 | 69 |
| 562 | 3300025933 | Ga0207706_10059182 | Ga0207706_100591822 | 69 |
| 563 | 3300025933 | Ga0207706_10155651 | Ga0207706_101556512 | 69 |
| 564 | 3300025933 | Ga0207706_10327685 | Ga0207706_103276852 | 69 |
| 565 | 3300025933 | Ga0207706_11437268 | Ga0207706_114372682 | 69 |
| 566 | 3300025935 | Ga0207709_10110073 | Ga0207709_101100734 | 69 |
| 567 | 3300025938 | Ga0207704_10485232 | Ga0207704_104852323 | 69 |
| 568 | 3300025938 | Ga0207704_10640618 | Ga0207704_106406182 | 69 |
| 569 | 3300025939 | Ga0207665_10373449 | Ga0207665_103734492 | 69 |
| 570 | 3300025940 | Ga0207691_10463185 | Ga0207691_104631852 | 69 |
| 571 | 3300025941 | Ga0207711_10079401 | Ga0207711_100794012 | 69 |
| 572 | 3300025944 | Ga0207661_10546516 | Ga0207661_105465162 | 69 |
| 573 | 3300025945 | Ga0207679_10018820 | Ga0207679_100188203 | 69 |
| 574 | 3300025945 | Ga0207679_11811151 | Ga0207679_118111512 | 69 |
| 575 | 3300025960 | Ga0207651_11100033 | Ga0207651_111000332 | 69 |
| 576 | 3300025972 | Ga0207668_11263272 | Ga0207668_112632722 | 69 |
| 577 | 3300025986 | Ga0207658_10035124 | Ga0207658_100351243 | 69 |
| 578 | 3300026035 | Ga0207703_10146263 | Ga0207703_101462633 | 69 |
| 579 | 3300026041 | Ga0207639_10305987 | Ga0207639_103059872 | 69 |
| 580 | 3300026067 | Ga0207678_10554615 | Ga0207678_105546152 | 69 |
| 581 | 3300026088 | Ga0207641_10097779 | Ga0207641_100977792 | 69 |
| 582 | 3300026089 | Ga0207648_10028525 | Ga0207648_100285255 | 69 |
| 583 | 3300026118 | Ga0207675_100257119 | Ga0207675_1002571192 | 69 |
| 584 | 3300028379 | Ga0268266_10766762 | Ga0268266_107667622 | 69 |
| 585 | 3300028380 | Ga0268265_10066103 | Ga0268265_100661031 | 69 |
| 586 | 3300028380 | Ga0268265_10827079 | Ga0268265_108270791 | 69 |
| 587 | 3300028380 | Ga0268265_10863786 | Ga0268265_108637862 | 69 |
| 588 | 3300028381 | Ga0268264_10066329 | Ga0268264_100663293 | 69 |
| 589 | 3300031901 | Ga0307406_10087952 | Ga0307406_100879523 | 69 |
| 590 | 3300031911 | Ga0307412_10374289 | Ga0307412_103742893 | 69 |
| 591 | 3300031995 | Ga0307409_100316452 | Ga0307409_1003164521 | 69 |
| 592 | 3300031995 | Ga0307409_101459233 | Ga0307409_1014592331 | 69 |
| 593 | 3300032002 | Ga0307416_100420958 | Ga0307416_1004209582 | 69 |
| 594 | 3300032002 | Ga0307416_103085616 | Ga0307416_1030856162 | 69 |
| 595 | 3300032004 | Ga0307414_10631204 | Ga0307414_106312042 | 69 |
| 596 | 3300032005 | Ga0307411_11174542 | Ga0307411_111745422 | 69 |
| 597 | 3300032126 | Ga0307415_100126970 | Ga0307415_1001269703 | 69 |
| 598 | 3300044901 | Ga0466960_0394845 | Ga0466960_0394845_443_694 | 69 |
| 599 | 3300046500 | Ga0495596_0070445 | Ga0495596_0070445_38_274 | 69 |
| 600 | 3300046525 | Ga0495663_0065241 | Ga0495663_0065241_402_638 | 69 |
| 601 | 3300046539 | Ga0495621_0007454 | Ga0495621_0007454_2391_2627 | 69 |
| 602 | 3300046539 | Ga0495621_0060120 | Ga0495621_0060120_920_1156 | 69 |
| 603 | 3300046615 | Ga0495656_0776576 | Ga0495656_0776576_14_250 | 69 |
| 604 | 3300046664 | Ga0495659_0022463 | Ga0495659_0022463_76_312 | 69 |
| 605 | 3300046691 | Ga0495670_0102544 | Ga0495670_0102544_584_820 | 69 |
| 606 | 3300047318 | Ga0495636_0613997 | Ga0495636_0613997_199_435 | 69 |
| 607 | 3300047445 | Ga0495677_0046311 | Ga0495677_0046311_90_326 | 69 |
| 608 | 3300047447 | Ga0495685_197201 | Ga0495685_197201_115_351 | 69 |
| 609 | 3300048910 | Ga0496107_0883511 | Ga0496107_0883511_183_401 | 69 |
| 610 | 3300049686 | Ga0501257_041658 | Ga0501257_041658_483_698 | 69 |
| 611 | 3300049704 | Ga0501221_216071 | Ga0501221_216071_100_315 | 69 |
| 612 | 3300049765 | Ga0501268_008468 | Ga0501268_008468_295_510 | 69 |
| 613 | 3300050511 | nmdc:mga08y16_752069_c1 | nmdc:mga08y16_752069_c1_501_737 | 69 |
| 614 | 3300005328 | Ga0070676_10000509 | Ga0070676_100005095 | 70 |
| 615 | 3300005333 | Ga0070677_10602858 | Ga0070677_106028582 | 70 |
| 616 | 3300005337 | Ga0070682_100056000 | Ga0070682_1000560004 | 70 |
| 617 | 3300005344 | Ga0070661_100147216 | Ga0070661_1001472162 | 70 |
| 618 | 3300005347 | Ga0070668_100004342 | Ga0070668_1000043429 | 70 |
| 619 | 3300005353 | Ga0070669_100016249 | Ga0070669_1000162496 | 70 |
| 620 | 3300005355 | Ga0070671_100313495 | Ga0070671_1003134952 | 70 |
| 621 | 3300005355 | Ga0070671_101299618 | Ga0070671_1012996182 | 70 |
| 622 | 3300005356 | Ga0070674_100081176 | Ga0070674_1000811761 | 70 |
| 623 | 3300005356 | Ga0070674_100339870 | Ga0070674_1003398702 | 70 |
| 624 | 3300005364 | Ga0070673_100011053 | Ga0070673_1000110533 | 70 |
| 625 | 3300005364 | Ga0070673_101392564 | Ga0070673_1013925642 | 70 |
| 626 | 3300005367 | Ga0070667_100795898 | Ga0070667_1007958983 | 70 |
| 627 | 3300005441 | Ga0070700_100484158 | Ga0070700_1004841583 | 70 |
| 628 | 3300005457 | Ga0070662_100469831 | Ga0070662_1004698311 | 70 |
| 629 | 3300005457 | Ga0070662_100957471 | Ga0070662_1009574711 | 70 |
| 630 | 3300005459 | Ga0068867_100009758 | Ga0068867_10000975810 | 70 |
| 631 | 3300005543 | Ga0070672_100052655 | Ga0070672_1000526552 | 70 |
| 632 | 3300005548 | Ga0070665_102224485 | Ga0070665_1022244852 | 70 |
| 633 | 3300005564 | Ga0070664_100162660 | Ga0070664_1001626604 | 70 |
| 634 | 3300005564 | Ga0070664_101595611 | Ga0070664_1015956111 | 70 |
| 635 | 3300005617 | Ga0068859_101913516 | Ga0068859_1019135162 | 70 |
| 636 | 3300005618 | Ga0068864_100253660 | Ga0068864_1002536603 | 70 |
| 637 | 3300005841 | Ga0068863_101019038 | Ga0068863_1010190382 | 70 |
| 638 | 3300005843 | Ga0068860_100283493 | Ga0068860_1002834932 | 70 |
| 639 | 3300005844 | Ga0068862_100011622 | Ga0068862_1000116226 | 70 |
| 640 | 3300005844 | Ga0068862_102707587 | Ga0068862_1027075871 | 70 |
| 641 | 3300006163 | Ga0070715_10502398 | Ga0070715_105023982 | 70 |
| 642 | 3300006237 | Ga0097621_100017678 | Ga0097621_1000176783 | 70 |
| 643 | 3300006358 | Ga0068871_100220973 | Ga0068871_1002209733 | 70 |
| 644 | 3300006881 | Ga0068865_100265185 | Ga0068865_1002651852 | 70 |
| 645 | 3300006931 | Ga0097620_101913692 | Ga0097620_1019136922 | 70 |
| 646 | 3300009177 | Ga0105248_10055018 | Ga0105248_100550182 | 70 |
| 647 | 3300013102 | Ga0157371_10551216 | Ga0157371_105512162 | 70 |
| 648 | 3300013296 | Ga0157374_10122097 | Ga0157374_101220972 | 70 |
| 649 | 3300015261 | Ga0182006_1202542 | Ga0182006_12025422 | 70 |
| 650 | 3300025315 | Ga0207697_10112929 | Ga0207697_101129292 | 70 |
| 651 | 3300025893 | Ga0207682_10490048 | Ga0207682_104900482 | 70 |
| 652 | 3300025899 | Ga0207642_10062750 | Ga0207642_100627502 | 70 |
| 653 | 3300025904 | Ga0207647_10089230 | Ga0207647_100892302 | 70 |
| 654 | 3300025907 | Ga0207645_10000896 | Ga0207645_1000089619 | 70 |
| 655 | 3300025909 | Ga0207705_10001965 | Ga0207705_100019652 | 70 |
| 656 | 3300025918 | Ga0207662_10853135 | Ga0207662_108531352 | 70 |
| 657 | 3300025920 | Ga0207649_10255400 | Ga0207649_102554002 | 70 |
| 658 | 3300025923 | Ga0207681_10065848 | Ga0207681_100658484 | 70 |
| 659 | 3300025926 | Ga0207659_10145992 | Ga0207659_101459923 | 70 |
| 660 | 3300025931 | Ga0207644_10189458 | Ga0207644_101894582 | 70 |
| 661 | 3300025931 | Ga0207644_11260195 | Ga0207644_112601952 | 70 |
| 662 | 3300025933 | Ga0207706_11175213 | Ga0207706_111752132 | 70 |
| 663 | 3300025937 | Ga0207669_10043744 | Ga0207669_100437442 | 70 |
| 664 | 3300025938 | Ga0207704_10360987 | Ga0207704_103609872 | 70 |
| 665 | 3300025940 | Ga0207691_10061771 | Ga0207691_100617712 | 70 |
| 666 | 3300025942 | Ga0207689_10196854 | Ga0207689_101968543 | 70 |
| 667 | 3300025945 | Ga0207679_10084641 | Ga0207679_100846412 | 70 |
| 668 | 3300025945 | Ga0207679_12066526 | Ga0207679_120665262 | 70 |
| 669 | 3300025960 | Ga0207651_10006856 | Ga0207651_100068564 | 70 |
| 670 | 3300025972 | Ga0207668_10000070 | Ga0207668_1000007066 | 70 |
| 671 | 3300025986 | Ga0207658_10044969 | Ga0207658_100449692 | 70 |
| 672 | 3300025986 | Ga0207658_11081175 | Ga0207658_110811752 | 70 |
| 673 | 3300026023 | Ga0207677_10630678 | Ga0207677_106306782 | 70 |
| 674 | 3300026088 | Ga0207641_11509909 | Ga0207641_115099091 | 70 |
| 675 | 3300026089 | Ga0207648_10001147 | Ga0207648_1000114725 | 70 |
| 676 | 3300026095 | Ga0207676_10010550 | Ga0207676_100105504 | 70 |
| 677 | 3300026121 | Ga0207683_10156523 | Ga0207683_101565232 | 70 |
| 678 | 3300028380 | Ga0268265_10079746 | Ga0268265_100797461 | 70 |
| 679 | 3300031824 | Ga0307413_10041265 | Ga0307413_100412652 | 70 |
| 680 | 3300031824 | Ga0307413_10060096 | Ga0307413_100600962 | 70 |
| 681 | 3300031824 | Ga0307413_11577875 | Ga0307413_115778751 | 70 |
| 682 | 3300031852 | Ga0307410_10035962 | Ga0307410_100359622 | 70 |
| 683 | 3300031852 | Ga0307410_10660891 | Ga0307410_106608912 | 70 |
| 684 | 3300031903 | Ga0307407_10025709 | Ga0307407_100257096 | 70 |
| 685 | 3300031995 | Ga0307409_100432532 | Ga0307409_1004325323 | 70 |
| 686 | 3300031995 | Ga0307409_100662179 | Ga0307409_1006621792 | 70 |
| 687 | 3300032002 | Ga0307416_102651869 | Ga0307416_1026518691 | 70 |
| 688 | 3300032004 | Ga0307414_10229875 | Ga0307414_102298752 | 70 |
| 689 | 3300032004 | Ga0307414_10238328 | Ga0307414_102383283 | 70 |
| 690 | 3300032004 | Ga0307414_10524743 | Ga0307414_105247432 | 70 |
| 691 | 3300032004 | Ga0307414_12070186 | Ga0307414_120701862 | 70 |
| 692 | 3300032005 | Ga0307411_10069353 | Ga0307411_100693532 | 70 |
| 693 | 3300032005 | Ga0307411_10121562 | Ga0307411_101215624 | 70 |
| 694 | 3300032005 | Ga0307411_10283152 | Ga0307411_102831522 | 70 |
| 695 | 3300032126 | Ga0307415_100065070 | Ga0307415_1000650702 | 70 |
| 696 | 3300037418 | Ga0395900_0187845 | Ga0395900_0187845_559_774 | 70 |
| 697 | 3300037471 | Ga0395905_0024115 | Ga0395905_0024115_2377_2598 | 70 |
| 698 | 3300037471 | Ga0395905_0125488 | Ga0395905_0125488_530_745 | 70 |
| 699 | 3300037471 | Ga0395905_0340328 | Ga0395905_0340328_536_754 | 70 |
| 700 | 3300041404 | Ga0439436_0263724 | Ga0439436_0263724_237_452 | 70 |
| 701 | 3300042461 | Ga0439460_0285751 | Ga0439460_0285751_338_556 | 70 |
| 702 | 3300046459 | Ga0495629_0959256 | Ga0495629_0959256_165_386 | 70 |
| 703 | 3300046500 | Ga0495596_0179050 | Ga0495596_0179050_130_345 | 70 |
| 704 | 3300046537 | Ga0495598_0163450 | Ga0495598_0163450_255_470 | 70 |
| 705 | 3300046539 | Ga0495621_0512259 | Ga0495621_0512259_279_494 | 70 |
| 706 | 3300046558 | Ga0495633_0006238 | Ga0495633_0006238_1320_1535 | 70 |
| 707 | 3300046684 | Ga0495669_0295848 | Ga0495669_0295848_256_471 | 70 |
| 708 | 3300046691 | Ga0495670_0015020 | Ga0495670_0015020_2206_2421 | 70 |
| 709 | 3300046691 | Ga0495670_0466437 | Ga0495670_0466437_356_574 | 70 |
| 710 | 3300048903 | Ga0496100_1105223 | Ga0496100_1105223_158_379 | 70 |
| 711 | 3300048904 | Ga0496101_0940404 | Ga0496101_0940404_181_402 | 70 |
| 712 | 3300048908 | Ga0496105_0251475 | Ga0496105_0251475_486_707 | 70 |
| 713 | 3300048909 | Ga0496106_0482926 | Ga0496106_0482926_100_321 | 70 |
| 714 | 3300048910 | Ga0496107_0043298 | Ga0496107_0043298_1428_1649 | 70 |
| 715 | 3300048910 | Ga0496107_0149558 | Ga0496107_0149558_1377_1598 | 70 |
| 716 | 3300048911 | Ga0496108_0039973 | Ga0496108_0039973_414_635 | 70 |
| 717 | 3300048912 | Ga0496109_0045704 | Ga0496109_0045704_1604_1825 | 70 |
| 718 | 3300048913 | Ga0496110_0002515 | Ga0496110_0002515_10736_10957 | 70 |
| 719 | 3300048914 | Ga0496111_0003916 | Ga0496111_0003916_8747_8968 | 70 |
| 720 | 3300048915 | Ga0496112_0067093 | Ga0496112_0067093_46_267 | 70 |
| 721 | 3300048915 | Ga0496112_0940316 | Ga0496112_0940316_31_252 | 70 |
| 722 | 3300050512 | nmdc:mga0n895_1974672_c1 | nmdc:mga0n895_1974672_c1_264_479 | 70 |
| 723 | 3300005333 | Ga0070677_10721637 | Ga0070677_107216371 | 71 |
| 724 | 3300005457 | Ga0070662_100127093 | Ga0070662_1001270932 | 71 |
| 725 | 3300005615 | Ga0070702_100496965 | Ga0070702_1004969652 | 71 |
| 726 | 3300013100 | Ga0157373_10291242 | Ga0157373_102912422 | 71 |
| 727 | 3300025893 | Ga0207682_10436197 | Ga0207682_104361972 | 71 |
| 728 | 3300025912 | Ga0207707_10981200 | Ga0207707_109812002 | 71 |
| 729 | 3300025923 | Ga0207681_10399550 | Ga0207681_103995502 | 71 |
| 730 | 3300027876 | Ga0209974_10083763 | Ga0209974_100837631 | 71 |
| 731 | 3300031548 | Ga0307408_100011889 | Ga0307408_10001188910 | 71 |
| 732 | 3300031548 | Ga0307408_101297580 | Ga0307408_1012975802 | 71 |
| 733 | 3300031731 | Ga0307405_10065406 | Ga0307405_100654062 | 71 |
| 734 | 3300031731 | Ga0307405_10382513 | Ga0307405_103825133 | 71 |
| 735 | 3300031731 | Ga0307405_10400061 | Ga0307405_104000612 | 71 |
| 736 | 3300031731 | Ga0307405_10526524 | Ga0307405_105265242 | 71 |
| 737 | 3300031824 | Ga0307413_10018307 | Ga0307413_100183072 | 71 |
| 738 | 3300031824 | Ga0307413_10062051 | Ga0307413_100620512 | 71 |
| 739 | 3300031824 | Ga0307413_10068638 | Ga0307413_100686382 | 71 |
| 740 | 3300031824 | Ga0307413_10094504 | Ga0307413_100945044 | 71 |
| 741 | 3300031824 | Ga0307413_10140627 | Ga0307413_101406272 | 71 |
| 742 | 3300031824 | Ga0307413_10460547 | Ga0307413_104605473 | 71 |
| 743 | 3300031852 | Ga0307410_10059315 | Ga0307410_100593152 | 71 |
| 744 | 3300031852 | Ga0307410_10082864 | Ga0307410_100828645 | 71 |
| 745 | 3300031852 | Ga0307410_10433732 | Ga0307410_104337323 | 71 |
| 746 | 3300031852 | Ga0307410_10467600 | Ga0307410_104676002 | 71 |
| 747 | 3300031901 | Ga0307406_10043702 | Ga0307406_100437025 | 71 |
| 748 | 3300031903 | Ga0307407_10059415 | Ga0307407_100594152 | 71 |
| 749 | 3300031903 | Ga0307407_10162004 | Ga0307407_101620042 | 71 |
| 750 | 3300031911 | Ga0307412_10133334 | Ga0307412_101333343 | 71 |
| 751 | 3300031911 | Ga0307412_10172699 | Ga0307412_101726992 | 71 |
| 752 | 3300031911 | Ga0307412_10726617 | Ga0307412_107266172 | 71 |
| 753 | 3300031911 | Ga0307412_11216157 | Ga0307412_112161571 | 71 |
| 754 | 3300031995 | Ga0307409_100216374 | Ga0307409_1002163743 | 71 |
| 755 | 3300031995 | Ga0307409_100698213 | Ga0307409_1006982132 | 71 |
| 756 | 3300031995 | Ga0307409_101211804 | Ga0307409_1012118042 | 71 |
| 757 | 3300031995 | Ga0307409_101218245 | Ga0307409_1012182452 | 71 |
| 758 | 3300031995 | Ga0307409_101646304 | Ga0307409_1016463042 | 71 |
| 759 | 3300031995 | Ga0307409_101796060 | Ga0307409_1017960601 | 71 |
| 760 | 3300032002 | Ga0307416_100012629 | Ga0307416_1000126292 | 71 |
| 761 | 3300032002 | Ga0307416_100124183 | Ga0307416_1001241832 | 71 |
| 762 | 3300032002 | Ga0307416_100414379 | Ga0307416_1004143792 | 71 |
| 763 | 3300032002 | Ga0307416_100835229 | Ga0307416_1008352291 | 71 |
| 764 | 3300032004 | Ga0307414_10003689 | Ga0307414_100036895 | 71 |
| 765 | 3300032004 | Ga0307414_10027762 | Ga0307414_100277622 | 71 |
| 766 | 3300032004 | Ga0307414_10195532 | Ga0307414_101955323 | 71 |
| 767 | 3300032004 | Ga0307414_11063029 | Ga0307414_110630291 | 71 |
| 768 | 3300032004 | Ga0307414_12108842 | Ga0307414_121088422 | 71 |
| 769 | 3300032005 | Ga0307411_10012473 | Ga0307411_100124732 | 71 |
| 770 | 3300032005 | Ga0307411_10037558 | Ga0307411_100375585 | 71 |
| 771 | 3300032005 | Ga0307411_10066526 | Ga0307411_100665262 | 71 |
| 772 | 3300032005 | Ga0307411_10077866 | Ga0307411_100778662 | 71 |
| 773 | 3300032005 | Ga0307411_10433125 | Ga0307411_104331252 | 71 |
| 774 | 3300032005 | Ga0307411_10801155 | Ga0307411_108011552 | 71 |
| 775 | 3300032005 | Ga0307411_10927361 | Ga0307411_109273612 | 71 |
| 776 | 3300032126 | Ga0307415_100233595 | Ga0307415_1002335953 | 71 |
| 777 | 3300032126 | Ga0307415_100385674 | Ga0307415_1003856743 | 71 |
| 778 | 3300032126 | Ga0307415_101824770 | Ga0307415_1018247702 | 71 |
| 779 | 3300005328 | Ga0070676_10224342 | Ga0070676_102243422 | 72 |
| 780 | 3300005334 | Ga0068869_100028374 | Ga0068869_1000283742 | 72 |
| 781 | 3300005334 | Ga0068869_100075541 | Ga0068869_1000755412 | 72 |
| 782 | 3300005335 | Ga0070666_11227282 | Ga0070666_112272821 | 72 |
| 783 | 3300005338 | Ga0068868_100616083 | Ga0068868_1006160832 | 72 |
| 784 | 3300005343 | Ga0070687_100769781 | Ga0070687_1007697812 | 72 |
| 785 | 3300005344 | Ga0070661_100296444 | Ga0070661_1002964443 | 72 |
| 786 | 3300005353 | Ga0070669_100091495 | Ga0070669_1000914952 | 72 |
| 787 | 3300005354 | Ga0070675_100499029 | Ga0070675_1004990292 | 72 |
| 788 | 3300005367 | Ga0070667_100415702 | Ga0070667_1004157022 | 72 |
| 789 | 3300005455 | Ga0070663_100030392 | Ga0070663_1000303922 | 72 |
| 790 | 3300005456 | Ga0070678_100763206 | Ga0070678_1007632061 | 72 |
| 791 | 3300005616 | Ga0068852_100984474 | Ga0068852_1009844743 | 72 |
| 792 | 3300005617 | Ga0068859_100162511 | Ga0068859_1001625114 | 72 |
| 793 | 3300005618 | Ga0068864_100314354 | Ga0068864_1003143543 | 72 |
| 794 | 3300005842 | Ga0068858_100020526 | Ga0068858_1000205269 | 72 |
| 795 | 3300005844 | Ga0068862_100025302 | Ga0068862_1000253028 | 72 |
| 796 | 3300006931 | Ga0097620_100162519 | Ga0097620_1001625194 | 72 |
| 797 | 3300009148 | Ga0105243_10161300 | Ga0105243_101613002 | 72 |
| 798 | 3300009176 | Ga0105242_10863468 | Ga0105242_108634682 | 72 |
| 799 | 3300009177 | Ga0105248_10694864 | Ga0105248_106948642 | 72 |
| 800 | 3300009177 | Ga0105248_11109947 | Ga0105248_111099472 | 72 |
| 801 | 3300009553 | Ga0105249_10121432 | Ga0105249_101214324 | 72 |
| 802 | 3300013306 | Ga0163162_11531835 | Ga0163162_115318352 | 72 |
| 803 | 3300014325 | Ga0163163_10274780 | Ga0163163_102747803 | 72 |
| 804 | 3300014745 | Ga0157377_10153597 | Ga0157377_101535972 | 72 |
| 805 | 3300014968 | Ga0157379_10753369 | Ga0157379_107533692 | 72 |
| 806 | 3300025926 | Ga0207659_11579333 | Ga0207659_115793332 | 72 |
| 807 | 3300025932 | Ga0207690_10069444 | Ga0207690_100694442 | 72 |
| 808 | 3300025935 | Ga0207709_10290075 | Ga0207709_102900752 | 72 |
| 809 | 3300025941 | Ga0207711_10782851 | Ga0207711_107828512 | 72 |
| 810 | 3300025941 | Ga0207711_11888227 | Ga0207711_118882272 | 72 |
| 811 | 3300025942 | Ga0207689_10073436 | Ga0207689_100734362 | 72 |
| 812 | 3300025945 | Ga0207679_10081752 | Ga0207679_100817524 | 72 |
| 813 | 3300025972 | Ga0207668_11243370 | Ga0207668_112433702 | 72 |
| 814 | 3300026035 | Ga0207703_10163523 | Ga0207703_101635232 | 72 |
| 815 | 3300026067 | Ga0207678_10148222 | Ga0207678_101482222 | 72 |
| 816 | 3300026088 | Ga0207641_10987317 | Ga0207641_109873172 | 72 |
| 817 | 3300031548 | Ga0307408_100029310 | Ga0307408_1000293102 | 72 |
| 818 | 3300031901 | Ga0307406_10018474 | Ga0307406_100184743 | 72 |
| 819 | 3300038443 | Ga0395901_0449364 | Ga0395901_0449364_528_752 | 72 |
| 820 | 3300042439 | Ga0439464_0001273 | Ga0439464_0001273_1332_1553 | 72 |
| 821 | 3300046525 | Ga0495663_0030415 | Ga0495663_0030415_455_679 | 72 |
| 822 | 3300046684 | Ga0495669_0126167 | Ga0495669_0126167_377_601 | 72 |
| 823 | 3300037312 | Ga0395899_0454091 | Ga0395899_0454091_523_750 | 73 |
| 824 | 3300037418 | Ga0395900_0000325 | Ga0395900_0000325_53234_53461 | 73 |
| 825 | 3300037471 | Ga0395905_0000218 | Ga0395905_0000218_57169_57396 | 73 |
| 826 | 3300038443 | Ga0395901_0000962 | Ga0395901_0000962_22756_22983 | 73 |
| 827 | 3300046616 | Ga0495668_0361688 | Ga0495668_0361688_214_441 | 73 |
| 828 | 3300049652 | Ga0501202_039918 | Ga0501202_039918_766_993 | 73 |
| 829 | 3300049654 | Ga0501207_106283 | Ga0501207_106283_275_502 | 73 |
| 830 | 3300049656 | Ga0501209_021727 | Ga0501209_021727_1195_1422 | 73 |
| 831 | 3300049660 | Ga0501216_191078 | Ga0501216_191078_214_441 | 73 |
| 832 | 3300049669 | Ga0501235_010718 | Ga0501235_010718_850_1077 | 73 |
| 833 | 3300049674 | Ga0501242_014640 | Ga0501242_014640_58_285 | 73 |
| 834 | 3300049683 | Ga0501253_123161 | Ga0501253_123161_42_269 | 73 |
| 835 | 3300049687 | Ga0501258_061312 | Ga0501258_061312_81_308 | 73 |
| 836 | 3300049688 | Ga0501259_206948 | Ga0501259_206948_251_478 | 73 |
| 837 | 3300049704 | Ga0501221_012393 | Ga0501221_012393_402_629 | 73 |
| 838 | 3300049705 | Ga0501225_0041815 | Ga0501225_0041815_415_642 | 73 |
| 839 | 3300049769 | Ga0501272_023855 | Ga0501272_023855_253_480 | 73 |
| 840 | 3300049770 | Ga0501273_030918 | Ga0501273_030918_401_628 | 73 |
| 841 | 3300049775 | Ga0501279_078600 | Ga0501279_078600_93_320 | 73 |
| 842 | 3300000532 | CNAas_1009794 | CNAas_10097942 | 74 |
| 843 | 3300005844 | Ga0068862_101360095 | Ga0068862_1013600952 | 74 |
| 844 | 3300025923 | Ga0207681_10765765 | Ga0207681_107657652 | 74 |
| 845 | 3300025938 | Ga0207704_10380619 | Ga0207704_103806192 | 74 |
| 846 | 3300046616 | Ga0495668_0012970 | Ga0495668_0012970_2237_2461 | 74 |
| 847 | 3300046684 | Ga0495669_0160775 | Ga0495669_0160775_344_568 | 74 |
| 848 | 3300053134 | Ga0500658_0000041 | Ga0500658_0000041_19158_19382 | 74 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar