F483373

General Info

Members Datasets Scaffolds Average Seq Length
848 253 848 71

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0394845|Ga0466960_0394845_443_694
Length 83
Sequence MTPRPRLLAAAMLIPACTGCISVKTPEKPIEINLNVAIRQEVLVRMQRDVENLINQNPDAFPQGQQPAATRPAQPARTPGSSR

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
191 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
192 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
193 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
233 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
237 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
240 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
244 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
245 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
246 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 4.83
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1009794 3300000532 Bacteria 637
2 JGI24736J21556_1063138 3300001904 Bacteria 574
3 JGI24740J21852_10136104 3300001979 Bacteria 612
4 JGI24739J22299_10153601 3300001989 Unclassified 680
5 JGI24737J22298_10032027 3300001990 Bacteria 1640
6 JGI24737J22298_10246022 3300001990 Bacteria 528
7 JGI24735J21928_10008884 3300002067 Bacteria 3241
8 JGI24735J21928_10018161 3300002067 Bacteria 2170
9 rootH1_10233400 3300003323 Unclassified 1727
10 Ga0070658_10048462 3300005327 Bacteria 3441
11 Ga0070658_10139741 3300005327 Bacteria 2023
12 Ga0070658_10374215 3300005327 Bacteria 1221
13 Ga0070658_10712416 3300005327 Bacteria 871
14 Ga0070658_10756568 3300005327 Bacteria 844
15 Ga0070658_11312374 3300005327 Bacteria 628
16 Ga0070676_10000509 3300005328 Bacteria 18636
17 Ga0070676_10018872 3300005328 Bacteria 3829
18 Ga0070676_10104474 3300005328 Bacteria 1755
19 Ga0070676_10224342 3300005328 Bacteria 1243
20 Ga0070676_10348171 3300005328 Bacteria 1018
21 Ga0070683_100096580 3300005329 Bacteria 2779
22 Ga0070683_100697847 3300005329 Bacteria 972
23 Ga0070683_101118406 3300005329 Bacteria 757
24 Ga0070690_100557112 3300005330 Bacteria 865
25 Ga0070690_100987582 3300005330 Bacteria 663
26 Ga0070670_100008324 3300005331 Bacteria 8840
27 Ga0070670_100090749 3300005331 Bacteria 2626
28 Ga0070670_100116328 3300005331 Bacteria 2306
29 Ga0070670_100257627 3300005331 Bacteria 1520
30 Ga0070670_100831531 3300005331 Bacteria 835
31 Ga0070670_101999614 3300005331 Bacteria 534
32 Ga0070677_10555225 3300005333 Bacteria 630
33 Ga0070677_10602858 3300005333 Bacteria 608
34 Ga0070677_10721637 3300005333 Bacteria 563
35 Ga0068869_100028374 3300005334 Bacteria 3910
36 Ga0068869_100075541 3300005334 Bacteria 2504
37 Ga0068869_100567022 3300005334 Bacteria 956
38 Ga0070666_10275760 3300005335 Bacteria 1195
39 Ga0070666_10532349 3300005335 Bacteria 854
40 Ga0070666_11227282 3300005335 Bacteria 559
41 Ga0070680_100260887 3300005336 Bacteria 1466
42 Ga0070680_100324275 3300005336 Bacteria 1307
43 Ga0070680_101666829 3300005336 Bacteria 552
44 Ga0070682_100056000 3300005337 Bacteria 2478
45 Ga0070682_100203586 3300005337 Bacteria 1398
46 Ga0070682_100354453 3300005337 Bacteria 1095
47 Ga0068868_100616083 3300005338 Bacteria 963
48 Ga0070660_100059424 3300005339 Bacteria 2964
49 Ga0070660_100075646 3300005339 Bacteria 2636
50 Ga0070660_100078186 3300005339 Bacteria 2594
51 Ga0070660_100212206 3300005339 Bacteria 1572
52 Ga0070660_100358965 3300005339 Bacteria 1201
53 Ga0070660_100574384 3300005339 Bacteria 941
54 Ga0070660_101366808 3300005339 Bacteria 601
55 Ga0070691_10114126 3300005341 Bacteria 1354
56 Ga0070687_100769781 3300005343 Bacteria 679
57 Ga0070661_100009966 3300005344 Bacteria 6592
58 Ga0070661_100147216 3300005344 Bacteria 1779
59 Ga0070661_100243216 3300005344 Bacteria 1386
60 Ga0070661_100296444 3300005344 Bacteria 1258
61 Ga0070661_100876166 3300005344 Bacteria 740
62 Ga0070661_100980028 3300005344 Bacteria 701
63 Ga0070692_10043292 3300005345 Bacteria 2314
64 Ga0070692_11177350 3300005345 Bacteria 545
65 Ga0070668_100004342 3300005347 Bacteria 10512
66 Ga0070668_100112350 3300005347 Bacteria 2170
67 Ga0070668_100136264 3300005347 Bacteria 1975
68 Ga0070669_100016249 3300005353 Bacteria 5308
69 Ga0070669_100091495 3300005353 Bacteria 2281
70 Ga0070675_100499029 3300005354 Bacteria 1096
71 Ga0070675_101475654 3300005354 Bacteria 627
72 Ga0070675_102013202 3300005354 Bacteria 533
73 Ga0070671_100002896 3300005355 Bacteria 13357
74 Ga0070671_100003087 3300005355 Bacteria 12960
75 Ga0070671_100027435 3300005355 Bacteria 4688
76 Ga0070671_100059138 3300005355 Bacteria 3189
77 Ga0070671_100059877 3300005355 Bacteria 3169
78 Ga0070671_100066201 3300005355 Bacteria 3011
79 Ga0070671_100178201 3300005355 Bacteria 1799
80 Ga0070671_100313495 3300005355 Bacteria 1336
81 Ga0070671_100380928 3300005355 Bacteria 1206
82 Ga0070671_101299618 3300005355 Unclassified 641
83 Ga0070674_100011647 3300005356 Bacteria 5361
84 Ga0070674_100081176 3300005356 Bacteria 2317
85 Ga0070674_100097187 3300005356 Bacteria 2138
86 Ga0070674_100119938 3300005356 Bacteria 1946
87 Ga0070674_100339870 3300005356 Bacteria 1209
88 Ga0070674_101731501 3300005356 Bacteria 566
89 Ga0070673_100011053 3300005364 Bacteria 6149
90 Ga0070673_100022961 3300005364 Bacteria 4551
91 Ga0070673_100104094 3300005364 Bacteria 2343
92 Ga0070673_100371344 3300005364 Bacteria 1274
93 Ga0070673_100696162 3300005364 Bacteria 933
94 Ga0070673_101392564 3300005364 Bacteria 660
95 Ga0070673_102318906 3300005364 Bacteria 510
96 Ga0070659_100006023 3300005366 Bacteria 8743
97 Ga0070659_100014006 3300005366 Bacteria 5985
98 Ga0070659_100015331 3300005366 Bacteria 5740
99 Ga0070659_100030454 3300005366 Bacteria 4177
100 Ga0070659_100174859 3300005366 Bacteria 1760
101 Ga0070659_100223854 3300005366 Bacteria 1554
102 Ga0070659_100551485 3300005366 Bacteria 987
103 Ga0070659_101140756 3300005366 Bacteria 688
104 Ga0070667_100011528 3300005367 Bacteria 7308
105 Ga0070667_100116248 3300005367 Bacteria 2323
106 Ga0070667_100319020 3300005367 Bacteria 1402
107 Ga0070667_100415702 3300005367 Bacteria 1225
108 Ga0070667_100795898 3300005367 Bacteria 878
109 Ga0070667_101816406 3300005367 Unclassified 574
110 Ga0070703_10528058 3300005406 Bacteria 535
111 Ga0070714_100038969 3300005435 Bacteria 3999
112 Ga0070713_102276255 3300005436 Bacteria 524
113 Ga0070705_100248088 3300005440 Bacteria 1248
114 Ga0070700_100484158 3300005441 Bacteria 948
115 Ga0070663_100030392 3300005455 Bacteria 3701
116 Ga0070663_100080310 3300005455 Bacteria 2395
117 Ga0070663_100138281 3300005455 Bacteria 1857
118 Ga0070663_100138820 3300005455 Bacteria 1853
119 Ga0070663_100492254 3300005455 Bacteria 1017
120 Ga0070663_100568611 3300005455 Bacteria 950
121 Ga0070663_100587933 3300005455 Bacteria 935
122 Ga0070663_100828172 3300005455 Bacteria 795
123 Ga0070663_101177204 3300005455 Bacteria 673
124 Ga0070678_100003214 3300005456 Bacteria 9068
125 Ga0070678_100052107 3300005456 Bacteria 2970
126 Ga0070678_100763206 3300005456 Bacteria 875
127 Ga0070662_100008232 3300005457 Bacteria 6790
128 Ga0070662_100027862 3300005457 Bacteria 3928
129 Ga0070662_100047133 3300005457 Bacteria 3099
130 Ga0070662_100050854 3300005457 Bacteria 2990
131 Ga0070662_100116544 3300005457 Bacteria 2042
132 Ga0070662_100127093 3300005457 Bacteria 1961
133 Ga0070662_100149126 3300005457 Bacteria 1819
134 Ga0070662_100469831 3300005457 Bacteria 1046
135 Ga0070662_100753904 3300005457 Bacteria 826
136 Ga0070662_100955457 3300005457 Bacteria 733
137 Ga0070662_100957471 3300005457 Bacteria 732
138 Ga0070662_101449773 3300005457 Bacteria 592
139 Ga0070681_10034249 3300005458 Bacteria 5101
140 Ga0070681_10216233 3300005458 Bacteria 1832
141 Ga0070681_10244658 3300005458 Bacteria 1707
142 Ga0068867_100003727 3300005459 Bacteria 10724
143 Ga0068867_100009758 3300005459 Bacteria 6765
144 Ga0068867_100011300 3300005459 Bacteria 6298
145 Ga0068867_100301555 3300005459 Bacteria 1321
146 Ga0068867_100500657 3300005459 Bacteria 1044
147 Ga0070706_100209129 3300005467 Bacteria 1822
148 Ga0070679_100336185 3300005530 Bacteria 1458
149 Ga0070679_100582314 3300005530 Bacteria 1063
150 Ga0070679_100974055 3300005530 Bacteria 792
151 Ga0070679_101247843 3300005530 Bacteria 689
152 Ga0070679_101520204 3300005530 Bacteria 616
153 Ga0070684_100433456 3300005535 Bacteria 1214
154 Ga0068853_100050171 3300005539 Bacteria 3589
155 Ga0068853_100487239 3300005539 Bacteria 1163
156 Ga0068853_100888068 3300005539 Bacteria 856
157 Ga0068853_101672803 3300005539 Unclassified 617
158 Ga0070672_100052655 3300005543 Bacteria 3179
159 Ga0070672_100431764 3300005543 Bacteria 1133
160 Ga0070672_100476246 3300005543 Bacteria 1078
161 Ga0070672_100866842 3300005543 Bacteria 797
162 Ga0070695_100011170 3300005545 Bacteria 5370
163 Ga0070696_100004394 3300005546 Bacteria 9405
164 Ga0070696_100020112 3300005546 Bacteria 4526
165 Ga0070696_100222395 3300005546 Bacteria 1417
166 Ga0070696_101372408 3300005546 Bacteria 602
167 Ga0070693_100017586 3300005547 Bacteria 3720
168 Ga0070693_100092633 3300005547 Bacteria 1825
169 Ga0070693_100118954 3300005547 Bacteria 1636
170 Ga0070665_100000785 3300005548 Bacteria 41798
171 Ga0070665_100079619 3300005548 Bacteria 3282
172 Ga0070665_100374571 3300005548 Bacteria 1431
173 Ga0070665_101738469 3300005548 Bacteria 631
174 Ga0070665_102224485 3300005548 Bacteria 552
175 Ga0068855_100229792 3300005563 Bacteria 2078
176 Ga0068855_100394417 3300005563 Bacteria 1518
177 Ga0068855_100429950 3300005563 Bacteria 1443
178 Ga0068855_101975258 3300005563 Bacteria 590
179 Ga0068855_102509242 3300005563 Bacteria 513
180 Ga0070664_100003416 3300005564 Bacteria 12825
181 Ga0070664_100005620 3300005564 Bacteria 10089
182 Ga0070664_100007027 3300005564 Bacteria 9084
183 Ga0070664_100100671 3300005564 Bacteria 2512
184 Ga0070664_100162660 3300005564 Bacteria 1975
185 Ga0070664_100215194 3300005564 Bacteria 1718
186 Ga0070664_100358586 3300005564 Bacteria 1327
187 Ga0070664_100534784 3300005564 Bacteria 1083
188 Ga0070664_100662015 3300005564 Bacteria 971
189 Ga0070664_100734325 3300005564 Bacteria 921
190 Ga0070664_101595611 3300005564 Bacteria 618
191 Ga0068857_100006626 3300005577 Bacteria 9948
192 Ga0068857_100010757 3300005577 Bacteria 7963
193 Ga0068857_100033123 3300005577 Bacteria 4569
194 Ga0068857_100213748 3300005577 Bacteria 1760
195 Ga0068854_100035685 3300005578 Bacteria 3482
196 Ga0068854_100046422 3300005578 Bacteria 3092
197 Ga0068854_100136917 3300005578 Bacteria 1875
198 Ga0068854_100787303 3300005578 Bacteria 828
199 Ga0068854_102132559 3300005578 Bacteria 518
200 Ga0068856_100134549 3300005614 Bacteria 2477
201 Ga0068856_100758017 3300005614 Bacteria 991
202 Ga0068856_101175507 3300005614 Bacteria 784
203 Ga0070702_100496965 3300005615 Bacteria 895
204 Ga0068852_100122539 3300005616 Bacteria 2383
205 Ga0068852_100323390 3300005616 Bacteria 1498
206 Ga0068852_100330037 3300005616 Bacteria 1484
207 Ga0068852_100984474 3300005616 Bacteria 862
208 Ga0068859_100031616 3300005617 Bacteria 5315
209 Ga0068859_100162511 3300005617 Bacteria 2312
210 Ga0068859_100243984 3300005617 Bacteria 1886
211 Ga0068859_101729035 3300005617 Bacteria 691
212 Ga0068859_101913516 3300005617 Bacteria 655
213 Ga0068864_100015969 3300005618 Bacteria 6247
214 Ga0068864_100025846 3300005618 Bacteria 4947
215 Ga0068864_100253660 3300005618 Bacteria 1634
216 Ga0068864_100271429 3300005618 Bacteria 1581
217 Ga0068864_100314354 3300005618 Bacteria 1469
218 Ga0068864_100544848 3300005618 Bacteria 1121
219 Ga0068864_100733877 3300005618 Bacteria 967
220 Ga0068864_101207447 3300005618 Bacteria 755
221 Ga0068866_10098353 3300005718 Bacteria 1609
222 Ga0068861_100630403 3300005719 Bacteria 988
223 Ga0068851_10009479 3300005834 Bacteria 4529
224 Ga0068851_10042686 3300005834 Bacteria 2284
225 Ga0068851_10084160 3300005834 Bacteria 1665
226 Ga0068851_10118403 3300005834 Bacteria 1421
227 Ga0068851_10357712 3300005834 Bacteria 851
228 Ga0068863_100003894 3300005841 Bacteria 14746
229 Ga0068863_100035175 3300005841 Bacteria 4772
230 Ga0068863_100282732 3300005841 Bacteria 1608
231 Ga0068863_101019038 3300005841 Bacteria 831
232 Ga0068863_101286743 3300005841 Bacteria 738
233 Ga0068858_100020526 3300005842 Bacteria 6174
234 Ga0068858_100433525 3300005842 Bacteria 1265
235 Ga0068858_100589575 3300005842 Bacteria 1078
236 Ga0068858_101391846 3300005842 Bacteria 691
237 Ga0068860_100027502 3300005843 Bacteria 5478
238 Ga0068860_100194469 3300005843 Bacteria 1964
239 Ga0068860_100283493 3300005843 Bacteria 1620
240 Ga0068860_102115491 3300005843 Bacteria 584
241 Ga0068862_100011622 3300005844 Bacteria 7264
242 Ga0068862_100025302 3300005844 Bacteria 4983
243 Ga0068862_100041195 3300005844 Bacteria 3930
244 Ga0068862_100516465 3300005844 Bacteria 1136
245 Ga0068862_100638174 3300005844 Bacteria 1026
246 Ga0068862_101360095 3300005844 Bacteria 713
247 Ga0068862_102707587 3300005844 Unclassified 507
248 Ga0081539_10024274 3300005985 Bacteria 3939
249 Ga0081539_10111840 3300005985 Bacteria 1373
250 Ga0081539_10215398 3300005985 Bacteria 877
251 Ga0070717_10089264 3300006028 Bacteria 2599
252 Ga0070715_10502398 3300006163 Bacteria 694
253 Ga0070716_100392697 3300006173 Bacteria 995
254 Ga0075369_10166144 3300006186 Unclassified 1012
255 Ga0097621_100012388 3300006237 Bacteria 6319
256 Ga0097621_100017678 3300006237 Bacteria 5422
257 Ga0097621_100751589 3300006237 Bacteria 901
258 Ga0068871_100018700 3300006358 Bacteria 5276
259 Ga0068871_100198259 3300006358 Bacteria 1732
260 Ga0068871_100220973 3300006358 Bacteria 1641
261 Ga0068871_100815928 3300006358 Bacteria 861
262 Ga0068871_101288497 3300006358 Bacteria 687
263 Ga0068871_101368608 3300006358 Bacteria 667
264 Ga0075428_101641064 3300006844 Bacteria 672
265 Ga0075429_100210845 3300006880 Bacteria 1702
266 Ga0068865_100090054 3300006881 Bacteria 2223
267 Ga0068865_100265185 3300006881 Bacteria 1361
268 Ga0068865_100632247 3300006881 Bacteria 908
269 Ga0097620_100031616 3300006931 Bacteria 5315
270 Ga0097620_100162519 3300006931 Bacteria 2312
271 Ga0097620_100243965 3300006931 Bacteria 1886
272 Ga0097620_101728715 3300006931 Bacteria 691
273 Ga0097620_101913692 3300006931 Bacteria 655
274 Ga0105251_10038441 3300009011 Bacteria 2344
275 Ga0111539_10058536 3300009094 Bacteria 4571
276 Ga0105245_12591162 3300009098 Bacteria 560
277 Ga0105247_10115081 3300009101 Bacteria 1735
278 Ga0105247_11764509 3300009101 Bacteria 514
279 Ga0105243_10014560 3300009148 Bacteria 5951
280 Ga0105243_10161300 3300009148 Bacteria 1933
281 Ga0105243_12705856 3300009148 Bacteria 536
282 Ga0105241_10065092 3300009174 Bacteria 2816
283 Ga0105242_10863468 3300009176 Bacteria 902
284 Ga0105242_11004428 3300009176 Bacteria 842
285 Ga0105248_10012350 3300009177 Bacteria 9425
286 Ga0105248_10022027 3300009177 Bacteria 7061
287 Ga0105248_10055018 3300009177 Bacteria 4463
288 Ga0105248_10136957 3300009177 Bacteria 2762
289 Ga0105248_10165154 3300009177 Bacteria 2496
290 Ga0105248_10694864 3300009177 Bacteria 1148
291 Ga0105248_11109947 3300009177 Bacteria 894
292 Ga0105248_11481423 3300009177 Bacteria 768
293 Ga0105248_11529196 3300009177 Bacteria 756
294 Ga0105248_13149114 3300009177 Bacteria 525
295 Ga0105237_10027499 3300009545 Bacteria 5805
296 Ga0105238_10262621 3300009551 Bacteria 1706
297 Ga0105238_10397575 3300009551 Bacteria 1371
298 Ga0105238_10619381 3300009551 Bacteria 1091
299 Ga0105249_10121432 3300009553 Bacteria 2483
300 Ga0105249_10620954 3300009553 Bacteria 1137
301 Ga0105239_12964624 3300010375 Bacteria 553
302 Ga0105246_10485246 3300011119 Bacteria 1046
303 Ga0157319_1021488 3300012497 Bacteria 631
304 Ga0157327_1033179 3300012512 Unclassified 656
305 Ga0157327_1052598 3300012512 Bacteria 584
306 Ga0157373_10115471 3300013100 Bacteria 1887
307 Ga0157373_10127536 3300013100 Bacteria 1789
308 Ga0157373_10281258 3300013100 Bacteria 1179
309 Ga0157373_10291242 3300013100 Bacteria 1158
310 Ga0157373_10606145 3300013100 Bacteria 797
311 Ga0157373_10649093 3300013100 Bacteria 771
312 Ga0157373_10828818 3300013100 Bacteria 683
313 Ga0157373_11073364 3300013100 Bacteria 603
314 Ga0157373_11556013 3300013100 Bacteria 506
315 Ga0157371_10409949 3300013102 Bacteria 992
316 Ga0157371_10487610 3300013102 Bacteria 909
317 Ga0157371_10529056 3300013102 Bacteria 872
318 Ga0157371_10551216 3300013102 Bacteria 855
319 Ga0157371_11300961 3300013102 Bacteria 562
320 Ga0157370_10111211 3300013104 Bacteria 2561
321 Ga0157370_10201071 3300013104 Bacteria 1848
322 Ga0157369_10382418 3300013105 Bacteria 1461
323 Ga0157369_10590332 3300013105 Bacteria 1147
324 Ga0157374_10122097 3300013296 Bacteria 2515
325 Ga0157374_12130581 3300013296 Bacteria 588
326 Ga0163162_10081734 3300013306 Bacteria 3302
327 Ga0163162_10589954 3300013306 Bacteria 1238
328 Ga0163162_10641825 3300013306 Bacteria 1186
329 Ga0163162_11531835 3300013306 Bacteria 760
330 Ga0157372_10142218 3300013307 Bacteria 2765
331 Ga0157372_10196510 3300013307 Bacteria 2336
332 Ga0157372_10935308 3300013307 Bacteria 1005
333 Ga0157372_10961001 3300013307 Bacteria 990
334 Ga0157372_11074758 3300013307 Bacteria 931
335 Ga0157372_11960692 3300013307 Bacteria 673
336 Ga0157372_12610635 3300013307 Unclassified 580
337 Ga0157375_10396925 3300013308 Unclassified 1546
338 Ga0157375_11058544 3300013308 Bacteria 948
339 Ga0163163_10173671 3300014325 Bacteria 2201
340 Ga0163163_10274780 3300014325 Bacteria 1736
341 Ga0157380_10010723 3300014326 Bacteria 6604
342 Ga0182008_10045746 3300014497 Bacteria 2176
343 Ga0157377_10153597 3300014745 Bacteria 1425
344 Ga0157377_10594837 3300014745 Bacteria 788
345 Ga0157377_11726193 3300014745 Unclassified 506
346 Ga0157379_10006649 3300014968 Bacteria 9978
347 Ga0157379_10753369 3300014968 Bacteria 917
348 Ga0157379_10866178 3300014968 Bacteria 855
349 Ga0182006_1202542 3300015261 Bacteria 657
350 Ga0163161_10160190 3300017792 Bacteria 1716
351 Ga0163161_11131492 3300017792 Bacteria 674
352 Ga0213876_10361112 3300021384 Bacteria 772
353 Ga0207697_10034932 3300025315 Bacteria 2057
354 Ga0207697_10112929 3300025315 Bacteria 1164
355 Ga0207697_10392672 3300025315 Bacteria 616
356 Ga0207656_10002893 3300025321 Bacteria 5850
357 Ga0207656_10012184 3300025321 Bacteria 3265
358 Ga0207656_10256000 3300025321 Bacteria 859
359 Ga0207656_10748480 3300025321 Bacteria 501
360 Ga0207713_1207201 3300025735 Bacteria 598
361 Ga0207682_10436197 3300025893 Bacteria 620
362 Ga0207682_10490048 3300025893 Bacteria 582
363 Ga0207682_10518707 3300025893 Bacteria 564
364 Ga0207642_10062750 3300025899 Bacteria 1735
365 Ga0207710_10068091 3300025900 Bacteria 1627
366 Ga0207688_10842127 3300025901 Bacteria 581
367 Ga0207680_10144651 3300025903 Bacteria 1579
368 Ga0207680_10843903 3300025903 Bacteria 657
369 Ga0207647_10026662 3300025904 Bacteria 3777
370 Ga0207647_10046560 3300025904 Bacteria 2702
371 Ga0207647_10089230 3300025904 Bacteria 1840
372 Ga0207647_10328211 3300025904 Unclassified 868
373 Ga0207645_10000896 3300025907 Bacteria 24720
374 Ga0207645_10014320 3300025907 Bacteria 5311
375 Ga0207645_10287122 3300025907 Bacteria 1093
376 Ga0207645_10332604 3300025907 Bacteria 1015
377 Ga0207643_10428470 3300025908 Bacteria 839
378 Ga0207705_10001965 3300025909 Bacteria 16037
379 Ga0207705_10024198 3300025909 Bacteria 4334
380 Ga0207705_10061994 3300025909 Bacteria 2701
381 Ga0207705_10064531 3300025909 Bacteria 2646
382 Ga0207705_10086178 3300025909 Bacteria 2295
383 Ga0207705_10093412 3300025909 Bacteria 2205
384 Ga0207705_10105612 3300025909 Bacteria 2076
385 Ga0207705_10385583 3300025909 Bacteria 1083
386 Ga0207705_10546995 3300025909 Bacteria 900
387 Ga0207705_10924239 3300025909 Bacteria 675
388 Ga0207684_10278038 3300025910 Bacteria 1444
389 Ga0207654_10119268 3300025911 Bacteria 1654
390 Ga0207654_10249995 3300025911 Bacteria 1188
391 Ga0207707_10981200 3300025912 Bacteria 694
392 Ga0207707_10988102 3300025912 Bacteria 691
393 Ga0207707_11599366 3300025912 Bacteria 513
394 Ga0207671_10129455 3300025914 Bacteria 1936
395 Ga0207660_10073102 3300025917 Bacteria 2499
396 Ga0207660_11613543 3300025917 Bacteria 523
397 Ga0207662_10033903 3300025918 Bacteria 2979
398 Ga0207662_10853135 3300025918 Bacteria 643
399 Ga0207657_10007272 3300025919 Bacteria 11370
400 Ga0207657_10024029 3300025919 Bacteria 5659
401 Ga0207657_10044314 3300025919 Bacteria 3911
402 Ga0207657_10159436 3300025919 Bacteria 1833
403 Ga0207657_10809192 3300025919 Bacteria 724
404 Ga0207649_10007872 3300025920 Bacteria 5799
405 Ga0207649_10017923 3300025920 Bacteria 4016
406 Ga0207649_10255400 3300025920 Bacteria 1264
407 Ga0207649_11182494 3300025920 Bacteria 604
408 Ga0207649_11476306 3300025920 Bacteria 538
409 Ga0207652_10195944 3300025921 Bacteria 1817
410 Ga0207652_10539151 3300025921 Bacteria 1049
411 Ga0207681_10005902 3300025923 Bacteria 7509
412 Ga0207681_10065848 3300025923 Bacteria 2506
413 Ga0207681_10091891 3300025923 Bacteria 2169
414 Ga0207681_10399550 3300025923 Bacteria 1110
415 Ga0207681_10732046 3300025923 Bacteria 824
416 Ga0207681_10765765 3300025923 Bacteria 805
417 Ga0207650_10048831 3300025925 Bacteria 3122
418 Ga0207650_10081807 3300025925 Bacteria 2450
419 Ga0207650_10483622 3300025925 Bacteria 1033
420 Ga0207650_10700098 3300025925 Bacteria 856
421 Ga0207650_10858081 3300025925 Bacteria 770
422 Ga0207650_10984972 3300025925 Bacteria 717
423 Ga0207659_10145992 3300025926 Bacteria 1842
424 Ga0207659_10388818 3300025926 Bacteria 1165
425 Ga0207659_11290601 3300025926 Bacteria 627
426 Ga0207659_11579333 3300025926 Bacteria 560
427 Ga0207700_10051185 3300025928 Bacteria 3081
428 Ga0207664_10108634 3300025929 Bacteria 2303
429 Ga0207644_10009935 3300025931 Bacteria 6261
430 Ga0207644_10078292 3300025931 Bacteria 2436
431 Ga0207644_10189458 3300025931 Bacteria 1616
432 Ga0207644_10377694 3300025931 Bacteria 1155
433 Ga0207644_10681091 3300025931 Bacteria 857
434 Ga0207644_11223885 3300025931 Bacteria 631
435 Ga0207644_11260195 3300025931 Unclassified 621
436 Ga0207690_10024491 3300025932 Bacteria 3780
437 Ga0207690_10069444 3300025932 Bacteria 2424
438 Ga0207690_10098069 3300025932 Bacteria 2087
439 Ga0207690_10110271 3300025932 Bacteria 1981
440 Ga0207690_10150582 3300025932 Bacteria 1724
441 Ga0207690_10208131 3300025932 Bacteria 1490
442 Ga0207690_10301700 3300025932 Bacteria 1253
443 Ga0207690_10613980 3300025932 Bacteria 889
444 Ga0207706_10002920 3300025933 Bacteria 16518
445 Ga0207706_10016973 3300025933 Bacteria 6568
446 Ga0207706_10038549 3300025933 Bacteria 4239
447 Ga0207706_10059182 3300025933 Bacteria 3374
448 Ga0207706_10073838 3300025933 Bacteria 2999
449 Ga0207706_10155651 3300025933 Bacteria 2010
450 Ga0207706_10327685 3300025933 Bacteria 1332
451 Ga0207706_10411954 3300025933 Bacteria 1171
452 Ga0207706_11175213 3300025933 Bacteria 638
453 Ga0207706_11265900 3300025933 Bacteria 611
454 Ga0207706_11437268 3300025933 Unclassified 565
455 Ga0207706_11571973 3300025933 Bacteria 534
456 Ga0207709_10110073 3300025935 Bacteria 1840
457 Ga0207709_10290075 3300025935 Bacteria 1212
458 Ga0207669_10043744 3300025937 Bacteria 2625
459 Ga0207669_10090941 3300025937 Bacteria 1986
460 Ga0207669_10399535 3300025937 Bacteria 1076
461 Ga0207704_10360987 3300025938 Bacteria 1134
462 Ga0207704_10380619 3300025938 Unclassified 1108
463 Ga0207704_10485232 3300025938 Bacteria 993
464 Ga0207704_10640618 3300025938 Bacteria 874
465 Ga0207665_10373449 3300025939 Bacteria 1081
466 Ga0207691_10061771 3300025940 Bacteria 3403
467 Ga0207691_10140129 3300025940 Bacteria 2132
468 Ga0207691_10463185 3300025940 Bacteria 1078
469 Ga0207691_10491554 3300025940 Bacteria 1042
470 Ga0207711_10032298 3300025941 Bacteria 4426
471 Ga0207711_10079401 3300025941 Bacteria 2864
472 Ga0207711_10779090 3300025941 Bacteria 891
473 Ga0207711_10782851 3300025941 Bacteria 889
474 Ga0207711_11888227 3300025941 Bacteria 540
475 Ga0207689_10073436 3300025942 Bacteria 2810
476 Ga0207689_10150703 3300025942 Bacteria 1917
477 Ga0207689_10196854 3300025942 Bacteria 1663
478 Ga0207689_11366308 3300025942 Bacteria 594
479 Ga0207661_10546516 3300025944 Bacteria 1061
480 Ga0207661_10799291 3300025944 Bacteria 868
481 Ga0207679_10012302 3300025945 Bacteria 5576
482 Ga0207679_10018820 3300025945 Bacteria 4633
483 Ga0207679_10081752 3300025945 Bacteria 2471
484 Ga0207679_10084641 3300025945 Bacteria 2434
485 Ga0207679_10168770 3300025945 Bacteria 1799
486 Ga0207679_10318644 3300025945 Bacteria 1346
487 Ga0207679_11062291 3300025945 Unclassified 743
488 Ga0207679_11811151 3300025945 Bacteria 558
489 Ga0207679_12066526 3300025945 Bacteria 518
490 Ga0207667_10264237 3300025949 Bacteria 1760
491 Ga0207667_10719321 3300025949 Bacteria 1000
492 Ga0207651_10006856 3300025960 Bacteria 6012
493 Ga0207651_10727003 3300025960 Bacteria 876
494 Ga0207651_10924344 3300025960 Unclassified 777
495 Ga0207651_11100033 3300025960 Bacteria 712
496 Ga0207651_11442595 3300025960 Bacteria 620
497 Ga0207668_10000070 3300025972 Bacteria 78666
498 Ga0207668_10237129 3300025972 Bacteria 1474
499 Ga0207668_11243370 3300025972 Bacteria 670
500 Ga0207668_11263272 3300025972 Bacteria 664
501 Ga0207668_11726148 3300025972 Bacteria 565
502 Ga0207640_10035015 3300025981 Bacteria 3139
503 Ga0207640_10959695 3300025981 Bacteria 750
504 Ga0207658_10004581 3300025986 Bacteria 9596
505 Ga0207658_10035124 3300025986 Bacteria 3588
506 Ga0207658_10044969 3300025986 Bacteria 3216
507 Ga0207658_11081175 3300025986 Bacteria 732
508 Ga0207677_10630678 3300026023 Bacteria 944
509 Ga0207677_12248673 3300026023 Unclassified 507
510 Ga0207703_10146263 3300026035 Bacteria 2056
511 Ga0207703_10163523 3300026035 Bacteria 1951
512 Ga0207639_10166842 3300026041 Bacteria 1861
513 Ga0207639_10305987 3300026041 Bacteria 1407
514 Ga0207639_10655743 3300026041 Bacteria 971
515 Ga0207678_10015045 3300026067 Bacteria 6807
516 Ga0207678_10148222 3300026067 Bacteria 2003
517 Ga0207678_10181273 3300026067 Bacteria 1798
518 Ga0207678_10400274 3300026067 Bacteria 1189
519 Ga0207678_10554615 3300026067 Bacteria 1005
520 Ga0207678_10583045 3300026067 Bacteria 980
521 Ga0207678_10856055 3300026067 Bacteria 803
522 Ga0207702_10005600 3300026078 Bacteria 10963
523 Ga0207702_10809414 3300026078 Bacteria 926
524 Ga0207641_10073932 3300026088 Bacteria 2938
525 Ga0207641_10097779 3300026088 Bacteria 2580
526 Ga0207641_10987317 3300026088 Bacteria 838
527 Ga0207641_11509909 3300026088 Bacteria 673
528 Ga0207641_11602943 3300026088 Bacteria 653
529 Ga0207648_10001147 3300026089 Bacteria 29705
530 Ga0207648_10013848 3300026089 Bacteria 7481
531 Ga0207648_10028525 3300026089 Bacteria 4947
532 Ga0207648_10237468 3300026089 Bacteria 1622
533 Ga0207648_11899547 3300026089 Bacteria 557
534 Ga0207676_10010550 3300026095 Bacteria 6584
535 Ga0207676_10180833 3300026095 Bacteria 1846
536 Ga0207676_10248481 3300026095 Bacteria 1600
537 Ga0207676_11844958 3300026095 Bacteria 603
538 Ga0207676_12231303 3300026095 Bacteria 545
539 Ga0207674_10000308 3300026116 Bacteria 62120
540 Ga0207674_10002878 3300026116 Bacteria 21384
541 Ga0207674_10009470 3300026116 Bacteria 11125
542 Ga0207674_10066032 3300026116 Bacteria 3645
543 Ga0207674_10238069 3300026116 Bacteria 1767
544 Ga0207675_100257119 3300026118 Bacteria 1692
545 Ga0207683_10024070 3300026121 Bacteria 5240
546 Ga0207683_10101882 3300026121 Bacteria 2563
547 Ga0207683_10114046 3300026121 Bacteria 2421
548 Ga0207683_10156523 3300026121 Bacteria 2058
549 Ga0207698_10201097 3300026142 Bacteria 1784
550 Ga0207698_11056276 3300026142 Bacteria 824
551 Ga0207698_11107684 3300026142 Bacteria 805
552 Ga0209974_10083763 3300027876 Bacteria 1100
553 Ga0268266_10000315 3300028379 Bacteria 76532
554 Ga0268266_10732274 3300028379 Bacteria 954
555 Ga0268266_10766762 3300028379 Bacteria 931
556 Ga0268266_10909639 3300028379 Bacteria 851
557 Ga0268266_11579413 3300028379 Bacteria 631
558 Ga0268265_10066103 3300028380 Bacteria 2794
559 Ga0268265_10079746 3300028380 Bacteria 2579
560 Ga0268265_10827079 3300028380 Bacteria 904
561 Ga0268265_10863786 3300028380 Bacteria 886
562 Ga0268264_10066329 3300028381 Bacteria 3043
563 Ga0268264_11786100 3300028381 Bacteria 625
564 Ga0307408_100011889 3300031548 Bacteria 5759
565 Ga0307408_100029310 3300031548 Bacteria 3812
566 Ga0307408_100401901 3300031548 Bacteria 1176
567 Ga0307408_100724948 3300031548 Bacteria 896
568 Ga0307408_101297580 3300031548 Bacteria 682
569 Ga0307405_10065406 3300031731 Bacteria 2314
570 Ga0307405_10173684 3300031731 Bacteria 1540
571 Ga0307405_10382513 3300031731 Bacteria 1096
572 Ga0307405_10400061 3300031731 Bacteria 1075
573 Ga0307405_10526524 3300031731 Bacteria 952
574 Ga0307405_10604455 3300031731 Bacteria 895
575 Ga0307405_11314789 3300031731 Bacteria 629
576 Ga0307413_10008886 3300031824 Bacteria 4773
577 Ga0307413_10018307 3300031824 Bacteria 3672
578 Ga0307413_10041265 3300031824 Bacteria 2700
579 Ga0307413_10060096 3300031824 Bacteria 2338
580 Ga0307413_10062051 3300031824 Bacteria 2310
581 Ga0307413_10068638 3300031824 Bacteria 2221
582 Ga0307413_10090035 3300031824 Bacteria 1995
583 Ga0307413_10093811 3300031824 Bacteria 1963
584 Ga0307413_10094504 3300031824 Bacteria 1957
585 Ga0307413_10140627 3300031824 Bacteria 1667
586 Ga0307413_10214573 3300031824 Bacteria 1400
587 Ga0307413_10460547 3300031824 Bacteria 1011
588 Ga0307413_10494498 3300031824 Bacteria 981
589 Ga0307413_10570072 3300031824 Bacteria 921
590 Ga0307413_11577875 3300031824 Bacteria 582
591 Ga0307413_12193465 3300031824 Bacteria 501
592 Ga0307410_10012027 3300031852 Bacteria 4981
593 Ga0307410_10035962 3300031852 Bacteria 3221
594 Ga0307410_10058215 3300031852 Bacteria 2634
595 Ga0307410_10059315 3300031852 Bacteria 2612
596 Ga0307410_10082864 3300031852 Bacteria 2257
597 Ga0307410_10153595 3300031852 Bacteria 1716
598 Ga0307410_10189258 3300031852 Bacteria 1564
599 Ga0307410_10433732 3300031852 Bacteria 1068
600 Ga0307410_10437324 3300031852 Bacteria 1064
601 Ga0307410_10467600 3300031852 Bacteria 1032
602 Ga0307410_10660891 3300031852 Bacteria 877
603 Ga0307410_11381946 3300031852 Unclassified 618
604 Ga0307410_11670068 3300031852 Bacteria 564
605 Ga0307406_10018474 3300031901 Bacteria 4075
606 Ga0307406_10043702 3300031901 Bacteria 2803
607 Ga0307406_10087952 3300031901 Bacteria 2084
608 Ga0307406_10298540 3300031901 Bacteria 1236
609 Ga0307406_10309011 3300031901 Bacteria 1218
610 Ga0307406_11731092 3300031901 Bacteria 554
611 Ga0307407_10025709 3300031903 Bacteria 3107
612 Ga0307407_10059415 3300031903 Bacteria 2227
613 Ga0307407_10088709 3300031903 Bacteria 1890
614 Ga0307407_10162004 3300031903 Bacteria 1465
615 Ga0307407_10397250 3300031903 Bacteria 988
616 Ga0307412_10133334 3300031911 Bacteria 1808
617 Ga0307412_10172699 3300031911 Bacteria 1617
618 Ga0307412_10374289 3300031911 Unclassified 1151
619 Ga0307412_10714590 3300031911 Bacteria 861
620 Ga0307412_10726617 3300031911 Bacteria 855
621 Ga0307412_11029944 3300031911 Bacteria 729
622 Ga0307412_11176782 3300031911 Bacteria 685
623 Ga0307412_11216157 3300031911 Unclassified 675
624 Ga0307412_11534390 3300031911 Bacteria 606
625 Ga0307409_100166809 3300031995 Bacteria 1933
626 Ga0307409_100188014 3300031995 Bacteria 1835
627 Ga0307409_100215525 3300031995 Bacteria 1729
628 Ga0307409_100216374 3300031995 Bacteria 1726
629 Ga0307409_100316452 3300031995 Bacteria 1459
630 Ga0307409_100342244 3300031995 Bacteria 1408
631 Ga0307409_100432532 3300031995 Bacteria 1265
632 Ga0307409_100662179 3300031995 Bacteria 1039
633 Ga0307409_100698213 3300031995 Bacteria 1013
634 Ga0307409_101211804 3300031995 Bacteria 778
635 Ga0307409_101218245 3300031995 Bacteria 776
636 Ga0307409_101369310 3300031995 Bacteria 733
637 Ga0307409_101459233 3300031995 Bacteria 711
638 Ga0307409_101646304 3300031995 Unclassified 670
639 Ga0307409_101796060 3300031995 Bacteria 642
640 Ga0307409_102175955 3300031995 Bacteria 584
641 Ga0307416_100011951 3300032002 Bacteria 5824
642 Ga0307416_100012629 3300032002 Bacteria 5700
643 Ga0307416_100124183 3300032002 Bacteria 2309
644 Ga0307416_100208353 3300032002 Bacteria 1862
645 Ga0307416_100323553 3300032002 Bacteria 1546
646 Ga0307416_100357784 3300032002 Bacteria 1480
647 Ga0307416_100414379 3300032002 Bacteria 1389
648 Ga0307416_100420958 3300032002 Unclassified 1380
649 Ga0307416_100835229 3300032002 Bacteria 1019
650 Ga0307416_100990658 3300032002 Bacteria 943
651 Ga0307416_102651869 3300032002 Bacteria 598
652 Ga0307416_103085616 3300032002 Unclassified 557
653 Ga0307414_10003689 3300032004 Bacteria 8209
654 Ga0307414_10027762 3300032004 Bacteria 3662
655 Ga0307414_10096978 3300032004 Bacteria 2207
656 Ga0307414_10189122 3300032004 Bacteria 1664
657 Ga0307414_10195532 3300032004 Bacteria 1640
658 Ga0307414_10229875 3300032004 Bacteria 1528
659 Ga0307414_10238328 3300032004 Bacteria 1504
660 Ga0307414_10276398 3300032004 Bacteria 1409
661 Ga0307414_10332344 3300032004 Bacteria 1298
662 Ga0307414_10524743 3300032004 Bacteria 1051
663 Ga0307414_10631204 3300032004 Unclassified 964
664 Ga0307414_11063029 3300032004 Bacteria 746
665 Ga0307414_12070186 3300032004 Bacteria 531
666 Ga0307414_12108842 3300032004 Bacteria 526
667 Ga0307411_10001276 3300032005 Bacteria 10094
668 Ga0307411_10012473 3300032005 Bacteria 4639
669 Ga0307411_10032088 3300032005 Bacteria 3241
670 Ga0307411_10037558 3300032005 Bacteria 3046
671 Ga0307411_10066526 3300032005 Bacteria 2421
672 Ga0307411_10069353 3300032005 Bacteria 2380
673 Ga0307411_10077866 3300032005 Bacteria 2271
674 Ga0307411_10121562 3300032005 Bacteria 1890
675 Ga0307411_10256952 3300032005 Bacteria 1377
676 Ga0307411_10283152 3300032005 Bacteria 1320
677 Ga0307411_10433125 3300032005 Bacteria 1095
678 Ga0307411_10778678 3300032005 Bacteria 840
679 Ga0307411_10801155 3300032005 Bacteria 829
680 Ga0307411_10927361 3300032005 Bacteria 775
681 Ga0307411_11013980 3300032005 Bacteria 744
682 Ga0307411_11017938 3300032005 Bacteria 742
683 Ga0307411_11174542 3300032005 Bacteria 695
684 Ga0307415_100042173 3300032126 Bacteria 3035
685 Ga0307415_100058166 3300032126 Bacteria 2660
686 Ga0307415_100065070 3300032126 Bacteria 2539
687 Ga0307415_100126970 3300032126 Unclassified 1924
688 Ga0307415_100150070 3300032126 Bacteria 1793
689 Ga0307415_100233595 3300032126 Bacteria 1482
690 Ga0307415_100385674 3300032126 Bacteria 1191
691 Ga0307415_100541826 3300032126 Bacteria 1025
692 Ga0307415_101824770 3300032126 Bacteria 589
693 Ga0373959_0140115 3300034820 Bacteria 605
694 Ga0395899_0136060 3300037312 Unclassified 1751
695 Ga0395899_0432078 3300037312 Unclassified 866
696 Ga0395899_0454091 3300037312 Bacteria 839
697 Ga0395899_0585588 3300037312 Bacteria 712
698 Ga0395899_0875507 3300037312 Unclassified 549
699 Ga0395900_0000325 3300037418 Bacteria 70579
700 Ga0395900_0026676 3300037418 Bacteria 5914
701 Ga0395900_0083036 3300037418 Bacteria 3291
702 Ga0395900_0187845 3300037418 Bacteria 2097
703 Ga0395900_0224583 3300037418 Bacteria 1891
704 Ga0395900_0323105 3300037418 Bacteria 1523
705 Ga0395900_0353400 3300037418 Bacteria 1443
706 Ga0395900_0422645 3300037418 Bacteria 1293
707 Ga0395898_0059038 3300037466 Bacteria 3734
708 Ga0395905_0000218 3300037471 Bacteria 87745
709 Ga0395905_0002116 3300037471 Bacteria 22546
710 Ga0395905_0024115 3300037471 Bacteria 5741
711 Ga0395905_0045805 3300037471 Bacteria 4102
712 Ga0395905_0071455 3300037471 Bacteria 3253
713 Ga0395905_0125488 3300037471 Bacteria 2413
714 Ga0395905_0218635 3300037471 Bacteria 1783
715 Ga0395905_0340328 3300037471 Bacteria 1391
716 Ga0395905_0583364 3300037471 Bacteria 1019
717 Ga0395905_0638584 3300037471 Bacteria 966
718 Ga0395905_0775783 3300037471 Bacteria 861
719 Ga0395905_1158123 3300037471 Bacteria 677
720 Ga0395905_1627359 3300037471 Bacteria 551
721 Ga0395901_0000962 3300038443 Bacteria 31358
722 Ga0395901_0059700 3300038443 Bacteria 3968
723 Ga0395901_0114055 3300038443 Unclassified 2838
724 Ga0395901_0163469 3300038443 Bacteria 2337
725 Ga0395901_0280439 3300038443 Bacteria 1731
726 Ga0395901_0356774 3300038443 Bacteria 1508
727 Ga0395901_0449364 3300038443 Bacteria 1318
728 Ga0395901_1247514 3300038443 Bacteria 707
729 Ga0395901_1986034 3300038443 Bacteria 528
730 Ga0436365_1446270 3300039437 Bacteria 1293
731 Ga0439436_0092581 3300041404 Bacteria 842
732 Ga0439436_0263724 3300041404 Bacteria 502
733 Ga0439447_080412 3300041407 Unclassified 753
734 Ga0439461_0113694 3300041410 Bacteria 671
735 Ga0450890_003198 3300042127 Bacteria 2187
736 Ga0450902_080904 3300042137 Bacteria 571
737 Ga0450905_001426 3300042142 Bacteria 3052
738 Ga0450889_001073 3300042144 Bacteria 2870
739 Ga0439464_0001273 3300042439 Bacteria 5861
740 Ga0439460_0285751 3300042461 Bacteria 575
741 Ga0466972_0172332 3300044658 Bacteria 1015
742 Ga0466965_0408229 3300044683 Bacteria 751
743 Ga0466965_0869016 3300044683 Bacteria 525
744 Ga0466957_1102527 3300044842 Bacteria 572
745 Ga0466960_0079354 3300044901 Bacteria 1650
746 Ga0466960_0394845 3300044901 Bacteria 796
747 Ga0495629_0959256 3300046459 Bacteria 558
748 Ga0495596_0070445 3300046500 Bacteria 1359
749 Ga0495596_0179050 3300046500 Unclassified 824
750 Ga0495663_0030415 3300046525 Bacteria 1600
751 Ga0495663_0043479 3300046525 Bacteria 1372
752 Ga0495663_0065241 3300046525 Bacteria 1150
753 Ga0495663_0097656 3300046525 Bacteria 964
754 Ga0495598_0163450 3300046537 Bacteria 785
755 Ga0495621_0007454 3300046539 Bacteria 3240
756 Ga0495621_0060120 3300046539 Bacteria 1377
757 Ga0495621_0512259 3300046539 Bacteria 518
758 Ga0495633_0006238 3300046558 Bacteria 7118
759 Ga0495656_0776576 3300046615 Bacteria 517
760 Ga0495668_0012970 3300046616 Bacteria 4933
761 Ga0495668_0361688 3300046616 Bacteria 797
762 Ga0495659_0022463 3300046664 Bacteria 2135
763 Ga0495669_0001299 3300046684 Bacteria 10357
764 Ga0495669_0042121 3300046684 Bacteria 2029
765 Ga0495669_0126167 3300046684 Bacteria 1202
766 Ga0495669_0160775 3300046684 Bacteria 1066
767 Ga0495669_0295848 3300046684 Bacteria 780
768 Ga0495670_0015020 3300046691 Bacteria 3810
769 Ga0495670_0102544 3300046691 Bacteria 1474
770 Ga0495670_0466437 3300046691 Bacteria 685
771 Ga0495636_0613997 3300047318 Bacteria 532
772 Ga0495677_0046311 3300047445 Bacteria 1596
773 Ga0495677_0051784 3300047445 Bacteria 1512
774 Ga0495685_197201 3300047447 Bacteria 646
775 Ga0495685_198761 3300047447 Bacteria 643
776 Ga0496100_0099324 3300048903 Bacteria 2003
777 Ga0496100_1105223 3300048903 Bacteria 625
778 Ga0496101_0775627 3300048904 Bacteria 756
779 Ga0496101_0940404 3300048904 Bacteria 680
780 Ga0496102_0116691 3300048905 Bacteria 2491
781 Ga0496102_0565731 3300048905 Bacteria 1059
782 Ga0496103_0007362 3300048906 Bacteria 6560
783 Ga0496103_0209985 3300048906 Bacteria 1252
784 Ga0496103_0254231 3300048906 Bacteria 1131
785 Ga0496104_0166791 3300048907 Bacteria 2112
786 Ga0496104_0623810 3300048907 Bacteria 988
787 Ga0496104_1089069 3300048907 Bacteria 703
788 Ga0496104_1108729 3300048907 Unclassified 695
789 Ga0496105_0251475 3300048908 Bacteria 1432
790 Ga0496105_0787608 3300048908 Bacteria 724
791 Ga0496105_1217246 3300048908 Bacteria 554
792 Ga0496106_0482926 3300048909 Unclassified 995
793 Ga0496107_0043298 3300048910 Bacteria 3234
794 Ga0496107_0149558 3300048910 Bacteria 1727
795 Ga0496107_0488575 3300048910 Bacteria 913
796 Ga0496107_0883511 3300048910 Bacteria 652
797 Ga0496108_0010565 3300048911 Bacteria 7495
798 Ga0496108_0039973 3300048911 Bacteria 3908
799 Ga0496108_0906935 3300048911 Bacteria 756
800 Ga0496109_0008469 3300048912 Bacteria 8743
801 Ga0496109_0045704 3300048912 Bacteria 3974
802 Ga0496109_1858705 3300048912 Bacteria 535
803 Ga0496110_0002515 3300048913 Bacteria 13774
804 Ga0496110_0023537 3300048913 Bacteria 5240
805 Ga0496110_0070841 3300048913 Bacteria 3090
806 Ga0496110_0475117 3300048913 Bacteria 1139
807 Ga0496111_0003916 3300048914 Bacteria 9331
808 Ga0496111_0007201 3300048914 Bacteria 7273
809 Ga0496111_0063305 3300048914 Bacteria 2682
810 Ga0496112_0003787 3300048915 Bacteria 12636
811 Ga0496112_0066201 3300048915 Bacteria 3565
812 Ga0496112_0067093 3300048915 Bacteria 3540
813 Ga0496112_0756531 3300048915 Bacteria 898
814 Ga0496112_0876435 3300048915 Bacteria 820
815 Ga0496112_0940316 3300048915 Bacteria 785
816 Ga0496113_0002425 3300048916 Bacteria 10840
817 Ga0501067_0033983 3300049583 Bacteria 2830
818 Ga0501067_0826484 3300049583 Bacteria 522
819 Ga0501068_0876301 3300049584 Bacteria 590
820 Ga0501069_0486446 3300049585 Bacteria 735
821 Ga0501202_039918 3300049652 Bacteria 1010
822 Ga0501207_106283 3300049654 Bacteria 569
823 Ga0501209_021727 3300049656 Bacteria 1530
824 Ga0501216_191078 3300049660 Bacteria 503
825 Ga0501235_010718 3300049669 Bacteria 2004
826 Ga0501235_037664 3300049669 Bacteria 1101
827 Ga0501242_014640 3300049674 Bacteria 972
828 Ga0501253_123161 3300049683 Bacteria 630
829 Ga0501257_041658 3300049686 Unclassified 1129
830 Ga0501258_061312 3300049687 Bacteria 544
831 Ga0501259_206948 3300049688 Bacteria 504
832 Ga0501221_012393 3300049704 Bacteria 1551
833 Ga0501221_216071 3300049704 Bacteria 539
834 Ga0501225_0041815 3300049705 Bacteria 1265
835 Ga0501225_0345578 3300049705 Bacteria 514
836 Ga0501268_008468 3300049765 Bacteria 1559
837 Ga0501272_023855 3300049769 Bacteria 747
838 Ga0501273_030918 3300049770 Bacteria 762
839 Ga0501279_078600 3300049775 Bacteria 566
840 nmdc:mga05p37_1177585_c1 3300050507 Bacteria 794
841 nmdc:mga09592_161265_c1 3300050508 Bacteria 1937
842 nmdc:mga09592_971207_c1 3300050508 Bacteria 711
843 nmdc:mga08y16_133627_c1 3300050511 Bacteria 2579
844 nmdc:mga08y16_752069_c1 3300050511 Bacteria 971
845 nmdc:mga0n895_1974672_c1 3300050512 Bacteria 541
846 nmdc:mga0rr50_1018523_c1 3300050513 Bacteria 705
847 nmdc:mga0sz30_152865_c1 3300050516 Unclassified 1021
848 Ga0500658_0000041 3300053134 Bacteria 77435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0408229 Ga0466965_0408229_14_232 58
2 3300005335 Ga0070666_10275760 Ga0070666_102757603 65
3 3300005355 Ga0070671_100059877 Ga0070671_1000598773 65
4 3300005367 Ga0070667_100319020 Ga0070667_1003190203 65
5 3300006358 Ga0068871_100815928 Ga0068871_1008159282 65
6 3300013102 Ga0157371_10409949 Ga0157371_104099492 65
7 3300048905 Ga0496102_0116691 Ga0496102_0116691_1250_1465 65
8 3300048906 Ga0496103_0209985 Ga0496103_0209985_188_403 65
9 3300048907 Ga0496104_1108729 Ga0496104_1108729_220_435 65
10 3300048908 Ga0496105_0787608 Ga0496105_0787608_81_296 65
11 3300005563 Ga0068855_102509242 Ga0068855_1025092422 66
12 3300009177 Ga0105248_11529196 Ga0105248_115291962 66
13 3300025918 Ga0207662_10033903 Ga0207662_100339037 66
14 3300031852 Ga0307410_10437324 Ga0307410_104373242 66
15 3300032004 Ga0307414_10332344 Ga0307414_103323443 66
16 3300001904 JGI24736J21556_1063138 JGI24736J21556_10631382 67
17 3300001989 JGI24739J22299_10153601 JGI24739J22299_101536012 67
18 3300001990 JGI24737J22298_10032027 JGI24737J22298_100320271 67
19 3300002067 JGI24735J21928_10018161 JGI24735J21928_100181612 67
20 3300005331 Ga0070670_100090749 Ga0070670_1000907491 67
21 3300005331 Ga0070670_100116328 Ga0070670_1001163282 67
22 3300005331 Ga0070670_101999614 Ga0070670_1019996141 67
23 3300005339 Ga0070660_100075646 Ga0070660_1000756463 67
24 3300005339 Ga0070660_100212206 Ga0070660_1002122063 67
25 3300005341 Ga0070691_10114126 Ga0070691_101141262 67
26 3300005345 Ga0070692_11177350 Ga0070692_111773502 67
27 3300005355 Ga0070671_100027435 Ga0070671_1000274352 67
28 3300005355 Ga0070671_100066201 Ga0070671_1000662015 67
29 3300005356 Ga0070674_100011647 Ga0070674_1000116477 67
30 3300005364 Ga0070673_100022961 Ga0070673_1000229612 67
31 3300005366 Ga0070659_100014006 Ga0070659_1000140064 67
32 3300005457 Ga0070662_100008232 Ga0070662_1000082324 67
33 3300005458 Ga0070681_10034249 Ga0070681_100342493 67
34 3300005539 Ga0068853_101672803 Ga0068853_1016728032 67
35 3300005546 Ga0070696_100222395 Ga0070696_1002223952 67
36 3300005547 Ga0070693_100118954 Ga0070693_1001189542 67
37 3300005564 Ga0070664_100007027 Ga0070664_10000702712 67
38 3300005564 Ga0070664_100662015 Ga0070664_1006620152 67
39 3300005564 Ga0070664_100734325 Ga0070664_1007343252 67
40 3300005577 Ga0068857_100033123 Ga0068857_1000331239 67
41 3300005578 Ga0068854_100035685 Ga0068854_1000356852 67
42 3300005614 Ga0068856_100134549 Ga0068856_1001345495 67
43 3300005616 Ga0068852_100330037 Ga0068852_1003300372 67
44 3300005618 Ga0068864_100025846 Ga0068864_1000258462 67
45 3300005834 Ga0068851_10357712 Ga0068851_103577122 67
46 3300005841 Ga0068863_100035175 Ga0068863_1000351752 67
47 3300005841 Ga0068863_101286743 Ga0068863_1012867432 67
48 3300005842 Ga0068858_100589575 Ga0068858_1005895752 67
49 3300005985 Ga0081539_10024274 Ga0081539_100242742 67
50 3300005985 Ga0081539_10111840 Ga0081539_101118402 67
51 3300006358 Ga0068871_100198259 Ga0068871_1001982593 67
52 3300009148 Ga0105243_12705856 Ga0105243_127058562 67
53 3300009177 Ga0105248_10136957 Ga0105248_101369572 67
54 3300012512 Ga0157327_1033179 Ga0157327_10331792 67
55 3300013100 Ga0157373_10606145 Ga0157373_106061452 67
56 3300013102 Ga0157371_11300961 Ga0157371_113009612 67
57 3300013306 Ga0163162_10081734 Ga0163162_100817345 67
58 3300013307 Ga0157372_11074758 Ga0157372_110747582 67
59 3300013307 Ga0157372_12610635 Ga0157372_126106352 67
60 3300013308 Ga0157375_10396925 Ga0157375_103969252 67
61 3300025909 Ga0207705_10924239 Ga0207705_109242392 67
62 3300025917 Ga0207660_11613543 Ga0207660_116135432 67
63 3300025919 Ga0207657_10044314 Ga0207657_100443142 67
64 3300025920 Ga0207649_10017923 Ga0207649_100179235 67
65 3300025925 Ga0207650_10048831 Ga0207650_100488312 67
66 3300025925 Ga0207650_10984972 Ga0207650_109849722 67
67 3300025932 Ga0207690_10098069 Ga0207690_100980694 67
68 3300025949 Ga0207667_10719321 Ga0207667_107193212 67
69 3300025972 Ga0207668_11726148 Ga0207668_117261482 67
70 3300026067 Ga0207678_10856055 Ga0207678_108560552 67
71 3300026078 Ga0207702_10809414 Ga0207702_108094142 67
72 3300026116 Ga0207674_10066032 Ga0207674_100660322 67
73 3300031731 Ga0307405_10173684 Ga0307405_101736842 67
74 3300031824 Ga0307413_10008886 Ga0307413_100088869 67
75 3300031824 Ga0307413_12193465 Ga0307413_121934652 67
76 3300031852 Ga0307410_10058215 Ga0307410_100582152 67
77 3300031852 Ga0307410_11670068 Ga0307410_116700682 67
78 3300031901 Ga0307406_10309011 Ga0307406_103090112 67
79 3300031903 Ga0307407_10397250 Ga0307407_103972502 67
80 3300031911 Ga0307412_10714590 Ga0307412_107145902 67
81 3300031995 Ga0307409_100215525 Ga0307409_1002155252 67
82 3300031995 Ga0307409_102175955 Ga0307409_1021759552 67
83 3300032002 Ga0307416_100011951 Ga0307416_1000119519 67
84 3300032004 Ga0307414_10189122 Ga0307414_101891222 67
85 3300032005 Ga0307411_10256952 Ga0307411_102569523 67
86 3300032126 Ga0307415_100058166 Ga0307415_1000581662 67
87 3300037418 Ga0395900_0353400 Ga0395900_0353400_821_1033 67
88 3300037471 Ga0395905_0775783 Ga0395905_0775783_561_773 67
89 3300037471 Ga0395905_1627359 Ga0395905_1627359_329_535 67
90 3300046684 Ga0495669_0042121 Ga0495669_0042121_1717_1935 67
91 3300048905 Ga0496102_0565731 Ga0496102_0565731_306_518 67
92 3300048907 Ga0496104_0623810 Ga0496104_0623810_381_593 67
93 3300048913 Ga0496110_0475117 Ga0496110_0475117_493_705 67
94 3300048915 Ga0496112_0876435 Ga0496112_0876435_240_452 67
95 3300049669 Ga0501235_037664 Ga0501235_037664_452_667 67
96 3300049705 Ga0501225_0345578 Ga0501225_0345578_275_490 67
97 3300001979 JGI24740J21852_10136104 JGI24740J21852_101361042 68
98 3300001990 JGI24737J22298_10246022 JGI24737J22298_102460222 68
99 3300002067 JGI24735J21928_10008884 JGI24735J21928_100088845 68
100 3300003323 rootH1_10233400 rootH1_102334003 68
101 3300005327 Ga0070658_10048462 Ga0070658_100484622 68
102 3300005327 Ga0070658_10374215 Ga0070658_103742152 68
103 3300005327 Ga0070658_10712416 Ga0070658_107124162 68
104 3300005327 Ga0070658_10756568 Ga0070658_107565682 68
105 3300005327 Ga0070658_11312374 Ga0070658_113123742 68
106 3300005328 Ga0070676_10104474 Ga0070676_101044744 68
107 3300005328 Ga0070676_10348171 Ga0070676_103481712 68
108 3300005329 Ga0070683_100096580 Ga0070683_1000965803 68
109 3300005329 Ga0070683_101118406 Ga0070683_1011184062 68
110 3300005330 Ga0070690_100557112 Ga0070690_1005571121 68
111 3300005331 Ga0070670_100008324 Ga0070670_1000083247 68
112 3300005331 Ga0070670_100257627 Ga0070670_1002576272 68
113 3300005333 Ga0070677_10555225 Ga0070677_105552252 68
114 3300005334 Ga0068869_100567022 Ga0068869_1005670222 68
115 3300005335 Ga0070666_10532349 Ga0070666_105323492 68
116 3300005336 Ga0070680_100260887 Ga0070680_1002608873 68
117 3300005336 Ga0070680_100324275 Ga0070680_1003242753 68
118 3300005336 Ga0070680_101666829 Ga0070680_1016668292 68
119 3300005337 Ga0070682_100203586 Ga0070682_1002035863 68
120 3300005339 Ga0070660_100059424 Ga0070660_1000594242 68
121 3300005339 Ga0070660_100078186 Ga0070660_1000781862 68
122 3300005339 Ga0070660_100358965 Ga0070660_1003589652 68
123 3300005339 Ga0070660_100574384 Ga0070660_1005743842 68
124 3300005339 Ga0070660_101366808 Ga0070660_1013668082 68
125 3300005344 Ga0070661_100009966 Ga0070661_1000099662 68
126 3300005344 Ga0070661_100243216 Ga0070661_1002432163 68
127 3300005344 Ga0070661_100876166 Ga0070661_1008761662 68
128 3300005344 Ga0070661_100980028 Ga0070661_1009800282 68
129 3300005345 Ga0070692_10043292 Ga0070692_100432923 68
130 3300005347 Ga0070668_100136264 Ga0070668_1001362642 68
131 3300005354 Ga0070675_102013202 Ga0070675_1020132021 68
132 3300005355 Ga0070671_100002896 Ga0070671_1000028968 68
133 3300005355 Ga0070671_100003087 Ga0070671_10000308715 68
134 3300005355 Ga0070671_100059138 Ga0070671_1000591382 68
135 3300005355 Ga0070671_100178201 Ga0070671_1001782012 68
136 3300005356 Ga0070674_100097187 Ga0070674_1000971874 68
137 3300005356 Ga0070674_100119938 Ga0070674_1001199383 68
138 3300005364 Ga0070673_100104094 Ga0070673_1001040942 68
139 3300005364 Ga0070673_102318906 Ga0070673_1023189061 68
140 3300005366 Ga0070659_100006023 Ga0070659_10000602312 68
141 3300005366 Ga0070659_100030454 Ga0070659_1000304542 68
142 3300005366 Ga0070659_100174859 Ga0070659_1001748592 68
143 3300005366 Ga0070659_100223854 Ga0070659_1002238542 68
144 3300005367 Ga0070667_100011528 Ga0070667_1000115282 68
145 3300005367 Ga0070667_101816406 Ga0070667_1018164061 68
146 3300005406 Ga0070703_10528058 Ga0070703_105280581 68
147 3300005455 Ga0070663_100080310 Ga0070663_1000803102 68
148 3300005455 Ga0070663_100138820 Ga0070663_1001388202 68
149 3300005455 Ga0070663_100492254 Ga0070663_1004922541 68
150 3300005455 Ga0070663_100568611 Ga0070663_1005686112 68
151 3300005455 Ga0070663_100587933 Ga0070663_1005879332 68
152 3300005455 Ga0070663_100828172 Ga0070663_1008281721 68
153 3300005455 Ga0070663_101177204 Ga0070663_1011772042 68
154 3300005456 Ga0070678_100003214 Ga0070678_1000032147 68
155 3300005456 Ga0070678_100052107 Ga0070678_1000521074 68
156 3300005457 Ga0070662_100027862 Ga0070662_1000278622 68
157 3300005457 Ga0070662_100047133 Ga0070662_1000471334 68
158 3300005457 Ga0070662_100050854 Ga0070662_1000508543 68
159 3300005457 Ga0070662_100116544 Ga0070662_1001165442 68
160 3300005457 Ga0070662_100149126 Ga0070662_1001491263 68
161 3300005457 Ga0070662_100955457 Ga0070662_1009554572 68
162 3300005457 Ga0070662_101449773 Ga0070662_1014497732 68
163 3300005458 Ga0070681_10216233 Ga0070681_102162332 68
164 3300005458 Ga0070681_10244658 Ga0070681_102446582 68
165 3300005459 Ga0068867_100003727 Ga0068867_10000372715 68
166 3300005459 Ga0068867_100011300 Ga0068867_10001130010 68
167 3300005467 Ga0070706_100209129 Ga0070706_1002091294 68
168 3300005530 Ga0070679_100336185 Ga0070679_1003361852 68
169 3300005530 Ga0070679_100974055 Ga0070679_1009740552 68
170 3300005530 Ga0070679_101247843 Ga0070679_1012478432 68
171 3300005530 Ga0070679_101520204 Ga0070679_1015202042 68
172 3300005535 Ga0070684_100433456 Ga0070684_1004334563 68
173 3300005539 Ga0068853_100050171 Ga0068853_1000501712 68
174 3300005539 Ga0068853_100487239 Ga0068853_1004872393 68
175 3300005539 Ga0068853_100888068 Ga0068853_1008880682 68
176 3300005543 Ga0070672_100431764 Ga0070672_1004317643 68
177 3300005543 Ga0070672_100866842 Ga0070672_1008668422 68
178 3300005545 Ga0070695_100011170 Ga0070695_1000111702 68
179 3300005546 Ga0070696_100020112 Ga0070696_1000201129 68
180 3300005547 Ga0070693_100092633 Ga0070693_1000926334 68
181 3300005548 Ga0070665_100000785 Ga0070665_1000007852 68
182 3300005548 Ga0070665_100079619 Ga0070665_1000796197 68
183 3300005548 Ga0070665_100374571 Ga0070665_1003745712 68
184 3300005563 Ga0068855_100229792 Ga0068855_1002297921 68
185 3300005563 Ga0068855_100394417 Ga0068855_1003944172 68
186 3300005563 Ga0068855_100429950 Ga0068855_1004299503 68
187 3300005563 Ga0068855_101975258 Ga0068855_1019752582 68
188 3300005564 Ga0070664_100003416 Ga0070664_10000341613 68
189 3300005564 Ga0070664_100100671 Ga0070664_1001006712 68
190 3300005564 Ga0070664_100215194 Ga0070664_1002151942 68
191 3300005564 Ga0070664_100358586 Ga0070664_1003585862 68
192 3300005564 Ga0070664_100534784 Ga0070664_1005347842 68
193 3300005577 Ga0068857_100006626 Ga0068857_1000066262 68
194 3300005577 Ga0068857_100010757 Ga0068857_1000107573 68
195 3300005577 Ga0068857_100213748 Ga0068857_1002137483 68
196 3300005578 Ga0068854_100046422 Ga0068854_1000464222 68
197 3300005578 Ga0068854_100136917 Ga0068854_1001369172 68
198 3300005578 Ga0068854_100787303 Ga0068854_1007873032 68
199 3300005578 Ga0068854_102132559 Ga0068854_1021325592 68
200 3300005614 Ga0068856_100758017 Ga0068856_1007580173 68
201 3300005614 Ga0068856_101175507 Ga0068856_1011755072 68
202 3300005616 Ga0068852_100122539 Ga0068852_1001225393 68
203 3300005616 Ga0068852_100323390 Ga0068852_1003233903 68
204 3300005617 Ga0068859_100243984 Ga0068859_1002439843 68
205 3300005617 Ga0068859_101729035 Ga0068859_1017290352 68
206 3300005618 Ga0068864_100015969 Ga0068864_1000159699 68
207 3300005618 Ga0068864_100271429 Ga0068864_1002714294 68
208 3300005618 Ga0068864_100544848 Ga0068864_1005448482 68
209 3300005618 Ga0068864_100733877 Ga0068864_1007338773 68
210 3300005618 Ga0068864_101207447 Ga0068864_1012074472 68
211 3300005834 Ga0068851_10009479 Ga0068851_100094792 68
212 3300005834 Ga0068851_10084160 Ga0068851_100841602 68
213 3300005834 Ga0068851_10118403 Ga0068851_101184033 68
214 3300005841 Ga0068863_100003894 Ga0068863_1000038946 68
215 3300005842 Ga0068858_101391846 Ga0068858_1013918462 68
216 3300005843 Ga0068860_100194469 Ga0068860_1001944693 68
217 3300005843 Ga0068860_102115491 Ga0068860_1021154912 68
218 3300005844 Ga0068862_100516465 Ga0068862_1005164653 68
219 3300006186 Ga0075369_10166144 Ga0075369_101661443 68
220 3300006237 Ga0097621_100012388 Ga0097621_1000123889 68
221 3300006237 Ga0097621_100751589 Ga0097621_1007515893 68
222 3300006358 Ga0068871_100018700 Ga0068871_1000187006 68
223 3300006358 Ga0068871_101288497 Ga0068871_1012884972 68
224 3300006358 Ga0068871_101368608 Ga0068871_1013686082 68
225 3300006844 Ga0075428_101641064 Ga0075428_1016410642 68
226 3300006880 Ga0075429_100210845 Ga0075429_1002108452 68
227 3300006881 Ga0068865_100090054 Ga0068865_1000900544 68
228 3300006931 Ga0097620_100243965 Ga0097620_1002439653 68
229 3300006931 Ga0097620_101728715 Ga0097620_1017287152 68
230 3300009011 Ga0105251_10038441 Ga0105251_100384415 68
231 3300009094 Ga0111539_10058536 Ga0111539_100585362 68
232 3300009098 Ga0105245_12591162 Ga0105245_125911622 68
233 3300009101 Ga0105247_10115081 Ga0105247_101150812 68
234 3300009174 Ga0105241_10065092 Ga0105241_100650922 68
235 3300009177 Ga0105248_10012350 Ga0105248_100123505 68
236 3300009177 Ga0105248_10165154 Ga0105248_101651542 68
237 3300009177 Ga0105248_11481423 Ga0105248_114814232 68
238 3300009177 Ga0105248_13149114 Ga0105248_131491142 68
239 3300009545 Ga0105237_10027499 Ga0105237_100274992 68
240 3300009551 Ga0105238_10262621 Ga0105238_102626213 68
241 3300009551 Ga0105238_10397575 Ga0105238_103975752 68
242 3300010375 Ga0105239_12964624 Ga0105239_129646242 68
243 3300011119 Ga0105246_10485246 Ga0105246_104852463 68
244 3300012497 Ga0157319_1021488 Ga0157319_10214882 68
245 3300012512 Ga0157327_1052598 Ga0157327_10525982 68
246 3300013100 Ga0157373_10281258 Ga0157373_102812583 68
247 3300013100 Ga0157373_10649093 Ga0157373_106490932 68
248 3300013100 Ga0157373_10828818 Ga0157373_108288182 68
249 3300013100 Ga0157373_11073364 Ga0157373_110733642 68
250 3300013100 Ga0157373_11556013 Ga0157373_115560132 68
251 3300013102 Ga0157371_10487610 Ga0157371_104876102 68
252 3300013102 Ga0157371_10529056 Ga0157371_105290563 68
253 3300013104 Ga0157370_10111211 Ga0157370_101112112 68
254 3300013104 Ga0157370_10201071 Ga0157370_102010711 68
255 3300013105 Ga0157369_10382418 Ga0157369_103824182 68
256 3300013105 Ga0157369_10590332 Ga0157369_105903322 68
257 3300013296 Ga0157374_12130581 Ga0157374_121305812 68
258 3300013306 Ga0163162_10589954 Ga0163162_105899542 68
259 3300013306 Ga0163162_10641825 Ga0163162_106418253 68
260 3300013307 Ga0157372_10142218 Ga0157372_101422184 68
261 3300013307 Ga0157372_10196510 Ga0157372_101965102 68
262 3300013307 Ga0157372_10935308 Ga0157372_109353082 68
263 3300013307 Ga0157372_10961001 Ga0157372_109610011 68
264 3300013307 Ga0157372_11960692 Ga0157372_119606922 68
265 3300014325 Ga0163163_10173671 Ga0163163_101736713 68
266 3300014497 Ga0182008_10045746 Ga0182008_100457462 68
267 3300014745 Ga0157377_10594837 Ga0157377_105948372 68
268 3300014745 Ga0157377_11726193 Ga0157377_117261932 68
269 3300014968 Ga0157379_10006649 Ga0157379_100066496 68
270 3300017792 Ga0163161_10160190 Ga0163161_101601902 68
271 3300017792 Ga0163161_11131492 Ga0163161_111314922 68
272 3300021384 Ga0213876_10361112 Ga0213876_103611122 68
273 3300025315 Ga0207697_10034932 Ga0207697_100349322 68
274 3300025315 Ga0207697_10392672 Ga0207697_103926722 68
275 3300025321 Ga0207656_10002893 Ga0207656_100028932 68
276 3300025321 Ga0207656_10256000 Ga0207656_102560002 68
277 3300025321 Ga0207656_10748480 Ga0207656_107484801 68
278 3300025735 Ga0207713_1207201 Ga0207713_12072012 68
279 3300025893 Ga0207682_10518707 Ga0207682_105187072 68
280 3300025900 Ga0207710_10068091 Ga0207710_100680912 68
281 3300025903 Ga0207680_10144651 Ga0207680_101446512 68
282 3300025903 Ga0207680_10843903 Ga0207680_108439032 68
283 3300025904 Ga0207647_10026662 Ga0207647_100266624 68
284 3300025904 Ga0207647_10046560 Ga0207647_100465602 68
285 3300025904 Ga0207647_10328211 Ga0207647_103282112 68
286 3300025907 Ga0207645_10332604 Ga0207645_103326042 68
287 3300025908 Ga0207643_10428470 Ga0207643_104284703 68
288 3300025909 Ga0207705_10024198 Ga0207705_100241988 68
289 3300025909 Ga0207705_10064531 Ga0207705_100645312 68
290 3300025909 Ga0207705_10086178 Ga0207705_100861782 68
291 3300025909 Ga0207705_10093412 Ga0207705_100934122 68
292 3300025909 Ga0207705_10105612 Ga0207705_101056122 68
293 3300025909 Ga0207705_10546995 Ga0207705_105469952 68
294 3300025910 Ga0207684_10278038 Ga0207684_102780382 68
295 3300025911 Ga0207654_10119268 Ga0207654_101192683 68
296 3300025911 Ga0207654_10249995 Ga0207654_102499952 68
297 3300025912 Ga0207707_10988102 Ga0207707_109881022 68
298 3300025912 Ga0207707_11599366 Ga0207707_115993662 68
299 3300025914 Ga0207671_10129455 Ga0207671_101294554 68
300 3300025917 Ga0207660_10073102 Ga0207660_100731025 68
301 3300025919 Ga0207657_10024029 Ga0207657_100240293 68
302 3300025919 Ga0207657_10159436 Ga0207657_101594364 68
303 3300025919 Ga0207657_10809192 Ga0207657_108091922 68
304 3300025920 Ga0207649_10007872 Ga0207649_100078722 68
305 3300025920 Ga0207649_11182494 Ga0207649_111824942 68
306 3300025920 Ga0207649_11476306 Ga0207649_114763062 68
307 3300025921 Ga0207652_10195944 Ga0207652_101959442 68
308 3300025921 Ga0207652_10539151 Ga0207652_105391512 68
309 3300025923 Ga0207681_10732046 Ga0207681_107320461 68
310 3300025925 Ga0207650_10081807 Ga0207650_100818072 68
311 3300025925 Ga0207650_10483622 Ga0207650_104836222 68
312 3300025925 Ga0207650_10858081 Ga0207650_108580812 68
313 3300025926 Ga0207659_10388818 Ga0207659_103888182 68
314 3300025931 Ga0207644_10009935 Ga0207644_100099352 68
315 3300025931 Ga0207644_10078292 Ga0207644_100782925 68
316 3300025931 Ga0207644_10377694 Ga0207644_103776943 68
317 3300025931 Ga0207644_10681091 Ga0207644_106810912 68
318 3300025931 Ga0207644_11223885 Ga0207644_112238852 68
319 3300025932 Ga0207690_10110271 Ga0207690_101102714 68
320 3300025932 Ga0207690_10150582 Ga0207690_101505823 68
321 3300025932 Ga0207690_10208131 Ga0207690_102081314 68
322 3300025932 Ga0207690_10301700 Ga0207690_103017002 68
323 3300025933 Ga0207706_10002920 Ga0207706_100029203 68
324 3300025933 Ga0207706_10016973 Ga0207706_100169733 68
325 3300025933 Ga0207706_10038549 Ga0207706_100385494 68
326 3300025933 Ga0207706_10073838 Ga0207706_100738382 68
327 3300025933 Ga0207706_10411954 Ga0207706_104119542 68
328 3300025933 Ga0207706_11265900 Ga0207706_112659002 68
329 3300025933 Ga0207706_11571973 Ga0207706_115719732 68
330 3300025937 Ga0207669_10090941 Ga0207669_100909412 68
331 3300025937 Ga0207669_10399535 Ga0207669_103995353 68
332 3300025940 Ga0207691_10140129 Ga0207691_101401293 68
333 3300025940 Ga0207691_10491554 Ga0207691_104915542 68
334 3300025941 Ga0207711_10032298 Ga0207711_100322985 68
335 3300025941 Ga0207711_10779090 Ga0207711_107790902 68
336 3300025942 Ga0207689_10150703 Ga0207689_101507032 68
337 3300025942 Ga0207689_11366308 Ga0207689_113663082 68
338 3300025944 Ga0207661_10799291 Ga0207661_107992912 68
339 3300025945 Ga0207679_10012302 Ga0207679_100123022 68
340 3300025945 Ga0207679_10168770 Ga0207679_101687702 68
341 3300025945 Ga0207679_10318644 Ga0207679_103186443 68
342 3300025945 Ga0207679_11062291 Ga0207679_110622911 68
343 3300025949 Ga0207667_10264237 Ga0207667_102642371 68
344 3300025960 Ga0207651_10727003 Ga0207651_107270032 68
345 3300025960 Ga0207651_10924344 Ga0207651_109243442 68
346 3300025960 Ga0207651_11442595 Ga0207651_114425952 68
347 3300025972 Ga0207668_10237129 Ga0207668_102371292 68
348 3300025981 Ga0207640_10035015 Ga0207640_100350152 68
349 3300025981 Ga0207640_10959695 Ga0207640_109596952 68
350 3300025986 Ga0207658_10004581 Ga0207658_1000458110 68
351 3300026023 Ga0207677_12248673 Ga0207677_122486731 68
352 3300026041 Ga0207639_10166842 Ga0207639_101668422 68
353 3300026041 Ga0207639_10655743 Ga0207639_106557432 68
354 3300026067 Ga0207678_10015045 Ga0207678_100150455 68
355 3300026067 Ga0207678_10181273 Ga0207678_101812732 68
356 3300026067 Ga0207678_10400274 Ga0207678_104002742 68
357 3300026067 Ga0207678_10583045 Ga0207678_105830452 68
358 3300026078 Ga0207702_10005600 Ga0207702_100056009 68
359 3300026088 Ga0207641_10073932 Ga0207641_100739325 68
360 3300026088 Ga0207641_11602943 Ga0207641_116029432 68
361 3300026089 Ga0207648_10013848 Ga0207648_100138485 68
362 3300026089 Ga0207648_10237468 Ga0207648_102374683 68
363 3300026089 Ga0207648_11899547 Ga0207648_118995471 68
364 3300026095 Ga0207676_10180833 Ga0207676_101808334 68
365 3300026095 Ga0207676_10248481 Ga0207676_102484812 68
366 3300026095 Ga0207676_11844958 Ga0207676_118449582 68
367 3300026095 Ga0207676_12231303 Ga0207676_122313032 68
368 3300026116 Ga0207674_10000308 Ga0207674_100003087 68
369 3300026116 Ga0207674_10002878 Ga0207674_1000287815 68
370 3300026116 Ga0207674_10009470 Ga0207674_100094705 68
371 3300026116 Ga0207674_10238069 Ga0207674_102380693 68
372 3300026121 Ga0207683_10024070 Ga0207683_100240704 68
373 3300026121 Ga0207683_10101882 Ga0207683_101018822 68
374 3300026121 Ga0207683_10114046 Ga0207683_101140462 68
375 3300026142 Ga0207698_10201097 Ga0207698_102010973 68
376 3300026142 Ga0207698_11056276 Ga0207698_110562762 68
377 3300026142 Ga0207698_11107684 Ga0207698_111076842 68
378 3300028379 Ga0268266_10000315 Ga0268266_1000031543 68
379 3300028379 Ga0268266_10732274 Ga0268266_107322742 68
380 3300028379 Ga0268266_10909639 Ga0268266_109096392 68
381 3300028379 Ga0268266_11579413 Ga0268266_115794132 68
382 3300028381 Ga0268264_11786100 Ga0268264_117861002 68
383 3300031548 Ga0307408_100401901 Ga0307408_1004019012 68
384 3300031548 Ga0307408_100724948 Ga0307408_1007249482 68
385 3300031731 Ga0307405_10604455 Ga0307405_106044552 68
386 3300031731 Ga0307405_11314789 Ga0307405_113147892 68
387 3300031824 Ga0307413_10090035 Ga0307413_100900351 68
388 3300031824 Ga0307413_10093811 Ga0307413_100938112 68
389 3300031824 Ga0307413_10214573 Ga0307413_102145734 68
390 3300031824 Ga0307413_10494498 Ga0307413_104944983 68
391 3300031824 Ga0307413_10570072 Ga0307413_105700722 68
392 3300031852 Ga0307410_10012027 Ga0307410_100120273 68
393 3300031852 Ga0307410_10153595 Ga0307410_101535954 68
394 3300031852 Ga0307410_10189258 Ga0307410_101892582 68
395 3300031852 Ga0307410_11381946 Ga0307410_113819462 68
396 3300031901 Ga0307406_10298540 Ga0307406_102985402 68
397 3300031901 Ga0307406_11731092 Ga0307406_117310922 68
398 3300031903 Ga0307407_10088709 Ga0307407_100887092 68
399 3300031911 Ga0307412_11029944 Ga0307412_110299442 68
400 3300031911 Ga0307412_11176782 Ga0307412_111767822 68
401 3300031911 Ga0307412_11534390 Ga0307412_115343902 68
402 3300031995 Ga0307409_100166809 Ga0307409_1001668092 68
403 3300031995 Ga0307409_100188014 Ga0307409_1001880142 68
404 3300031995 Ga0307409_100342244 Ga0307409_1003422442 68
405 3300031995 Ga0307409_101369310 Ga0307409_1013693102 68
406 3300032002 Ga0307416_100208353 Ga0307416_1002083532 68
407 3300032002 Ga0307416_100323553 Ga0307416_1003235532 68
408 3300032002 Ga0307416_100357784 Ga0307416_1003577842 68
409 3300032002 Ga0307416_100990658 Ga0307416_1009906581 68
410 3300032004 Ga0307414_10096978 Ga0307414_100969781 68
411 3300032004 Ga0307414_10276398 Ga0307414_102763982 68
412 3300032005 Ga0307411_10001276 Ga0307411_100012767 68
413 3300032005 Ga0307411_10032088 Ga0307411_100320882 68
414 3300032005 Ga0307411_10778678 Ga0307411_107786783 68
415 3300032005 Ga0307411_11013980 Ga0307411_110139802 68
416 3300032005 Ga0307411_11017938 Ga0307411_110179382 68
417 3300032126 Ga0307415_100042173 Ga0307415_1000421732 68
418 3300032126 Ga0307415_100150070 Ga0307415_1001500702 68
419 3300032126 Ga0307415_100541826 Ga0307415_1005418262 68
420 3300034820 Ga0373959_0140115 Ga0373959_0140115_93_305 68
421 3300037312 Ga0395899_0136060 Ga0395899_0136060_19_234 68
422 3300037312 Ga0395899_0432078 Ga0395899_0432078_420_629 68
423 3300037312 Ga0395899_0585588 Ga0395899_0585588_11_226 68
424 3300037312 Ga0395899_0875507 Ga0395899_0875507_292_507 68
425 3300037418 Ga0395900_0026676 Ga0395900_0026676_1103_1318 68
426 3300037418 Ga0395900_0083036 Ga0395900_0083036_450_665 68
427 3300037418 Ga0395900_0224583 Ga0395900_0224583_564_779 68
428 3300037418 Ga0395900_0323105 Ga0395900_0323105_595_807 68
429 3300037418 Ga0395900_0422645 Ga0395900_0422645_781_990 68
430 3300037466 Ga0395898_0059038 Ga0395898_0059038_657_872 68
431 3300037471 Ga0395905_0002116 Ga0395905_0002116_17689_17898 68
432 3300037471 Ga0395905_0045805 Ga0395905_0045805_1434_1649 68
433 3300037471 Ga0395905_0071455 Ga0395905_0071455_737_952 68
434 3300037471 Ga0395905_0218635 Ga0395905_0218635_1103_1318 68
435 3300037471 Ga0395905_0583364 Ga0395905_0583364_387_602 68
436 3300037471 Ga0395905_0638584 Ga0395905_0638584_706_921 68
437 3300037471 Ga0395905_1158123 Ga0395905_1158123_100_309 68
438 3300038443 Ga0395901_0059700 Ga0395901_0059700_828_1037 68
439 3300038443 Ga0395901_0114055 Ga0395901_0114055_1190_1405 68
440 3300038443 Ga0395901_0163469 Ga0395901_0163469_812_1027 68
441 3300038443 Ga0395901_0280439 Ga0395901_0280439_289_504 68
442 3300038443 Ga0395901_0356774 Ga0395901_0356774_211_432 68
443 3300038443 Ga0395901_1247514 Ga0395901_1247514_66_287 68
444 3300038443 Ga0395901_1986034 Ga0395901_1986034_250_462 68
445 3300039437 Ga0436365_1446270 Ga0436365_1446270_532_744 68
446 3300041404 Ga0439436_0092581 Ga0439436_0092581_322_564 68
447 3300041407 Ga0439447_080412 Ga0439447_080412_200_442 68
448 3300041410 Ga0439461_0113694 Ga0439461_0113694_375_617 68
449 3300042127 Ga0450890_003198 Ga0450890_003198_607_834 68
450 3300042137 Ga0450902_080904 Ga0450902_080904_315_542 68
451 3300042142 Ga0450905_001426 Ga0450905_001426_2197_2424 68
452 3300042144 Ga0450889_001073 Ga0450889_001073_2452_2679 68
453 3300044658 Ga0466972_0172332 Ga0466972_0172332_33_248 68
454 3300044683 Ga0466965_0869016 Ga0466965_0869016_267_482 68
455 3300044842 Ga0466957_1102527 Ga0466957_1102527_26_244 68
456 3300044901 Ga0466960_0079354 Ga0466960_0079354_220_435 68
457 3300046525 Ga0495663_0043479 Ga0495663_0043479_1076_1288 68
458 3300046525 Ga0495663_0097656 Ga0495663_0097656_729_944 68
459 3300046684 Ga0495669_0001299 Ga0495669_0001299_1336_1548 68
460 3300047445 Ga0495677_0051784 Ga0495677_0051784_1107_1319 68
461 3300047447 Ga0495685_198761 Ga0495685_198761_287_499 68
462 3300048903 Ga0496100_0099324 Ga0496100_0099324_1352_1567 68
463 3300048904 Ga0496101_0775627 Ga0496101_0775627_43_255 68
464 3300048906 Ga0496103_0007362 Ga0496103_0007362_2112_2327 68
465 3300048906 Ga0496103_0254231 Ga0496103_0254231_701_913 68
466 3300048907 Ga0496104_0166791 Ga0496104_0166791_82_297 68
467 3300048907 Ga0496104_1089069 Ga0496104_1089069_252_470 68
468 3300048908 Ga0496105_1217246 Ga0496105_1217246_85_300 68
469 3300048910 Ga0496107_0488575 Ga0496107_0488575_234_449 68
470 3300048911 Ga0496108_0010565 Ga0496108_0010565_5364_5579 68
471 3300048911 Ga0496108_0906935 Ga0496108_0906935_431_652 68
472 3300048912 Ga0496109_0008469 Ga0496109_0008469_6387_6602 68
473 3300048912 Ga0496109_1858705 Ga0496109_1858705_300_515 68
474 3300048913 Ga0496110_0023537 Ga0496110_0023537_4990_5205 68
475 3300048913 Ga0496110_0070841 Ga0496110_0070841_86_295 68
476 3300048914 Ga0496111_0007201 Ga0496111_0007201_189_404 68
477 3300048914 Ga0496111_0063305 Ga0496111_0063305_64_279 68
478 3300048915 Ga0496112_0003787 Ga0496112_0003787_5055_5270 68
479 3300048915 Ga0496112_0066201 Ga0496112_0066201_1977_2198 68
480 3300048915 Ga0496112_0756531 Ga0496112_0756531_590_808 68
481 3300048916 Ga0496113_0002425 Ga0496113_0002425_8326_8541 68
482 3300049583 Ga0501067_0033983 Ga0501067_0033983_431_649 68
483 3300049583 Ga0501067_0826484 Ga0501067_0826484_165_374 68
484 3300049584 Ga0501068_0876301 Ga0501068_0876301_273_494 68
485 3300049585 Ga0501069_0486446 Ga0501069_0486446_434_652 68
486 3300050507 nmdc:mga05p37_1177585_c1 nmdc:mga05p37_1177585_c1_508_735 68
487 3300050508 nmdc:mga09592_161265_c1 nmdc:mga09592_161265_c1_1300_1527 68
488 3300050508 nmdc:mga09592_971207_c1 nmdc:mga09592_971207_c1_55_282 68
489 3300050511 nmdc:mga08y16_133627_c1 nmdc:mga08y16_133627_c1_264_491 68
490 3300050513 nmdc:mga0rr50_1018523_c1 nmdc:mga0rr50_1018523_c1_459_674 68
491 3300050516 nmdc:mga0sz30_152865_c1 nmdc:mga0sz30_152865_c1_456_665 68
492 3300005327 Ga0070658_10139741 Ga0070658_101397412 69
493 3300005328 Ga0070676_10018872 Ga0070676_100188724 69
494 3300005329 Ga0070683_100697847 Ga0070683_1006978472 69
495 3300005330 Ga0070690_100987582 Ga0070690_1009875821 69
496 3300005331 Ga0070670_100831531 Ga0070670_1008315312 69
497 3300005337 Ga0070682_100354453 Ga0070682_1003544532 69
498 3300005347 Ga0070668_100112350 Ga0070668_1001123502 69
499 3300005354 Ga0070675_101475654 Ga0070675_1014756542 69
500 3300005355 Ga0070671_100380928 Ga0070671_1003809283 69
501 3300005356 Ga0070674_101731501 Ga0070674_1017315012 69
502 3300005364 Ga0070673_100371344 Ga0070673_1003713442 69
503 3300005364 Ga0070673_100696162 Ga0070673_1006961622 69
504 3300005366 Ga0070659_100015331 Ga0070659_1000153319 69
505 3300005366 Ga0070659_100551485 Ga0070659_1005514852 69
506 3300005366 Ga0070659_101140756 Ga0070659_1011407561 69
507 3300005367 Ga0070667_100116248 Ga0070667_1001162482 69
508 3300005435 Ga0070714_100038969 Ga0070714_1000389692 69
509 3300005436 Ga0070713_102276255 Ga0070713_1022762551 69
510 3300005440 Ga0070705_100248088 Ga0070705_1002480882 69
511 3300005455 Ga0070663_100138281 Ga0070663_1001382812 69
512 3300005457 Ga0070662_100753904 Ga0070662_1007539042 69
513 3300005459 Ga0068867_100301555 Ga0068867_1003015552 69
514 3300005459 Ga0068867_100500657 Ga0068867_1005006572 69
515 3300005530 Ga0070679_100582314 Ga0070679_1005823141 69
516 3300005543 Ga0070672_100476246 Ga0070672_1004762462 69
517 3300005546 Ga0070696_100004394 Ga0070696_10000439413 69
518 3300005546 Ga0070696_101372408 Ga0070696_1013724081 69
519 3300005547 Ga0070693_100017586 Ga0070693_1000175868 69
520 3300005548 Ga0070665_101738469 Ga0070665_1017384692 69
521 3300005564 Ga0070664_100005620 Ga0070664_1000056205 69
522 3300005617 Ga0068859_100031616 Ga0068859_1000316162 69
523 3300005718 Ga0068866_10098353 Ga0068866_100983532 69
524 3300005719 Ga0068861_100630403 Ga0068861_1006304032 69
525 3300005834 Ga0068851_10042686 Ga0068851_100426862 69
526 3300005841 Ga0068863_100282732 Ga0068863_1002827322 69
527 3300005842 Ga0068858_100433525 Ga0068858_1004335253 69
528 3300005843 Ga0068860_100027502 Ga0068860_1000275027 69
529 3300005844 Ga0068862_100041195 Ga0068862_1000411954 69
530 3300005844 Ga0068862_100638174 Ga0068862_1006381742 69
531 3300005985 Ga0081539_10215398 Ga0081539_102153982 69
532 3300006028 Ga0070717_10089264 Ga0070717_100892644 69
533 3300006173 Ga0070716_100392697 Ga0070716_1003926972 69
534 3300006881 Ga0068865_100632247 Ga0068865_1006322473 69
535 3300006931 Ga0097620_100031616 Ga0097620_1000316162 69
536 3300009101 Ga0105247_11764509 Ga0105247_117645091 69
537 3300009148 Ga0105243_10014560 Ga0105243_100145602 69
538 3300009176 Ga0105242_11004428 Ga0105242_110044282 69
539 3300009177 Ga0105248_10022027 Ga0105248_100220279 69
540 3300009551 Ga0105238_10619381 Ga0105238_106193812 69
541 3300009553 Ga0105249_10620954 Ga0105249_106209542 69
542 3300013100 Ga0157373_10115471 Ga0157373_101154712 69
543 3300013100 Ga0157373_10127536 Ga0157373_101275362 69
544 3300013308 Ga0157375_11058544 Ga0157375_110585442 69
545 3300014326 Ga0157380_10010723 Ga0157380_100107234 69
546 3300014968 Ga0157379_10866178 Ga0157379_108661783 69
547 3300025321 Ga0207656_10012184 Ga0207656_100121842 69
548 3300025901 Ga0207688_10842127 Ga0207688_108421272 69
549 3300025907 Ga0207645_10014320 Ga0207645_100143204 69
550 3300025907 Ga0207645_10287122 Ga0207645_102871223 69
551 3300025909 Ga0207705_10061994 Ga0207705_100619943 69
552 3300025909 Ga0207705_10385583 Ga0207705_103855833 69
553 3300025919 Ga0207657_10007272 Ga0207657_100072724 69
554 3300025923 Ga0207681_10005902 Ga0207681_100059022 69
555 3300025923 Ga0207681_10091891 Ga0207681_100918914 69
556 3300025925 Ga0207650_10700098 Ga0207650_107000982 69
557 3300025926 Ga0207659_11290601 Ga0207659_112906012 69
558 3300025928 Ga0207700_10051185 Ga0207700_100511856 69
559 3300025929 Ga0207664_10108634 Ga0207664_101086342 69
560 3300025932 Ga0207690_10024491 Ga0207690_100244918 69
561 3300025932 Ga0207690_10613980 Ga0207690_106139802 69
562 3300025933 Ga0207706_10059182 Ga0207706_100591822 69
563 3300025933 Ga0207706_10155651 Ga0207706_101556512 69
564 3300025933 Ga0207706_10327685 Ga0207706_103276852 69
565 3300025933 Ga0207706_11437268 Ga0207706_114372682 69
566 3300025935 Ga0207709_10110073 Ga0207709_101100734 69
567 3300025938 Ga0207704_10485232 Ga0207704_104852323 69
568 3300025938 Ga0207704_10640618 Ga0207704_106406182 69
569 3300025939 Ga0207665_10373449 Ga0207665_103734492 69
570 3300025940 Ga0207691_10463185 Ga0207691_104631852 69
571 3300025941 Ga0207711_10079401 Ga0207711_100794012 69
572 3300025944 Ga0207661_10546516 Ga0207661_105465162 69
573 3300025945 Ga0207679_10018820 Ga0207679_100188203 69
574 3300025945 Ga0207679_11811151 Ga0207679_118111512 69
575 3300025960 Ga0207651_11100033 Ga0207651_111000332 69
576 3300025972 Ga0207668_11263272 Ga0207668_112632722 69
577 3300025986 Ga0207658_10035124 Ga0207658_100351243 69
578 3300026035 Ga0207703_10146263 Ga0207703_101462633 69
579 3300026041 Ga0207639_10305987 Ga0207639_103059872 69
580 3300026067 Ga0207678_10554615 Ga0207678_105546152 69
581 3300026088 Ga0207641_10097779 Ga0207641_100977792 69
582 3300026089 Ga0207648_10028525 Ga0207648_100285255 69
583 3300026118 Ga0207675_100257119 Ga0207675_1002571192 69
584 3300028379 Ga0268266_10766762 Ga0268266_107667622 69
585 3300028380 Ga0268265_10066103 Ga0268265_100661031 69
586 3300028380 Ga0268265_10827079 Ga0268265_108270791 69
587 3300028380 Ga0268265_10863786 Ga0268265_108637862 69
588 3300028381 Ga0268264_10066329 Ga0268264_100663293 69
589 3300031901 Ga0307406_10087952 Ga0307406_100879523 69
590 3300031911 Ga0307412_10374289 Ga0307412_103742893 69
591 3300031995 Ga0307409_100316452 Ga0307409_1003164521 69
592 3300031995 Ga0307409_101459233 Ga0307409_1014592331 69
593 3300032002 Ga0307416_100420958 Ga0307416_1004209582 69
594 3300032002 Ga0307416_103085616 Ga0307416_1030856162 69
595 3300032004 Ga0307414_10631204 Ga0307414_106312042 69
596 3300032005 Ga0307411_11174542 Ga0307411_111745422 69
597 3300032126 Ga0307415_100126970 Ga0307415_1001269703 69
598 3300044901 Ga0466960_0394845 Ga0466960_0394845_443_694 69
599 3300046500 Ga0495596_0070445 Ga0495596_0070445_38_274 69
600 3300046525 Ga0495663_0065241 Ga0495663_0065241_402_638 69
601 3300046539 Ga0495621_0007454 Ga0495621_0007454_2391_2627 69
602 3300046539 Ga0495621_0060120 Ga0495621_0060120_920_1156 69
603 3300046615 Ga0495656_0776576 Ga0495656_0776576_14_250 69
604 3300046664 Ga0495659_0022463 Ga0495659_0022463_76_312 69
605 3300046691 Ga0495670_0102544 Ga0495670_0102544_584_820 69
606 3300047318 Ga0495636_0613997 Ga0495636_0613997_199_435 69
607 3300047445 Ga0495677_0046311 Ga0495677_0046311_90_326 69
608 3300047447 Ga0495685_197201 Ga0495685_197201_115_351 69
609 3300048910 Ga0496107_0883511 Ga0496107_0883511_183_401 69
610 3300049686 Ga0501257_041658 Ga0501257_041658_483_698 69
611 3300049704 Ga0501221_216071 Ga0501221_216071_100_315 69
612 3300049765 Ga0501268_008468 Ga0501268_008468_295_510 69
613 3300050511 nmdc:mga08y16_752069_c1 nmdc:mga08y16_752069_c1_501_737 69
614 3300005328 Ga0070676_10000509 Ga0070676_100005095 70
615 3300005333 Ga0070677_10602858 Ga0070677_106028582 70
616 3300005337 Ga0070682_100056000 Ga0070682_1000560004 70
617 3300005344 Ga0070661_100147216 Ga0070661_1001472162 70
618 3300005347 Ga0070668_100004342 Ga0070668_1000043429 70
619 3300005353 Ga0070669_100016249 Ga0070669_1000162496 70
620 3300005355 Ga0070671_100313495 Ga0070671_1003134952 70
621 3300005355 Ga0070671_101299618 Ga0070671_1012996182 70
622 3300005356 Ga0070674_100081176 Ga0070674_1000811761 70
623 3300005356 Ga0070674_100339870 Ga0070674_1003398702 70
624 3300005364 Ga0070673_100011053 Ga0070673_1000110533 70
625 3300005364 Ga0070673_101392564 Ga0070673_1013925642 70
626 3300005367 Ga0070667_100795898 Ga0070667_1007958983 70
627 3300005441 Ga0070700_100484158 Ga0070700_1004841583 70
628 3300005457 Ga0070662_100469831 Ga0070662_1004698311 70
629 3300005457 Ga0070662_100957471 Ga0070662_1009574711 70
630 3300005459 Ga0068867_100009758 Ga0068867_10000975810 70
631 3300005543 Ga0070672_100052655 Ga0070672_1000526552 70
632 3300005548 Ga0070665_102224485 Ga0070665_1022244852 70
633 3300005564 Ga0070664_100162660 Ga0070664_1001626604 70
634 3300005564 Ga0070664_101595611 Ga0070664_1015956111 70
635 3300005617 Ga0068859_101913516 Ga0068859_1019135162 70
636 3300005618 Ga0068864_100253660 Ga0068864_1002536603 70
637 3300005841 Ga0068863_101019038 Ga0068863_1010190382 70
638 3300005843 Ga0068860_100283493 Ga0068860_1002834932 70
639 3300005844 Ga0068862_100011622 Ga0068862_1000116226 70
640 3300005844 Ga0068862_102707587 Ga0068862_1027075871 70
641 3300006163 Ga0070715_10502398 Ga0070715_105023982 70
642 3300006237 Ga0097621_100017678 Ga0097621_1000176783 70
643 3300006358 Ga0068871_100220973 Ga0068871_1002209733 70
644 3300006881 Ga0068865_100265185 Ga0068865_1002651852 70
645 3300006931 Ga0097620_101913692 Ga0097620_1019136922 70
646 3300009177 Ga0105248_10055018 Ga0105248_100550182 70
647 3300013102 Ga0157371_10551216 Ga0157371_105512162 70
648 3300013296 Ga0157374_10122097 Ga0157374_101220972 70
649 3300015261 Ga0182006_1202542 Ga0182006_12025422 70
650 3300025315 Ga0207697_10112929 Ga0207697_101129292 70
651 3300025893 Ga0207682_10490048 Ga0207682_104900482 70
652 3300025899 Ga0207642_10062750 Ga0207642_100627502 70
653 3300025904 Ga0207647_10089230 Ga0207647_100892302 70
654 3300025907 Ga0207645_10000896 Ga0207645_1000089619 70
655 3300025909 Ga0207705_10001965 Ga0207705_100019652 70
656 3300025918 Ga0207662_10853135 Ga0207662_108531352 70
657 3300025920 Ga0207649_10255400 Ga0207649_102554002 70
658 3300025923 Ga0207681_10065848 Ga0207681_100658484 70
659 3300025926 Ga0207659_10145992 Ga0207659_101459923 70
660 3300025931 Ga0207644_10189458 Ga0207644_101894582 70
661 3300025931 Ga0207644_11260195 Ga0207644_112601952 70
662 3300025933 Ga0207706_11175213 Ga0207706_111752132 70
663 3300025937 Ga0207669_10043744 Ga0207669_100437442 70
664 3300025938 Ga0207704_10360987 Ga0207704_103609872 70
665 3300025940 Ga0207691_10061771 Ga0207691_100617712 70
666 3300025942 Ga0207689_10196854 Ga0207689_101968543 70
667 3300025945 Ga0207679_10084641 Ga0207679_100846412 70
668 3300025945 Ga0207679_12066526 Ga0207679_120665262 70
669 3300025960 Ga0207651_10006856 Ga0207651_100068564 70
670 3300025972 Ga0207668_10000070 Ga0207668_1000007066 70
671 3300025986 Ga0207658_10044969 Ga0207658_100449692 70
672 3300025986 Ga0207658_11081175 Ga0207658_110811752 70
673 3300026023 Ga0207677_10630678 Ga0207677_106306782 70
674 3300026088 Ga0207641_11509909 Ga0207641_115099091 70
675 3300026089 Ga0207648_10001147 Ga0207648_1000114725 70
676 3300026095 Ga0207676_10010550 Ga0207676_100105504 70
677 3300026121 Ga0207683_10156523 Ga0207683_101565232 70
678 3300028380 Ga0268265_10079746 Ga0268265_100797461 70
679 3300031824 Ga0307413_10041265 Ga0307413_100412652 70
680 3300031824 Ga0307413_10060096 Ga0307413_100600962 70
681 3300031824 Ga0307413_11577875 Ga0307413_115778751 70
682 3300031852 Ga0307410_10035962 Ga0307410_100359622 70
683 3300031852 Ga0307410_10660891 Ga0307410_106608912 70
684 3300031903 Ga0307407_10025709 Ga0307407_100257096 70
685 3300031995 Ga0307409_100432532 Ga0307409_1004325323 70
686 3300031995 Ga0307409_100662179 Ga0307409_1006621792 70
687 3300032002 Ga0307416_102651869 Ga0307416_1026518691 70
688 3300032004 Ga0307414_10229875 Ga0307414_102298752 70
689 3300032004 Ga0307414_10238328 Ga0307414_102383283 70
690 3300032004 Ga0307414_10524743 Ga0307414_105247432 70
691 3300032004 Ga0307414_12070186 Ga0307414_120701862 70
692 3300032005 Ga0307411_10069353 Ga0307411_100693532 70
693 3300032005 Ga0307411_10121562 Ga0307411_101215624 70
694 3300032005 Ga0307411_10283152 Ga0307411_102831522 70
695 3300032126 Ga0307415_100065070 Ga0307415_1000650702 70
696 3300037418 Ga0395900_0187845 Ga0395900_0187845_559_774 70
697 3300037471 Ga0395905_0024115 Ga0395905_0024115_2377_2598 70
698 3300037471 Ga0395905_0125488 Ga0395905_0125488_530_745 70
699 3300037471 Ga0395905_0340328 Ga0395905_0340328_536_754 70
700 3300041404 Ga0439436_0263724 Ga0439436_0263724_237_452 70
701 3300042461 Ga0439460_0285751 Ga0439460_0285751_338_556 70
702 3300046459 Ga0495629_0959256 Ga0495629_0959256_165_386 70
703 3300046500 Ga0495596_0179050 Ga0495596_0179050_130_345 70
704 3300046537 Ga0495598_0163450 Ga0495598_0163450_255_470 70
705 3300046539 Ga0495621_0512259 Ga0495621_0512259_279_494 70
706 3300046558 Ga0495633_0006238 Ga0495633_0006238_1320_1535 70
707 3300046684 Ga0495669_0295848 Ga0495669_0295848_256_471 70
708 3300046691 Ga0495670_0015020 Ga0495670_0015020_2206_2421 70
709 3300046691 Ga0495670_0466437 Ga0495670_0466437_356_574 70
710 3300048903 Ga0496100_1105223 Ga0496100_1105223_158_379 70
711 3300048904 Ga0496101_0940404 Ga0496101_0940404_181_402 70
712 3300048908 Ga0496105_0251475 Ga0496105_0251475_486_707 70
713 3300048909 Ga0496106_0482926 Ga0496106_0482926_100_321 70
714 3300048910 Ga0496107_0043298 Ga0496107_0043298_1428_1649 70
715 3300048910 Ga0496107_0149558 Ga0496107_0149558_1377_1598 70
716 3300048911 Ga0496108_0039973 Ga0496108_0039973_414_635 70
717 3300048912 Ga0496109_0045704 Ga0496109_0045704_1604_1825 70
718 3300048913 Ga0496110_0002515 Ga0496110_0002515_10736_10957 70
719 3300048914 Ga0496111_0003916 Ga0496111_0003916_8747_8968 70
720 3300048915 Ga0496112_0067093 Ga0496112_0067093_46_267 70
721 3300048915 Ga0496112_0940316 Ga0496112_0940316_31_252 70
722 3300050512 nmdc:mga0n895_1974672_c1 nmdc:mga0n895_1974672_c1_264_479 70
723 3300005333 Ga0070677_10721637 Ga0070677_107216371 71
724 3300005457 Ga0070662_100127093 Ga0070662_1001270932 71
725 3300005615 Ga0070702_100496965 Ga0070702_1004969652 71
726 3300013100 Ga0157373_10291242 Ga0157373_102912422 71
727 3300025893 Ga0207682_10436197 Ga0207682_104361972 71
728 3300025912 Ga0207707_10981200 Ga0207707_109812002 71
729 3300025923 Ga0207681_10399550 Ga0207681_103995502 71
730 3300027876 Ga0209974_10083763 Ga0209974_100837631 71
731 3300031548 Ga0307408_100011889 Ga0307408_10001188910 71
732 3300031548 Ga0307408_101297580 Ga0307408_1012975802 71
733 3300031731 Ga0307405_10065406 Ga0307405_100654062 71
734 3300031731 Ga0307405_10382513 Ga0307405_103825133 71
735 3300031731 Ga0307405_10400061 Ga0307405_104000612 71
736 3300031731 Ga0307405_10526524 Ga0307405_105265242 71
737 3300031824 Ga0307413_10018307 Ga0307413_100183072 71
738 3300031824 Ga0307413_10062051 Ga0307413_100620512 71
739 3300031824 Ga0307413_10068638 Ga0307413_100686382 71
740 3300031824 Ga0307413_10094504 Ga0307413_100945044 71
741 3300031824 Ga0307413_10140627 Ga0307413_101406272 71
742 3300031824 Ga0307413_10460547 Ga0307413_104605473 71
743 3300031852 Ga0307410_10059315 Ga0307410_100593152 71
744 3300031852 Ga0307410_10082864 Ga0307410_100828645 71
745 3300031852 Ga0307410_10433732 Ga0307410_104337323 71
746 3300031852 Ga0307410_10467600 Ga0307410_104676002 71
747 3300031901 Ga0307406_10043702 Ga0307406_100437025 71
748 3300031903 Ga0307407_10059415 Ga0307407_100594152 71
749 3300031903 Ga0307407_10162004 Ga0307407_101620042 71
750 3300031911 Ga0307412_10133334 Ga0307412_101333343 71
751 3300031911 Ga0307412_10172699 Ga0307412_101726992 71
752 3300031911 Ga0307412_10726617 Ga0307412_107266172 71
753 3300031911 Ga0307412_11216157 Ga0307412_112161571 71
754 3300031995 Ga0307409_100216374 Ga0307409_1002163743 71
755 3300031995 Ga0307409_100698213 Ga0307409_1006982132 71
756 3300031995 Ga0307409_101211804 Ga0307409_1012118042 71
757 3300031995 Ga0307409_101218245 Ga0307409_1012182452 71
758 3300031995 Ga0307409_101646304 Ga0307409_1016463042 71
759 3300031995 Ga0307409_101796060 Ga0307409_1017960601 71
760 3300032002 Ga0307416_100012629 Ga0307416_1000126292 71
761 3300032002 Ga0307416_100124183 Ga0307416_1001241832 71
762 3300032002 Ga0307416_100414379 Ga0307416_1004143792 71
763 3300032002 Ga0307416_100835229 Ga0307416_1008352291 71
764 3300032004 Ga0307414_10003689 Ga0307414_100036895 71
765 3300032004 Ga0307414_10027762 Ga0307414_100277622 71
766 3300032004 Ga0307414_10195532 Ga0307414_101955323 71
767 3300032004 Ga0307414_11063029 Ga0307414_110630291 71
768 3300032004 Ga0307414_12108842 Ga0307414_121088422 71
769 3300032005 Ga0307411_10012473 Ga0307411_100124732 71
770 3300032005 Ga0307411_10037558 Ga0307411_100375585 71
771 3300032005 Ga0307411_10066526 Ga0307411_100665262 71
772 3300032005 Ga0307411_10077866 Ga0307411_100778662 71
773 3300032005 Ga0307411_10433125 Ga0307411_104331252 71
774 3300032005 Ga0307411_10801155 Ga0307411_108011552 71
775 3300032005 Ga0307411_10927361 Ga0307411_109273612 71
776 3300032126 Ga0307415_100233595 Ga0307415_1002335953 71
777 3300032126 Ga0307415_100385674 Ga0307415_1003856743 71
778 3300032126 Ga0307415_101824770 Ga0307415_1018247702 71
779 3300005328 Ga0070676_10224342 Ga0070676_102243422 72
780 3300005334 Ga0068869_100028374 Ga0068869_1000283742 72
781 3300005334 Ga0068869_100075541 Ga0068869_1000755412 72
782 3300005335 Ga0070666_11227282 Ga0070666_112272821 72
783 3300005338 Ga0068868_100616083 Ga0068868_1006160832 72
784 3300005343 Ga0070687_100769781 Ga0070687_1007697812 72
785 3300005344 Ga0070661_100296444 Ga0070661_1002964443 72
786 3300005353 Ga0070669_100091495 Ga0070669_1000914952 72
787 3300005354 Ga0070675_100499029 Ga0070675_1004990292 72
788 3300005367 Ga0070667_100415702 Ga0070667_1004157022 72
789 3300005455 Ga0070663_100030392 Ga0070663_1000303922 72
790 3300005456 Ga0070678_100763206 Ga0070678_1007632061 72
791 3300005616 Ga0068852_100984474 Ga0068852_1009844743 72
792 3300005617 Ga0068859_100162511 Ga0068859_1001625114 72
793 3300005618 Ga0068864_100314354 Ga0068864_1003143543 72
794 3300005842 Ga0068858_100020526 Ga0068858_1000205269 72
795 3300005844 Ga0068862_100025302 Ga0068862_1000253028 72
796 3300006931 Ga0097620_100162519 Ga0097620_1001625194 72
797 3300009148 Ga0105243_10161300 Ga0105243_101613002 72
798 3300009176 Ga0105242_10863468 Ga0105242_108634682 72
799 3300009177 Ga0105248_10694864 Ga0105248_106948642 72
800 3300009177 Ga0105248_11109947 Ga0105248_111099472 72
801 3300009553 Ga0105249_10121432 Ga0105249_101214324 72
802 3300013306 Ga0163162_11531835 Ga0163162_115318352 72
803 3300014325 Ga0163163_10274780 Ga0163163_102747803 72
804 3300014745 Ga0157377_10153597 Ga0157377_101535972 72
805 3300014968 Ga0157379_10753369 Ga0157379_107533692 72
806 3300025926 Ga0207659_11579333 Ga0207659_115793332 72
807 3300025932 Ga0207690_10069444 Ga0207690_100694442 72
808 3300025935 Ga0207709_10290075 Ga0207709_102900752 72
809 3300025941 Ga0207711_10782851 Ga0207711_107828512 72
810 3300025941 Ga0207711_11888227 Ga0207711_118882272 72
811 3300025942 Ga0207689_10073436 Ga0207689_100734362 72
812 3300025945 Ga0207679_10081752 Ga0207679_100817524 72
813 3300025972 Ga0207668_11243370 Ga0207668_112433702 72
814 3300026035 Ga0207703_10163523 Ga0207703_101635232 72
815 3300026067 Ga0207678_10148222 Ga0207678_101482222 72
816 3300026088 Ga0207641_10987317 Ga0207641_109873172 72
817 3300031548 Ga0307408_100029310 Ga0307408_1000293102 72
818 3300031901 Ga0307406_10018474 Ga0307406_100184743 72
819 3300038443 Ga0395901_0449364 Ga0395901_0449364_528_752 72
820 3300042439 Ga0439464_0001273 Ga0439464_0001273_1332_1553 72
821 3300046525 Ga0495663_0030415 Ga0495663_0030415_455_679 72
822 3300046684 Ga0495669_0126167 Ga0495669_0126167_377_601 72
823 3300037312 Ga0395899_0454091 Ga0395899_0454091_523_750 73
824 3300037418 Ga0395900_0000325 Ga0395900_0000325_53234_53461 73
825 3300037471 Ga0395905_0000218 Ga0395905_0000218_57169_57396 73
826 3300038443 Ga0395901_0000962 Ga0395901_0000962_22756_22983 73
827 3300046616 Ga0495668_0361688 Ga0495668_0361688_214_441 73
828 3300049652 Ga0501202_039918 Ga0501202_039918_766_993 73
829 3300049654 Ga0501207_106283 Ga0501207_106283_275_502 73
830 3300049656 Ga0501209_021727 Ga0501209_021727_1195_1422 73
831 3300049660 Ga0501216_191078 Ga0501216_191078_214_441 73
832 3300049669 Ga0501235_010718 Ga0501235_010718_850_1077 73
833 3300049674 Ga0501242_014640 Ga0501242_014640_58_285 73
834 3300049683 Ga0501253_123161 Ga0501253_123161_42_269 73
835 3300049687 Ga0501258_061312 Ga0501258_061312_81_308 73
836 3300049688 Ga0501259_206948 Ga0501259_206948_251_478 73
837 3300049704 Ga0501221_012393 Ga0501221_012393_402_629 73
838 3300049705 Ga0501225_0041815 Ga0501225_0041815_415_642 73
839 3300049769 Ga0501272_023855 Ga0501272_023855_253_480 73
840 3300049770 Ga0501273_030918 Ga0501273_030918_401_628 73
841 3300049775 Ga0501279_078600 Ga0501279_078600_93_320 73
842 3300000532 CNAas_1009794 CNAas_10097942 74
843 3300005844 Ga0068862_101360095 Ga0068862_1013600952 74
844 3300025923 Ga0207681_10765765 Ga0207681_107657652 74
845 3300025938 Ga0207704_10380619 Ga0207704_103806192 74
846 3300046616 Ga0495668_0012970 Ga0495668_0012970_2237_2461 74
847 3300046684 Ga0495669_0160775 Ga0495669_0160775_344_568 74
848 3300053134 Ga0500658_0000041 Ga0500658_0000041_19158_19382 74

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13617

Lipoprotein_19

YnbE-like lipoprotein

26

59

0.99

Feature Viewer

pLDDT pTM Quality
58.48 0.17 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map