F483316

General Info

Members Datasets Scaffolds Average Seq Length
847 337 1682 337

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100010138|Ga0068868_1000101384
Length 385
Sequence MTMHVGVGESASRPISRFRHGFAACAGCCEPRRSSLAFSATGVPATKKAPKGKSDTGRQNGAAAAKPHRIDVHHHIVPPRYVTDMGLKWVNRHNAPLPLHGPLQWTPEQSIAEMDRNGVATAITSLSDPGVWSGDVARSRSVARYCNDYAAQLARDYPGRFGVFASLAPPDIEGSLREIEYAFDVLGADGIVLMTSYGDRWPGDAAFAPVFDELNRRKAVVYFHPTAAPCCEGLIPDVADAVVEFLFDTVRAVTSLLYSGTLSRCSDIRYIFSHAGSAVPLLAGRISRLARITEAVNPRLPNGAMHELKRLYYDVAQQASPEGLVPLMTLVSADQVLFGSDYPWAPPGMMAQTVAGLAAFGFQPDELQAIERGNALRLFPRFAQP

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0
Rhizoplane 6.26
Rhizosphere 86.78
Stem 0
Stem Tuber 0
Unclassified 12.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100010138 3300005338 Bacteria 6809
2 JGI25153J46596_10001600 3300003215 Bacteria 13420
3 JGI25153J46596_10003919 3300003215 Bacteria 8164
4 Ga0065715_10007812 3300005293 Unclassified 2592
5 Ga0070658_10031050 3300005327 Bacteria 4290
6 Ga0070676_10006719 3300005328 Bacteria 6163
7 Ga0070683_100005567 3300005329 Bacteria 10516
8 Ga0070683_100251336 3300005329 Bacteria 1681
9 Ga0070690_100035776 3300005330 Bacteria 3118
10 Ga0070690_100148028 3300005330 Bacteria 1599
11 Ga0070670_100000360 3300005331 Bacteria 38098
12 Ga0070670_100004292 3300005331 Bacteria 11933
13 Ga0070670_100008155 3300005331 Bacteria 8918
14 Ga0068869_100022698 3300005334 Bacteria 4327
15 Ga0068869_100155068 3300005334 Unclassified 1779
16 Ga0070666_10003141 3300005335 Bacteria 10030
17 Ga0070680_100001073 3300005336 Bacteria 19625
18 Ga0070680_100001601 3300005336 Bacteria 16529
19 Ga0070680_100013675 3300005336 Bacteria 6327
20 Ga0070680_100084397 3300005336 Bacteria 2623
21 Ga0070680_100089716 3300005336 Bacteria 2544
22 Ga0070680_100121819 3300005336 Bacteria 2178
23 Ga0070680_100153483 3300005336 Bacteria 1934
24 Ga0070680_100240301 3300005336 Bacteria 1531
25 Ga0068868_100001821 3300005338 Bacteria 14654
26 Ga0068868_100009212 3300005338 Bacteria 7094
27 Ga0070660_100004998 3300005339 Bacteria 9169
28 Ga0070660_100237426 3300005339 Unclassified 1484
29 Ga0070689_100008822 3300005340 Bacteria 7121
30 Ga0070689_100070073 3300005340 Bacteria 2736
31 Ga0070689_100241615 3300005340 Bacteria 1487
32 Ga0070691_10046989 3300005341 Unclassified 2052
33 Ga0070687_100020116 3300005343 Bacteria 3116
34 Ga0070687_100023314 3300005343 Unclassified 2941
35 Ga0070661_100000772 3300005344 Bacteria 23116
36 Ga0070661_100036427 3300005344 Bacteria 3576
37 Ga0070661_100049114 3300005344 Bacteria 3089
38 Ga0070661_100425122 3300005344 Bacteria 1054
39 Ga0070692_10022678 3300005345 Bacteria 3069
40 Ga0070668_100090479 3300005347 Bacteria 2411
41 Ga0070668_100133205 3300005347 Unclassified 1996
42 Ga0070668_100187874 3300005347 Bacteria 1691
43 Ga0070675_100039312 3300005354 Bacteria 3860
44 Ga0070675_100201549 3300005354 Unclassified 1727
45 Ga0070671_100001024 3300005355 Bacteria 20538
46 Ga0070671_100010061 3300005355 Bacteria 7596
47 Ga0070671_100054636 3300005355 Bacteria 3321
48 Ga0070671_100057104 3300005355 Bacteria 3247
49 Ga0070674_100061668 3300005356 Bacteria 2618
50 Ga0070674_100093025 3300005356 Bacteria 2181
51 Ga0070673_100000234 3300005364 Bacteria 27814
52 Ga0070673_100123210 3300005364 Bacteria 2166
53 Ga0070673_100129972 3300005364 Bacteria 2112
54 Ga0070673_100167049 3300005364 Bacteria 1876
55 Ga0070688_100061740 3300005365 Bacteria 2370
56 Ga0070688_100102529 3300005365 Bacteria 1889
57 Ga0070688_100118618 3300005365 Bacteria 1769
58 Ga0070688_100226817 3300005365 Bacteria 1319
59 Ga0070659_100092341 3300005366 Bacteria 2427
60 Ga0070659_100138977 3300005366 Bacteria 1977
61 Ga0070667_100014038 3300005367 Bacteria 6621
62 Ga0070667_100014411 3300005367 Bacteria 6533
63 Ga0070667_100211413 3300005367 Unclassified 1724
64 Ga0070709_10014066 3300005434 Bacteria 4517
65 Ga0070714_100001344 3300005435 Bacteria 17780
66 Ga0070714_100020981 3300005435 Bacteria 5341
67 Ga0070714_100035257 3300005435 Bacteria 4193
68 Ga0070713_100001547 3300005436 Bacteria 14707
69 Ga0070713_100065329 3300005436 Bacteria 3056
70 Ga0070713_100068666 3300005436 Bacteria 2987
71 Ga0070713_100194615 3300005436 Bacteria 1828
72 Ga0070701_10053981 3300005438 Unclassified 2094
73 Ga0070711_100335680 3300005439 Bacteria 1211
74 Ga0070700_100155415 3300005441 Bacteria 1569
75 Ga0070694_100023040 3300005444 Bacteria 3998
76 Ga0070694_100070229 3300005444 Bacteria 2411
77 Ga0070663_100008942 3300005455 Bacteria 6186
78 Ga0070678_100000029 3300005456 Bacteria 45879
79 Ga0070678_100047842 3300005456 Bacteria 3076
80 Ga0070678_100531369 3300005456 Bacteria 1042
81 Ga0070662_100069230 3300005457 Unclassified 2596
82 Ga0070681_10001127 3300005458 Bacteria 22938
83 Ga0070681_10003861 3300005458 Bacteria 14104
84 Ga0070681_10010586 3300005458 Bacteria 9111
85 Ga0070681_10013126 3300005458 Bacteria 8229
86 Ga0070681_10027003 3300005458 Bacteria 5772
87 Ga0070681_10047532 3300005458 Unclassified 4290
88 Ga0070681_10085053 3300005458 Bacteria 3116
89 Ga0070681_10112684 3300005458 Bacteria 2660
90 Ga0070681_10125886 3300005458 Bacteria 2495
91 Ga0070681_10131109 3300005458 Bacteria 2439
92 Ga0070681_10420970 3300005458 Unclassified 1248
93 Ga0068867_100013424 3300005459 Bacteria 5803
94 Ga0068867_100014340 3300005459 Bacteria 5614
95 Ga0068867_100084333 3300005459 Bacteria 2400
96 Ga0068867_100091715 3300005459 Bacteria 2307
97 Ga0068867_100126649 3300005459 Bacteria 1980
98 Ga0068867_100188936 3300005459 Unclassified 1642
99 Ga0070685_10040207 3300005466 Unclassified 2660
100 Ga0070685_10060997 3300005466 Bacteria 2207
101 Ga0070699_100045216 3300005518 Bacteria 3811
102 Ga0070679_100000747 3300005530 Bacteria 28132
103 Ga0070679_100003445 3300005530 Bacteria 14489
104 Ga0070679_100012721 3300005530 Bacteria 8048
105 Ga0070679_100105672 3300005530 Bacteria 2801
106 Ga0070679_100119144 3300005530 Bacteria 2624
107 Ga0070679_100126401 3300005530 Bacteria 2539
108 Ga0070679_100132597 3300005530 Bacteria 2472
109 Ga0070679_100135881 3300005530 Bacteria 2440
110 Ga0070679_100167854 3300005530 Bacteria 2168
111 Ga0070679_100182842 3300005530 Bacteria 2068
112 Ga0070684_100041950 3300005535 Unclassified 3948
113 Ga0070684_100045575 3300005535 Bacteria 3797
114 Ga0070684_100075718 3300005535 Unclassified 2969
115 Ga0070684_100098494 3300005535 Bacteria 2608
116 Ga0070684_100306894 3300005535 Unclassified 1457
117 Ga0070684_100554897 3300005535 Bacteria 1066
118 Ga0068853_100070760 3300005539 Unclassified 3037
119 Ga0068853_100080699 3300005539 Bacteria 2847
120 Ga0070672_100000952 3300005543 Bacteria 17440
121 Ga0070672_100024538 3300005543 Bacteria 4459
122 Ga0070672_100030395 3300005543 Bacteria 4057
123 Ga0070672_100063647 3300005543 Unclassified 2913
124 Ga0070695_100283595 3300005545 Bacteria 1218
125 Ga0070696_100116697 3300005546 Bacteria 1928
126 Ga0070665_100080630 3300005548 Unclassified 3260
127 Ga0070665_100143329 3300005548 Unclassified 2392
128 Ga0070704_100004501 3300005549 Bacteria 8048
129 Ga0068855_100004131 3300005563 Bacteria 17708
130 Ga0068855_100056524 3300005563 Bacteria 4604
131 Ga0068855_100082843 3300005563 Bacteria 3717
132 Ga0068855_100160584 3300005563 Bacteria 2551
133 Ga0068855_100222282 3300005563 Bacteria 2117
134 Ga0070664_100001531 3300005564 Bacteria 18459
135 Ga0070664_100008176 3300005564 Bacteria 8456
136 Ga0070664_100008202 3300005564 Bacteria 8448
137 Ga0070664_100085893 3300005564 Bacteria 2718
138 Ga0070664_100093464 3300005564 Unclassified 2606
139 Ga0070664_100117409 3300005564 Unclassified 2327
140 Ga0068857_100002292 3300005577 Bacteria 15564
141 Ga0068857_100003096 3300005577 Bacteria 13761
142 Ga0068857_100028101 3300005577 Bacteria 4961
143 Ga0068857_100039051 3300005577 Unclassified 4204
144 Ga0068857_100040629 3300005577 Bacteria 4125
145 Ga0068857_100172853 3300005577 Bacteria 1964
146 Ga0068857_100359503 3300005577 Unclassified 1349
147 Ga0068854_100000507 3300005578 Bacteria 23751
148 Ga0068854_100104443 3300005578 Bacteria 2128
149 Ga0068856_100005189 3300005614 Bacteria 12860
150 Ga0068856_100045474 3300005614 Bacteria 4323
151 Ga0068856_100140700 3300005614 Unclassified 2420
152 Ga0068856_100294430 3300005614 Unclassified 1640
153 Ga0068856_100398118 3300005614 Bacteria 1397
154 Ga0068852_100000304 3300005616 Bacteria 33142
155 Ga0068852_100001579 3300005616 Bacteria 15484
156 Ga0068852_100024490 3300005616 Bacteria 4879
157 Ga0068859_100008832 3300005617 Bacteria 10175
158 Ga0068859_100083699 3300005617 Bacteria 3234
159 Ga0068859_100093499 3300005617 Bacteria 3058
160 Ga0068859_100121663 3300005617 Bacteria 2677
161 Ga0068859_100380404 3300005617 Unclassified 1507
162 Ga0068864_100008517 3300005618 Bacteria 8461
163 Ga0068864_100013302 3300005618 Bacteria 6815
164 Ga0068864_100159953 3300005618 Unclassified 2047
165 Ga0068864_100282554 3300005618 Bacteria 1549
166 Ga0068866_10012323 3300005718 Bacteria 3724
167 Ga0068866_10091640 3300005718 Unclassified 1656
168 Ga0068861_100010480 3300005719 Bacteria 6433
169 Ga0068851_10003179 3300005834 Bacteria 7280
170 Ga0068851_10015788 3300005834 Bacteria 3604
171 Ga0068870_10016862 3300005840 Bacteria 3501
172 Ga0068870_10028970 3300005840 Bacteria 2785
173 Ga0068863_100016598 3300005841 Bacteria 7066
174 Ga0068863_100020579 3300005841 Bacteria 6306
175 Ga0068863_100118268 3300005841 Bacteria 2526
176 Ga0068863_100129941 3300005841 Bacteria 2404
177 Ga0068863_100441823 3300005841 Bacteria 1276
178 Ga0068863_100553194 3300005841 Unclassified 1136
179 Ga0068858_100011311 3300005842 Bacteria 8431
180 Ga0068858_100015894 3300005842 Bacteria 7073
181 Ga0068858_100106780 3300005842 Bacteria 2613
182 Ga0068858_100165648 3300005842 Bacteria 2083
183 Ga0068858_100266687 3300005842 Bacteria 1629
184 Ga0068860_100012074 3300005843 Bacteria 8505
185 Ga0068860_100042971 3300005843 Bacteria 4313
186 Ga0068860_100044476 3300005843 Bacteria 4232
187 Ga0068860_100240848 3300005843 Unclassified 1759
188 Ga0068860_100286267 3300005843 Bacteria 1611
189 Ga0068860_100534885 3300005843 Bacteria 1173
190 Ga0068862_100004017 3300005844 Bacteria 12473
191 Ga0068862_100043818 3300005844 Bacteria 3815
192 Ga0081539_10015961 3300005985 Bacteria 5409
193 Ga0075365_10028321 3300006038 Bacteria 3573
194 Ga0075365_10029767 3300006038 Bacteria 3493
195 Ga0075365_10067402 3300006038 Bacteria 2403
196 Ga0075365_10131461 3300006038 Bacteria 1732
197 Ga0075368_10012864 3300006042 Bacteria 3064
198 Ga0075363_100007008 3300006048 Bacteria 5153
199 Ga0075363_100008158 3300006048 Bacteria 4862
200 Ga0075363_100023423 3300006048 Bacteria 3129
201 Ga0075364_10013177 3300006051 Bacteria 5075
202 Ga0075364_10151058 3300006051 Bacteria 1565
203 Ga0075364_10247121 3300006051 Bacteria 1212
204 Ga0070715_10039124 3300006163 Unclassified 1973
205 Ga0070716_100056741 3300006173 Bacteria 2247
206 Ga0070712_100018454 3300006175 Bacteria 4532
207 Ga0070712_100192442 3300006175 Bacteria 1597
208 Ga0075362_10001351 3300006177 Bacteria 7761
209 Ga0075362_10086549 3300006177 Bacteria 1450
210 Ga0075367_10058435 3300006178 Bacteria 2295
211 Ga0075367_10156001 3300006178 Unclassified 1418
212 Ga0075366_10002637 3300006195 Bacteria 9235
213 Ga0075366_10044936 3300006195 Bacteria 2618
214 Ga0097621_100001892 3300006237 Bacteria 14292
215 Ga0097621_100010583 3300006237 Bacteria 6756
216 Ga0097621_100065103 3300006237 Bacteria 2999
217 Ga0097621_100197938 3300006237 Unclassified 1743
218 Ga0075370_10004386 3300006353 Bacteria 6843
219 Ga0075370_10034735 3300006353 Unclassified 2827
220 Ga0068871_100000178 3300006358 Bacteria 43025
221 Ga0068871_100004850 3300006358 Bacteria 9399
222 Ga0068871_100008039 3300006358 Bacteria 7571
223 Ga0068871_100044859 3300006358 Bacteria 3556
224 Ga0068871_100048242 3300006358 Bacteria 3437
225 Ga0068871_100264253 3300006358 Unclassified 1502
226 Ga0075428_100134776 3300006844 Bacteria 2686
227 Ga0075430_100001709 3300006846 Bacteria 17898
228 Ga0075431_100036195 3300006847 Bacteria 5084
229 Ga0075431_100322754 3300006847 Bacteria 1557
230 Ga0075433_10076716 3300006852 Bacteria 2943
231 Ga0075433_10112496 3300006852 Bacteria 2415
232 Ga0075433_10351968 3300006852 Bacteria 1302
233 Ga0075434_100025232 3300006871 Bacteria 5816
234 Ga0075434_100046742 3300006871 Bacteria 4295
235 Ga0075434_100101966 3300006871 Bacteria 2877
236 Ga0075429_100112864 3300006880 Bacteria 2375
237 Ga0075429_100202630 3300006880 Unclassified 1739
238 Ga0068865_100059948 3300006881 Bacteria 2663
239 Ga0068865_100089042 3300006881 Bacteria 2234
240 Ga0097620_100008832 3300006931 Bacteria 10175
241 Ga0097620_100083695 3300006931 Bacteria 3234
242 Ga0097620_100093498 3300006931 Bacteria 3058
243 Ga0097620_100121665 3300006931 Bacteria 2677
244 Ga0097620_100380398 3300006931 Unclassified 1507
245 Ga0075435_100041209 3300007076 Bacteria 3691
246 Ga0075435_100069115 3300007076 Bacteria 2879
247 Ga0105240_10003088 3300009093 Bacteria 26186
248 Ga0105240_10008709 3300009093 Bacteria 14473
249 Ga0105240_10009948 3300009093 Bacteria 13407
250 Ga0105240_10022713 3300009093 Bacteria 8310
251 Ga0105240_10048700 3300009093 Bacteria 5354
252 Ga0105240_10064259 3300009093 Bacteria 4561
253 Ga0105240_10067874 3300009093 Bacteria 4419
254 Ga0105240_10297110 3300009093 Bacteria 1849
255 Ga0105240_10719551 3300009093 Unclassified 1088
256 Ga0111539_10000966 3300009094 Bacteria 37738
257 Ga0111539_10002463 3300009094 Bacteria 24585
258 Ga0111539_10024789 3300009094 Bacteria 7357
259 Ga0111539_10038682 3300009094 Bacteria 5756
260 Ga0111539_10103464 3300009094 Bacteria 3342
261 Ga0111539_10332176 3300009094 Unclassified 1769
262 Ga0105245_10000873 3300009098 Bacteria 27322
263 Ga0105245_10004551 3300009098 Bacteria 12237
264 Ga0105245_10008605 3300009098 Bacteria 8903
265 Ga0105245_10044451 3300009098 Bacteria 3964
266 Ga0105245_10048198 3300009098 Bacteria 3811
267 Ga0105247_10006463 3300009101 Bacteria 7259
268 Ga0105247_10028032 3300009101 Bacteria 3406
269 Ga0105247_10172965 3300009101 Bacteria 1437
270 Ga0114129_10047462 3300009147 Bacteria 6033
271 Ga0114129_10048772 3300009147 Bacteria 5952
272 Ga0114129_10093819 3300009147 Bacteria 4157
273 Ga0114129_10107522 3300009147 Bacteria 3852
274 Ga0114129_10203432 3300009147 Bacteria 2680
275 Ga0114129_10451088 3300009147 Unclassified 1687
276 Ga0105243_10033245 3300009148 Bacteria 3988
277 Ga0105243_10057455 3300009148 Bacteria 3098
278 Ga0105243_10121583 3300009148 Bacteria 2202
279 Ga0105241_10016750 3300009174 Bacteria 5378
280 Ga0105241_10025688 3300009174 Bacteria 4378
281 Ga0105241_10118040 3300009174 Bacteria 2132
282 Ga0105241_10205732 3300009174 Bacteria 1647
283 Ga0105242_10001175 3300009176 Bacteria 20607
284 Ga0105242_10017298 3300009176 Bacteria 5615
285 Ga0105242_10027010 3300009176 Bacteria 4553
286 Ga0105242_10033080 3300009176 Bacteria 4138
287 Ga0105242_10098912 3300009176 Bacteria 2468
288 Ga0105242_10147209 3300009176 Unclassified 2050
289 Ga0105242_10227682 3300009176 Unclassified 1669
290 Ga0105248_10001047 3300009177 Bacteria 30629
291 Ga0105248_10009284 3300009177 Bacteria 10829
292 Ga0105248_10012888 3300009177 Bacteria 9219
293 Ga0105248_10024707 3300009177 Bacteria 6682
294 Ga0105248_10150427 3300009177 Unclassified 2626
295 Ga0105248_10178959 3300009177 Unclassified 2390
296 Ga0105237_10012575 3300009545 Bacteria 8915
297 Ga0105237_10017735 3300009545 Bacteria 7380
298 Ga0105237_10105768 3300009545 Bacteria 2805
299 Ga0105237_10263944 3300009545 Bacteria 1725
300 Ga0105238_10008593 3300009551 Bacteria 10218
301 Ga0105238_10015546 3300009551 Bacteria 7706
302 Ga0105238_10057321 3300009551 Bacteria 3906
303 Ga0105249_10022737 3300009553 Bacteria 5619
304 Ga0105249_10197939 3300009553 Bacteria 1965
305 Ga0105239_10027842 3300010375 Bacteria 6218
306 Ga0105239_10053275 3300010375 Unclassified 4438
307 Ga0105239_10389467 3300010375 Bacteria 1576
308 Ga0157373_10019856 3300013100 Bacteria 4888
309 Ga0157370_10013826 3300013104 Bacteria 8291
310 Ga0157370_10014113 3300013104 Bacteria 8194
311 Ga0157370_10046152 3300013104 Bacteria 4177
312 Ga0157370_10108970 3300013104 Bacteria 2589
313 Ga0157370_10136615 3300013104 Bacteria 2285
314 Ga0157369_10002769 3300013105 Bacteria 20942
315 Ga0157369_10010521 3300013105 Bacteria 10531
316 Ga0157369_10020431 3300013105 Bacteria 7402
317 Ga0157369_10075019 3300013105 Bacteria 3626
318 Ga0157369_10136917 3300013105 Bacteria 2592
319 Ga0157369_10315166 3300013105 Bacteria 1626
320 Ga0157369_10479294 3300013105 Bacteria 1288
321 Ga0157374_10006530 3300013296 Bacteria 9904
322 Ga0157374_10043040 3300013296 Bacteria 4169
323 Ga0157374_10142908 3300013296 Unclassified 2323
324 Ga0157374_10179311 3300013296 Bacteria 2069
325 Ga0157378_10000669 3300013297 Bacteria 32263
326 Ga0157378_10070930 3300013297 Bacteria 3128
327 Ga0157378_10114911 3300013297 Unclassified 2473
328 Ga0163162_10007098 3300013306 Bacteria 10872
329 Ga0163162_10058159 3300013306 Unclassified 3895
330 Ga0163162_10076918 3300013306 Bacteria 3400
331 Ga0163162_10311329 3300013306 Bacteria 1707
332 Ga0157372_10007514 3300013307 Bacteria 11592
333 Ga0157372_10170372 3300013307 Bacteria 2519
334 Ga0157372_10245451 3300013307 Bacteria 2078
335 Ga0157372_10343095 3300013307 Bacteria 1740
336 Ga0157372_10459096 3300013307 Bacteria 1485
337 Ga0157372_10487366 3300013307 Bacteria 1437
338 Ga0157375_10019135 3300013308 Bacteria 6220
339 Ga0157375_10139469 3300013308 Unclassified 2550
340 Ga0157375_10140829 3300013308 Unclassified 2539
341 Ga0157375_10244923 3300013308 Unclassified 1953
342 Ga0163163_10018204 3300014325 Bacteria 6570
343 Ga0163163_10020236 3300014325 Bacteria 6264
344 Ga0163163_10060723 3300014325 Bacteria 3744
345 Ga0163163_10165626 3300014325 Unclassified 2256
346 Ga0157380_10005881 3300014326 Bacteria 8581
347 Ga0157380_10382003 3300014326 Bacteria 1329
348 Ga0182008_10035495 3300014497 Bacteria 2497
349 Ga0157377_10030701 3300014745 Bacteria 2913
350 Ga0157379_10016182 3300014968 Bacteria 6562
351 Ga0157379_10023564 3300014968 Bacteria 5463
352 Ga0157379_10030492 3300014968 Unclassified 4801
353 Ga0157376_10071446 3300014969 Unclassified 2950
354 Ga0157376_10100530 3300014969 Unclassified 2525
355 Ga0157376_10138791 3300014969 Unclassified 2178
356 Ga0209758_1005734 3300025297 Bacteria 9358
357 Ga0207697_10066972 3300025315 Unclassified 1501
358 Ga0207656_10042183 3300025321 Bacteria 1940
359 Ga0207682_10035721 3300025893 Bacteria 2008
360 Ga0207710_10006028 3300025900 Bacteria 5195
361 Ga0207688_10000663 3300025901 Bacteria 16993
362 Ga0207688_10200083 3300025901 Bacteria 1197
363 Ga0207680_10001550 3300025903 Bacteria 10828
364 Ga0207680_10009786 3300025903 Bacteria 4770
365 Ga0207647_10029447 3300025904 Bacteria 3554
366 Ga0207699_10112757 3300025906 Unclassified 1745
367 Ga0207699_10262773 3300025906 Bacteria 1194
368 Ga0207645_10031160 3300025907 Bacteria 3433
369 Ga0207645_10059680 3300025907 Bacteria 2436
370 Ga0207645_10082106 3300025907 Bacteria 2066
371 Ga0207645_10290694 3300025907 Bacteria 1087
372 Ga0207643_10000808 3300025908 Bacteria 19021
373 Ga0207643_10029129 3300025908 Bacteria 3071
374 Ga0207705_10056046 3300025909 Unclassified 2841
375 Ga0207654_10084100 3300025911 Bacteria 1923
376 Ga0207707_10001661 3300025912 Bacteria 20543
377 Ga0207707_10013041 3300025912 Bacteria 7238
378 Ga0207707_10021068 3300025912 Bacteria 5696
379 Ga0207707_10029072 3300025912 Bacteria 4830
380 Ga0207707_10038987 3300025912 Bacteria 4153
381 Ga0207707_10076906 3300025912 Bacteria 2913
382 Ga0207707_10104809 3300025912 Unclassified 2471
383 Ga0207707_10112399 3300025912 Bacteria 2381
384 Ga0207707_10162473 3300025912 Bacteria 1953
385 Ga0207707_10170460 3300025912 Unclassified 1902
386 Ga0207695_10030460 3300025913 Bacteria 5938
387 Ga0207695_10045477 3300025913 Bacteria 4659
388 Ga0207695_10073689 3300025913 Bacteria 3478
389 Ga0207695_10377743 3300025913 Bacteria 1303
390 Ga0207671_10035879 3300025914 Bacteria 3676
391 Ga0207693_10011631 3300025915 Bacteria 7121
392 Ga0207663_10040483 3300025916 Bacteria 2833
393 Ga0207663_10250140 3300025916 Bacteria 1304
394 Ga0207660_10000876 3300025917 Bacteria 19858
395 Ga0207660_10017996 3300025917 Bacteria 4706
396 Ga0207660_10252796 3300025917 Bacteria 1391
397 Ga0207660_10277032 3300025917 Bacteria 1330
398 Ga0207660_10310820 3300025917 Bacteria 1257
399 Ga0207662_10026192 3300025918 Bacteria 3362
400 Ga0207662_10114617 3300025918 Unclassified 1684
401 Ga0207657_10021585 3300025919 Bacteria 6055
402 Ga0207657_10026429 3300025919 Bacteria 5336
403 Ga0207657_10089547 3300025919 Bacteria 2570
404 Ga0207649_10001851 3300025920 Bacteria 12091
405 Ga0207649_10078376 3300025920 Bacteria 2132
406 Ga0207652_10003186 3300025921 Bacteria 13631
407 Ga0207652_10020148 3300025921 Bacteria 5491
408 Ga0207652_10035135 3300025921 Bacteria 4229
409 Ga0207652_10053056 3300025921 Bacteria 3482
410 Ga0207652_10088894 3300025921 Bacteria 2711
411 Ga0207681_10020177 3300025923 Bacteria 4220
412 Ga0207681_10025247 3300025923 Bacteria 3821
413 Ga0207694_10002315 3300025924 Bacteria 15573
414 Ga0207694_10003094 3300025924 Bacteria 13309
415 Ga0207694_10047761 3300025924 Bacteria 3311
416 Ga0207650_10001556 3300025925 Bacteria 16428
417 Ga0207650_10006782 3300025925 Bacteria 7808
418 Ga0207650_10076521 3300025925 Unclassified 2528
419 Ga0207659_10019877 3300025926 Bacteria 4429
420 Ga0207687_10003422 3300025927 Bacteria 10694
421 Ga0207687_10028032 3300025927 Bacteria 3782
422 Ga0207687_10055874 3300025927 Unclassified 2767
423 Ga0207687_10064734 3300025927 Unclassified 2594
424 Ga0207700_10000711 3300025928 Bacteria 19257
425 Ga0207700_10141430 3300025928 Unclassified 1978
426 Ga0207700_10243096 3300025928 Bacteria 1535
427 Ga0207664_10000996 3300025929 Bacteria 19036
428 Ga0207644_10138354 3300025931 Bacteria 1872
429 Ga0207690_10045660 3300025932 Bacteria 2896
430 Ga0207690_10265153 3300025932 Bacteria 1332
431 Ga0207690_10295464 3300025932 Bacteria 1266
432 Ga0207706_10007308 3300025933 Bacteria 10214
433 Ga0207706_10092504 3300025933 Bacteria 2659
434 Ga0207706_10178490 3300025933 Bacteria 1865
435 Ga0207686_10002714 3300025934 Bacteria 9602
436 Ga0207686_10012270 3300025934 Bacteria 4708
437 Ga0207686_10045010 3300025934 Bacteria 2713
438 Ga0207686_10116638 3300025934 Bacteria 1810
439 Ga0207686_10119173 3300025934 Bacteria 1793
440 Ga0207686_10161083 3300025934 Unclassified 1572
441 Ga0207709_10125083 3300025935 Bacteria 1742
442 Ga0207670_10001103 3300025936 Bacteria 14203
443 Ga0207670_10004513 3300025936 Bacteria 7503
444 Ga0207669_10010994 3300025937 Bacteria 4383
445 Ga0207669_10099697 3300025937 Bacteria 1916
446 Ga0207704_10178173 3300025938 Unclassified 1533
447 Ga0207691_10000487 3300025940 Bacteria 39347
448 Ga0207691_10007977 3300025940 Bacteria 10186
449 Ga0207691_10011566 3300025940 Bacteria 8473
450 Ga0207691_10095988 3300025940 Unclassified 2651
451 Ga0207691_10171199 3300025940 Bacteria 1902
452 Ga0207691_10226751 3300025940 Bacteria 1619
453 Ga0207711_10018915 3300025941 Bacteria 5729
454 Ga0207711_10034011 3300025941 Bacteria 4315
455 Ga0207711_10066338 3300025941 Unclassified 3121
456 Ga0207711_10114093 3300025941 Bacteria 2406
457 Ga0207711_10203539 3300025941 Unclassified 1807
458 Ga0207689_10033065 3300025942 Bacteria 4298
459 Ga0207689_10164215 3300025942 Unclassified 1830
460 Ga0207661_10000791 3300025944 Bacteria 20647
461 Ga0207679_10005265 3300025945 Bacteria 8108
462 Ga0207679_10005698 3300025945 Bacteria 7810
463 Ga0207679_10188185 3300025945 Unclassified 1714
464 Ga0207679_10383770 3300025945 Unclassified 1232
465 Ga0207667_10009675 3300025949 Bacteria 11339
466 Ga0207667_10044627 3300025949 Bacteria 4696
467 Ga0207667_10058405 3300025949 Unclassified 4046
468 Ga0207667_10136510 3300025949 Bacteria 2526
469 Ga0207667_10317198 3300025949 Bacteria 1592
470 Ga0207667_10335599 3300025949 Bacteria 1543
471 Ga0207651_10000522 3300025960 Bacteria 16155
472 Ga0207651_10083250 3300025960 Bacteria 2313
473 Ga0207712_10250665 3300025961 Bacteria 1431
474 Ga0207640_10000864 3300025981 Bacteria 17199
475 Ga0207658_10118664 3300025986 Unclassified 2105
476 Ga0207677_10000909 3300026023 Bacteria 16582
477 Ga0207677_10019201 3300026023 Bacteria 4123
478 Ga0207677_10054923 3300026023 Bacteria 2721
479 Ga0207677_10058062 3300026023 Bacteria 2662
480 Ga0207677_10081831 3300026023 Unclassified 2318
481 Ga0207703_10003230 3300026035 Bacteria 13705
482 Ga0207703_10005264 3300026035 Bacteria 10434
483 Ga0207703_10030728 3300026035 Unclassified 4244
484 Ga0207639_10179460 3300026041 Bacteria 1800
485 Ga0207678_10011629 3300026067 Bacteria 7731
486 Ga0207678_10087745 3300026067 Bacteria 2658
487 Ga0207678_10209985 3300026067 Bacteria 1665
488 Ga0207708_10017098 3300026075 Bacteria 5459
489 Ga0207708_10160293 3300026075 Bacteria 1776
490 Ga0207702_10005560 3300026078 Bacteria 11008
491 Ga0207702_10306829 3300026078 Unclassified 1508
492 Ga0207641_10038856 3300026088 Bacteria 3980
493 Ga0207641_10069108 3300026088 Bacteria 3031
494 Ga0207641_10158636 3300026088 Unclassified 2055
495 Ga0207641_10179724 3300026088 Unclassified 1937
496 Ga0207641_10295741 3300026088 Bacteria 1528
497 Ga0207641_10381836 3300026088 Bacteria 1349
498 Ga0207648_10013950 3300026089 Bacteria 7449
499 Ga0207648_10018557 3300026089 Bacteria 6295
500 Ga0207648_10021939 3300026089 Bacteria 5737
501 Ga0207648_10041396 3300026089 Bacteria 4045
502 Ga0207648_10070878 3300026089 Bacteria 3038
503 Ga0207648_10114088 3300026089 Bacteria 2374
504 Ga0207676_10008300 3300026095 Bacteria 7382
505 Ga0207676_10290116 3300026095 Bacteria 1489
506 Ga0207674_10004206 3300026116 Bacteria 17371
507 Ga0207674_10004223 3300026116 Bacteria 17334
508 Ga0207674_10023513 3300026116 Bacteria 6599
509 Ga0207674_10037457 3300026116 Bacteria 5044
510 Ga0207674_10037894 3300026116 Bacteria 5009
511 Ga0207674_10040678 3300026116 Bacteria 4814
512 Ga0207674_10102958 3300026116 Unclassified 2835
513 Ga0207675_100002040 3300026118 Bacteria 20146
514 Ga0207675_100121015 3300026118 Bacteria 2476
515 Ga0207675_100151299 3300026118 Bacteria 2209
516 Ga0207683_10001359 3300026121 Bacteria 22123
517 Ga0207683_10002624 3300026121 Bacteria 15706
518 Ga0207683_10094760 3300026121 Bacteria 2661
519 Ga0207683_10165451 3300026121 Bacteria 2001
520 Ga0207683_10167454 3300026121 Bacteria 1989
521 Ga0207698_10003982 3300026142 Bacteria 8959
522 Ga0207698_10006663 3300026142 Bacteria 7220
523 Ga0207698_10078798 3300026142 Bacteria 2647
524 Ga0209813_10019704 3300027866 Bacteria 1878
525 Ga0207428_10013971 3300027907 Bacteria 6993
526 Ga0207428_10185877 3300027907 Bacteria 1568
527 Ga0268266_10082106 3300028379 Unclassified 2811
528 Ga0268266_10249683 3300028379 Bacteria 1641
529 Ga0268266_10254026 3300028379 Bacteria 1627
530 Ga0268266_10285439 3300028379 Unclassified 1536
531 Ga0268265_10003753 3300028380 Bacteria 10798
532 Ga0268265_10110274 3300028380 Bacteria 2245
533 Ga0268265_10170677 3300028380 Bacteria 1859
534 Ga0268264_10019097 3300028381 Bacteria 5604
535 Ga0268264_10024308 3300028381 Bacteria 4947
536 Ga0268264_10115629 3300028381 Bacteria 2357
537 Ga0268264_10242333 3300028381 Bacteria 1671
538 Ga0268264_10374045 3300028381 Bacteria 1363
539 Ga0265319_1000609 3300028563 Bacteria 23663
540 Ga0265319_1001589 3300028563 Bacteria 13285
541 Ga0265318_10000413 3300028577 Bacteria 33039
542 Ga0265318_10003429 3300028577 Bacteria 7963
543 Ga0265332_10021346 3300031238 Bacteria 2861
544 Ga0265328_10040237 3300031239 Unclassified 1723
545 Ga0265320_10000126 3300031240 Bacteria 66933
546 Ga0265325_10000300 3300031241 Bacteria 34777
547 Ga0265325_10039612 3300031241 Bacteria 2480
548 Ga0265325_10066760 3300031241 Bacteria 1813
549 Ga0265329_10002177 3300031242 Bacteria 9067
550 Ga0265329_10003421 3300031242 Bacteria 6919
551 Ga0265340_10006776 3300031247 Bacteria 6270
552 Ga0265340_10013459 3300031247 Bacteria 4295
553 Ga0265339_10021805 3300031249 Bacteria 3720
554 Ga0265339_10036466 3300031249 Bacteria 2752
555 Ga0265339_10077022 3300031249 Bacteria 1768
556 Ga0265331_10000025 3300031250 Bacteria 229346
557 Ga0265316_10002023 3300031344 Bacteria 21346
558 Ga0265316_10011066 3300031344 Bacteria 8173
559 Ga0307513_10163172 3300031456 Bacteria 2117
560 Ga0265313_10002717 3300031595 Bacteria 14978
561 Ga0265313_10005119 3300031595 Bacteria 9766
562 Ga0307508_10118987 3300031616 Bacteria 2243
563 Ga0265314_10002211 3300031711 Bacteria 20286
564 Ga0265314_10002925 3300031711 Bacteria 16946
565 Ga0265314_10006180 3300031711 Bacteria 10637
566 Ga0265314_10028254 3300031711 Bacteria 4184
567 Ga0265342_10002273 3300031712 Bacteria 16798
568 Ga0265342_10003553 3300031712 Bacteria 12759
569 Ga0307410_10001555 3300031852 Bacteria 10470
570 Ga0307409_100229207 3300031995 Bacteria 1683
571 Ga0307411_10029466 3300032005 Bacteria 3352
572 Ga0307411_10115651 3300032005 Bacteria 1930
573 Ga0307507_10021651 3300033179 Bacteria 7141
574 Ga0373958_0003514 3300034819 Bacteria 2264
575 Ga0373926_0003746 3300035083 Bacteria 4950
576 Ga0373923_0014926 3300035111 Unclassified 2925
577 Ga0373939_0045084 3300035114 Bacteria 1344
578 Ga0373943_0049954 3300035170 Bacteria 2054
579 Ga0373961_0021220 3300035241 Bacteria 1725
580 Ga0373931_0005266 3300035691 Bacteria 5965
581 Ga0373931_0028508 3300035691 Bacteria 2859
582 Ga0373935_0013406 3300035692 Bacteria 4945
583 Ga0373935_0095845 3300035692 Bacteria 1949
584 Ga0373927_0013237 3300035695 Bacteria 5485
585 Ga0373927_0029586 3300035695 Bacteria 3571
586 Ga0373933_0040617 3300035724 Unclassified 2742
587 Ga0373933_0129976 3300035724 Bacteria 1583
588 Ga0373933_0185573 3300035724 Bacteria 1327
589 Ga0373947_0081263 3300035725 Bacteria 2006
590 Ga0373947_0092281 3300035725 Bacteria 1891
591 Ga0373937_0001624 3300036401 Bacteria 18901
592 Ga0373937_0012218 3300036401 Bacteria 7540
593 Ga0373937_0020394 3300036401 Bacteria 5944
594 Ga0373937_0025752 3300036401 Bacteria 5312
595 Ga0373937_0109331 3300036401 Bacteria 2570
596 Ga0373937_0151708 3300036401 Bacteria 2171
597 Ga0373937_0499211 3300036401 Unclassified 1156
598 Ga0373925_0005806 3300037068 Bacteria 9168
599 Ga0373925_0049808 3300037068 Bacteria 3123
600 Ga0373925_0156901 3300037068 Bacteria 1790
601 Ga0395899_0087951 3300037312 Bacteria 2254
602 Ga0395900_0002747 3300037418 Bacteria 19217
603 Ga0395900_0254251 3300037418 Bacteria 1757
604 Ga0395898_0018984 3300037466 Bacteria 7002
605 Ga0395905_0220132 3300037471 Bacteria 1777
606 Ga0436364_1342640 3300037853 Bacteria 1997
607 Ga0395901_0056051 3300038443 Bacteria 4100
608 Ga0436361_0598168 3300039447 Bacteria 5635
609 Ga0436363_1081739 3300039450 Bacteria 2145
610 Ga0466958_0120408 3300045836 Bacteria 1643
611 Ga0466967_0331005 3300045976 Bacteria 1471
612 Ga0495627_009242 3300046453 Bacteria 3634
613 Ga0495592_0060067 3300046454 Bacteria 2797
614 Ga0495603_0116302 3300046455 Bacteria 1559
615 Ga0495603_0202319 3300046455 Bacteria 1148
616 Ga0495590_0060334 3300046457 Bacteria 1328
617 Ga0495651_0003700 3300046462 Bacteria 11717
618 Ga0495651_0017221 3300046462 Bacteria 5600
619 Ga0495653_0005354 3300046463 Bacteria 10443
620 Ga0495653_0022342 3300046463 Bacteria 5119
621 Ga0495580_0008302 3300046472 Bacteria 8264
622 Ga0495580_0151628 3300046472 Bacteria 1606
623 Ga0495582_0045692 3300046473 Bacteria 2412
624 Ga0495664_0021142 3300046477 Bacteria 3759
625 Ga0495664_0022622 3300046477 Bacteria 3646
626 Ga0495584_0232131 3300046491 Bacteria 938
627 Ga0495585_0072556 3300046492 Bacteria 1875
628 Ga0495608_0040750 3300046511 Bacteria 3111
629 Ga0495608_0051857 3300046511 Bacteria 2717
630 Ga0495616_0075573 3300046513 Unclassified 1621
631 Ga0495620_0036941 3300046515 Bacteria 2180
632 Ga0495628_0015347 3300046516 Bacteria 6397
633 Ga0495628_0251985 3300046516 Bacteria 1318
634 Ga0495630_0017063 3300046517 Bacteria 5314
635 Ga0495630_0105400 3300046517 Bacteria 2135
636 Ga0495630_0115118 3300046517 Bacteria 2038
637 Ga0495644_0021615 3300046523 Bacteria 2454
638 Ga0495652_0012012 3300046529 Bacteria 7827
639 Ga0495652_0038611 3300046529 Bacteria 4135
640 Ga0495665_0019038 3300046531 Unclassified 3690
641 Ga0495587_0006972 3300046536 Bacteria 7338
642 Ga0495587_0008300 3300046536 Bacteria 6687
643 Ga0495598_0047802 3300046537 Bacteria 1277
644 Ga0495621_0011285 3300046539 Unclassified 2759
645 Ga0495621_0048496 3300046539 Unclassified 1513
646 Ga0495645_0034846 3300046543 Bacteria 3670
647 Ga0495645_0065843 3300046543 Bacteria 2621
648 Ga0495622_0091214 3300046557 Bacteria 1400
649 Ga0495633_0079489 3300046558 Bacteria 1527
650 Ga0495633_0089526 3300046558 Unclassified 1431
651 Ga0495667_0001766 3300046559 Bacteria 14358
652 Ga0495667_0002726 3300046559 Bacteria 11798
653 Ga0495656_0021736 3300046615 Unclassified 2502
654 Ga0495656_0022552 3300046615 Unclassified 2467
655 Ga0495668_0132149 3300046616 Bacteria 1366
656 Ga0495625_0155211 3300046660 Bacteria 1536
657 Ga0495635_0009050 3300046663 Bacteria 6949
658 Ga0495635_0039202 3300046663 Bacteria 3278
659 Ga0495659_0034039 3300046664 Bacteria 1790
660 Ga0495661_0131790 3300046665 Unclassified 1369
661 Ga0495588_0096308 3300046674 Bacteria 1552
662 Ga0495657_0009531 3300046675 Bacteria 7356
663 Ga0495657_0029527 3300046675 Bacteria 3845
664 Ga0495599_0011681 3300046678 Bacteria 5399
665 Ga0495646_0007578 3300046680 Bacteria 6898
666 Ga0495658_0064913 3300046683 Bacteria 2105
667 Ga0495613_0010679 3300046689 Bacteria 6810
668 Ga0495613_0024298 3300046689 Bacteria 4514
669 Ga0495624_0007500 3300046690 Bacteria 7651
670 Ga0495624_0047148 3300046690 Bacteria 2738
671 Ga0495624_0172749 3300046690 Unclassified 1318
672 Ga0495670_0013224 3300046691 Bacteria 4060
673 Ga0495670_0040088 3300046691 Bacteria 2336
674 Ga0495671_0016342 3300046692 Bacteria 3963
675 Ga0495589_0038877 3300046794 Bacteria 2380
676 Ga0495589_0051868 3300046794 Unclassified 2027
677 Ga0495600_0001469 3300046809 Bacteria 13065
678 Ga0495600_0014002 3300046809 Bacteria 5054
679 Ga0495604_0001664 3300047317 Bacteria 18292
680 Ga0495604_0007416 3300047317 Bacteria 8687
681 Ga0495604_0018395 3300047317 Bacteria 5595
682 Ga0495604_0247359 3300047317 Bacteria 1217
683 Ga0495674_0029342 3300047319 Bacteria 5011
684 Ga0495674_0037720 3300047319 Bacteria 4342
685 Ga0495674_0053620 3300047319 Unclassified 3543
686 Ga0495674_0140076 3300047319 Bacteria 2034
687 Ga0495674_0309214 3300047319 Bacteria 1290
688 Ga0495680_0000648 3300047322 Bacteria 39027
689 Ga0495680_0020176 3300047322 Bacteria 5613
690 Ga0495675_0000643 3300047444 Bacteria 22174
691 Ga0495675_0026266 3300047444 Unclassified 3713
692 Ga0495675_0027252 3300047444 Bacteria 3641
693 Ga0495675_0168246 3300047444 Unclassified 1347
694 Ga0495684_0001017 3300047471 Bacteria 22849
695 Ga0495684_0002508 3300047471 Bacteria 14627
696 Ga0495684_0345533 3300047471 Unclassified 1058
697 Ga0495593_0007923 3300047673 Bacteria 6189
698 Ga0495602_0028473 3300048088 Bacteria 5345
699 Ga0495602_0096714 3300048088 Bacteria 2434
700 Ga0495602_0197203 3300048088 Unclassified 1539
701 Ga0496100_0042248 3300048903 Bacteria 2911
702 Ga0496100_0126255 3300048903 Bacteria 1796
703 Ga0496100_0189952 3300048903 Bacteria 1491
704 Ga0496100_0386280 3300048903 Bacteria 1064
705 Ga0496101_0044456 3300048904 Bacteria 3178
706 Ga0496101_0047499 3300048904 Bacteria 3082
707 Ga0496102_0202408 3300048905 Bacteria 1871
708 Ga0496102_0352009 3300048905 Bacteria 1387
709 Ga0496103_0009597 3300048906 Bacteria 5729
710 Ga0496104_0000629 3300048907 Bacteria 30223
711 Ga0496104_0034040 3300048907 Bacteria 4748
712 Ga0496105_0019396 3300048908 Bacteria 5485
713 Ga0496105_0019467 3300048908 Bacteria 5474
714 Ga0496105_0051517 3300048908 Bacteria 3401
715 Ga0496105_0055817 3300048908 Bacteria 3261
716 Ga0496105_0309860 3300048908 Bacteria 1268
717 Ga0496106_0061353 3300048909 Unclassified 2852
718 Ga0496106_0352882 3300048909 Bacteria 1181
719 Ga0496107_0015140 3300048910 Bacteria 5403
720 Ga0496108_0003956 3300048911 Bacteria 11902
721 Ga0496108_0008275 3300048911 Bacteria 8437
722 Ga0496108_0039962 3300048911 Bacteria 3909
723 Ga0496108_0065021 3300048911 Bacteria 3074
724 Ga0496109_0000766 3300048912 Bacteria 26715
725 Ga0496109_0017476 3300048912 Bacteria 6290
726 Ga0496109_0025633 3300048912 Bacteria 5255
727 Ga0496109_0061682 3300048912 Bacteria 3428
728 Ga0496109_0077486 3300048912 Bacteria 3059
729 Ga0496109_0161631 3300048912 Bacteria 2098
730 Ga0496109_0179131 3300048912 Bacteria 1990
731 Ga0496109_0292355 3300048912 Bacteria 1536
732 Ga0496110_0000354 3300048913 Bacteria 30708
733 Ga0496110_0002398 3300048913 Bacteria 14041
734 Ga0496110_0013610 3300048913 Bacteria 6734
735 Ga0496111_0011549 3300048914 Bacteria 5956
736 Ga0496111_0020931 3300048914 Bacteria 4560
737 Ga0496111_0164779 3300048914 Bacteria 1646
738 Ga0496111_0352688 3300048914 Bacteria 1089
739 Ga0496112_0001055 3300048915 Bacteria 20328
740 Ga0496112_0009411 3300048915 Bacteria 8801
741 Ga0496112_0031686 3300048915 Bacteria 5128
742 Ga0496112_0090177 3300048915 Bacteria 3035
743 Ga0496112_0467858 3300048915 Bacteria 1198
744 Ga0496113_0000323 3300048916 Bacteria 22774
745 Ga0496113_0022159 3300048916 Bacteria 4488
746 Ga0496113_0103915 3300048916 Bacteria 2204
747 Ga0496113_0207089 3300048916 Bacteria 1560
748 Ga0496114_0079340 3300048917 Bacteria 2770
749 Ga0496114_0199376 3300048917 Bacteria 1753
750 Ga0496115_0016209 3300048918 Bacteria 5670
751 Ga0496115_0019361 3300048918 Bacteria 5236
752 Ga0496115_0159256 3300048918 Bacteria 1865
753 Ga0496115_0433097 3300048918 Bacteria 1064
754 Ga0501032_0078449 3300049569 Bacteria 2198
755 Ga0501033_0012886 3300049570 Bacteria 6377
756 Ga0501033_0122020 3300049570 Bacteria 1890
757 Ga0501034_0018046 3300049571 Bacteria 7239
758 Ga0501034_0175476 3300049571 Bacteria 2109
759 Ga0501036_0004687 3300049572 Bacteria 11040
760 Ga0501037_0005982 3300049573 Bacteria 8887
761 Ga0501039_0001438 3300049575 Bacteria 17522
762 Ga0501042_0272635 3300049578 Bacteria 1222
763 Ga0501046_0010334 3300049580 Bacteria 8025
764 Ga0501047_0111201 3300049581 Bacteria 2622
765 Ga0501047_0135237 3300049581 Bacteria 2346
766 Ga0501047_0624976 3300049581 Bacteria 898
767 Ga0501048_0004490 3300049582 Bacteria 10621
768 Ga0501068_0011406 3300049584 Bacteria 5019
769 Ga0501069_0006487 3300049585 Bacteria 6116
770 Ga0501070_0014496 3300049586 Bacteria 6632
771 Ga0501070_0054165 3300049586 Bacteria 3326
772 Ga0501070_0091316 3300049586 Bacteria 2520
773 Ga0501071_0023104 3300049587 Bacteria 4340
774 Ga0501074_0124226 3300049590 Bacteria 1846
775 Ga0501076_0420531 3300049592 Bacteria 1100
776 Ga0501080_0082175 3300049742 Bacteria 2993
777 Ga0501080_0150883 3300049742 Bacteria 2148
778 Ga0501080_0206837 3300049742 Bacteria 1800
779 Ga0501080_0220472 3300049742 Bacteria 1736
780 Ga0501035_0014526 3300049822 Bacteria 7268
781 Ga0501035_0085017 3300049822 Bacteria 2790
782 Ga0501044_0000193 3300049823 Bacteria 76794
783 Ga0501044_0000458 3300049823 Bacteria 49695
784 Ga0501044_0026928 3300049823 Bacteria 6083
785 Ga0501044_0224672 3300049823 Bacteria 1827
786 Ga0501044_0251692 3300049823 Bacteria 1707
787 Ga0501045_0024198 3300049824 Bacteria 4358
788 nmdc:mga03683_14758_c1 3300050489 Bacteria 2898
789 nmdc:mga03683_16132_c1 3300050489 Bacteria 2800
790 nmdc:mga03683_363_c1 3300050489 Bacteria 3039
791 nmdc:mga03683_363_c2 3300050489 Bacteria 10016
792 nmdc:mga03n38_79608_c1 3300050490 Bacteria 1537
793 nmdc:mga00v17_7692_c1 3300050491 Bacteria 5764
794 nmdc:mga0yw44_158908_c1 3300050492 Bacteria 1479
795 nmdc:mga0yw44_62387_c1 3300050492 Bacteria 2289
796 nmdc:mga0yw44_76447_c1 3300050492 Bacteria 1484
797 nmdc:mga0yw44_9242_c1 3300050492 Unclassified 4964
798 nmdc:mga0k408_15679_c1 3300050493 Bacteria 4194
799 nmdc:mga0k408_176154_c1 3300050493 Bacteria 1275
800 nmdc:mga0k408_28442_c1 3300050493 Bacteria 3178
801 nmdc:mga06z11_160112_c1 3300050494 Bacteria 1286
802 nmdc:mga06z11_57436_c1 3300050494 Bacteria 2016
803 nmdc:mga04h51_100902_c1 3300050495 Bacteria 1051
804 nmdc:mga07m45_14539_c2 3300050496 Bacteria 3009
805 nmdc:mga07m45_41932_c1 3300050496 Bacteria 2564
806 nmdc:mga07m45_43094_c1 3300050496 Bacteria 2530
807 nmdc:mga07m45_7395_c1 3300050496 Bacteria 5612
808 nmdc:mga05p37_11335_c1 3300050507 Bacteria 10605
809 nmdc:mga05p37_533843_c1 3300050507 Bacteria 1339
810 nmdc:mga05p37_71294_c1 3300050507 Bacteria 4274
811 nmdc:mga05p37_75490_c1 3300050507 Bacteria 4149
812 nmdc:mga0qj67_41_c1 3300050509 Bacteria 89688
813 nmdc:mga06r32_103740_c1 3300050510 Bacteria 2792
814 nmdc:mga08y16_25452_c1 3300050511 Bacteria 6241
815 nmdc:mga08y16_33436_c1 3300050511 Bacteria 5401
816 nmdc:mga0n895_13231_c1 3300050512 Bacteria 7435
817 nmdc:mga0n895_33930_c1 3300050512 Bacteria 4908
818 nmdc:mga0n895_81049_c1 3300050512 Bacteria 3234
819 nmdc:mga0rr50_24140_c1 3300050513 Bacteria 4207
820 nmdc:mga0rr50_50807_c1 3300050513 Bacteria 3073
821 nmdc:mga0a205_132545_c1 3300050515 Bacteria 2392
822 nmdc:mga0a205_66695_c1 3300050515 Unclassified 3477
823 nmdc:mga0a205_93763_c1 3300050515 Bacteria 2900
824 Ga0495601_0029040 3300053077 Bacteria 3428
825 Ga0495601_0074252 3300053077 Bacteria 2175
826 Ga0495601_0106854 3300053077 Unclassified 1810
827 Ga0495612_0002024 3300053078 Bacteria 8355
828 Ga0500610_0001956 3300053079 Bacteria 7336
829 Ga0500610_0002763 3300053079 Bacteria 6563
830 Ga0500644_0116885 3300053088 Bacteria 1035
831 Ga0500566_0136186 3300053094 Bacteria 1308
832 Ga0500641_0127855 3300053096 Bacteria 1096
833 Ga0500593_000167 3300053117 Bacteria 26501
834 Ga0500595_008487 3300053119 Bacteria 4193
835 Ga0500616_0098680 3300053153 Bacteria 1432
836 Ga0500627_0000617 3300053158 Bacteria 9484
837 Ga0500634_0094881 3300053161 Unclassified 1505
838 Ga0500596_023070 3300053735 Bacteria 942
839 Ga0501084_0212319 3300054114 Bacteria 1633
840 Ga0501082_0006937 3300060353 Bacteria 9790
841 Ga0501082_0100515 3300060353 Bacteria 2502
842 Ga0068868_100010138
843 JGI25153J46596_10001600
844 JGI25153J46596_10003919
845 Ga0065715_10007812
846 Ga0070658_10031050
847 Ga0070676_10006719
848 Ga0070683_100005567
849 Ga0070683_100251336
850 Ga0070690_100035776
851 Ga0070690_100148028
852 Ga0070670_100000360
853 Ga0070670_100004292
854 Ga0070670_100008155
855 Ga0068869_100022698
856 Ga0068869_100155068
857 Ga0070666_10003141
858 Ga0070680_100001073
859 Ga0070680_100001601
860 Ga0070680_100013675
861 Ga0070680_100084397
862 Ga0070680_100089716
863 Ga0070680_100121819
864 Ga0070680_100153483
865 Ga0070680_100240301
866 Ga0068868_100001821
867 Ga0068868_100009212
868 Ga0070660_100004998
869 Ga0070660_100237426
870 Ga0070689_100008822
871 Ga0070689_100070073
872 Ga0070689_100241615
873 Ga0070691_10046989
874 Ga0070687_100020116
875 Ga0070687_100023314
876 Ga0070661_100000772
877 Ga0070661_100036427
878 Ga0070661_100049114
879 Ga0070661_100425122
880 Ga0070692_10022678
881 Ga0070668_100090479
882 Ga0070668_100133205
883 Ga0070668_100187874
884 Ga0070675_100039312
885 Ga0070675_100201549
886 Ga0070671_100001024
887 Ga0070671_100010061
888 Ga0070671_100054636
889 Ga0070671_100057104
890 Ga0070674_100061668
891 Ga0070674_100093025
892 Ga0070673_100000234
893 Ga0070673_100123210
894 Ga0070673_100129972
895 Ga0070673_100167049
896 Ga0070688_100061740
897 Ga0070688_100102529
898 Ga0070688_100118618
899 Ga0070688_100226817
900 Ga0070659_100092341
901 Ga0070659_100138977
902 Ga0070667_100014038
903 Ga0070667_100014411
904 Ga0070667_100211413
905 Ga0070709_10014066
906 Ga0070714_100001344
907 Ga0070714_100020981
908 Ga0070714_100035257
909 Ga0070713_100001547
910 Ga0070713_100065329
911 Ga0070713_100068666
912 Ga0070713_100194615
913 Ga0070701_10053981
914 Ga0070711_100335680
915 Ga0070700_100155415
916 Ga0070694_100023040
917 Ga0070694_100070229
918 Ga0070663_100008942
919 Ga0070678_100000029
920 Ga0070678_100047842
921 Ga0070678_100531369
922 Ga0070662_100069230
923 Ga0070681_10001127
924 Ga0070681_10003861
925 Ga0070681_10010586
926 Ga0070681_10013126
927 Ga0070681_10027003
928 Ga0070681_10047532
929 Ga0070681_10085053
930 Ga0070681_10112684
931 Ga0070681_10125886
932 Ga0070681_10131109
933 Ga0070681_10420970
934 Ga0068867_100013424
935 Ga0068867_100014340
936 Ga0068867_100084333
937 Ga0068867_100091715
938 Ga0068867_100126649
939 Ga0068867_100188936
940 Ga0070685_10040207
941 Ga0070685_10060997
942 Ga0070699_100045216
943 Ga0070679_100000747
944 Ga0070679_100003445
945 Ga0070679_100012721
946 Ga0070679_100105672
947 Ga0070679_100119144
948 Ga0070679_100126401
949 Ga0070679_100132597
950 Ga0070679_100135881
951 Ga0070679_100167854
952 Ga0070679_100182842
953 Ga0070684_100041950
954 Ga0070684_100045575
955 Ga0070684_100075718
956 Ga0070684_100098494
957 Ga0070684_100306894
958 Ga0070684_100554897
959 Ga0068853_100070760
960 Ga0068853_100080699
961 Ga0070672_100000952
962 Ga0070672_100024538
963 Ga0070672_100030395
964 Ga0070672_100063647
965 Ga0070695_100283595
966 Ga0070696_100116697
967 Ga0070665_100080630
968 Ga0070665_100143329
969 Ga0070704_100004501
970 Ga0068855_100004131
971 Ga0068855_100056524
972 Ga0068855_100082843
973 Ga0068855_100160584
974 Ga0068855_100222282
975 Ga0070664_100001531
976 Ga0070664_100008176
977 Ga0070664_100008202
978 Ga0070664_100085893
979 Ga0070664_100093464
980 Ga0070664_100117409
981 Ga0068857_100002292
982 Ga0068857_100003096
983 Ga0068857_100028101
984 Ga0068857_100039051
985 Ga0068857_100040629
986 Ga0068857_100172853
987 Ga0068857_100359503
988 Ga0068854_100000507
989 Ga0068854_100104443
990 Ga0068856_100005189
991 Ga0068856_100045474
992 Ga0068856_100140700
993 Ga0068856_100294430
994 Ga0068856_100398118
995 Ga0068852_100000304
996 Ga0068852_100001579
997 Ga0068852_100024490
998 Ga0068859_100008832
999 Ga0068859_100083699
1000 Ga0068859_100093499
1001 Ga0068859_100121663
1002 Ga0068859_100380404
1003 Ga0068864_100008517
1004 Ga0068864_100013302
1005 Ga0068864_100159953
1006 Ga0068864_100282554
1007 Ga0068866_10012323
1008 Ga0068866_10091640
1009 Ga0068861_100010480
1010 Ga0068851_10003179
1011 Ga0068851_10015788
1012 Ga0068870_10016862
1013 Ga0068870_10028970
1014 Ga0068863_100016598
1015 Ga0068863_100020579
1016 Ga0068863_100118268
1017 Ga0068863_100129941
1018 Ga0068863_100441823
1019 Ga0068863_100553194
1020 Ga0068858_100011311
1021 Ga0068858_100015894
1022 Ga0068858_100106780
1023 Ga0068858_100165648
1024 Ga0068858_100266687
1025 Ga0068860_100012074
1026 Ga0068860_100042971
1027 Ga0068860_100044476
1028 Ga0068860_100240848
1029 Ga0068860_100286267
1030 Ga0068860_100534885
1031 Ga0068862_100004017
1032 Ga0068862_100043818
1033 Ga0081539_10015961
1034 Ga0075365_10028321
1035 Ga0075365_10029767
1036 Ga0075365_10067402
1037 Ga0075365_10131461
1038 Ga0075368_10012864
1039 Ga0075363_100007008
1040 Ga0075363_100008158
1041 Ga0075363_100023423
1042 Ga0075364_10013177
1043 Ga0075364_10151058
1044 Ga0075364_10247121
1045 Ga0070715_10039124
1046 Ga0070716_100056741
1047 Ga0070712_100018454
1048 Ga0070712_100192442
1049 Ga0075362_10001351
1050 Ga0075362_10086549
1051 Ga0075367_10058435
1052 Ga0075367_10156001
1053 Ga0075366_10002637
1054 Ga0075366_10044936
1055 Ga0097621_100001892
1056 Ga0097621_100010583
1057 Ga0097621_100065103
1058 Ga0097621_100197938
1059 Ga0075370_10004386
1060 Ga0075370_10034735
1061 Ga0068871_100000178
1062 Ga0068871_100004850
1063 Ga0068871_100008039
1064 Ga0068871_100044859
1065 Ga0068871_100048242
1066 Ga0068871_100264253
1067 Ga0075428_100134776
1068 Ga0075430_100001709
1069 Ga0075431_100036195
1070 Ga0075431_100322754
1071 Ga0075433_10076716
1072 Ga0075433_10112496
1073 Ga0075433_10351968
1074 Ga0075434_100025232
1075 Ga0075434_100046742
1076 Ga0075434_100101966
1077 Ga0075429_100112864
1078 Ga0075429_100202630
1079 Ga0068865_100059948
1080 Ga0068865_100089042
1081 Ga0097620_100008832
1082 Ga0097620_100083695
1083 Ga0097620_100093498
1084 Ga0097620_100121665
1085 Ga0097620_100380398
1086 Ga0075435_100041209
1087 Ga0075435_100069115
1088 Ga0105240_10003088
1089 Ga0105240_10008709
1090 Ga0105240_10009948
1091 Ga0105240_10022713
1092 Ga0105240_10048700
1093 Ga0105240_10064259
1094 Ga0105240_10067874
1095 Ga0105240_10297110
1096 Ga0105240_10719551
1097 Ga0111539_10000966
1098 Ga0111539_10002463
1099 Ga0111539_10024789
1100 Ga0111539_10038682
1101 Ga0111539_10103464
1102 Ga0111539_10332176
1103 Ga0105245_10000873
1104 Ga0105245_10004551
1105 Ga0105245_10008605
1106 Ga0105245_10044451
1107 Ga0105245_10048198
1108 Ga0105247_10006463
1109 Ga0105247_10028032
1110 Ga0105247_10172965
1111 Ga0114129_10047462
1112 Ga0114129_10048772
1113 Ga0114129_10093819
1114 Ga0114129_10107522
1115 Ga0114129_10203432
1116 Ga0114129_10451088
1117 Ga0105243_10033245
1118 Ga0105243_10057455
1119 Ga0105243_10121583
1120 Ga0105241_10016750
1121 Ga0105241_10025688
1122 Ga0105241_10118040
1123 Ga0105241_10205732
1124 Ga0105242_10001175
1125 Ga0105242_10017298
1126 Ga0105242_10027010
1127 Ga0105242_10033080
1128 Ga0105242_10098912
1129 Ga0105242_10147209
1130 Ga0105242_10227682
1131 Ga0105248_10001047
1132 Ga0105248_10009284
1133 Ga0105248_10012888
1134 Ga0105248_10024707
1135 Ga0105248_10150427
1136 Ga0105248_10178959
1137 Ga0105237_10012575
1138 Ga0105237_10017735
1139 Ga0105237_10105768
1140 Ga0105237_10263944
1141 Ga0105238_10008593
1142 Ga0105238_10015546
1143 Ga0105238_10057321
1144 Ga0105249_10022737
1145 Ga0105249_10197939
1146 Ga0105239_10027842
1147 Ga0105239_10053275
1148 Ga0105239_10389467
1149 Ga0157373_10019856
1150 Ga0157370_10013826
1151 Ga0157370_10014113
1152 Ga0157370_10046152
1153 Ga0157370_10108970
1154 Ga0157370_10136615
1155 Ga0157369_10002769
1156 Ga0157369_10010521
1157 Ga0157369_10020431
1158 Ga0157369_10075019
1159 Ga0157369_10136917
1160 Ga0157369_10315166
1161 Ga0157369_10479294
1162 Ga0157374_10006530
1163 Ga0157374_10043040
1164 Ga0157374_10142908
1165 Ga0157374_10179311
1166 Ga0157378_10000669
1167 Ga0157378_10070930
1168 Ga0157378_10114911
1169 Ga0163162_10007098
1170 Ga0163162_10058159
1171 Ga0163162_10076918
1172 Ga0163162_10311329
1173 Ga0157372_10007514
1174 Ga0157372_10170372
1175 Ga0157372_10245451
1176 Ga0157372_10343095
1177 Ga0157372_10459096
1178 Ga0157372_10487366
1179 Ga0157375_10019135
1180 Ga0157375_10139469
1181 Ga0157375_10140829
1182 Ga0157375_10244923
1183 Ga0163163_10018204
1184 Ga0163163_10020236
1185 Ga0163163_10060723
1186 Ga0163163_10165626
1187 Ga0157380_10005881
1188 Ga0157380_10382003
1189 Ga0182008_10035495
1190 Ga0157377_10030701
1191 Ga0157379_10016182
1192 Ga0157379_10023564
1193 Ga0157379_10030492
1194 Ga0157376_10071446
1195 Ga0157376_10100530
1196 Ga0157376_10138791
1197 Ga0209758_1005734
1198 Ga0207697_10066972
1199 Ga0207656_10042183
1200 Ga0207682_10035721
1201 Ga0207710_10006028
1202 Ga0207688_10000663
1203 Ga0207688_10200083
1204 Ga0207680_10001550
1205 Ga0207680_10009786
1206 Ga0207647_10029447
1207 Ga0207699_10112757
1208 Ga0207699_10262773
1209 Ga0207645_10031160
1210 Ga0207645_10059680
1211 Ga0207645_10082106
1212 Ga0207645_10290694
1213 Ga0207643_10000808
1214 Ga0207643_10029129
1215 Ga0207705_10056046
1216 Ga0207654_10084100
1217 Ga0207707_10001661
1218 Ga0207707_10013041
1219 Ga0207707_10021068
1220 Ga0207707_10029072
1221 Ga0207707_10038987
1222 Ga0207707_10076906
1223 Ga0207707_10104809
1224 Ga0207707_10112399
1225 Ga0207707_10162473
1226 Ga0207707_10170460
1227 Ga0207695_10030460
1228 Ga0207695_10045477
1229 Ga0207695_10073689
1230 Ga0207695_10377743
1231 Ga0207671_10035879
1232 Ga0207693_10011631
1233 Ga0207663_10040483
1234 Ga0207663_10250140
1235 Ga0207660_10000876
1236 Ga0207660_10017996
1237 Ga0207660_10252796
1238 Ga0207660_10277032
1239 Ga0207660_10310820
1240 Ga0207662_10026192
1241 Ga0207662_10114617
1242 Ga0207657_10021585
1243 Ga0207657_10026429
1244 Ga0207657_10089547
1245 Ga0207649_10001851
1246 Ga0207649_10078376
1247 Ga0207652_10003186
1248 Ga0207652_10020148
1249 Ga0207652_10035135
1250 Ga0207652_10053056
1251 Ga0207652_10088894
1252 Ga0207681_10020177
1253 Ga0207681_10025247
1254 Ga0207694_10002315
1255 Ga0207694_10003094
1256 Ga0207694_10047761
1257 Ga0207650_10001556
1258 Ga0207650_10006782
1259 Ga0207650_10076521
1260 Ga0207659_10019877
1261 Ga0207687_10003422
1262 Ga0207687_10028032
1263 Ga0207687_10055874
1264 Ga0207687_10064734
1265 Ga0207700_10000711
1266 Ga0207700_10141430
1267 Ga0207700_10243096
1268 Ga0207664_10000996
1269 Ga0207644_10138354
1270 Ga0207690_10045660
1271 Ga0207690_10265153
1272 Ga0207690_10295464
1273 Ga0207706_10007308
1274 Ga0207706_10092504
1275 Ga0207706_10178490
1276 Ga0207686_10002714
1277 Ga0207686_10012270
1278 Ga0207686_10045010
1279 Ga0207686_10116638
1280 Ga0207686_10119173
1281 Ga0207686_10161083
1282 Ga0207709_10125083
1283 Ga0207670_10001103
1284 Ga0207670_10004513
1285 Ga0207669_10010994
1286 Ga0207669_10099697
1287 Ga0207704_10178173
1288 Ga0207691_10000487
1289 Ga0207691_10007977
1290 Ga0207691_10011566
1291 Ga0207691_10095988
1292 Ga0207691_10171199
1293 Ga0207691_10226751
1294 Ga0207711_10018915
1295 Ga0207711_10034011
1296 Ga0207711_10066338
1297 Ga0207711_10114093
1298 Ga0207711_10203539
1299 Ga0207689_10033065
1300 Ga0207689_10164215
1301 Ga0207661_10000791
1302 Ga0207679_10005265
1303 Ga0207679_10005698
1304 Ga0207679_10188185
1305 Ga0207679_10383770
1306 Ga0207667_10009675
1307 Ga0207667_10044627
1308 Ga0207667_10058405
1309 Ga0207667_10136510
1310 Ga0207667_10317198
1311 Ga0207667_10335599
1312 Ga0207651_10000522
1313 Ga0207651_10083250
1314 Ga0207712_10250665
1315 Ga0207640_10000864
1316 Ga0207658_10118664
1317 Ga0207677_10000909
1318 Ga0207677_10019201
1319 Ga0207677_10054923
1320 Ga0207677_10058062
1321 Ga0207677_10081831
1322 Ga0207703_10003230
1323 Ga0207703_10005264
1324 Ga0207703_10030728
1325 Ga0207639_10179460
1326 Ga0207678_10011629
1327 Ga0207678_10087745
1328 Ga0207678_10209985
1329 Ga0207708_10017098
1330 Ga0207708_10160293
1331 Ga0207702_10005560
1332 Ga0207702_10306829
1333 Ga0207641_10038856
1334 Ga0207641_10069108
1335 Ga0207641_10158636
1336 Ga0207641_10179724
1337 Ga0207641_10295741
1338 Ga0207641_10381836
1339 Ga0207648_10013950
1340 Ga0207648_10018557
1341 Ga0207648_10021939
1342 Ga0207648_10041396
1343 Ga0207648_10070878
1344 Ga0207648_10114088
1345 Ga0207676_10008300
1346 Ga0207676_10290116
1347 Ga0207674_10004206
1348 Ga0207674_10004223
1349 Ga0207674_10023513
1350 Ga0207674_10037457
1351 Ga0207674_10037894
1352 Ga0207674_10040678
1353 Ga0207674_10102958
1354 Ga0207675_100002040
1355 Ga0207675_100121015
1356 Ga0207675_100151299
1357 Ga0207683_10001359
1358 Ga0207683_10002624
1359 Ga0207683_10094760
1360 Ga0207683_10165451
1361 Ga0207683_10167454
1362 Ga0207698_10003982
1363 Ga0207698_10006663
1364 Ga0207698_10078798
1365 Ga0209813_10019704
1366 Ga0207428_10013971
1367 Ga0207428_10185877
1368 Ga0268266_10082106
1369 Ga0268266_10249683
1370 Ga0268266_10254026
1371 Ga0268266_10285439
1372 Ga0268265_10003753
1373 Ga0268265_10110274
1374 Ga0268265_10170677
1375 Ga0268264_10019097
1376 Ga0268264_10024308
1377 Ga0268264_10115629
1378 Ga0268264_10242333
1379 Ga0268264_10374045
1380 Ga0265319_1000609
1381 Ga0265319_1001589
1382 Ga0265318_10000413
1383 Ga0265318_10003429
1384 Ga0265332_10021346
1385 Ga0265328_10040237
1386 Ga0265320_10000126
1387 Ga0265325_10000300
1388 Ga0265325_10039612
1389 Ga0265325_10066760
1390 Ga0265329_10002177
1391 Ga0265329_10003421
1392 Ga0265340_10006776
1393 Ga0265340_10013459
1394 Ga0265339_10021805
1395 Ga0265339_10036466
1396 Ga0265339_10077022
1397 Ga0265331_10000025
1398 Ga0265316_10002023
1399 Ga0265316_10011066
1400 Ga0307513_10163172
1401 Ga0265313_10002717
1402 Ga0265313_10005119
1403 Ga0307508_10118987
1404 Ga0265314_10002211
1405 Ga0265314_10002925
1406 Ga0265314_10006180
1407 Ga0265314_10028254
1408 Ga0265342_10002273
1409 Ga0265342_10003553
1410 Ga0307410_10001555
1411 Ga0307409_100229207
1412 Ga0307411_10029466
1413 Ga0307411_10115651
1414 Ga0307507_10021651
1415 Ga0373958_0003514
1416 Ga0373926_0003746
1417 Ga0373923_0014926
1418 Ga0373939_0045084
1419 Ga0373943_0049954
1420 Ga0373961_0021220
1421 Ga0373931_0005266
1422 Ga0373931_0028508
1423 Ga0373935_0013406
1424 Ga0373935_0095845
1425 Ga0373927_0013237
1426 Ga0373927_0029586
1427 Ga0373933_0040617
1428 Ga0373933_0129976
1429 Ga0373933_0185573
1430 Ga0373947_0081263
1431 Ga0373947_0092281
1432 Ga0373937_0001624
1433 Ga0373937_0012218
1434 Ga0373937_0020394
1435 Ga0373937_0025752
1436 Ga0373937_0109331
1437 Ga0373937_0151708
1438 Ga0373937_0499211
1439 Ga0373925_0005806
1440 Ga0373925_0049808
1441 Ga0373925_0156901
1442 Ga0395899_0087951
1443 Ga0395900_0002747
1444 Ga0395900_0254251
1445 Ga0395898_0018984
1446 Ga0395905_0220132
1447 Ga0436364_1342640
1448 Ga0395901_0056051
1449 Ga0436361_0598168
1450 Ga0436363_1081739
1451 Ga0466958_0120408
1452 Ga0466967_0331005
1453 Ga0495627_009242
1454 Ga0495592_0060067
1455 Ga0495603_0116302
1456 Ga0495603_0202319
1457 Ga0495590_0060334
1458 Ga0495651_0003700
1459 Ga0495651_0017221
1460 Ga0495653_0005354
1461 Ga0495653_0022342
1462 Ga0495580_0008302
1463 Ga0495580_0151628
1464 Ga0495582_0045692
1465 Ga0495664_0021142
1466 Ga0495664_0022622
1467 Ga0495584_0232131
1468 Ga0495585_0072556
1469 Ga0495608_0040750
1470 Ga0495608_0051857
1471 Ga0495616_0075573
1472 Ga0495620_0036941
1473 Ga0495628_0015347
1474 Ga0495628_0251985
1475 Ga0495630_0017063
1476 Ga0495630_0105400
1477 Ga0495630_0115118
1478 Ga0495644_0021615
1479 Ga0495652_0012012
1480 Ga0495652_0038611
1481 Ga0495665_0019038
1482 Ga0495587_0006972
1483 Ga0495587_0008300
1484 Ga0495598_0047802
1485 Ga0495621_0011285
1486 Ga0495621_0048496
1487 Ga0495645_0034846
1488 Ga0495645_0065843
1489 Ga0495622_0091214
1490 Ga0495633_0079489
1491 Ga0495633_0089526
1492 Ga0495667_0001766
1493 Ga0495667_0002726
1494 Ga0495656_0021736
1495 Ga0495656_0022552
1496 Ga0495668_0132149
1497 Ga0495625_0155211
1498 Ga0495635_0009050
1499 Ga0495635_0039202
1500 Ga0495659_0034039
1501 Ga0495661_0131790
1502 Ga0495588_0096308
1503 Ga0495657_0009531
1504 Ga0495657_0029527
1505 Ga0495599_0011681
1506 Ga0495646_0007578
1507 Ga0495658_0064913
1508 Ga0495613_0010679
1509 Ga0495613_0024298
1510 Ga0495624_0007500
1511 Ga0495624_0047148
1512 Ga0495624_0172749
1513 Ga0495670_0013224
1514 Ga0495670_0040088
1515 Ga0495671_0016342
1516 Ga0495589_0038877
1517 Ga0495589_0051868
1518 Ga0495600_0001469
1519 Ga0495600_0014002
1520 Ga0495604_0001664
1521 Ga0495604_0007416
1522 Ga0495604_0018395
1523 Ga0495604_0247359
1524 Ga0495674_0029342
1525 Ga0495674_0037720
1526 Ga0495674_0053620
1527 Ga0495674_0140076
1528 Ga0495674_0309214
1529 Ga0495680_0000648
1530 Ga0495680_0020176
1531 Ga0495675_0000643
1532 Ga0495675_0026266
1533 Ga0495675_0027252
1534 Ga0495675_0168246
1535 Ga0495684_0001017
1536 Ga0495684_0002508
1537 Ga0495684_0345533
1538 Ga0495593_0007923
1539 Ga0495602_0028473
1540 Ga0495602_0096714
1541 Ga0495602_0197203
1542 Ga0496100_0042248
1543 Ga0496100_0126255
1544 Ga0496100_0189952
1545 Ga0496100_0386280
1546 Ga0496101_0044456
1547 Ga0496101_0047499
1548 Ga0496102_0202408
1549 Ga0496102_0352009
1550 Ga0496103_0009597
1551 Ga0496104_0000629
1552 Ga0496104_0034040
1553 Ga0496105_0019396
1554 Ga0496105_0019467
1555 Ga0496105_0051517
1556 Ga0496105_0055817
1557 Ga0496105_0309860
1558 Ga0496106_0061353
1559 Ga0496106_0352882
1560 Ga0496107_0015140
1561 Ga0496108_0003956
1562 Ga0496108_0008275
1563 Ga0496108_0039962
1564 Ga0496108_0065021
1565 Ga0496109_0000766
1566 Ga0496109_0017476
1567 Ga0496109_0025633
1568 Ga0496109_0061682
1569 Ga0496109_0077486
1570 Ga0496109_0161631
1571 Ga0496109_0179131
1572 Ga0496109_0292355
1573 Ga0496110_0000354
1574 Ga0496110_0002398
1575 Ga0496110_0013610
1576 Ga0496111_0011549
1577 Ga0496111_0020931
1578 Ga0496111_0164779
1579 Ga0496111_0352688
1580 Ga0496112_0001055
1581 Ga0496112_0009411
1582 Ga0496112_0031686
1583 Ga0496112_0090177
1584 Ga0496112_0467858
1585 Ga0496113_0000323
1586 Ga0496113_0022159
1587 Ga0496113_0103915
1588 Ga0496113_0207089
1589 Ga0496114_0079340
1590 Ga0496114_0199376
1591 Ga0496115_0016209
1592 Ga0496115_0019361
1593 Ga0496115_0159256
1594 Ga0496115_0433097
1595 Ga0501032_0078449
1596 Ga0501033_0012886
1597 Ga0501033_0122020
1598 Ga0501034_0018046
1599 Ga0501034_0175476
1600 Ga0501036_0004687
1601 Ga0501037_0005982
1602 Ga0501039_0001438
1603 Ga0501042_0272635
1604 Ga0501046_0010334
1605 Ga0501047_0111201
1606 Ga0501047_0135237
1607 Ga0501047_0624976
1608 Ga0501048_0004490
1609 Ga0501068_0011406
1610 Ga0501069_0006487
1611 Ga0501070_0014496
1612 Ga0501070_0054165
1613 Ga0501070_0091316
1614 Ga0501071_0023104
1615 Ga0501074_0124226
1616 Ga0501076_0420531
1617 Ga0501080_0082175
1618 Ga0501080_0150883
1619 Ga0501080_0206837
1620 Ga0501080_0220472
1621 Ga0501035_0014526
1622 Ga0501035_0085017
1623 Ga0501044_0000193
1624 Ga0501044_0000458
1625 Ga0501044_0026928
1626 Ga0501044_0224672
1627 Ga0501044_0251692
1628 Ga0501045_0024198
1629 nmdc:mga03683_14758_c1
1630 nmdc:mga03683_16132_c1
1631 nmdc:mga03683_363_c1
1632 nmdc:mga03683_363_c2
1633 nmdc:mga03n38_79608_c1
1634 nmdc:mga00v17_7692_c1
1635 nmdc:mga0yw44_158908_c1
1636 nmdc:mga0yw44_62387_c1
1637 nmdc:mga0yw44_76447_c1
1638 nmdc:mga0yw44_9242_c1
1639 nmdc:mga0k408_15679_c1
1640 nmdc:mga0k408_176154_c1
1641 nmdc:mga0k408_28442_c1
1642 nmdc:mga06z11_160112_c1
1643 nmdc:mga06z11_57436_c1
1644 nmdc:mga04h51_100902_c1
1645 nmdc:mga07m45_14539_c2
1646 nmdc:mga07m45_41932_c1
1647 nmdc:mga07m45_43094_c1
1648 nmdc:mga07m45_7395_c1
1649 nmdc:mga05p37_11335_c1
1650 nmdc:mga05p37_533843_c1
1651 nmdc:mga05p37_71294_c1
1652 nmdc:mga05p37_75490_c1
1653 nmdc:mga0qj67_41_c1
1654 nmdc:mga06r32_103740_c1
1655 nmdc:mga08y16_25452_c1
1656 nmdc:mga08y16_33436_c1
1657 nmdc:mga0n895_13231_c1
1658 nmdc:mga0n895_33930_c1
1659 nmdc:mga0n895_81049_c1
1660 nmdc:mga0rr50_24140_c1
1661 nmdc:mga0rr50_50807_c1
1662 nmdc:mga0a205_132545_c1
1663 nmdc:mga0a205_66695_c1
1664 nmdc:mga0a205_93763_c1
1665 Ga0495601_0029040
1666 Ga0495601_0074252
1667 Ga0495601_0106854
1668 Ga0495612_0002024
1669 Ga0500610_0001956
1670 Ga0500610_0002763
1671 Ga0500644_0116885
1672 Ga0500566_0136186
1673 Ga0500641_0127855
1674 Ga0500593_000167
1675 Ga0500595_008487
1676 Ga0500616_0098680
1677 Ga0500627_0000617
1678 Ga0500634_0094881
1679 Ga0500596_023070
1680 Ga0501084_0212319
1681 Ga0501082_0006937
1682 Ga0501082_0100515

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

70

381

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.9009 2 311
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.8963 5 312
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.8906 5 312
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.8848 2 311
2dvt-assembly1.cif.gz_C crystal structure of 2,6-dihydroxybenzoate decarboxylase from rhizobium 0.8775 1 311
ID Description Score Start End Superfamily
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8961 5 312 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8904 5 312 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8661 5 311 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8543 5 311 3.20.20.140
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8535 5 311 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A127EPW6-F1-model_v4 Metal-dependent hydrolase 0.9993 1 315 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3P4B6C2-F1-model_v4 Amidohydrolase 0.9872 1 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A844Z3T8-F1-model_v4 Amidohydrolase family protein 0.9822 5 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A552UF10-F1-model_v4 Amidohydrolase 0.981 5 311 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3P4B6C2-F1-model_v4 Amidohydrolase 0.9748 1 313 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map