F483315
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 847 | 344 | 1694 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100019199|Ga0070682_1000191993 |
| Length | 157 |
| Sequence | MAANSQRVAAAEPPFPPSYKMVGSMRGTMERQNISSGARWEPIVGYSRAVRVGPYIHVAGTTATGADGNIVGVGDVYAQTVQTLKNIESALRKAGATLADVVRTRMFVINIADWEKIGKAHGEFFRDIRPATSMIEIKSLISPEMLVEIEADAIVMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 133 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 134 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 203 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 301 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 302 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 303 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 1.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 4.96 |
| Rhizosphere | 94.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070682_100019199 | 3300005337 | Bacteria | 4006 |
| 2 | LJNas_1000045 | 3300000546 | Bacteria | 16942 |
| 3 | JGI24752J21851_1002644 | 3300001976 | Bacteria | 2378 |
| 4 | JGI24743J22301_10008450 | 3300001991 | Bacteria | 1804 |
| 5 | JGI24749J21850_1070977 | 3300002076 | Unclassified | 538 |
| 6 | JGI24034J26672_10000666 | 3300002239 | Bacteria | 4416 |
| 7 | Ga0065712_10140859 | 3300005290 | Unclassified | 1451 |
| 8 | Ga0065712_10378804 | 3300005290 | Bacteria | 754 |
| 9 | Ga0065715_10097290 | 3300005293 | Bacteria | 3729 |
| 10 | Ga0065715_10471564 | 3300005293 | Unclassified | 806 |
| 11 | Ga0070658_10013835 | 3300005327 | Bacteria | 6475 |
| 12 | Ga0070676_10009262 | 3300005328 | Bacteria | 5322 |
| 13 | Ga0070676_10011632 | 3300005328 | Bacteria | 4786 |
| 14 | Ga0070676_10015848 | 3300005328 | Bacteria | 4158 |
| 15 | Ga0070683_100005690 | 3300005329 | Bacteria | 10410 |
| 16 | Ga0070683_100476508 | 3300005329 | Unclassified | 1192 |
| 17 | Ga0070690_100004767 | 3300005330 | Bacteria | 7566 |
| 18 | Ga0070690_100026065 | 3300005330 | Bacteria | 3603 |
| 19 | Ga0070690_100114120 | 3300005330 | Bacteria | 1806 |
| 20 | Ga0070690_100128281 | 3300005330 | Bacteria | 1710 |
| 21 | Ga0070670_100017432 | 3300005331 | Bacteria | 6160 |
| 22 | Ga0070670_100780295 | 3300005331 | Bacteria | 862 |
| 23 | Ga0070677_10046985 | 3300005333 | Bacteria | 1729 |
| 24 | Ga0068869_100010054 | 3300005334 | Bacteria | 6154 |
| 25 | Ga0068869_100022887 | 3300005334 | Bacteria | 4310 |
| 26 | Ga0070666_10050617 | 3300005335 | Bacteria | 2794 |
| 27 | Ga0070666_10107537 | 3300005335 | Bacteria | 1927 |
| 28 | Ga0070680_100003019 | 3300005336 | Bacteria | 12489 |
| 29 | Ga0070680_100072151 | 3300005336 | Bacteria | 2838 |
| 30 | Ga0070680_101354033 | 3300005336 | Unclassified | 616 |
| 31 | Ga0070680_101814454 | 3300005336 | Bacteria | 528 |
| 32 | Ga0070682_100215717 | 3300005337 | Unclassified | 1363 |
| 33 | Ga0068868_100046390 | 3300005338 | Bacteria | 3401 |
| 34 | Ga0068868_100359373 | 3300005338 | Bacteria | 1249 |
| 35 | Ga0070660_100014554 | 3300005339 | Bacteria | 5672 |
| 36 | Ga0070660_100329899 | 3300005339 | Bacteria | 1254 |
| 37 | Ga0070689_100011048 | 3300005340 | Bacteria | 6455 |
| 38 | Ga0070689_100063497 | 3300005340 | Bacteria | 2874 |
| 39 | Ga0070691_10235596 | 3300005341 | Bacteria | 976 |
| 40 | Ga0070691_10552043 | 3300005341 | Unclassified | 673 |
| 41 | Ga0070687_100041382 | 3300005343 | Bacteria | 2328 |
| 42 | Ga0070687_100069501 | 3300005343 | Bacteria | 1886 |
| 43 | Ga0070661_100005140 | 3300005344 | Bacteria | 9012 |
| 44 | Ga0070661_100258997 | 3300005344 | Bacteria | 1344 |
| 45 | Ga0070692_10007213 | 3300005345 | Bacteria | 4884 |
| 46 | Ga0070668_100011172 | 3300005347 | Bacteria | 6686 |
| 47 | Ga0070669_100022993 | 3300005353 | Bacteria | 4460 |
| 48 | Ga0070669_100070596 | 3300005353 | Bacteria | 2582 |
| 49 | Ga0070675_100048328 | 3300005354 | Bacteria | 3488 |
| 50 | Ga0070675_100053204 | 3300005354 | Bacteria | 3329 |
| 51 | Ga0070675_100060562 | 3300005354 | Bacteria | 3125 |
| 52 | Ga0070671_100000192 | 3300005355 | Bacteria | 41206 |
| 53 | Ga0070671_100007699 | 3300005355 | Bacteria | 8608 |
| 54 | Ga0070671_100270868 | 3300005355 | Bacteria | 1443 |
| 55 | Ga0070674_100045716 | 3300005356 | Bacteria | 2992 |
| 56 | Ga0070674_100180049 | 3300005356 | Bacteria | 1618 |
| 57 | Ga0070673_100176615 | 3300005364 | Bacteria | 1826 |
| 58 | Ga0070673_100394060 | 3300005364 | Bacteria | 1237 |
| 59 | Ga0070673_100572412 | 3300005364 | Bacteria | 1028 |
| 60 | Ga0070688_100000617 | 3300005365 | Bacteria | 17791 |
| 61 | Ga0070688_100030502 | 3300005365 | Bacteria | 3237 |
| 62 | Ga0070688_101680690 | 3300005365 | Unclassified | 519 |
| 63 | Ga0070659_100012421 | 3300005366 | Bacteria | 6315 |
| 64 | Ga0070659_100168216 | 3300005366 | Bacteria | 1794 |
| 65 | Ga0070667_100004454 | 3300005367 | Bacteria | 11810 |
| 66 | Ga0070667_100111547 | 3300005367 | Bacteria | 2372 |
| 67 | Ga0070667_100229863 | 3300005367 | Bacteria | 1653 |
| 68 | Ga0070703_10000950 | 3300005406 | Bacteria | 9222 |
| 69 | Ga0070709_10056314 | 3300005434 | Bacteria | 2485 |
| 70 | Ga0070709_10071379 | 3300005434 | Unclassified | 2241 |
| 71 | Ga0070709_10094859 | 3300005434 | Bacteria | 1975 |
| 72 | Ga0070709_10120300 | 3300005434 | Bacteria | 1779 |
| 73 | Ga0070709_10208182 | 3300005434 | Bacteria | 1389 |
| 74 | Ga0070709_10475991 | 3300005434 | Unclassified | 945 |
| 75 | Ga0070714_100003456 | 3300005435 | Bacteria | 11776 |
| 76 | Ga0070714_100005356 | 3300005435 | Bacteria | 9788 |
| 77 | Ga0070714_100046410 | 3300005435 | Bacteria | 3686 |
| 78 | Ga0070714_100480031 | 3300005435 | Unclassified | 1184 |
| 79 | Ga0070714_100511155 | 3300005435 | Bacteria | 1146 |
| 80 | Ga0070714_100523729 | 3300005435 | Bacteria | 1133 |
| 81 | Ga0070714_100551931 | 3300005435 | Bacteria | 1103 |
| 82 | Ga0070714_101062143 | 3300005435 | Unclassified | 789 |
| 83 | Ga0070714_101087918 | 3300005435 | Unclassified | 779 |
| 84 | Ga0070714_101368649 | 3300005435 | Bacteria | 691 |
| 85 | Ga0070713_100000117 | 3300005436 | Bacteria | 51918 |
| 86 | Ga0070713_100002140 | 3300005436 | Bacteria | 12785 |
| 87 | Ga0070713_100111541 | 3300005436 | Bacteria | 2385 |
| 88 | Ga0070713_100378640 | 3300005436 | Bacteria | 1318 |
| 89 | Ga0070713_100474031 | 3300005436 | Bacteria | 1178 |
| 90 | Ga0070713_101226615 | 3300005436 | Unclassified | 726 |
| 91 | Ga0070713_101411363 | 3300005436 | Unclassified | 675 |
| 92 | Ga0070713_102123038 | 3300005436 | Unclassified | 544 |
| 93 | Ga0070710_10001214 | 3300005437 | Bacteria | 12197 |
| 94 | Ga0070710_10114524 | 3300005437 | Bacteria | 1624 |
| 95 | Ga0070710_10275579 | 3300005437 | Unclassified | 1090 |
| 96 | Ga0070710_10351919 | 3300005437 | Unclassified | 975 |
| 97 | Ga0070710_10591309 | 3300005437 | Unclassified | 771 |
| 98 | Ga0070710_10839432 | 3300005437 | Unclassified | 659 |
| 99 | Ga0070701_10016079 | 3300005438 | Bacteria | 3470 |
| 100 | Ga0070701_10228498 | 3300005438 | Bacteria | 1113 |
| 101 | Ga0070701_10233199 | 3300005438 | Unclassified | 1103 |
| 102 | Ga0070701_11396613 | 3300005438 | Unclassified | 503 |
| 103 | Ga0070711_100000152 | 3300005439 | Bacteria | 37810 |
| 104 | Ga0070711_100020189 | 3300005439 | Bacteria | 4290 |
| 105 | Ga0070711_100071047 | 3300005439 | Bacteria | 2452 |
| 106 | Ga0070711_100134959 | 3300005439 | Unclassified | 1843 |
| 107 | Ga0070711_100153039 | 3300005439 | Bacteria | 1741 |
| 108 | Ga0070711_100442036 | 3300005439 | Unclassified | 1063 |
| 109 | Ga0070711_100477628 | 3300005439 | Unclassified | 1024 |
| 110 | Ga0070711_100703020 | 3300005439 | Unclassified | 851 |
| 111 | Ga0070705_100027280 | 3300005440 | Bacteria | 3117 |
| 112 | Ga0070705_100030648 | 3300005440 | Bacteria | 2971 |
| 113 | Ga0070705_100270054 | 3300005440 | Unclassified | 1204 |
| 114 | Ga0070700_100021304 | 3300005441 | Bacteria | 3767 |
| 115 | Ga0070694_100127764 | 3300005444 | Unclassified | 1832 |
| 116 | Ga0070694_100849679 | 3300005444 | Bacteria | 751 |
| 117 | Ga0070694_101609480 | 3300005444 | Bacteria | 551 |
| 118 | Ga0070708_100046403 | 3300005445 | Bacteria | 3833 |
| 119 | Ga0070708_100063098 | 3300005445 | Unclassified | 3316 |
| 120 | Ga0070708_100170406 | 3300005445 | Unclassified | 2032 |
| 121 | Ga0070708_100176095 | 3300005445 | Bacteria | 1999 |
| 122 | Ga0070708_100769666 | 3300005445 | Bacteria | 905 |
| 123 | Ga0070708_101132793 | 3300005445 | Bacteria | 732 |
| 124 | Ga0070708_101145204 | 3300005445 | Bacteria | 728 |
| 125 | Ga0070708_101296481 | 3300005445 | Bacteria | 680 |
| 126 | Ga0070708_101728015 | 3300005445 | Unclassified | 581 |
| 127 | Ga0070708_101798532 | 3300005445 | Unclassified | 569 |
| 128 | Ga0070663_100009895 | 3300005455 | Bacteria | 5927 |
| 129 | Ga0070663_100013138 | 3300005455 | Bacteria | 5265 |
| 130 | Ga0070678_100100578 | 3300005456 | Bacteria | 2240 |
| 131 | Ga0070678_101876367 | 3300005456 | Unclassified | 566 |
| 132 | Ga0070662_100029508 | 3300005457 | Bacteria | 3828 |
| 133 | Ga0070662_100349046 | 3300005457 | Unclassified | 1212 |
| 134 | Ga0070681_10025762 | 3300005458 | Bacteria | 5913 |
| 135 | Ga0068867_100014693 | 3300005459 | Bacteria | 5548 |
| 136 | Ga0068867_100015612 | 3300005459 | Bacteria | 5389 |
| 137 | Ga0070685_10001498 | 3300005466 | Bacteria | 12310 |
| 138 | Ga0070706_100009184 | 3300005467 | Bacteria | 9206 |
| 139 | Ga0070706_100042734 | 3300005467 | Bacteria | 4188 |
| 140 | Ga0070706_100078483 | 3300005467 | Unclassified | 3057 |
| 141 | Ga0070706_101126282 | 3300005467 | Unclassified | 722 |
| 142 | Ga0070706_101336800 | 3300005467 | Bacteria | 657 |
| 143 | Ga0070706_102034124 | 3300005467 | Bacteria | 520 |
| 144 | Ga0070707_100032500 | 3300005468 | Bacteria | 4973 |
| 145 | Ga0070707_100052212 | 3300005468 | Bacteria | 3919 |
| 146 | Ga0070707_100058448 | 3300005468 | Bacteria | 3698 |
| 147 | Ga0070707_100062243 | 3300005468 | Bacteria | 3580 |
| 148 | Ga0070707_100068185 | 3300005468 | Bacteria | 3423 |
| 149 | Ga0070707_100178008 | 3300005468 | Bacteria | 2073 |
| 150 | Ga0070707_100190269 | 3300005468 | Unclassified | 2001 |
| 151 | Ga0070707_100259850 | 3300005468 | Unclassified | 1689 |
| 152 | Ga0070707_100301160 | 3300005468 | Bacteria | 1558 |
| 153 | Ga0070707_101133963 | 3300005468 | Unclassified | 748 |
| 154 | Ga0070707_101508738 | 3300005468 | Bacteria | 639 |
| 155 | Ga0070698_100032307 | 3300005471 | Bacteria | 5423 |
| 156 | Ga0070698_100186863 | 3300005471 | Bacteria | 2010 |
| 157 | Ga0070698_101530326 | 3300005471 | Unclassified | 619 |
| 158 | Ga0070699_100131819 | 3300005518 | Bacteria | 2203 |
| 159 | Ga0070699_100136926 | 3300005518 | Unclassified | 2160 |
| 160 | Ga0070699_100352650 | 3300005518 | Bacteria | 1325 |
| 161 | Ga0070699_100502353 | 3300005518 | Unclassified | 1102 |
| 162 | Ga0070699_100770448 | 3300005518 | Bacteria | 880 |
| 163 | Ga0070699_100880697 | 3300005518 | Unclassified | 820 |
| 164 | Ga0070699_101017696 | 3300005518 | Bacteria | 760 |
| 165 | Ga0070699_101970685 | 3300005518 | Unclassified | 534 |
| 166 | Ga0070679_100270660 | 3300005530 | Bacteria | 1653 |
| 167 | Ga0070684_100003517 | 3300005535 | Bacteria | 11772 |
| 168 | Ga0070697_100012550 | 3300005536 | Bacteria | 6637 |
| 169 | Ga0070697_100201409 | 3300005536 | Bacteria | 1692 |
| 170 | Ga0070697_100223240 | 3300005536 | Bacteria | 1606 |
| 171 | Ga0070697_100293240 | 3300005536 | Unclassified | 1397 |
| 172 | Ga0070697_100340357 | 3300005536 | Unclassified | 1294 |
| 173 | Ga0070697_100356961 | 3300005536 | Bacteria | 1263 |
| 174 | Ga0070697_100455501 | 3300005536 | Unclassified | 1115 |
| 175 | Ga0070697_100562353 | 3300005536 | Bacteria | 1000 |
| 176 | Ga0068853_100020129 | 3300005539 | Bacteria | 5547 |
| 177 | Ga0070672_100001333 | 3300005543 | Bacteria | 15223 |
| 178 | Ga0070672_100013959 | 3300005543 | Bacteria | 5683 |
| 179 | Ga0070672_100023729 | 3300005543 | Bacteria | 4525 |
| 180 | Ga0070672_100043955 | 3300005543 | Bacteria | 3449 |
| 181 | Ga0070686_100009065 | 3300005544 | Bacteria | 5581 |
| 182 | Ga0070686_100073297 | 3300005544 | Bacteria | 2248 |
| 183 | Ga0070686_100107525 | 3300005544 | Bacteria | 1895 |
| 184 | Ga0070695_100015846 | 3300005545 | Bacteria | 4555 |
| 185 | Ga0070695_100109583 | 3300005545 | Bacteria | 1871 |
| 186 | Ga0070695_100178946 | 3300005545 | Bacteria | 1501 |
| 187 | Ga0070695_101787138 | 3300005545 | Unclassified | 515 |
| 188 | Ga0070696_100007482 | 3300005546 | Bacteria | 7305 |
| 189 | Ga0070696_100055703 | 3300005546 | Unclassified | 2757 |
| 190 | Ga0070696_100461231 | 3300005546 | Unclassified | 1004 |
| 191 | Ga0070693_100009244 | 3300005547 | Bacteria | 4896 |
| 192 | Ga0070693_101130233 | 3300005547 | Bacteria | 599 |
| 193 | Ga0070665_100010620 | 3300005548 | Bacteria | 9321 |
| 194 | Ga0070704_100003471 | 3300005549 | Bacteria | 9046 |
| 195 | Ga0070704_100006035 | 3300005549 | Bacteria | 7103 |
| 196 | Ga0070704_100184910 | 3300005549 | Bacteria | 1670 |
| 197 | Ga0070704_100227630 | 3300005549 | Bacteria | 1519 |
| 198 | Ga0070704_100873629 | 3300005549 | Unclassified | 807 |
| 199 | Ga0070704_100975039 | 3300005549 | Bacteria | 766 |
| 200 | Ga0070704_101187374 | 3300005549 | Bacteria | 695 |
| 201 | Ga0068855_100114658 | 3300005563 | Bacteria | 3089 |
| 202 | Ga0068855_100173602 | 3300005563 | Bacteria | 2440 |
| 203 | Ga0068855_100241951 | 3300005563 | Unclassified | 2016 |
| 204 | Ga0070664_100015138 | 3300005564 | Bacteria | 6299 |
| 205 | Ga0070664_100060204 | 3300005564 | Bacteria | 3233 |
| 206 | Ga0070664_100108628 | 3300005564 | Bacteria | 2419 |
| 207 | Ga0068857_100000556 | 3300005577 | Bacteria | 27260 |
| 208 | Ga0068857_100346002 | 3300005577 | Unclassified | 1376 |
| 209 | Ga0068857_100346150 | 3300005577 | Bacteria | 1376 |
| 210 | Ga0068857_102340530 | 3300005577 | Unclassified | 524 |
| 211 | Ga0068854_100251792 | 3300005578 | Unclassified | 1410 |
| 212 | Ga0068854_100603050 | 3300005578 | Unclassified | 938 |
| 213 | Ga0068854_102192453 | 3300005578 | Bacteria | 511 |
| 214 | Ga0068856_100002603 | 3300005614 | Bacteria | 18563 |
| 215 | Ga0068856_100009133 | 3300005614 | Bacteria | 9640 |
| 216 | Ga0068856_100014945 | 3300005614 | Bacteria | 7496 |
| 217 | Ga0068856_100830779 | 3300005614 | Unclassified | 943 |
| 218 | Ga0070702_100421814 | 3300005615 | Unclassified | 960 |
| 219 | Ga0068852_100023164 | 3300005616 | Bacteria | 4993 |
| 220 | Ga0068852_100294620 | 3300005616 | Bacteria | 1569 |
| 221 | Ga0068852_100560078 | 3300005616 | Bacteria | 1144 |
| 222 | Ga0068859_100000695 | 3300005617 | Bacteria | 33715 |
| 223 | Ga0068859_100387600 | 3300005617 | Bacteria | 1493 |
| 224 | Ga0068859_100841210 | 3300005617 | Bacteria | 1004 |
| 225 | Ga0068864_100396265 | 3300005618 | Bacteria | 1311 |
| 226 | Ga0068866_10039439 | 3300005718 | Bacteria | 2332 |
| 227 | Ga0068866_10113601 | 3300005718 | Bacteria | 1515 |
| 228 | Ga0068861_100575658 | 3300005719 | Unclassified | 1030 |
| 229 | Ga0068851_10007835 | 3300005834 | Bacteria | 4918 |
| 230 | Ga0068870_10002556 | 3300005840 | Bacteria | 7605 |
| 231 | Ga0068863_100013974 | 3300005841 | Bacteria | 7738 |
| 232 | Ga0068863_100018878 | 3300005841 | Bacteria | 6598 |
| 233 | Ga0068863_100130886 | 3300005841 | Bacteria | 2396 |
| 234 | Ga0068863_100677793 | 3300005841 | Unclassified | 1024 |
| 235 | Ga0068863_101605053 | 3300005841 | Bacteria | 660 |
| 236 | Ga0068858_100001625 | 3300005842 | Bacteria | 22912 |
| 237 | Ga0068858_100080695 | 3300005842 | Bacteria | 3023 |
| 238 | Ga0068858_100495600 | 3300005842 | Bacteria | 1180 |
| 239 | Ga0068860_100000924 | 3300005843 | Bacteria | 32627 |
| 240 | Ga0068860_100052886 | 3300005843 | Bacteria | 3862 |
| 241 | Ga0068860_100267279 | 3300005843 | Bacteria | 1668 |
| 242 | Ga0068862_100010186 | 3300005844 | Bacteria | 7759 |
| 243 | Ga0081539_10099777 | 3300005985 | Bacteria | 1482 |
| 244 | Ga0070717_10000862 | 3300006028 | Bacteria | 20076 |
| 245 | Ga0070717_10002152 | 3300006028 | Bacteria | 13812 |
| 246 | Ga0070717_10020059 | 3300006028 | Bacteria | 5252 |
| 247 | Ga0070717_10035252 | 3300006028 | Bacteria | 4049 |
| 248 | Ga0070717_10105598 | 3300006028 | Bacteria | 2397 |
| 249 | Ga0070717_10159516 | 3300006028 | Bacteria | 1956 |
| 250 | Ga0070717_10560446 | 3300006028 | Bacteria | 1035 |
| 251 | Ga0070717_10768524 | 3300006028 | Bacteria | 876 |
| 252 | Ga0070717_10793943 | 3300006028 | Unclassified | 861 |
| 253 | Ga0070717_10923961 | 3300006028 | Bacteria | 794 |
| 254 | Ga0070715_10017641 | 3300006163 | Bacteria | 2705 |
| 255 | Ga0070716_100001453 | 3300006173 | Bacteria | 10546 |
| 256 | Ga0070716_100007489 | 3300006173 | Bacteria | 5379 |
| 257 | Ga0070716_100102702 | 3300006173 | Unclassified | 1756 |
| 258 | Ga0070716_100301855 | 3300006173 | Unclassified | 1114 |
| 259 | Ga0070716_100338702 | 3300006173 | Bacteria | 1060 |
| 260 | Ga0070716_100380196 | 3300006173 | Bacteria | 1009 |
| 261 | Ga0070716_101591308 | 3300006173 | Unclassified | 536 |
| 262 | Ga0070712_100000070 | 3300006175 | Bacteria | 52731 |
| 263 | Ga0070712_100000309 | 3300006175 | Bacteria | 27477 |
| 264 | Ga0070712_100023403 | 3300006175 | Bacteria | 4081 |
| 265 | Ga0070712_100064462 | 3300006175 | Bacteria | 2598 |
| 266 | Ga0070712_100127896 | 3300006175 | Unclassified | 1922 |
| 267 | Ga0070712_100152634 | 3300006175 | Unclassified | 1775 |
| 268 | Ga0075366_10172597 | 3300006195 | Bacteria | 1312 |
| 269 | Ga0068871_100006456 | 3300006358 | Bacteria | 8299 |
| 270 | Ga0068871_100297647 | 3300006358 | Bacteria | 1415 |
| 271 | Ga0075428_100013151 | 3300006844 | Bacteria | 9204 |
| 272 | Ga0075428_100098017 | 3300006844 | Unclassified | 3196 |
| 273 | Ga0075430_100056948 | 3300006846 | Bacteria | 3287 |
| 274 | Ga0075431_100006030 | 3300006847 | Bacteria | 12014 |
| 275 | Ga0075431_100100687 | 3300006847 | Bacteria | 2981 |
| 276 | Ga0075431_100441813 | 3300006847 | Bacteria | 1298 |
| 277 | Ga0075431_101526595 | 3300006847 | Unclassified | 626 |
| 278 | Ga0075433_10000504 | 3300006852 | Bacteria | 25461 |
| 279 | Ga0075433_10007971 | 3300006852 | Bacteria | 8433 |
| 280 | Ga0075433_10354778 | 3300006852 | Bacteria | 1296 |
| 281 | Ga0075433_10371693 | 3300006852 | Bacteria | 1262 |
| 282 | Ga0075433_11234274 | 3300006852 | Bacteria | 648 |
| 283 | Ga0075434_100004069 | 3300006871 | Bacteria | 13106 |
| 284 | Ga0075434_100019217 | 3300006871 | Bacteria | 6610 |
| 285 | Ga0075434_100042024 | 3300006871 | Bacteria | 4531 |
| 286 | Ga0075434_100840880 | 3300006871 | Bacteria | 933 |
| 287 | Ga0075434_101059453 | 3300006871 | Bacteria | 824 |
| 288 | Ga0075434_102124144 | 3300006871 | Unclassified | 566 |
| 289 | Ga0075434_102602498 | 3300006871 | Unclassified | 506 |
| 290 | Ga0075429_100053069 | 3300006880 | Unclassified | 3528 |
| 291 | Ga0075429_100156056 | 3300006880 | Bacteria | 1999 |
| 292 | Ga0075429_101401454 | 3300006880 | Bacteria | 609 |
| 293 | Ga0068865_100003984 | 3300006881 | Bacteria | 8859 |
| 294 | Ga0068865_100013747 | 3300006881 | Bacteria | 5127 |
| 295 | Ga0075436_100097126 | 3300006914 | Bacteria | 2049 |
| 296 | Ga0097620_100000695 | 3300006931 | Bacteria | 33715 |
| 297 | Ga0097620_100387576 | 3300006931 | Bacteria | 1493 |
| 298 | Ga0097620_100840991 | 3300006931 | Bacteria | 1004 |
| 299 | Ga0075435_100072426 | 3300007076 | Bacteria | 2815 |
| 300 | Ga0075435_100394379 | 3300007076 | Bacteria | 1190 |
| 301 | Ga0075435_100404456 | 3300007076 | Bacteria | 1174 |
| 302 | Ga0075435_100795997 | 3300007076 | Unclassified | 823 |
| 303 | Ga0075435_100966241 | 3300007076 | Unclassified | 743 |
| 304 | Ga0099794_10026446 | 3300007265 | Bacteria | 2683 |
| 305 | Ga0099794_10036586 | 3300007265 | Unclassified | 2322 |
| 306 | Ga0099794_10056367 | 3300007265 | Bacteria | 1901 |
| 307 | Ga0099794_10127202 | 3300007265 | Bacteria | 1285 |
| 308 | Ga0105244_10199391 | 3300009036 | Bacteria | 944 |
| 309 | Ga0105250_10018868 | 3300009092 | Bacteria | 2790 |
| 310 | Ga0105240_10009668 | 3300009093 | Bacteria | 13628 |
| 311 | Ga0105240_10041544 | 3300009093 | Bacteria | 5869 |
| 312 | Ga0105240_10124351 | 3300009093 | Bacteria | 3102 |
| 313 | Ga0111539_10223648 | 3300009094 | Bacteria | 2192 |
| 314 | Ga0105245_10070445 | 3300009098 | Bacteria | 3173 |
| 315 | Ga0105245_10139001 | 3300009098 | Bacteria | 2286 |
| 316 | Ga0105247_10003131 | 3300009101 | Bacteria | 10913 |
| 317 | Ga0105247_10082762 | 3300009101 | Bacteria | 2026 |
| 318 | Ga0105247_10895908 | 3300009101 | Bacteria | 685 |
| 319 | Ga0105247_11777003 | 3300009101 | Bacteria | 512 |
| 320 | Ga0114129_10171915 | 3300009147 | Unclassified | 2953 |
| 321 | Ga0105243_10003500 | 3300009148 | Bacteria | 12676 |
| 322 | Ga0105243_10090887 | 3300009148 | Bacteria | 2513 |
| 323 | Ga0105241_10007141 | 3300009174 | Bacteria | 8221 |
| 324 | Ga0105241_10047096 | 3300009174 | Bacteria | 3277 |
| 325 | Ga0105241_10373655 | 3300009174 | Unclassified | 1243 |
| 326 | Ga0105241_10981514 | 3300009174 | Bacteria | 789 |
| 327 | Ga0105242_10042378 | 3300009176 | Bacteria | 3675 |
| 328 | Ga0105242_10055982 | 3300009176 | Bacteria | 3226 |
| 329 | Ga0105242_11426207 | 3300009176 | Bacteria | 721 |
| 330 | Ga0105248_10001718 | 3300009177 | Bacteria | 24357 |
| 331 | Ga0105248_10128189 | 3300009177 | Bacteria | 2862 |
| 332 | Ga0105248_10165748 | 3300009177 | Bacteria | 2491 |
| 333 | Ga0105237_10280571 | 3300009545 | Unclassified | 1668 |
| 334 | Ga0105237_11159107 | 3300009545 | Unclassified | 779 |
| 335 | Ga0105238_10279507 | 3300009551 | Unclassified | 1650 |
| 336 | Ga0105249_10014167 | 3300009553 | Bacteria | 7048 |
| 337 | Ga0105249_10584039 | 3300009553 | Bacteria | 1171 |
| 338 | Ga0105249_11408446 | 3300009553 | Bacteria | 769 |
| 339 | Ga0105239_10007481 | 3300010375 | Bacteria | 12534 |
| 340 | Ga0105246_10013190 | 3300011119 | Bacteria | 5175 |
| 341 | Ga0105246_11574351 | 3300011119 | Bacteria | 620 |
| 342 | Ga0157373_10558570 | 3300013100 | Unclassified | 831 |
| 343 | Ga0157373_10688302 | 3300013100 | Bacteria | 748 |
| 344 | Ga0157369_10015772 | 3300013105 | Bacteria | 8513 |
| 345 | Ga0157369_10017495 | 3300013105 | Bacteria | 8056 |
| 346 | Ga0157369_10212038 | 3300013105 | Bacteria | 2030 |
| 347 | Ga0157369_10412388 | 3300013105 | Bacteria | 1401 |
| 348 | Ga0157369_10918836 | 3300013105 | Unclassified | 897 |
| 349 | Ga0157369_10929863 | 3300013105 | Unclassified | 891 |
| 350 | Ga0157374_10226284 | 3300013296 | Unclassified | 1837 |
| 351 | Ga0157374_10450522 | 3300013296 | Unclassified | 1288 |
| 352 | Ga0157378_10384656 | 3300013297 | Bacteria | 1379 |
| 353 | Ga0163162_10164139 | 3300013306 | Bacteria | 2344 |
| 354 | Ga0163162_10603302 | 3300013306 | Unclassified | 1224 |
| 355 | Ga0157372_10011062 | 3300013307 | Bacteria | 9602 |
| 356 | Ga0157372_10011443 | 3300013307 | Bacteria | 9434 |
| 357 | Ga0157372_10024974 | 3300013307 | Bacteria | 6494 |
| 358 | Ga0157372_10060479 | 3300013307 | Bacteria | 4239 |
| 359 | Ga0157372_10118263 | 3300013307 | Unclassified | 3041 |
| 360 | Ga0157372_10211639 | 3300013307 | Bacteria | 2247 |
| 361 | Ga0157372_10692112 | 3300013307 | Bacteria | 1186 |
| 362 | Ga0157372_10808296 | 3300013307 | Bacteria | 1089 |
| 363 | Ga0157375_10042807 | 3300013308 | Bacteria | 4386 |
| 364 | Ga0157375_10062423 | 3300013308 | Bacteria | 3703 |
| 365 | Ga0157375_10315075 | 3300013308 | Bacteria | 1729 |
| 366 | Ga0157375_11105863 | 3300013308 | Bacteria | 928 |
| 367 | Ga0157375_11997206 | 3300013308 | Bacteria | 689 |
| 368 | Ga0163163_10042188 | 3300014325 | Bacteria | 4467 |
| 369 | Ga0163163_10875589 | 3300014325 | Bacteria | 961 |
| 370 | Ga0163163_11183972 | 3300014325 | Bacteria | 827 |
| 371 | Ga0157380_10056941 | 3300014326 | Bacteria | 3111 |
| 372 | Ga0157380_10074606 | 3300014326 | Bacteria | 2754 |
| 373 | Ga0157380_10099771 | 3300014326 | Bacteria | 2415 |
| 374 | Ga0157380_10726137 | 3300014326 | Unclassified | 1002 |
| 375 | Ga0182008_10073148 | 3300014497 | Unclassified | 1687 |
| 376 | Ga0157377_10018672 | 3300014745 | Bacteria | 3608 |
| 377 | Ga0157377_10024220 | 3300014745 | Bacteria | 3225 |
| 378 | Ga0157379_10006121 | 3300014968 | Bacteria | 10359 |
| 379 | Ga0157379_11226123 | 3300014968 | Bacteria | 722 |
| 380 | Ga0157376_10136614 | 3300014969 | Bacteria | 2195 |
| 381 | Ga0157376_10797696 | 3300014969 | Unclassified | 957 |
| 382 | Ga0182007_10022821 | 3300015262 | Bacteria | 2205 |
| 383 | Ga0163161_10007744 | 3300017792 | Bacteria | 7429 |
| 384 | Ga0213873_10005554 | 3300021358 | Bacteria | 2428 |
| 385 | Ga0224572_1027208 | 3300024225 | Bacteria | 1096 |
| 386 | Ga0228598_1058071 | 3300024227 | Unclassified | 769 |
| 387 | Ga0207697_10005179 | 3300025315 | Bacteria | 6087 |
| 388 | Ga0207653_10000024 | 3300025885 | Bacteria | 117069 |
| 389 | Ga0207682_10008600 | 3300025893 | Bacteria | 4035 |
| 390 | Ga0207692_10000654 | 3300025898 | Bacteria | 12205 |
| 391 | Ga0207692_10053337 | 3300025898 | Bacteria | 2059 |
| 392 | Ga0207692_10242586 | 3300025898 | Unclassified | 1077 |
| 393 | Ga0207692_10559612 | 3300025898 | Unclassified | 731 |
| 394 | Ga0207692_11185526 | 3300025898 | Unclassified | 507 |
| 395 | Ga0207642_10043617 | 3300025899 | Bacteria | 1979 |
| 396 | Ga0207710_10042340 | 3300025900 | Bacteria | 2022 |
| 397 | Ga0207688_10002810 | 3300025901 | Bacteria | 9451 |
| 398 | Ga0207680_10004848 | 3300025903 | Bacteria | 6400 |
| 399 | Ga0207680_10028555 | 3300025903 | Bacteria | 3122 |
| 400 | Ga0207680_10182473 | 3300025903 | Bacteria | 1420 |
| 401 | Ga0207685_10011767 | 3300025905 | Bacteria | 2644 |
| 402 | Ga0207699_10029133 | 3300025906 | Bacteria | 3076 |
| 403 | Ga0207699_10031371 | 3300025906 | Bacteria | 2983 |
| 404 | Ga0207699_10058954 | 3300025906 | Bacteria | 2299 |
| 405 | Ga0207699_10098354 | 3300025906 | Bacteria | 1851 |
| 406 | Ga0207645_10002635 | 3300025907 | Bacteria | 13985 |
| 407 | Ga0207645_10014270 | 3300025907 | Bacteria | 5321 |
| 408 | Ga0207645_10025603 | 3300025907 | Bacteria | 3817 |
| 409 | Ga0207643_10001249 | 3300025908 | Bacteria | 14938 |
| 410 | Ga0207705_10031224 | 3300025909 | Bacteria | 3800 |
| 411 | Ga0207705_10670003 | 3300025909 | Unclassified | 807 |
| 412 | Ga0207684_10017085 | 3300025910 | Bacteria | 6230 |
| 413 | Ga0207684_10021485 | 3300025910 | Bacteria | 5511 |
| 414 | Ga0207684_10327863 | 3300025910 | Unclassified | 1319 |
| 415 | Ga0207684_10514059 | 3300025910 | Bacteria | 1026 |
| 416 | Ga0207684_10688876 | 3300025910 | Bacteria | 869 |
| 417 | Ga0207684_10690533 | 3300025910 | Bacteria | 868 |
| 418 | Ga0207654_10589131 | 3300025911 | Unclassified | 793 |
| 419 | Ga0207707_10015217 | 3300025912 | Bacteria | 6698 |
| 420 | Ga0207707_10110448 | 3300025912 | Bacteria | 2403 |
| 421 | Ga0207695_10034687 | 3300025913 | Bacteria | 5483 |
| 422 | Ga0207695_10042304 | 3300025913 | Unclassified | 4868 |
| 423 | Ga0207671_10200949 | 3300025914 | Bacteria | 1557 |
| 424 | Ga0207671_10594691 | 3300025914 | Unclassified | 882 |
| 425 | Ga0207693_10000121 | 3300025915 | Bacteria | 69495 |
| 426 | Ga0207693_10006665 | 3300025915 | Bacteria | 9539 |
| 427 | Ga0207693_10038241 | 3300025915 | Bacteria | 3779 |
| 428 | Ga0207693_10176228 | 3300025915 | Unclassified | 1682 |
| 429 | Ga0207693_10363540 | 3300025915 | Bacteria | 1132 |
| 430 | Ga0207693_10377198 | 3300025915 | Bacteria | 1109 |
| 431 | Ga0207693_10702351 | 3300025915 | Unclassified | 783 |
| 432 | Ga0207663_10000231 | 3300025916 | Bacteria | 24690 |
| 433 | Ga0207663_10456967 | 3300025916 | Unclassified | 986 |
| 434 | Ga0207660_10085622 | 3300025917 | Bacteria | 2325 |
| 435 | Ga0207660_11138366 | 3300025917 | Archaea | 636 |
| 436 | Ga0207662_10037171 | 3300025918 | Bacteria | 2849 |
| 437 | Ga0207662_10160223 | 3300025918 | Bacteria | 1437 |
| 438 | Ga0207657_10010924 | 3300025919 | Bacteria | 9034 |
| 439 | Ga0207657_10153330 | 3300025919 | Bacteria | 1875 |
| 440 | Ga0207649_10001140 | 3300025920 | Bacteria | 16078 |
| 441 | Ga0207649_10143173 | 3300025920 | Bacteria | 1638 |
| 442 | Ga0207652_10058817 | 3300025921 | Bacteria | 3312 |
| 443 | Ga0207652_10942960 | 3300025921 | Unclassified | 761 |
| 444 | Ga0207646_10110228 | 3300025922 | Unclassified | 2470 |
| 445 | Ga0207646_10131915 | 3300025922 | Bacteria | 2249 |
| 446 | Ga0207646_10154765 | 3300025922 | Bacteria | 2068 |
| 447 | Ga0207646_10166264 | 3300025922 | Bacteria | 1991 |
| 448 | Ga0207646_10204401 | 3300025922 | Bacteria | 1784 |
| 449 | Ga0207646_10266294 | 3300025922 | Bacteria | 1549 |
| 450 | Ga0207646_10329207 | 3300025922 | Unclassified | 1380 |
| 451 | Ga0207646_10339887 | 3300025922 | Unclassified | 1356 |
| 452 | Ga0207646_10641832 | 3300025922 | Bacteria | 951 |
| 453 | Ga0207646_11742592 | 3300025922 | Bacteria | 534 |
| 454 | Ga0207681_10040362 | 3300025923 | Bacteria | 3105 |
| 455 | Ga0207681_10314302 | 3300025923 | Unclassified | 1243 |
| 456 | Ga0207694_10152524 | 3300025924 | Unclassified | 1862 |
| 457 | Ga0207650_10000150 | 3300025925 | Bacteria | 83380 |
| 458 | Ga0207650_10708745 | 3300025925 | Unclassified | 850 |
| 459 | Ga0207659_10011671 | 3300025926 | Bacteria | 5558 |
| 460 | Ga0207659_10050700 | 3300025926 | Bacteria | 2949 |
| 461 | Ga0207659_10102634 | 3300025926 | Bacteria | 2159 |
| 462 | Ga0207659_10507048 | 3300025926 | Bacteria | 1022 |
| 463 | Ga0207687_10215738 | 3300025927 | Bacteria | 1508 |
| 464 | Ga0207700_10000064 | 3300025928 | Bacteria | 65512 |
| 465 | Ga0207700_10078431 | 3300025928 | Bacteria | 2569 |
| 466 | Ga0207700_10266212 | 3300025928 | Bacteria | 1469 |
| 467 | Ga0207700_10306677 | 3300025928 | Bacteria | 1372 |
| 468 | Ga0207700_10328157 | 3300025928 | Bacteria | 1328 |
| 469 | Ga0207700_10410969 | 3300025928 | Unclassified | 1187 |
| 470 | Ga0207700_10686128 | 3300025928 | Bacteria | 914 |
| 471 | Ga0207700_10996497 | 3300025928 | Unclassified | 750 |
| 472 | Ga0207700_11302601 | 3300025928 | Unclassified | 647 |
| 473 | Ga0207664_10003297 | 3300025929 | Bacteria | 10733 |
| 474 | Ga0207664_10052165 | 3300025929 | Bacteria | 3234 |
| 475 | Ga0207664_10117090 | 3300025929 | Bacteria | 2224 |
| 476 | Ga0207664_10208821 | 3300025929 | Bacteria | 1689 |
| 477 | Ga0207664_10528637 | 3300025929 | Bacteria | 1057 |
| 478 | Ga0207644_10000219 | 3300025931 | Bacteria | 39533 |
| 479 | Ga0207644_10083497 | 3300025931 | Bacteria | 2366 |
| 480 | Ga0207644_10135771 | 3300025931 | Bacteria | 1888 |
| 481 | Ga0207644_10897316 | 3300025931 | Bacteria | 743 |
| 482 | Ga0207644_11828625 | 3300025931 | Bacteria | 508 |
| 483 | Ga0207690_10013253 | 3300025932 | Bacteria | 4950 |
| 484 | Ga0207690_10168811 | 3300025932 | Unclassified | 1637 |
| 485 | Ga0207706_10004536 | 3300025933 | Bacteria | 13031 |
| 486 | Ga0207706_10050984 | 3300025933 | Bacteria | 3656 |
| 487 | Ga0207706_10119323 | 3300025933 | Bacteria | 2319 |
| 488 | Ga0207706_10156029 | 3300025933 | Bacteria | 2007 |
| 489 | Ga0207686_10043976 | 3300025934 | Bacteria | 2740 |
| 490 | Ga0207686_10176896 | 3300025934 | Bacteria | 1510 |
| 491 | Ga0207686_10739671 | 3300025934 | Bacteria | 784 |
| 492 | Ga0207709_10024179 | 3300025935 | Bacteria | 3466 |
| 493 | Ga0207670_10045730 | 3300025936 | Bacteria | 2904 |
| 494 | Ga0207670_10087847 | 3300025936 | Bacteria | 2191 |
| 495 | Ga0207670_10511803 | 3300025936 | Unclassified | 976 |
| 496 | Ga0207669_10131718 | 3300025937 | Bacteria | 1719 |
| 497 | Ga0207704_10029584 | 3300025938 | Bacteria | 3057 |
| 498 | Ga0207704_10537133 | 3300025938 | Unclassified | 948 |
| 499 | Ga0207665_10013840 | 3300025939 | Bacteria | 5305 |
| 500 | Ga0207665_10071959 | 3300025939 | Bacteria | 2361 |
| 501 | Ga0207665_10151296 | 3300025939 | Unclassified | 1662 |
| 502 | Ga0207665_10179011 | 3300025939 | Bacteria | 1535 |
| 503 | Ga0207665_10417499 | 3300025939 | Unclassified | 1024 |
| 504 | Ga0207665_10684713 | 3300025939 | Bacteria | 805 |
| 505 | Ga0207665_11146653 | 3300025939 | Bacteria | 620 |
| 506 | Ga0207665_11151863 | 3300025939 | Unclassified | 618 |
| 507 | Ga0207691_10001031 | 3300025940 | Bacteria | 27605 |
| 508 | Ga0207691_10005259 | 3300025940 | Bacteria | 12493 |
| 509 | Ga0207691_10035476 | 3300025940 | Bacteria | 4628 |
| 510 | Ga0207691_10079883 | 3300025940 | Bacteria | 2943 |
| 511 | Ga0207691_10200380 | 3300025940 | Bacteria | 1738 |
| 512 | Ga0207711_10000769 | 3300025941 | Bacteria | 31516 |
| 513 | Ga0207711_10082691 | 3300025941 | Bacteria | 2807 |
| 514 | Ga0207711_10305082 | 3300025941 | Bacteria | 1469 |
| 515 | Ga0207711_10634770 | 3300025941 | Bacteria | 996 |
| 516 | Ga0207689_10005493 | 3300025942 | Bacteria | 11339 |
| 517 | Ga0207689_10009453 | 3300025942 | Bacteria | 8417 |
| 518 | Ga0207689_10111291 | 3300025942 | Bacteria | 2251 |
| 519 | Ga0207661_10001443 | 3300025944 | Bacteria | 16030 |
| 520 | Ga0207661_10104919 | 3300025944 | Bacteria | 2381 |
| 521 | Ga0207679_10001208 | 3300025945 | Bacteria | 16415 |
| 522 | Ga0207679_10184053 | 3300025945 | Bacteria | 1730 |
| 523 | Ga0207679_11162558 | 3300025945 | Unclassified | 708 |
| 524 | Ga0207667_10544913 | 3300025949 | Bacteria | 1174 |
| 525 | Ga0207667_10945968 | 3300025949 | Unclassified | 851 |
| 526 | Ga0207667_10950016 | 3300025949 | Unclassified | 849 |
| 527 | Ga0207651_10108270 | 3300025960 | Unclassified | 2079 |
| 528 | Ga0207651_10474523 | 3300025960 | Bacteria | 1077 |
| 529 | Ga0207712_10704742 | 3300025961 | Bacteria | 881 |
| 530 | Ga0207712_11352440 | 3300025961 | Bacteria | 637 |
| 531 | Ga0207712_11527554 | 3300025961 | Bacteria | 598 |
| 532 | Ga0207668_10531004 | 3300025972 | Unclassified | 1016 |
| 533 | Ga0207640_10101334 | 3300025981 | Bacteria | 2020 |
| 534 | Ga0207658_10002773 | 3300025986 | Bacteria | 12621 |
| 535 | Ga0207658_10045001 | 3300025986 | Bacteria | 3215 |
| 536 | Ga0207658_10513731 | 3300025986 | Bacteria | 1068 |
| 537 | Ga0207677_10021611 | 3300026023 | Bacteria | 3935 |
| 538 | Ga0207677_10440113 | 3300026023 | Bacteria | 1115 |
| 539 | Ga0207703_10004034 | 3300026035 | Bacteria | 12137 |
| 540 | Ga0207703_11386256 | 3300026035 | Bacteria | 676 |
| 541 | Ga0207639_10405328 | 3300026041 | Bacteria | 1229 |
| 542 | Ga0207639_11951357 | 3300026041 | Unclassified | 548 |
| 543 | Ga0207678_10005661 | 3300026067 | Bacteria | 11168 |
| 544 | Ga0207678_10054636 | 3300026067 | Bacteria | 3440 |
| 545 | Ga0207708_10029168 | 3300026075 | Bacteria | 4180 |
| 546 | Ga0207708_10906083 | 3300026075 | Bacteria | 763 |
| 547 | Ga0207702_10003886 | 3300026078 | Bacteria | 13458 |
| 548 | Ga0207702_10091581 | 3300026078 | Bacteria | 2662 |
| 549 | Ga0207702_10176938 | 3300026078 | Bacteria | 1961 |
| 550 | Ga0207641_10000147 | 3300026088 | Bacteria | 99902 |
| 551 | Ga0207641_10047954 | 3300026088 | Bacteria | 3604 |
| 552 | Ga0207641_10088003 | 3300026088 | Bacteria | 2711 |
| 553 | Ga0207641_10253970 | 3300026088 | Bacteria | 1643 |
| 554 | Ga0207648_10000163 | 3300026089 | Bacteria | 68352 |
| 555 | Ga0207648_10002972 | 3300026089 | Bacteria | 17912 |
| 556 | Ga0207648_10006258 | 3300026089 | Bacteria | 11853 |
| 557 | Ga0207676_10002739 | 3300026095 | Bacteria | 12543 |
| 558 | Ga0207676_10893424 | 3300026095 | Bacteria | 871 |
| 559 | Ga0207674_10000432 | 3300026116 | Bacteria | 54683 |
| 560 | Ga0207674_10496037 | 3300026116 | Bacteria | 1180 |
| 561 | Ga0207674_10767684 | 3300026116 | Bacteria | 930 |
| 562 | Ga0207674_11567092 | 3300026116 | Bacteria | 627 |
| 563 | Ga0207675_100011858 | 3300026118 | Bacteria | 8143 |
| 564 | Ga0207675_100424534 | 3300026118 | Unclassified | 1313 |
| 565 | Ga0207683_10005098 | 3300026121 | Bacteria | 11271 |
| 566 | Ga0207683_10085119 | 3300026121 | Bacteria | 2811 |
| 567 | Ga0207698_10464471 | 3300026142 | Bacteria | 1225 |
| 568 | Ga0209588_1004547 | 3300027671 | Bacteria | 3920 |
| 569 | Ga0265354_1002329 | 3300028016 | Bacteria | 2388 |
| 570 | Ga0265357_1032509 | 3300028023 | Unclassified | 599 |
| 571 | Ga0268266_10007640 | 3300028379 | Bacteria | 9725 |
| 572 | Ga0268266_10017397 | 3300028379 | Bacteria | 6133 |
| 573 | Ga0268265_10069709 | 3300028380 | Bacteria | 2731 |
| 574 | Ga0268265_10662130 | 3300028380 | Bacteria | 1005 |
| 575 | Ga0268265_11721786 | 3300028380 | Unclassified | 633 |
| 576 | Ga0268264_10011405 | 3300028381 | Bacteria | 7342 |
| 577 | Ga0268264_10214673 | 3300028381 | Unclassified | 1768 |
| 578 | Ga0268264_10379950 | 3300028381 | Bacteria | 1352 |
| 579 | Ga0265319_1163096 | 3300028563 | Unclassified | 688 |
| 580 | Ga0265338_10053619 | 3300028800 | Bacteria | 3605 |
| 581 | Ga0265338_10072333 | 3300028800 | Bacteria | 2944 |
| 582 | Ga0265338_10098695 | 3300028800 | Unclassified | 2388 |
| 583 | Ga0265338_10140440 | 3300028800 | Bacteria | 1893 |
| 584 | Ga0265338_10188465 | 3300028800 | Bacteria | 1566 |
| 585 | Ga0265338_10586239 | 3300028800 | Bacteria | 778 |
| 586 | Ga0265762_1009173 | 3300030760 | Bacteria | 1764 |
| 587 | Ga0265762_1036087 | 3300030760 | Unclassified | 953 |
| 588 | Ga0265760_10002419 | 3300031090 | Bacteria | 5452 |
| 589 | Ga0265760_10032184 | 3300031090 | Bacteria | 1548 |
| 590 | Ga0265760_10036713 | 3300031090 | Unclassified | 1454 |
| 591 | Ga0265325_10007020 | 3300031241 | Bacteria | 6788 |
| 592 | Ga0265325_10029298 | 3300031241 | Bacteria | 2960 |
| 593 | Ga0265325_10042685 | 3300031241 | Unclassified | 2369 |
| 594 | Ga0265340_10030561 | 3300031247 | Bacteria | 2699 |
| 595 | Ga0265340_10055572 | 3300031247 | Unclassified | 1906 |
| 596 | Ga0265340_10068037 | 3300031247 | Bacteria | 1692 |
| 597 | Ga0265339_10103136 | 3300031249 | Unclassified | 1482 |
| 598 | Ga0265339_10124412 | 3300031249 | Unclassified | 1323 |
| 599 | Ga0265331_10021700 | 3300031250 | Bacteria | 3284 |
| 600 | Ga0265331_10553976 | 3300031250 | Unclassified | 518 |
| 601 | Ga0265327_10037167 | 3300031251 | Bacteria | 2669 |
| 602 | Ga0265316_10002094 | 3300031344 | Bacteria | 20982 |
| 603 | Ga0265316_10134522 | 3300031344 | Unclassified | 1860 |
| 604 | Ga0265316_10167791 | 3300031344 | Bacteria | 1639 |
| 605 | Ga0265316_10516880 | 3300031344 | Unclassified | 852 |
| 606 | Ga0307408_100340673 | 3300031548 | Bacteria | 1269 |
| 607 | Ga0265313_10004201 | 3300031595 | Bacteria | 11179 |
| 608 | Ga0265313_10146494 | 3300031595 | Unclassified | 1012 |
| 609 | Ga0265314_10001915 | 3300031711 | Bacteria | 22231 |
| 610 | Ga0265314_10489283 | 3300031711 | Unclassified | 649 |
| 611 | Ga0265342_10017958 | 3300031712 | Unclassified | 4593 |
| 612 | Ga0307405_11128945 | 3300031731 | Bacteria | 675 |
| 613 | Ga0307413_10074956 | 3300031824 | Bacteria | 2145 |
| 614 | Ga0307410_10069645 | 3300031852 | Bacteria | 2434 |
| 615 | Ga0307406_10004357 | 3300031901 | Bacteria | 7703 |
| 616 | Ga0307407_10067909 | 3300031903 | Bacteria | 2109 |
| 617 | Ga0307412_10966573 | 3300031911 | Unclassified | 750 |
| 618 | Ga0307409_101636228 | 3300031995 | Bacteria | 672 |
| 619 | Ga0307416_100004807 | 3300032002 | Bacteria | 8208 |
| 620 | Ga0307416_100373080 | 3300032002 | Bacteria | 1454 |
| 621 | Ga0307411_10012474 | 3300032005 | Bacteria | 4639 |
| 622 | Ga0307415_100018167 | 3300032126 | Bacteria | 4239 |
| 623 | Ga0373926_0022257 | 3300035083 | Bacteria | 2199 |
| 624 | Ga0373944_0116822 | 3300035089 | Bacteria | 916 |
| 625 | Ga0373923_0056408 | 3300035111 | Bacteria | 1658 |
| 626 | Ga0373923_0283737 | 3300035111 | Unclassified | 781 |
| 627 | Ga0373923_0350789 | 3300035111 | Bacteria | 705 |
| 628 | Ga0373923_0447901 | 3300035111 | Unclassified | 626 |
| 629 | Ga0373936_0001376 | 3300035113 | Bacteria | 8824 |
| 630 | Ga0373936_0039047 | 3300035113 | Bacteria | 1899 |
| 631 | Ga0373936_0048611 | 3300035113 | Bacteria | 1712 |
| 632 | Ga0373936_0403826 | 3300035113 | Bacteria | 627 |
| 633 | Ga0373945_0002193 | 3300035116 | Bacteria | 6100 |
| 634 | Ga0373945_0048626 | 3300035116 | Bacteria | 1554 |
| 635 | Ga0373953_0005730 | 3300035117 | Unclassified | 4050 |
| 636 | Ga0373957_0135020 | 3300035120 | Unclassified | 1006 |
| 637 | Ga0373943_0002083 | 3300035170 | Bacteria | 9081 |
| 638 | Ga0373943_0402744 | 3300035170 | Unclassified | 790 |
| 639 | Ga0373946_0005302 | 3300035171 | Bacteria | 4647 |
| 640 | Ga0373946_0584770 | 3300035171 | Bacteria | 578 |
| 641 | Ga0373955_0167970 | 3300035172 | Bacteria | 1297 |
| 642 | Ga0373955_0566881 | 3300035172 | Bacteria | 695 |
| 643 | Ga0373961_0264106 | 3300035241 | Unclassified | 627 |
| 644 | Ga0373924_0034248 | 3300035410 | Bacteria | 2055 |
| 645 | Ga0373924_0092296 | 3300035410 | Bacteria | 1296 |
| 646 | Ga0373924_0469053 | 3300035410 | Unclassified | 565 |
| 647 | Ga0373935_0013182 | 3300035692 | Unclassified | 4984 |
| 648 | Ga0373935_0022318 | 3300035692 | Bacteria | 3880 |
| 649 | Ga0373935_0247094 | 3300035692 | Bacteria | 1247 |
| 650 | Ga0373927_0001136 | 3300035695 | Bacteria | 20149 |
| 651 | Ga0373927_0094131 | 3300035695 | Bacteria | 1947 |
| 652 | Ga0373933_0015464 | 3300035724 | Unclassified | 4254 |
| 653 | Ga0373933_0168681 | 3300035724 | Bacteria | 1392 |
| 654 | Ga0373933_0442551 | 3300035724 | Unclassified | 850 |
| 655 | Ga0373933_0711399 | 3300035724 | Bacteria | 661 |
| 656 | Ga0373947_0001191 | 3300035725 | Bacteria | 16011 |
| 657 | Ga0373947_0028666 | 3300035725 | Unclassified | 3265 |
| 658 | Ga0373947_0498753 | 3300035725 | Unclassified | 827 |
| 659 | Ga0373937_0087778 | 3300036401 | Bacteria | 2879 |
| 660 | Ga0373937_0094573 | 3300036401 | Bacteria | 2771 |
| 661 | Ga0373937_0141391 | 3300036401 | Bacteria | 2252 |
| 662 | Ga0373937_0243075 | 3300036401 | Bacteria | 1696 |
| 663 | Ga0373937_0808924 | 3300036401 | Bacteria | 885 |
| 664 | Ga0373937_1326693 | 3300036401 | Unclassified | 667 |
| 665 | Ga0373925_0002873 | 3300037068 | Bacteria | 13598 |
| 666 | Ga0436364_0539137 | 3300037853 | Unclassified | 828 |
| 667 | Ga0436360_0923790 | 3300039438 | Bacteria | 2335 |
| 668 | Ga0436361_0138788 | 3300039447 | Bacteria | 908 |
| 669 | Ga0436361_0541395 | 3300039447 | Bacteria | 4723 |
| 670 | Ga0436362_0173019 | 3300039453 | Archaea | 524 |
| 671 | Ga0436362_0859868 | 3300039453 | Bacteria | 3920 |
| 672 | Ga0451791_1430284 | 3300041451 | Bacteria | 808 |
| 673 | Ga0451798_0274452 | 3300041458 | Bacteria | 730 |
| 674 | Ga0451839_0858850 | 3300041496 | Unclassified | 558 |
| 675 | Ga0451853_1027504 | 3300041512 | Bacteria | 1593 |
| 676 | Ga0439435_0024358 | 3300042436 | Bacteria | 1596 |
| 677 | Ga0451577_0000331 | 3300042876 | Bacteria | 88029 |
| 678 | Ga0451577_0168657 | 3300042876 | Bacteria | 1972 |
| 679 | Ga0451577_0337697 | 3300042876 | Unclassified | 1366 |
| 680 | Ga0451577_0354158 | 3300042876 | Bacteria | 1332 |
| 681 | Ga0451577_1967095 | 3300042876 | Bacteria | 511 |
| 682 | Ga0453683_0058493 | 3300044673 | Bacteria | 2411 |
| 683 | Ga0453683_0068973 | 3300044673 | Unclassified | 2211 |
| 684 | Ga0453683_0086394 | 3300044673 | Bacteria | 1965 |
| 685 | Ga0453683_0093358 | 3300044673 | Bacteria | 1887 |
| 686 | Ga0453683_0182114 | 3300044673 | Bacteria | 1333 |
| 687 | Ga0453683_0244196 | 3300044673 | Bacteria | 1144 |
| 688 | Ga0466963_0063984 | 3300044694 | Bacteria | 2463 |
| 689 | Ga0466963_1201343 | 3300044694 | Unclassified | 533 |
| 690 | Ga0466964_0371804 | 3300044706 | Bacteria | 740 |
| 691 | Ga0453684_0000429 | 3300044712 | Bacteria | 171513 |
| 692 | Ga0453684_2019533 | 3300044712 | Bacteria | 580 |
| 693 | Ga0466957_1134598 | 3300044842 | Bacteria | 564 |
| 694 | Ga0451576_0003131 | 3300045051 | Bacteria | 23171 |
| 695 | Ga0451576_0008004 | 3300045051 | Bacteria | 12493 |
| 696 | Ga0451576_0010501 | 3300045051 | Bacteria | 10615 |
| 697 | Ga0451576_0336295 | 3300045051 | Unclassified | 1580 |
| 698 | Ga0451576_0468335 | 3300045051 | Bacteria | 1323 |
| 699 | Ga0451576_0748115 | 3300045051 | Bacteria | 1027 |
| 700 | Ga0451576_0890744 | 3300045051 | Bacteria | 934 |
| 701 | Ga0451576_0892330 | 3300045051 | Bacteria | 933 |
| 702 | Ga0466958_0293205 | 3300045836 | Bacteria | 1044 |
| 703 | Ga0466967_0005760 | 3300045976 | Bacteria | 8655 |
| 704 | Ga0466967_0023910 | 3300045976 | Bacteria | 5015 |
| 705 | Ga0495592_0192186 | 3300046454 | Bacteria | 1383 |
| 706 | Ga0495629_0041026 | 3300046459 | Unclassified | 3257 |
| 707 | Ga0495629_0199219 | 3300046459 | Bacteria | 1385 |
| 708 | Ga0495629_0686098 | 3300046459 | Unclassified | 681 |
| 709 | Ga0495651_0057273 | 3300046462 | Bacteria | 2992 |
| 710 | Ga0495653_0203345 | 3300046463 | Unclassified | 1343 |
| 711 | Ga0495653_0276262 | 3300046463 | Bacteria | 1104 |
| 712 | Ga0495653_0719427 | 3300046463 | Bacteria | 605 |
| 713 | Ga0495580_0000097 | 3300046472 | Bacteria | 58068 |
| 714 | Ga0495580_0012232 | 3300046472 | Bacteria | 6592 |
| 715 | Ga0495580_0109994 | 3300046472 | Unclassified | 1913 |
| 716 | Ga0495582_0015036 | 3300046473 | Unclassified | 4256 |
| 717 | Ga0495582_0165376 | 3300046473 | Bacteria | 1259 |
| 718 | Ga0495664_0586774 | 3300046477 | Unclassified | 663 |
| 719 | Ga0495664_0638699 | 3300046477 | Bacteria | 631 |
| 720 | Ga0495608_0669155 | 3300046511 | Bacteria | 619 |
| 721 | Ga0495618_0921606 | 3300046514 | Bacteria | 504 |
| 722 | Ga0495630_0085877 | 3300046517 | Bacteria | 2376 |
| 723 | Ga0495630_0300074 | 3300046517 | Bacteria | 1227 |
| 724 | Ga0495630_0388701 | 3300046517 | Bacteria | 1069 |
| 725 | Ga0495652_0078059 | 3300046529 | Bacteria | 2742 |
| 726 | Ga0495640_0056102 | 3300046533 | Bacteria | 2692 |
| 727 | Ga0495640_0082200 | 3300046533 | Bacteria | 2140 |
| 728 | Ga0495586_0025740 | 3300046535 | Bacteria | 3149 |
| 729 | Ga0495621_0116268 | 3300046539 | Unclassified | 1030 |
| 730 | Ga0495645_0017082 | 3300046543 | Bacteria | 5197 |
| 731 | Ga0495667_0111868 | 3300046559 | Bacteria | 1764 |
| 732 | Ga0495667_0915728 | 3300046559 | Unclassified | 537 |
| 733 | Ga0495635_0456335 | 3300046663 | Bacteria | 844 |
| 734 | Ga0495635_0623289 | 3300046663 | Bacteria | 703 |
| 735 | Ga0495599_0011400 | 3300046678 | Bacteria | 5460 |
| 736 | Ga0495599_0278892 | 3300046678 | Bacteria | 1013 |
| 737 | Ga0495623_0361354 | 3300046679 | Bacteria | 789 |
| 738 | Ga0495647_0173296 | 3300046681 | Bacteria | 935 |
| 739 | Ga0495647_0283656 | 3300046681 | Unclassified | 743 |
| 740 | Ga0495658_0028390 | 3300046683 | Unclassified | 3020 |
| 741 | Ga0495658_0043728 | 3300046683 | Bacteria | 2507 |
| 742 | Ga0495600_0148050 | 3300046809 | Bacteria | 1521 |
| 743 | Ga0495581_0052481 | 3300047315 | Bacteria | 2355 |
| 744 | Ga0495581_0857382 | 3300047315 | Unclassified | 520 |
| 745 | Ga0495604_0085041 | 3300047317 | Bacteria | 2361 |
| 746 | Ga0495674_0040409 | 3300047319 | Bacteria | 4172 |
| 747 | Ga0495674_0323925 | 3300047319 | Bacteria | 1255 |
| 748 | Ga0495680_0210090 | 3300047322 | Bacteria | 1394 |
| 749 | Ga0495680_0385203 | 3300047322 | Bacteria | 970 |
| 750 | Ga0495684_0451769 | 3300047471 | Unclassified | 893 |
| 751 | Ga0495593_0189137 | 3300047673 | Bacteria | 1036 |
| 752 | Ga0495602_0122456 | 3300048088 | Bacteria | 2090 |
| 753 | Ga0495602_0151404 | 3300048088 | Bacteria | 1823 |
| 754 | Ga0495602_0350202 | 3300048088 | Unclassified | 1066 |
| 755 | Ga0496100_0654639 | 3300048903 | Bacteria | 818 |
| 756 | Ga0496101_0006691 | 3300048904 | Bacteria | 7433 |
| 757 | Ga0496101_0235533 | 3300048904 | Unclassified | 1424 |
| 758 | Ga0496102_0068164 | 3300048905 | Bacteria | 3264 |
| 759 | Ga0496102_0086924 | 3300048905 | Bacteria | 2888 |
| 760 | Ga0496103_0015071 | 3300048906 | Bacteria | 4595 |
| 761 | Ga0496104_0039654 | 3300048907 | Bacteria | 4410 |
| 762 | Ga0496104_0170814 | 3300048907 | Bacteria | 2085 |
| 763 | Ga0496104_0270348 | 3300048907 | Bacteria | 1612 |
| 764 | Ga0496104_0425921 | 3300048907 | Bacteria | 1239 |
| 765 | Ga0496105_0128949 | 3300048908 | Bacteria | 2086 |
| 766 | Ga0496105_0690550 | 3300048908 | Unclassified | 784 |
| 767 | Ga0496105_1214631 | 3300048908 | Unclassified | 554 |
| 768 | Ga0496106_0001241 | 3300048909 | Bacteria | 19106 |
| 769 | Ga0496106_0565544 | 3300048909 | Unclassified | 912 |
| 770 | Ga0496106_0740071 | 3300048909 | Bacteria | 782 |
| 771 | Ga0496107_0001617 | 3300048910 | Bacteria | 14027 |
| 772 | Ga0496108_0000051 | 3300048911 | Bacteria | 131546 |
| 773 | Ga0496108_0008626 | 3300048911 | Bacteria | 8269 |
| 774 | Ga0496108_0217105 | 3300048911 | Bacteria | 1661 |
| 775 | Ga0496109_0000105 | 3300048912 | Bacteria | 87116 |
| 776 | Ga0496109_0029537 | 3300048912 | Bacteria | 4910 |
| 777 | Ga0496109_0635252 | 3300048912 | Bacteria | 1004 |
| 778 | Ga0496110_0005502 | 3300048913 | Bacteria | 9937 |
| 779 | Ga0496110_0011215 | 3300048913 | Bacteria | 7325 |
| 780 | Ga0496110_0044211 | 3300048913 | Bacteria | 3890 |
| 781 | Ga0496111_0013479 | 3300048914 | Bacteria | 5565 |
| 782 | Ga0496111_0071429 | 3300048914 | Bacteria | 2526 |
| 783 | Ga0496111_0646520 | 3300048914 | Unclassified | 772 |
| 784 | Ga0496112_0000050 | 3300048915 | Bacteria | 83676 |
| 785 | Ga0496112_0110662 | 3300048915 | Bacteria | 2717 |
| 786 | Ga0496112_1183206 | 3300048915 | Unclassified | 681 |
| 787 | Ga0496113_0000254 | 3300048916 | Bacteria | 25129 |
| 788 | Ga0496113_0008982 | 3300048916 | Bacteria | 6542 |
| 789 | Ga0496113_0439909 | 3300048916 | Unclassified | 1047 |
| 790 | Ga0496113_1121816 | 3300048916 | Bacteria | 616 |
| 791 | Ga0496114_0132713 | 3300048917 | Bacteria | 2152 |
| 792 | Ga0496115_0005030 | 3300048918 | Bacteria | 9603 |
| 793 | Ga0496115_0099941 | 3300048918 | Bacteria | 2378 |
| 794 | Ga0496115_0186149 | 3300048918 | Bacteria | 1716 |
| 795 | Ga0501033_0009319 | 3300049570 | Bacteria | 7561 |
| 796 | Ga0501034_1308394 | 3300049571 | Bacteria | 601 |
| 797 | Ga0501042_0603010 | 3300049578 | Unclassified | 798 |
| 798 | Ga0501043_0013705 | 3300049579 | Bacteria | 6344 |
| 799 | Ga0501046_0022846 | 3300049580 | Bacteria | 5151 |
| 800 | Ga0501046_0046383 | 3300049580 | Bacteria | 3449 |
| 801 | Ga0501046_0398557 | 3300049580 | Unclassified | 994 |
| 802 | Ga0501047_0198932 | 3300049581 | Bacteria | 1865 |
| 803 | Ga0501047_0285165 | 3300049581 | Bacteria | 1495 |
| 804 | Ga0501048_0102747 | 3300049582 | Bacteria | 2017 |
| 805 | Ga0501067_0426403 | 3300049583 | Bacteria | 740 |
| 806 | Ga0501069_0142529 | 3300049585 | Bacteria | 1375 |
| 807 | Ga0501070_0000995 | 3300049586 | Bacteria | 25466 |
| 808 | Ga0501072_0663937 | 3300049588 | Unclassified | 820 |
| 809 | Ga0501077_0319318 | 3300049593 | Unclassified | 990 |
| 810 | Ga0501217_208817 | 3300049661 | Unclassified | 612 |
| 811 | Ga0501081_0704645 | 3300049743 | Bacteria | 758 |
| 812 | Ga0501081_1459967 | 3300049743 | Unclassified | 519 |
| 813 | Ga0501044_0025059 | 3300049823 | Bacteria | 6326 |
| 814 | nmdc:mga05p37_192735_c1 | 3300050507 | Bacteria | 1687 |
| 815 | nmdc:mga05p37_292470_c1 | 3300050507 | Bacteria | 1938 |
| 816 | nmdc:mga09592_1540765_c1 | 3300050508 | Bacteria | 540 |
| 817 | nmdc:mga09592_19125_c1 | 3300050508 | Bacteria | 5621 |
| 818 | nmdc:mga09592_204089_c1 | 3300050508 | Bacteria | 1712 |
| 819 | nmdc:mga0qj67_117338_c1 | 3300050509 | Unclassified | 751 |
| 820 | nmdc:mga0qj67_24967_c1 | 3300050509 | Bacteria | 4612 |
| 821 | nmdc:mga0qj67_838742_c1 | 3300050509 | Bacteria | 726 |
| 822 | nmdc:mga06r32_1208592_c1 | 3300050510 | Bacteria | 702 |
| 823 | nmdc:mga06r32_1302000_c1 | 3300050510 | Unclassified | 671 |
| 824 | nmdc:mga0n895_15409_c1 | 3300050512 | Bacteria | 6969 |
| 825 | nmdc:mga0n895_28241_c1 | 3300050512 | Bacteria | 5337 |
| 826 | nmdc:mga0n895_417048_c1 | 3300050512 | Bacteria | 1357 |
| 827 | nmdc:mga0n895_552382_c1 | 3300050512 | Unclassified | 1157 |
| 828 | nmdc:mga0rr50_1125456_c1 | 3300050513 | Bacteria | 668 |
| 829 | nmdc:mga0rr50_245060_c1 | 3300050513 | Unclassified | 1487 |
| 830 | nmdc:mga0rr50_385933_c1 | 3300050513 | Bacteria | 1182 |
| 831 | nmdc:mga0rr50_9396_c1 | 3300050513 | Bacteria | 6144 |
| 832 | nmdc:mga08x19_164997_c1 | 3300050514 | Bacteria | 1506 |
| 833 | nmdc:mga0a205_208993_c1 | 3300050515 | Unclassified | 1841 |
| 834 | nmdc:mga0a205_566116_c1 | 3300050515 | Unclassified | 991 |
| 835 | Ga0495601_0066674 | 3300053077 | Bacteria | 2292 |
| 836 | Ga0495601_0656017 | 3300053077 | Bacteria | 671 |
| 837 | Ga0495612_0253462 | 3300053078 | Bacteria | 783 |
| 838 | Ga0495612_0330393 | 3300053078 | Unclassified | 687 |
| 839 | Ga0587066_125981 | 3300059490 | Unclassified | 610 |
| 840 | Ga0587073_0234969 | 3300059492 | Unclassified | 567 |
| 841 | Ga0587077_216976 | 3300059493 | Unclassified | 537 |
| 842 | Ga0587083_0034269 | 3300059505 | Unclassified | 1029 |
| 843 | Ga0587088_149199 | 3300059508 | Unclassified | 564 |
| 844 | Ga0587128_109954 | 3300059630 | Unclassified | 588 |
| 845 | Ga0501082_0614639 | 3300060353 | Unclassified | 951 |
| 846 | Ga0501082_0746184 | 3300060353 | Bacteria | 857 |
| 847 | Ga0530510_0035856 | 3300061734 | Unclassified | 3576 |
| 848 | Ga0070682_100019199 | |||
| 849 | LJNas_1000045 | |||
| 850 | JGI24752J21851_1002644 | |||
| 851 | JGI24743J22301_10008450 | |||
| 852 | JGI24749J21850_1070977 | |||
| 853 | JGI24034J26672_10000666 | |||
| 854 | Ga0065712_10140859 | |||
| 855 | Ga0065712_10378804 | |||
| 856 | Ga0065715_10097290 | |||
| 857 | Ga0065715_10471564 | |||
| 858 | Ga0070658_10013835 | |||
| 859 | Ga0070676_10009262 | |||
| 860 | Ga0070676_10011632 | |||
| 861 | Ga0070676_10015848 | |||
| 862 | Ga0070683_100005690 | |||
| 863 | Ga0070683_100476508 | |||
| 864 | Ga0070690_100004767 | |||
| 865 | Ga0070690_100026065 | |||
| 866 | Ga0070690_100114120 | |||
| 867 | Ga0070690_100128281 | |||
| 868 | Ga0070670_100017432 | |||
| 869 | Ga0070670_100780295 | |||
| 870 | Ga0070677_10046985 | |||
| 871 | Ga0068869_100010054 | |||
| 872 | Ga0068869_100022887 | |||
| 873 | Ga0070666_10050617 | |||
| 874 | Ga0070666_10107537 | |||
| 875 | Ga0070680_100003019 | |||
| 876 | Ga0070680_100072151 | |||
| 877 | Ga0070680_101354033 | |||
| 878 | Ga0070680_101814454 | |||
| 879 | Ga0070682_100215717 | |||
| 880 | Ga0068868_100046390 | |||
| 881 | Ga0068868_100359373 | |||
| 882 | Ga0070660_100014554 | |||
| 883 | Ga0070660_100329899 | |||
| 884 | Ga0070689_100011048 | |||
| 885 | Ga0070689_100063497 | |||
| 886 | Ga0070691_10235596 | |||
| 887 | Ga0070691_10552043 | |||
| 888 | Ga0070687_100041382 | |||
| 889 | Ga0070687_100069501 | |||
| 890 | Ga0070661_100005140 | |||
| 891 | Ga0070661_100258997 | |||
| 892 | Ga0070692_10007213 | |||
| 893 | Ga0070668_100011172 | |||
| 894 | Ga0070669_100022993 | |||
| 895 | Ga0070669_100070596 | |||
| 896 | Ga0070675_100048328 | |||
| 897 | Ga0070675_100053204 | |||
| 898 | Ga0070675_100060562 | |||
| 899 | Ga0070671_100000192 | |||
| 900 | Ga0070671_100007699 | |||
| 901 | Ga0070671_100270868 | |||
| 902 | Ga0070674_100045716 | |||
| 903 | Ga0070674_100180049 | |||
| 904 | Ga0070673_100176615 | |||
| 905 | Ga0070673_100394060 | |||
| 906 | Ga0070673_100572412 | |||
| 907 | Ga0070688_100000617 | |||
| 908 | Ga0070688_100030502 | |||
| 909 | Ga0070688_101680690 | |||
| 910 | Ga0070659_100012421 | |||
| 911 | Ga0070659_100168216 | |||
| 912 | Ga0070667_100004454 | |||
| 913 | Ga0070667_100111547 | |||
| 914 | Ga0070667_100229863 | |||
| 915 | Ga0070703_10000950 | |||
| 916 | Ga0070709_10056314 | |||
| 917 | Ga0070709_10071379 | |||
| 918 | Ga0070709_10094859 | |||
| 919 | Ga0070709_10120300 | |||
| 920 | Ga0070709_10208182 | |||
| 921 | Ga0070709_10475991 | |||
| 922 | Ga0070714_100003456 | |||
| 923 | Ga0070714_100005356 | |||
| 924 | Ga0070714_100046410 | |||
| 925 | Ga0070714_100480031 | |||
| 926 | Ga0070714_100511155 | |||
| 927 | Ga0070714_100523729 | |||
| 928 | Ga0070714_100551931 | |||
| 929 | Ga0070714_101062143 | |||
| 930 | Ga0070714_101087918 | |||
| 931 | Ga0070714_101368649 | |||
| 932 | Ga0070713_100000117 | |||
| 933 | Ga0070713_100002140 | |||
| 934 | Ga0070713_100111541 | |||
| 935 | Ga0070713_100378640 | |||
| 936 | Ga0070713_100474031 | |||
| 937 | Ga0070713_101226615 | |||
| 938 | Ga0070713_101411363 | |||
| 939 | Ga0070713_102123038 | |||
| 940 | Ga0070710_10001214 | |||
| 941 | Ga0070710_10114524 | |||
| 942 | Ga0070710_10275579 | |||
| 943 | Ga0070710_10351919 | |||
| 944 | Ga0070710_10591309 | |||
| 945 | Ga0070710_10839432 | |||
| 946 | Ga0070701_10016079 | |||
| 947 | Ga0070701_10228498 | |||
| 948 | Ga0070701_10233199 | |||
| 949 | Ga0070701_11396613 | |||
| 950 | Ga0070711_100000152 | |||
| 951 | Ga0070711_100020189 | |||
| 952 | Ga0070711_100071047 | |||
| 953 | Ga0070711_100134959 | |||
| 954 | Ga0070711_100153039 | |||
| 955 | Ga0070711_100442036 | |||
| 956 | Ga0070711_100477628 | |||
| 957 | Ga0070711_100703020 | |||
| 958 | Ga0070705_100027280 | |||
| 959 | Ga0070705_100030648 | |||
| 960 | Ga0070705_100270054 | |||
| 961 | Ga0070700_100021304 | |||
| 962 | Ga0070694_100127764 | |||
| 963 | Ga0070694_100849679 | |||
| 964 | Ga0070694_101609480 | |||
| 965 | Ga0070708_100046403 | |||
| 966 | Ga0070708_100063098 | |||
| 967 | Ga0070708_100170406 | |||
| 968 | Ga0070708_100176095 | |||
| 969 | Ga0070708_100769666 | |||
| 970 | Ga0070708_101132793 | |||
| 971 | Ga0070708_101145204 | |||
| 972 | Ga0070708_101296481 | |||
| 973 | Ga0070708_101728015 | |||
| 974 | Ga0070708_101798532 | |||
| 975 | Ga0070663_100009895 | |||
| 976 | Ga0070663_100013138 | |||
| 977 | Ga0070678_100100578 | |||
| 978 | Ga0070678_101876367 | |||
| 979 | Ga0070662_100029508 | |||
| 980 | Ga0070662_100349046 | |||
| 981 | Ga0070681_10025762 | |||
| 982 | Ga0068867_100014693 | |||
| 983 | Ga0068867_100015612 | |||
| 984 | Ga0070685_10001498 | |||
| 985 | Ga0070706_100009184 | |||
| 986 | Ga0070706_100042734 | |||
| 987 | Ga0070706_100078483 | |||
| 988 | Ga0070706_101126282 | |||
| 989 | Ga0070706_101336800 | |||
| 990 | Ga0070706_102034124 | |||
| 991 | Ga0070707_100032500 | |||
| 992 | Ga0070707_100052212 | |||
| 993 | Ga0070707_100058448 | |||
| 994 | Ga0070707_100062243 | |||
| 995 | Ga0070707_100068185 | |||
| 996 | Ga0070707_100178008 | |||
| 997 | Ga0070707_100190269 | |||
| 998 | Ga0070707_100259850 | |||
| 999 | Ga0070707_100301160 | |||
| 1000 | Ga0070707_101133963 | |||
| 1001 | Ga0070707_101508738 | |||
| 1002 | Ga0070698_100032307 | |||
| 1003 | Ga0070698_100186863 | |||
| 1004 | Ga0070698_101530326 | |||
| 1005 | Ga0070699_100131819 | |||
| 1006 | Ga0070699_100136926 | |||
| 1007 | Ga0070699_100352650 | |||
| 1008 | Ga0070699_100502353 | |||
| 1009 | Ga0070699_100770448 | |||
| 1010 | Ga0070699_100880697 | |||
| 1011 | Ga0070699_101017696 | |||
| 1012 | Ga0070699_101970685 | |||
| 1013 | Ga0070679_100270660 | |||
| 1014 | Ga0070684_100003517 | |||
| 1015 | Ga0070697_100012550 | |||
| 1016 | Ga0070697_100201409 | |||
| 1017 | Ga0070697_100223240 | |||
| 1018 | Ga0070697_100293240 | |||
| 1019 | Ga0070697_100340357 | |||
| 1020 | Ga0070697_100356961 | |||
| 1021 | Ga0070697_100455501 | |||
| 1022 | Ga0070697_100562353 | |||
| 1023 | Ga0068853_100020129 | |||
| 1024 | Ga0070672_100001333 | |||
| 1025 | Ga0070672_100013959 | |||
| 1026 | Ga0070672_100023729 | |||
| 1027 | Ga0070672_100043955 | |||
| 1028 | Ga0070686_100009065 | |||
| 1029 | Ga0070686_100073297 | |||
| 1030 | Ga0070686_100107525 | |||
| 1031 | Ga0070695_100015846 | |||
| 1032 | Ga0070695_100109583 | |||
| 1033 | Ga0070695_100178946 | |||
| 1034 | Ga0070695_101787138 | |||
| 1035 | Ga0070696_100007482 | |||
| 1036 | Ga0070696_100055703 | |||
| 1037 | Ga0070696_100461231 | |||
| 1038 | Ga0070693_100009244 | |||
| 1039 | Ga0070693_101130233 | |||
| 1040 | Ga0070665_100010620 | |||
| 1041 | Ga0070704_100003471 | |||
| 1042 | Ga0070704_100006035 | |||
| 1043 | Ga0070704_100184910 | |||
| 1044 | Ga0070704_100227630 | |||
| 1045 | Ga0070704_100873629 | |||
| 1046 | Ga0070704_100975039 | |||
| 1047 | Ga0070704_101187374 | |||
| 1048 | Ga0068855_100114658 | |||
| 1049 | Ga0068855_100173602 | |||
| 1050 | Ga0068855_100241951 | |||
| 1051 | Ga0070664_100015138 | |||
| 1052 | Ga0070664_100060204 | |||
| 1053 | Ga0070664_100108628 | |||
| 1054 | Ga0068857_100000556 | |||
| 1055 | Ga0068857_100346002 | |||
| 1056 | Ga0068857_100346150 | |||
| 1057 | Ga0068857_102340530 | |||
| 1058 | Ga0068854_100251792 | |||
| 1059 | Ga0068854_100603050 | |||
| 1060 | Ga0068854_102192453 | |||
| 1061 | Ga0068856_100002603 | |||
| 1062 | Ga0068856_100009133 | |||
| 1063 | Ga0068856_100014945 | |||
| 1064 | Ga0068856_100830779 | |||
| 1065 | Ga0070702_100421814 | |||
| 1066 | Ga0068852_100023164 | |||
| 1067 | Ga0068852_100294620 | |||
| 1068 | Ga0068852_100560078 | |||
| 1069 | Ga0068859_100000695 | |||
| 1070 | Ga0068859_100387600 | |||
| 1071 | Ga0068859_100841210 | |||
| 1072 | Ga0068864_100396265 | |||
| 1073 | Ga0068866_10039439 | |||
| 1074 | Ga0068866_10113601 | |||
| 1075 | Ga0068861_100575658 | |||
| 1076 | Ga0068851_10007835 | |||
| 1077 | Ga0068870_10002556 | |||
| 1078 | Ga0068863_100013974 | |||
| 1079 | Ga0068863_100018878 | |||
| 1080 | Ga0068863_100130886 | |||
| 1081 | Ga0068863_100677793 | |||
| 1082 | Ga0068863_101605053 | |||
| 1083 | Ga0068858_100001625 | |||
| 1084 | Ga0068858_100080695 | |||
| 1085 | Ga0068858_100495600 | |||
| 1086 | Ga0068860_100000924 | |||
| 1087 | Ga0068860_100052886 | |||
| 1088 | Ga0068860_100267279 | |||
| 1089 | Ga0068862_100010186 | |||
| 1090 | Ga0081539_10099777 | |||
| 1091 | Ga0070717_10000862 | |||
| 1092 | Ga0070717_10002152 | |||
| 1093 | Ga0070717_10020059 | |||
| 1094 | Ga0070717_10035252 | |||
| 1095 | Ga0070717_10105598 | |||
| 1096 | Ga0070717_10159516 | |||
| 1097 | Ga0070717_10560446 | |||
| 1098 | Ga0070717_10768524 | |||
| 1099 | Ga0070717_10793943 | |||
| 1100 | Ga0070717_10923961 | |||
| 1101 | Ga0070715_10017641 | |||
| 1102 | Ga0070716_100001453 | |||
| 1103 | Ga0070716_100007489 | |||
| 1104 | Ga0070716_100102702 | |||
| 1105 | Ga0070716_100301855 | |||
| 1106 | Ga0070716_100338702 | |||
| 1107 | Ga0070716_100380196 | |||
| 1108 | Ga0070716_101591308 | |||
| 1109 | Ga0070712_100000070 | |||
| 1110 | Ga0070712_100000309 | |||
| 1111 | Ga0070712_100023403 | |||
| 1112 | Ga0070712_100064462 | |||
| 1113 | Ga0070712_100127896 | |||
| 1114 | Ga0070712_100152634 | |||
| 1115 | Ga0075366_10172597 | |||
| 1116 | Ga0068871_100006456 | |||
| 1117 | Ga0068871_100297647 | |||
| 1118 | Ga0075428_100013151 | |||
| 1119 | Ga0075428_100098017 | |||
| 1120 | Ga0075430_100056948 | |||
| 1121 | Ga0075431_100006030 | |||
| 1122 | Ga0075431_100100687 | |||
| 1123 | Ga0075431_100441813 | |||
| 1124 | Ga0075431_101526595 | |||
| 1125 | Ga0075433_10000504 | |||
| 1126 | Ga0075433_10007971 | |||
| 1127 | Ga0075433_10354778 | |||
| 1128 | Ga0075433_10371693 | |||
| 1129 | Ga0075433_11234274 | |||
| 1130 | Ga0075434_100004069 | |||
| 1131 | Ga0075434_100019217 | |||
| 1132 | Ga0075434_100042024 | |||
| 1133 | Ga0075434_100840880 | |||
| 1134 | Ga0075434_101059453 | |||
| 1135 | Ga0075434_102124144 | |||
| 1136 | Ga0075434_102602498 | |||
| 1137 | Ga0075429_100053069 | |||
| 1138 | Ga0075429_100156056 | |||
| 1139 | Ga0075429_101401454 | |||
| 1140 | Ga0068865_100003984 | |||
| 1141 | Ga0068865_100013747 | |||
| 1142 | Ga0075436_100097126 | |||
| 1143 | Ga0097620_100000695 | |||
| 1144 | Ga0097620_100387576 | |||
| 1145 | Ga0097620_100840991 | |||
| 1146 | Ga0075435_100072426 | |||
| 1147 | Ga0075435_100394379 | |||
| 1148 | Ga0075435_100404456 | |||
| 1149 | Ga0075435_100795997 | |||
| 1150 | Ga0075435_100966241 | |||
| 1151 | Ga0099794_10026446 | |||
| 1152 | Ga0099794_10036586 | |||
| 1153 | Ga0099794_10056367 | |||
| 1154 | Ga0099794_10127202 | |||
| 1155 | Ga0105244_10199391 | |||
| 1156 | Ga0105250_10018868 | |||
| 1157 | Ga0105240_10009668 | |||
| 1158 | Ga0105240_10041544 | |||
| 1159 | Ga0105240_10124351 | |||
| 1160 | Ga0111539_10223648 | |||
| 1161 | Ga0105245_10070445 | |||
| 1162 | Ga0105245_10139001 | |||
| 1163 | Ga0105247_10003131 | |||
| 1164 | Ga0105247_10082762 | |||
| 1165 | Ga0105247_10895908 | |||
| 1166 | Ga0105247_11777003 | |||
| 1167 | Ga0114129_10171915 | |||
| 1168 | Ga0105243_10003500 | |||
| 1169 | Ga0105243_10090887 | |||
| 1170 | Ga0105241_10007141 | |||
| 1171 | Ga0105241_10047096 | |||
| 1172 | Ga0105241_10373655 | |||
| 1173 | Ga0105241_10981514 | |||
| 1174 | Ga0105242_10042378 | |||
| 1175 | Ga0105242_10055982 | |||
| 1176 | Ga0105242_11426207 | |||
| 1177 | Ga0105248_10001718 | |||
| 1178 | Ga0105248_10128189 | |||
| 1179 | Ga0105248_10165748 | |||
| 1180 | Ga0105237_10280571 | |||
| 1181 | Ga0105237_11159107 | |||
| 1182 | Ga0105238_10279507 | |||
| 1183 | Ga0105249_10014167 | |||
| 1184 | Ga0105249_10584039 | |||
| 1185 | Ga0105249_11408446 | |||
| 1186 | Ga0105239_10007481 | |||
| 1187 | Ga0105246_10013190 | |||
| 1188 | Ga0105246_11574351 | |||
| 1189 | Ga0157373_10558570 | |||
| 1190 | Ga0157373_10688302 | |||
| 1191 | Ga0157369_10015772 | |||
| 1192 | Ga0157369_10017495 | |||
| 1193 | Ga0157369_10212038 | |||
| 1194 | Ga0157369_10412388 | |||
| 1195 | Ga0157369_10918836 | |||
| 1196 | Ga0157369_10929863 | |||
| 1197 | Ga0157374_10226284 | |||
| 1198 | Ga0157374_10450522 | |||
| 1199 | Ga0157378_10384656 | |||
| 1200 | Ga0163162_10164139 | |||
| 1201 | Ga0163162_10603302 | |||
| 1202 | Ga0157372_10011062 | |||
| 1203 | Ga0157372_10011443 | |||
| 1204 | Ga0157372_10024974 | |||
| 1205 | Ga0157372_10060479 | |||
| 1206 | Ga0157372_10118263 | |||
| 1207 | Ga0157372_10211639 | |||
| 1208 | Ga0157372_10692112 | |||
| 1209 | Ga0157372_10808296 | |||
| 1210 | Ga0157375_10042807 | |||
| 1211 | Ga0157375_10062423 | |||
| 1212 | Ga0157375_10315075 | |||
| 1213 | Ga0157375_11105863 | |||
| 1214 | Ga0157375_11997206 | |||
| 1215 | Ga0163163_10042188 | |||
| 1216 | Ga0163163_10875589 | |||
| 1217 | Ga0163163_11183972 | |||
| 1218 | Ga0157380_10056941 | |||
| 1219 | Ga0157380_10074606 | |||
| 1220 | Ga0157380_10099771 | |||
| 1221 | Ga0157380_10726137 | |||
| 1222 | Ga0182008_10073148 | |||
| 1223 | Ga0157377_10018672 | |||
| 1224 | Ga0157377_10024220 | |||
| 1225 | Ga0157379_10006121 | |||
| 1226 | Ga0157379_11226123 | |||
| 1227 | Ga0157376_10136614 | |||
| 1228 | Ga0157376_10797696 | |||
| 1229 | Ga0182007_10022821 | |||
| 1230 | Ga0163161_10007744 | |||
| 1231 | Ga0213873_10005554 | |||
| 1232 | Ga0224572_1027208 | |||
| 1233 | Ga0228598_1058071 | |||
| 1234 | Ga0207697_10005179 | |||
| 1235 | Ga0207653_10000024 | |||
| 1236 | Ga0207682_10008600 | |||
| 1237 | Ga0207692_10000654 | |||
| 1238 | Ga0207692_10053337 | |||
| 1239 | Ga0207692_10242586 | |||
| 1240 | Ga0207692_10559612 | |||
| 1241 | Ga0207692_11185526 | |||
| 1242 | Ga0207642_10043617 | |||
| 1243 | Ga0207710_10042340 | |||
| 1244 | Ga0207688_10002810 | |||
| 1245 | Ga0207680_10004848 | |||
| 1246 | Ga0207680_10028555 | |||
| 1247 | Ga0207680_10182473 | |||
| 1248 | Ga0207685_10011767 | |||
| 1249 | Ga0207699_10029133 | |||
| 1250 | Ga0207699_10031371 | |||
| 1251 | Ga0207699_10058954 | |||
| 1252 | Ga0207699_10098354 | |||
| 1253 | Ga0207645_10002635 | |||
| 1254 | Ga0207645_10014270 | |||
| 1255 | Ga0207645_10025603 | |||
| 1256 | Ga0207643_10001249 | |||
| 1257 | Ga0207705_10031224 | |||
| 1258 | Ga0207705_10670003 | |||
| 1259 | Ga0207684_10017085 | |||
| 1260 | Ga0207684_10021485 | |||
| 1261 | Ga0207684_10327863 | |||
| 1262 | Ga0207684_10514059 | |||
| 1263 | Ga0207684_10688876 | |||
| 1264 | Ga0207684_10690533 | |||
| 1265 | Ga0207654_10589131 | |||
| 1266 | Ga0207707_10015217 | |||
| 1267 | Ga0207707_10110448 | |||
| 1268 | Ga0207695_10034687 | |||
| 1269 | Ga0207695_10042304 | |||
| 1270 | Ga0207671_10200949 | |||
| 1271 | Ga0207671_10594691 | |||
| 1272 | Ga0207693_10000121 | |||
| 1273 | Ga0207693_10006665 | |||
| 1274 | Ga0207693_10038241 | |||
| 1275 | Ga0207693_10176228 | |||
| 1276 | Ga0207693_10363540 | |||
| 1277 | Ga0207693_10377198 | |||
| 1278 | Ga0207693_10702351 | |||
| 1279 | Ga0207663_10000231 | |||
| 1280 | Ga0207663_10456967 | |||
| 1281 | Ga0207660_10085622 | |||
| 1282 | Ga0207660_11138366 | |||
| 1283 | Ga0207662_10037171 | |||
| 1284 | Ga0207662_10160223 | |||
| 1285 | Ga0207657_10010924 | |||
| 1286 | Ga0207657_10153330 | |||
| 1287 | Ga0207649_10001140 | |||
| 1288 | Ga0207649_10143173 | |||
| 1289 | Ga0207652_10058817 | |||
| 1290 | Ga0207652_10942960 | |||
| 1291 | Ga0207646_10110228 | |||
| 1292 | Ga0207646_10131915 | |||
| 1293 | Ga0207646_10154765 | |||
| 1294 | Ga0207646_10166264 | |||
| 1295 | Ga0207646_10204401 | |||
| 1296 | Ga0207646_10266294 | |||
| 1297 | Ga0207646_10329207 | |||
| 1298 | Ga0207646_10339887 | |||
| 1299 | Ga0207646_10641832 | |||
| 1300 | Ga0207646_11742592 | |||
| 1301 | Ga0207681_10040362 | |||
| 1302 | Ga0207681_10314302 | |||
| 1303 | Ga0207694_10152524 | |||
| 1304 | Ga0207650_10000150 | |||
| 1305 | Ga0207650_10708745 | |||
| 1306 | Ga0207659_10011671 | |||
| 1307 | Ga0207659_10050700 | |||
| 1308 | Ga0207659_10102634 | |||
| 1309 | Ga0207659_10507048 | |||
| 1310 | Ga0207687_10215738 | |||
| 1311 | Ga0207700_10000064 | |||
| 1312 | Ga0207700_10078431 | |||
| 1313 | Ga0207700_10266212 | |||
| 1314 | Ga0207700_10306677 | |||
| 1315 | Ga0207700_10328157 | |||
| 1316 | Ga0207700_10410969 | |||
| 1317 | Ga0207700_10686128 | |||
| 1318 | Ga0207700_10996497 | |||
| 1319 | Ga0207700_11302601 | |||
| 1320 | Ga0207664_10003297 | |||
| 1321 | Ga0207664_10052165 | |||
| 1322 | Ga0207664_10117090 | |||
| 1323 | Ga0207664_10208821 | |||
| 1324 | Ga0207664_10528637 | |||
| 1325 | Ga0207644_10000219 | |||
| 1326 | Ga0207644_10083497 | |||
| 1327 | Ga0207644_10135771 | |||
| 1328 | Ga0207644_10897316 | |||
| 1329 | Ga0207644_11828625 | |||
| 1330 | Ga0207690_10013253 | |||
| 1331 | Ga0207690_10168811 | |||
| 1332 | Ga0207706_10004536 | |||
| 1333 | Ga0207706_10050984 | |||
| 1334 | Ga0207706_10119323 | |||
| 1335 | Ga0207706_10156029 | |||
| 1336 | Ga0207686_10043976 | |||
| 1337 | Ga0207686_10176896 | |||
| 1338 | Ga0207686_10739671 | |||
| 1339 | Ga0207709_10024179 | |||
| 1340 | Ga0207670_10045730 | |||
| 1341 | Ga0207670_10087847 | |||
| 1342 | Ga0207670_10511803 | |||
| 1343 | Ga0207669_10131718 | |||
| 1344 | Ga0207704_10029584 | |||
| 1345 | Ga0207704_10537133 | |||
| 1346 | Ga0207665_10013840 | |||
| 1347 | Ga0207665_10071959 | |||
| 1348 | Ga0207665_10151296 | |||
| 1349 | Ga0207665_10179011 | |||
| 1350 | Ga0207665_10417499 | |||
| 1351 | Ga0207665_10684713 | |||
| 1352 | Ga0207665_11146653 | |||
| 1353 | Ga0207665_11151863 | |||
| 1354 | Ga0207691_10001031 | |||
| 1355 | Ga0207691_10005259 | |||
| 1356 | Ga0207691_10035476 | |||
| 1357 | Ga0207691_10079883 | |||
| 1358 | Ga0207691_10200380 | |||
| 1359 | Ga0207711_10000769 | |||
| 1360 | Ga0207711_10082691 | |||
| 1361 | Ga0207711_10305082 | |||
| 1362 | Ga0207711_10634770 | |||
| 1363 | Ga0207689_10005493 | |||
| 1364 | Ga0207689_10009453 | |||
| 1365 | Ga0207689_10111291 | |||
| 1366 | Ga0207661_10001443 | |||
| 1367 | Ga0207661_10104919 | |||
| 1368 | Ga0207679_10001208 | |||
| 1369 | Ga0207679_10184053 | |||
| 1370 | Ga0207679_11162558 | |||
| 1371 | Ga0207667_10544913 | |||
| 1372 | Ga0207667_10945968 | |||
| 1373 | Ga0207667_10950016 | |||
| 1374 | Ga0207651_10108270 | |||
| 1375 | Ga0207651_10474523 | |||
| 1376 | Ga0207712_10704742 | |||
| 1377 | Ga0207712_11352440 | |||
| 1378 | Ga0207712_11527554 | |||
| 1379 | Ga0207668_10531004 | |||
| 1380 | Ga0207640_10101334 | |||
| 1381 | Ga0207658_10002773 | |||
| 1382 | Ga0207658_10045001 | |||
| 1383 | Ga0207658_10513731 | |||
| 1384 | Ga0207677_10021611 | |||
| 1385 | Ga0207677_10440113 | |||
| 1386 | Ga0207703_10004034 | |||
| 1387 | Ga0207703_11386256 | |||
| 1388 | Ga0207639_10405328 | |||
| 1389 | Ga0207639_11951357 | |||
| 1390 | Ga0207678_10005661 | |||
| 1391 | Ga0207678_10054636 | |||
| 1392 | Ga0207708_10029168 | |||
| 1393 | Ga0207708_10906083 | |||
| 1394 | Ga0207702_10003886 | |||
| 1395 | Ga0207702_10091581 | |||
| 1396 | Ga0207702_10176938 | |||
| 1397 | Ga0207641_10000147 | |||
| 1398 | Ga0207641_10047954 | |||
| 1399 | Ga0207641_10088003 | |||
| 1400 | Ga0207641_10253970 | |||
| 1401 | Ga0207648_10000163 | |||
| 1402 | Ga0207648_10002972 | |||
| 1403 | Ga0207648_10006258 | |||
| 1404 | Ga0207676_10002739 | |||
| 1405 | Ga0207676_10893424 | |||
| 1406 | Ga0207674_10000432 | |||
| 1407 | Ga0207674_10496037 | |||
| 1408 | Ga0207674_10767684 | |||
| 1409 | Ga0207674_11567092 | |||
| 1410 | Ga0207675_100011858 | |||
| 1411 | Ga0207675_100424534 | |||
| 1412 | Ga0207683_10005098 | |||
| 1413 | Ga0207683_10085119 | |||
| 1414 | Ga0207698_10464471 | |||
| 1415 | Ga0209588_1004547 | |||
| 1416 | Ga0265354_1002329 | |||
| 1417 | Ga0265357_1032509 | |||
| 1418 | Ga0268266_10007640 | |||
| 1419 | Ga0268266_10017397 | |||
| 1420 | Ga0268265_10069709 | |||
| 1421 | Ga0268265_10662130 | |||
| 1422 | Ga0268265_11721786 | |||
| 1423 | Ga0268264_10011405 | |||
| 1424 | Ga0268264_10214673 | |||
| 1425 | Ga0268264_10379950 | |||
| 1426 | Ga0265319_1163096 | |||
| 1427 | Ga0265338_10053619 | |||
| 1428 | Ga0265338_10072333 | |||
| 1429 | Ga0265338_10098695 | |||
| 1430 | Ga0265338_10140440 | |||
| 1431 | Ga0265338_10188465 | |||
| 1432 | Ga0265338_10586239 | |||
| 1433 | Ga0265762_1009173 | |||
| 1434 | Ga0265762_1036087 | |||
| 1435 | Ga0265760_10002419 | |||
| 1436 | Ga0265760_10032184 | |||
| 1437 | Ga0265760_10036713 | |||
| 1438 | Ga0265325_10007020 | |||
| 1439 | Ga0265325_10029298 | |||
| 1440 | Ga0265325_10042685 | |||
| 1441 | Ga0265340_10030561 | |||
| 1442 | Ga0265340_10055572 | |||
| 1443 | Ga0265340_10068037 | |||
| 1444 | Ga0265339_10103136 | |||
| 1445 | Ga0265339_10124412 | |||
| 1446 | Ga0265331_10021700 | |||
| 1447 | Ga0265331_10553976 | |||
| 1448 | Ga0265327_10037167 | |||
| 1449 | Ga0265316_10002094 | |||
| 1450 | Ga0265316_10134522 | |||
| 1451 | Ga0265316_10167791 | |||
| 1452 | Ga0265316_10516880 | |||
| 1453 | Ga0307408_100340673 | |||
| 1454 | Ga0265313_10004201 | |||
| 1455 | Ga0265313_10146494 | |||
| 1456 | Ga0265314_10001915 | |||
| 1457 | Ga0265314_10489283 | |||
| 1458 | Ga0265342_10017958 | |||
| 1459 | Ga0307405_11128945 | |||
| 1460 | Ga0307413_10074956 | |||
| 1461 | Ga0307410_10069645 | |||
| 1462 | Ga0307406_10004357 | |||
| 1463 | Ga0307407_10067909 | |||
| 1464 | Ga0307412_10966573 | |||
| 1465 | Ga0307409_101636228 | |||
| 1466 | Ga0307416_100004807 | |||
| 1467 | Ga0307416_100373080 | |||
| 1468 | Ga0307411_10012474 | |||
| 1469 | Ga0307415_100018167 | |||
| 1470 | Ga0373926_0022257 | |||
| 1471 | Ga0373944_0116822 | |||
| 1472 | Ga0373923_0056408 | |||
| 1473 | Ga0373923_0283737 | |||
| 1474 | Ga0373923_0350789 | |||
| 1475 | Ga0373923_0447901 | |||
| 1476 | Ga0373936_0001376 | |||
| 1477 | Ga0373936_0039047 | |||
| 1478 | Ga0373936_0048611 | |||
| 1479 | Ga0373936_0403826 | |||
| 1480 | Ga0373945_0002193 | |||
| 1481 | Ga0373945_0048626 | |||
| 1482 | Ga0373953_0005730 | |||
| 1483 | Ga0373957_0135020 | |||
| 1484 | Ga0373943_0002083 | |||
| 1485 | Ga0373943_0402744 | |||
| 1486 | Ga0373946_0005302 | |||
| 1487 | Ga0373946_0584770 | |||
| 1488 | Ga0373955_0167970 | |||
| 1489 | Ga0373955_0566881 | |||
| 1490 | Ga0373961_0264106 | |||
| 1491 | Ga0373924_0034248 | |||
| 1492 | Ga0373924_0092296 | |||
| 1493 | Ga0373924_0469053 | |||
| 1494 | Ga0373935_0013182 | |||
| 1495 | Ga0373935_0022318 | |||
| 1496 | Ga0373935_0247094 | |||
| 1497 | Ga0373927_0001136 | |||
| 1498 | Ga0373927_0094131 | |||
| 1499 | Ga0373933_0015464 | |||
| 1500 | Ga0373933_0168681 | |||
| 1501 | Ga0373933_0442551 | |||
| 1502 | Ga0373933_0711399 | |||
| 1503 | Ga0373947_0001191 | |||
| 1504 | Ga0373947_0028666 | |||
| 1505 | Ga0373947_0498753 | |||
| 1506 | Ga0373937_0087778 | |||
| 1507 | Ga0373937_0094573 | |||
| 1508 | Ga0373937_0141391 | |||
| 1509 | Ga0373937_0243075 | |||
| 1510 | Ga0373937_0808924 | |||
| 1511 | Ga0373937_1326693 | |||
| 1512 | Ga0373925_0002873 | |||
| 1513 | Ga0436364_0539137 | |||
| 1514 | Ga0436360_0923790 | |||
| 1515 | Ga0436361_0138788 | |||
| 1516 | Ga0436361_0541395 | |||
| 1517 | Ga0436362_0173019 | |||
| 1518 | Ga0436362_0859868 | |||
| 1519 | Ga0451791_1430284 | |||
| 1520 | Ga0451798_0274452 | |||
| 1521 | Ga0451839_0858850 | |||
| 1522 | Ga0451853_1027504 | |||
| 1523 | Ga0439435_0024358 | |||
| 1524 | Ga0451577_0000331 | |||
| 1525 | Ga0451577_0168657 | |||
| 1526 | Ga0451577_0337697 | |||
| 1527 | Ga0451577_0354158 | |||
| 1528 | Ga0451577_1967095 | |||
| 1529 | Ga0453683_0058493 | |||
| 1530 | Ga0453683_0068973 | |||
| 1531 | Ga0453683_0086394 | |||
| 1532 | Ga0453683_0093358 | |||
| 1533 | Ga0453683_0182114 | |||
| 1534 | Ga0453683_0244196 | |||
| 1535 | Ga0466963_0063984 | |||
| 1536 | Ga0466963_1201343 | |||
| 1537 | Ga0466964_0371804 | |||
| 1538 | Ga0453684_0000429 | |||
| 1539 | Ga0453684_2019533 | |||
| 1540 | Ga0466957_1134598 | |||
| 1541 | Ga0451576_0003131 | |||
| 1542 | Ga0451576_0008004 | |||
| 1543 | Ga0451576_0010501 | |||
| 1544 | Ga0451576_0336295 | |||
| 1545 | Ga0451576_0468335 | |||
| 1546 | Ga0451576_0748115 | |||
| 1547 | Ga0451576_0890744 | |||
| 1548 | Ga0451576_0892330 | |||
| 1549 | Ga0466958_0293205 | |||
| 1550 | Ga0466967_0005760 | |||
| 1551 | Ga0466967_0023910 | |||
| 1552 | Ga0495592_0192186 | |||
| 1553 | Ga0495629_0041026 | |||
| 1554 | Ga0495629_0199219 | |||
| 1555 | Ga0495629_0686098 | |||
| 1556 | Ga0495651_0057273 | |||
| 1557 | Ga0495653_0203345 | |||
| 1558 | Ga0495653_0276262 | |||
| 1559 | Ga0495653_0719427 | |||
| 1560 | Ga0495580_0000097 | |||
| 1561 | Ga0495580_0012232 | |||
| 1562 | Ga0495580_0109994 | |||
| 1563 | Ga0495582_0015036 | |||
| 1564 | Ga0495582_0165376 | |||
| 1565 | Ga0495664_0586774 | |||
| 1566 | Ga0495664_0638699 | |||
| 1567 | Ga0495608_0669155 | |||
| 1568 | Ga0495618_0921606 | |||
| 1569 | Ga0495630_0085877 | |||
| 1570 | Ga0495630_0300074 | |||
| 1571 | Ga0495630_0388701 | |||
| 1572 | Ga0495652_0078059 | |||
| 1573 | Ga0495640_0056102 | |||
| 1574 | Ga0495640_0082200 | |||
| 1575 | Ga0495586_0025740 | |||
| 1576 | Ga0495621_0116268 | |||
| 1577 | Ga0495645_0017082 | |||
| 1578 | Ga0495667_0111868 | |||
| 1579 | Ga0495667_0915728 | |||
| 1580 | Ga0495635_0456335 | |||
| 1581 | Ga0495635_0623289 | |||
| 1582 | Ga0495599_0011400 | |||
| 1583 | Ga0495599_0278892 | |||
| 1584 | Ga0495623_0361354 | |||
| 1585 | Ga0495647_0173296 | |||
| 1586 | Ga0495647_0283656 | |||
| 1587 | Ga0495658_0028390 | |||
| 1588 | Ga0495658_0043728 | |||
| 1589 | Ga0495600_0148050 | |||
| 1590 | Ga0495581_0052481 | |||
| 1591 | Ga0495581_0857382 | |||
| 1592 | Ga0495604_0085041 | |||
| 1593 | Ga0495674_0040409 | |||
| 1594 | Ga0495674_0323925 | |||
| 1595 | Ga0495680_0210090 | |||
| 1596 | Ga0495680_0385203 | |||
| 1597 | Ga0495684_0451769 | |||
| 1598 | Ga0495593_0189137 | |||
| 1599 | Ga0495602_0122456 | |||
| 1600 | Ga0495602_0151404 | |||
| 1601 | Ga0495602_0350202 | |||
| 1602 | Ga0496100_0654639 | |||
| 1603 | Ga0496101_0006691 | |||
| 1604 | Ga0496101_0235533 | |||
| 1605 | Ga0496102_0068164 | |||
| 1606 | Ga0496102_0086924 | |||
| 1607 | Ga0496103_0015071 | |||
| 1608 | Ga0496104_0039654 | |||
| 1609 | Ga0496104_0170814 | |||
| 1610 | Ga0496104_0270348 | |||
| 1611 | Ga0496104_0425921 | |||
| 1612 | Ga0496105_0128949 | |||
| 1613 | Ga0496105_0690550 | |||
| 1614 | Ga0496105_1214631 | |||
| 1615 | Ga0496106_0001241 | |||
| 1616 | Ga0496106_0565544 | |||
| 1617 | Ga0496106_0740071 | |||
| 1618 | Ga0496107_0001617 | |||
| 1619 | Ga0496108_0000051 | |||
| 1620 | Ga0496108_0008626 | |||
| 1621 | Ga0496108_0217105 | |||
| 1622 | Ga0496109_0000105 | |||
| 1623 | Ga0496109_0029537 | |||
| 1624 | Ga0496109_0635252 | |||
| 1625 | Ga0496110_0005502 | |||
| 1626 | Ga0496110_0011215 | |||
| 1627 | Ga0496110_0044211 | |||
| 1628 | Ga0496111_0013479 | |||
| 1629 | Ga0496111_0071429 | |||
| 1630 | Ga0496111_0646520 | |||
| 1631 | Ga0496112_0000050 | |||
| 1632 | Ga0496112_0110662 | |||
| 1633 | Ga0496112_1183206 | |||
| 1634 | Ga0496113_0000254 | |||
| 1635 | Ga0496113_0008982 | |||
| 1636 | Ga0496113_0439909 | |||
| 1637 | Ga0496113_1121816 | |||
| 1638 | Ga0496114_0132713 | |||
| 1639 | Ga0496115_0005030 | |||
| 1640 | Ga0496115_0099941 | |||
| 1641 | Ga0496115_0186149 | |||
| 1642 | Ga0501033_0009319 | |||
| 1643 | Ga0501034_1308394 | |||
| 1644 | Ga0501042_0603010 | |||
| 1645 | Ga0501043_0013705 | |||
| 1646 | Ga0501046_0022846 | |||
| 1647 | Ga0501046_0046383 | |||
| 1648 | Ga0501046_0398557 | |||
| 1649 | Ga0501047_0198932 | |||
| 1650 | Ga0501047_0285165 | |||
| 1651 | Ga0501048_0102747 | |||
| 1652 | Ga0501067_0426403 | |||
| 1653 | Ga0501069_0142529 | |||
| 1654 | Ga0501070_0000995 | |||
| 1655 | Ga0501072_0663937 | |||
| 1656 | Ga0501077_0319318 | |||
| 1657 | Ga0501217_208817 | |||
| 1658 | Ga0501081_0704645 | |||
| 1659 | Ga0501081_1459967 | |||
| 1660 | Ga0501044_0025059 | |||
| 1661 | nmdc:mga05p37_192735_c1 | |||
| 1662 | nmdc:mga05p37_292470_c1 | |||
| 1663 | nmdc:mga09592_1540765_c1 | |||
| 1664 | nmdc:mga09592_19125_c1 | |||
| 1665 | nmdc:mga09592_204089_c1 | |||
| 1666 | nmdc:mga0qj67_117338_c1 | |||
| 1667 | nmdc:mga0qj67_24967_c1 | |||
| 1668 | nmdc:mga0qj67_838742_c1 | |||
| 1669 | nmdc:mga06r32_1208592_c1 | |||
| 1670 | nmdc:mga06r32_1302000_c1 | |||
| 1671 | nmdc:mga0n895_15409_c1 | |||
| 1672 | nmdc:mga0n895_28241_c1 | |||
| 1673 | nmdc:mga0n895_417048_c1 | |||
| 1674 | nmdc:mga0n895_552382_c1 | |||
| 1675 | nmdc:mga0rr50_1125456_c1 | |||
| 1676 | nmdc:mga0rr50_245060_c1 | |||
| 1677 | nmdc:mga0rr50_385933_c1 | |||
| 1678 | nmdc:mga0rr50_9396_c1 | |||
| 1679 | nmdc:mga08x19_164997_c1 | |||
| 1680 | nmdc:mga0a205_208993_c1 | |||
| 1681 | nmdc:mga0a205_566116_c1 | |||
| 1682 | Ga0495601_0066674 | |||
| 1683 | Ga0495601_0656017 | |||
| 1684 | Ga0495612_0253462 | |||
| 1685 | Ga0495612_0330393 | |||
| 1686 | Ga0587066_125981 | |||
| 1687 | Ga0587073_0234969 | |||
| 1688 | Ga0587077_216976 | |||
| 1689 | Ga0587083_0034269 | |||
| 1690 | Ga0587088_149199 | |||
| 1691 | Ga0587128_109954 | |||
| 1692 | Ga0501082_0614639 | |||
| 1693 | Ga0501082_0746184 | |||
| 1694 | Ga0530510_0035856 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7t-assembly1.cif.gz_A | crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis | 0.9782 | 2 | 127 |
| 3i7t-assembly1.cif.gz_A | crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis | 0.9701 | 2 | 127 |
| 2dyy-assembly4.cif.gz_K | crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii | 0.952 | 18 | 128 |
| 5hp7-assembly1.cif.gz_A | crystal structures of rida in the apo form | 0.9501 | 19 | 127 |
| 6izh-assembly1.cif.gz_E | crystal structure of deaminase amne from pseudomonas sp. ap-3 | 0.9483 | 20 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i7tA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9782 | 2 | 127 | 3.30.1330.40 |
| 3i7tA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9701 | 2 | 127 | 3.30.1330.40 |
| af_Q86I26_20_139_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9582 | 18 | 126 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9468 | 19 | 127 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9384 | 19 | 127 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845U4Z4-F1-model_v4 | RidA family protein | 0.9974 | 1 | 128 |
|
| AF-A0A2V9MLY6-F1-model_v4 | RidA family protein | 0.9972 | 1 | 129 |
|
| AF-A0A7V9JWY7-F1-model_v4 | RidA family protein | 0.9972 | 19 | 127 |
|
| AF-T0ZC75-F1-model_v4 | Endoribonuclease L-PSP | 0.9971 | 29 | 130 |
|
| AF-A0A2V8GT55-F1-model_v4 | RidA family protein | 0.9968 | 2 | 129 |
|