F483304

General Info

Members Datasets Scaffolds Average Seq Length
846 307 1692 137

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0313343|Ga0495586_0313343_200_670
Length 156
Sequence MVGPQEGDRLPQIDHEVTEMDEPLNLVLFSGTDDKLQAAAVLTAGAAALGKPVNIFLQYWALDAFRADRIATDHGLAPEAGPAGRAAVDALAAAGQAPWSDTLRQAKELGGVDIEACSLSMDLLHLDQADLDPLVDGIEGVTAFYLAAGAGQVVFI

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
203 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
204 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
207 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.92
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 27.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0313343 3300046535 Unclassified 900
2 JGI24751J29686_10040609 3300002459 Bacteria 963
3 JGI26129J50193_1000841 3300003349 Bacteria 1997
4 Ga0065715_10192854 3300005293 Unclassified 1405
5 Ga0070683_100141862 3300005329 Bacteria 2276
6 Ga0070683_100308656 3300005329 Bacteria 1505
7 Ga0070683_100348399 3300005329 Bacteria 1410
8 Ga0070683_100492560 3300005329 Bacteria 1171
9 Ga0070690_100588471 3300005330 Unclassified 843
10 Ga0070670_101471874 3300005331 Unclassified 625
11 Ga0068869_100375491 3300005334 Bacteria 1164
12 Ga0068869_100419639 3300005334 Unclassified 1104
13 Ga0070666_10181643 3300005335 Archaea 1476
14 Ga0070680_100563290 3300005336 Unclassified 977
15 Ga0070682_100145823 3300005337 Bacteria 1619
16 Ga0068868_100421540 3300005338 Archaea 1156
17 Ga0068868_100571289 3300005338 Bacteria 999
18 Ga0068868_100931016 3300005338 Bacteria 791
19 Ga0068868_101173001 3300005338 Bacteria 709
20 Ga0070660_100623906 3300005339 Unclassified 902
21 Ga0070689_102195008 3300005340 Bacteria 506
22 Ga0070687_100713026 3300005343 Bacteria 702
23 Ga0070687_101348675 3300005343 Unclassified 531
24 Ga0070661_101586125 3300005344 Unclassified 553
25 Ga0070692_10076684 3300005345 Unclassified 1792
26 Ga0070692_10883176 3300005345 Unclassified 617
27 Ga0070668_101079220 3300005347 Unclassified 724
28 Ga0070669_100601685 3300005353 Unclassified 921
29 Ga0070675_100395920 3300005354 Unclassified 1231
30 Ga0070674_100040870 3300005356 Bacteria 3139
31 Ga0070674_100102902 3300005356 Bacteria 2084
32 Ga0070674_100110206 3300005356 Archaea 2020
33 Ga0070688_100644933 3300005365 Bacteria 815
34 Ga0070688_101520373 3300005365 Unclassified 545
35 Ga0070659_100822732 3300005366 Unclassified 809
36 Ga0070667_100140020 3300005367 Bacteria 2118
37 Ga0070703_10113273 3300005406 Unclassified 973
38 Ga0070714_100024950 3300005435 Bacteria 4930
39 Ga0070714_100287512 3300005435 Bacteria 1529
40 Ga0070701_10767800 3300005438 Unclassified 654
41 Ga0070705_100278846 3300005440 Unclassified 1187
42 Ga0070705_101279677 3300005440 Unclassified 607
43 Ga0070694_100001806 3300005444 Bacteria 12673
44 Ga0070694_100249381 3300005444 Unclassified 1342
45 Ga0070694_100545666 3300005444 Bacteria 928
46 Ga0070694_100631096 3300005444 Unclassified 866
47 Ga0070708_100008964 3300005445 Bacteria 8060
48 Ga0070708_100014992 3300005445 Bacteria 6391
49 Ga0070708_100079211 3300005445 Bacteria 2972
50 Ga0070708_100400820 3300005445 Bacteria 1294
51 Ga0070681_10091928 3300005458 Bacteria 2984
52 Ga0068867_100087308 3300005459 Archaea 2361
53 Ga0070685_10143969 3300005466 Bacteria 1504
54 Ga0070706_100071595 3300005467 Bacteria 3207
55 Ga0070706_100127231 3300005467 Bacteria 2376
56 Ga0070707_100046795 3300005468 Unclassified 4140
57 Ga0070698_100038976 3300005471 Bacteria 4895
58 Ga0070698_100212429 3300005471 Unclassified 1869
59 Ga0070698_100926857 3300005471 Bacteria 817
60 Ga0070684_100017931 3300005535 Bacteria 5820
61 Ga0070684_100303282 3300005535 Bacteria 1466
62 Ga0070684_100477814 3300005535 Bacteria 1153
63 Ga0070697_100343617 3300005536 Bacteria 1288
64 Ga0068853_100501264 3300005539 Unclassified 1146
65 Ga0070672_100386463 3300005543 Unclassified 1198
66 Ga0070686_100010945 3300005544 Bacteria 5135
67 Ga0070686_100108291 3300005544 Bacteria 1888
68 Ga0070696_100500915 3300005546 Bacteria 966
69 Ga0070696_100738357 3300005546 Bacteria 805
70 Ga0070693_100229336 3300005547 Archaea 1221
71 Ga0070693_100243080 3300005547 Unclassified 1190
72 Ga0070665_101820598 3300005548 Unclassified 615
73 Ga0070704_100151703 3300005549 Unclassified 1822
74 Ga0070704_101119232 3300005549 Bacteria 716
75 Ga0070664_100073153 3300005564 Bacteria 2940
76 Ga0070664_100704851 3300005564 Archaea 941
77 Ga0070664_100875005 3300005564 Bacteria 842
78 Ga0070664_101014800 3300005564 Bacteria 780
79 Ga0068857_100062594 3300005577 Bacteria 3308
80 Ga0068857_100171149 3300005577 Bacteria 1974
81 Ga0068857_100407967 3300005577 Unclassified 1265
82 Ga0068857_100530487 3300005577 Bacteria 1107
83 Ga0068857_102490012 3300005577 Bacteria 508
84 Ga0068854_100396563 3300005578 Archaea 1141
85 Ga0068856_100241135 3300005614 Bacteria 1823
86 Ga0068856_102203087 3300005614 Bacteria 560
87 Ga0068856_102383627 3300005614 Bacteria 537
88 Ga0070702_100033848 3300005615 Archaea 2812
89 Ga0070702_100947223 3300005615 Bacteria 678
90 Ga0068859_100564913 3300005617 Bacteria 1232
91 Ga0068864_100035416 3300005618 Bacteria 4249
92 Ga0068864_100200705 3300005618 Unclassified 1832
93 Ga0068864_100367286 3300005618 Bacteria 1361
94 Ga0068864_100453016 3300005618 Unclassified 1227
95 Ga0068864_101289404 3300005618 Unclassified 731
96 Ga0068861_100894666 3300005719 Archaea 840
97 Ga0068870_10189070 3300005840 Unclassified 1241
98 Ga0068863_100156394 3300005841 Bacteria 2183
99 Ga0068863_100876426 3300005841 Archaea 897
100 Ga0068863_101218035 3300005841 Bacteria 759
101 Ga0068858_100774222 3300005842 Unclassified 936
102 Ga0068858_101152220 3300005842 Bacteria 762
103 Ga0068860_100355640 3300005843 Unclassified 1442
104 Ga0068862_100218939 3300005844 Bacteria 1723
105 Ga0068862_101157677 3300005844 Unclassified 770
106 Ga0081455_10194303 3300005937 Bacteria 1525
107 Ga0070717_10004633 3300006028 Bacteria 9966
108 Ga0097621_100893756 3300006237 Bacteria 827
109 Ga0075428_100001182 3300006844 Bacteria 27941
110 Ga0075431_100396446 3300006847 Unclassified 1382
111 Ga0075433_10051692 3300006852 Bacteria 3579
112 Ga0075434_100086236 3300006871 Bacteria 3140
113 Ga0097620_100564869 3300006931 Bacteria 1232
114 Ga0075435_100032533 3300007076 Unclassified 4120
115 Ga0075435_100263803 3300007076 Archaea 1468
116 Ga0105251_10541692 3300009011 Unclassified 547
117 Ga0105240_12374229 3300009093 Unclassified 549
118 Ga0111539_10015824 3300009094 Bacteria 9369
119 Ga0105245_10115070 3300009098 Bacteria 2506
120 Ga0105245_10215866 3300009098 Bacteria 1848
121 Ga0105245_10230624 3300009098 Archaea 1790
122 Ga0105245_10359110 3300009098 Bacteria 1445
123 Ga0105247_10073191 3300009101 Bacteria 2147
124 Ga0114129_10000286 3300009147 Bacteria 58249
125 Ga0114129_11434423 3300009147 Bacteria 851
126 Ga0105243_10016596 3300009148 Bacteria 5568
127 Ga0105243_10022853 3300009148 Archaea 4754
128 Ga0105243_10136985 3300009148 Bacteria 2084
129 Ga0105241_10588348 3300009174 Unclassified 1004
130 Ga0105242_10056453 3300009176 Archaea 3213
131 Ga0105248_11283381 3300009177 Unclassified 828
132 Ga0105249_10026689 3300009553 Bacteria 5207
133 Ga0105249_10387907 3300009553 Archaea 1424
134 Ga0105249_10554939 3300009553 Bacteria 1200
135 Ga0105249_12001442 3300009553 Bacteria 652
136 Ga0105246_10025408 3300011119 Bacteria 3860
137 Ga0105246_10166331 3300011119 Unclassified 1685
138 Ga0105246_11321905 3300011119 Unclassified 669
139 Ga0157373_10416866 3300013100 Bacteria 964
140 Ga0157374_10203916 3300013296 Unclassified 1937
141 Ga0157374_10612452 3300013296 Bacteria 1099
142 Ga0157378_10021069 3300013297 Bacteria 5735
143 Ga0157378_10082199 3300013297 Bacteria 2912
144 Ga0157378_10831700 3300013297 Unclassified 951
145 Ga0163162_10145513 3300013306 Unclassified 2486
146 Ga0163162_10638955 3300013306 Bacteria 1188
147 Ga0157375_10015545 3300013308 Bacteria 6816
148 Ga0157375_10024796 3300013308 Bacteria 5558
149 Ga0157375_10161444 3300013308 Bacteria 2383
150 Ga0157375_10175692 3300013308 Bacteria 2291
151 Ga0163163_10017578 3300014325 Bacteria 6673
152 Ga0163163_10063661 3300014325 Bacteria 3658
153 Ga0163163_10070836 3300014325 Unclassified 3473
154 Ga0163163_10272713 3300014325 Bacteria 1743
155 Ga0163163_10471319 3300014325 Bacteria 1316
156 Ga0163163_10504774 3300014325 Bacteria 1271
157 Ga0163163_11197557 3300014325 Unclassified 822
158 Ga0163163_11718142 3300014325 Unclassified 688
159 Ga0163163_11783793 3300014325 Bacteria 676
160 Ga0163163_11926580 3300014325 Bacteria 651
161 Ga0163163_12067347 3300014325 Bacteria 629
162 Ga0157380_10151235 3300014326 Bacteria 2007
163 Ga0157380_10526006 3300014326 Bacteria 1155
164 Ga0157380_11082832 3300014326 Unclassified 840
165 Ga0157380_11125808 3300014326 Bacteria 825
166 Ga0157380_12660307 3300014326 Bacteria 567
167 Ga0157377_10068554 3300014745 Unclassified 2044
168 Ga0157377_10106218 3300014745 Unclassified 1681
169 Ga0157377_10365524 3300014745 Unclassified 972
170 Ga0157379_10027724 3300014968 Bacteria 5042
171 Ga0157379_10170160 3300014968 Bacteria 1967
172 Ga0157379_10398118 3300014968 Unclassified 1265
173 Ga0157379_10494831 3300014968 Bacteria 1133
174 Ga0157379_10731651 3300014968 Bacteria 930
175 Ga0157376_10252941 3300014969 Bacteria 1646
176 Ga0157376_10998946 3300014969 Unclassified 859
177 Ga0163161_10010120 3300017792 Bacteria 6526
178 Ga0163161_11930362 3300017792 Bacteria 525
179 Ga0207653_10104235 3300025885 Bacteria 1006
180 Ga0207710_10037066 3300025900 Bacteria 2152
181 Ga0207643_10176499 3300025908 Unclassified 1291
182 Ga0207684_10065853 3300025910 Bacteria 3077
183 Ga0207654_10786187 3300025911 Bacteria 687
184 Ga0207662_10661109 3300025918 Bacteria 730
185 Ga0207646_10013021 3300025922 Bacteria 7967
186 Ga0207646_10759913 3300025922 Bacteria 865
187 Ga0207681_10578704 3300025923 Unclassified 926
188 Ga0207694_10345775 3300025924 Unclassified 1230
189 Ga0207650_10334973 3300025925 Bacteria 1242
190 Ga0207659_10172156 3300025926 Unclassified 1709
191 Ga0207659_10434881 3300025926 Bacteria 1103
192 Ga0207659_10718895 3300025926 Bacteria 856
193 Ga0207687_10302259 3300025927 Unclassified 1289
194 Ga0207687_10412281 3300025927 Bacteria 1113
195 Ga0207687_10515387 3300025927 Bacteria 1000
196 Ga0207687_10626495 3300025927 Bacteria 908
197 Ga0207687_10676073 3300025927 Bacteria 875
198 Ga0207644_11766155 3300025931 Bacteria 518
199 Ga0207706_10861678 3300025933 Bacteria 767
200 Ga0207686_10096360 3300025934 Bacteria 1966
201 Ga0207709_10164561 3300025935 Bacteria 1550
202 Ga0207670_10707128 3300025936 Unclassified 834
203 Ga0207669_10063804 3300025937 Archaea 2276
204 Ga0207669_10068893 3300025937 Bacteria 2212
205 Ga0207691_10270243 3300025940 Archaea 1464
206 Ga0207691_10347905 3300025940 Unclassified 1268
207 Ga0207711_11100984 3300025941 Unclassified 735
208 Ga0207689_10258350 3300025942 Bacteria 1441
209 Ga0207661_10162152 3300025944 Unclassified 1941
210 Ga0207661_10287517 3300025944 Unclassified 1471
211 Ga0207661_10378361 3300025944 Bacteria 1281
212 Ga0207679_10031564 3300025945 Bacteria 3709
213 Ga0207679_10042742 3300025945 Bacteria 3259
214 Ga0207679_10765119 3300025945 Bacteria 879
215 Ga0207679_10827771 3300025945 Unclassified 845
216 Ga0207667_10324604 3300025949 Unclassified 1572
217 Ga0207651_11342222 3300025960 Unclassified 643
218 Ga0207712_10118924 3300025961 Unclassified 1996
219 Ga0207712_10959877 3300025961 Bacteria 757
220 Ga0207668_10380030 3300025972 Bacteria 1189
221 Ga0207640_10110141 3300025981 Bacteria 1950
222 Ga0207658_10645432 3300025986 Bacteria 954
223 Ga0207677_10345102 3300026023 Bacteria 1245
224 Ga0207703_10235490 3300026035 Bacteria 1643
225 Ga0207703_11353516 3300026035 Bacteria 685
226 Ga0207639_10445461 3300026041 Unclassified 1175
227 Ga0207678_10634726 3300026067 Unclassified 938
228 Ga0207708_10105314 3300026075 Unclassified 2186
229 Ga0207708_10410503 3300026075 Bacteria 1121
230 Ga0207708_11423877 3300026075 Bacteria 608
231 Ga0207702_11364241 3300026078 Bacteria 703
232 Ga0207641_10106456 3300026088 Bacteria 2479
233 Ga0207641_10114125 3300026088 Unclassified 2400
234 Ga0207641_10474697 3300026088 Unclassified 1212
235 Ga0207648_10016610 3300026089 Bacteria 6719
236 Ga0207648_10398406 3300026089 Bacteria 1247
237 Ga0207648_10884702 3300026089 Bacteria 834
238 Ga0207648_10886035 3300026089 Bacteria 833
239 Ga0207676_10120228 3300026095 Bacteria 2214
240 Ga0207676_10148981 3300026095 Bacteria 2013
241 Ga0207676_10568828 3300026095 Bacteria 1085
242 Ga0207676_10857546 3300026095 Unclassified 889
243 Ga0207676_10978950 3300026095 Unclassified 833
244 Ga0207674_10862862 3300026116 Bacteria 873
245 Ga0207674_10890979 3300026116 Bacteria 858
246 Ga0207674_10909778 3300026116 Bacteria 848
247 Ga0207674_11007848 3300026116 Bacteria 802
248 Ga0207675_100397601 3300026118 Unclassified 1357
249 Ga0207675_101533784 3300026118 Unclassified 687
250 Ga0207683_10991224 3300026121 Bacteria 780
251 Ga0207698_10213543 3300026142 Unclassified 1738
252 Ga0209973_1007531 3300027252 Bacteria 1219
253 Ga0209968_1003052 3300027526 Unclassified 2513
254 Ga0209999_1020279 3300027543 Bacteria 1221
255 Ga0209999_1093959 3300027543 Unclassified 582
256 Ga0209982_1050392 3300027552 Bacteria 671
257 Ga0209970_1021101 3300027614 Bacteria 1102
258 Ga0209970_1047325 3300027614 Unclassified 773
259 Ga0209983_1014764 3300027665 Bacteria 1610
260 Ga0209983_1044483 3300027665 Bacteria 965
261 Ga0209971_1002642 3300027682 Bacteria 4291
262 Ga0209971_1009644 3300027682 Bacteria 2287
263 Ga0209966_1001464 3300027695 Bacteria 4094
264 Ga0209966_1006311 3300027695 Bacteria 2056
265 Ga0209998_10000084 3300027717 Bacteria 36963
266 Ga0209998_10007931 3300027717 Bacteria 2203
267 Ga0209998_10020145 3300027717 Bacteria 1426
268 Ga0209974_10000371 3300027876 Bacteria 14833
269 Ga0209974_10001443 3300027876 Bacteria 8618
270 Ga0209974_10115029 3300027876 Unclassified 949
271 Ga0207428_10070341 3300027907 Bacteria 2750
272 Ga0268266_12184994 3300028379 Bacteria 526
273 Ga0268265_10339299 3300028380 Bacteria 1368
274 Ga0268265_11192121 3300028380 Archaea 759
275 Ga0268264_10032460 3300028381 Bacteria 4284
276 Ga0268264_12110149 3300028381 Bacteria 572
277 Ga0265337_1024169 3300028556 Bacteria 1862
278 Ga0265326_10024283 3300028558 Unclassified 1730
279 Ga0265326_10120116 3300028558 Bacteria 747
280 Ga0265319_1001557 3300028563 Bacteria 13503
281 Ga0265319_1019322 3300028563 Bacteria 2545
282 Ga0265319_1030383 3300028563 Bacteria 1890
283 Ga0265319_1041743 3300028563 Unclassified 1546
284 Ga0265334_10009016 3300028573 Bacteria 4230
285 Ga0265334_10031842 3300028573 Bacteria 2106
286 Ga0265334_10063716 3300028573 Unclassified 1385
287 Ga0265318_10003654 3300028577 Bacteria 7680
288 Ga0265318_10011724 3300028577 Bacteria 3759
289 Ga0265318_10034376 3300028577 Bacteria 1954
290 Ga0265318_10038682 3300028577 Unclassified 1822
291 Ga0265318_10059555 3300028577 Bacteria 1424
292 Ga0265318_10097274 3300028577 Bacteria 1083
293 Ga0265323_10024956 3300028653 Bacteria 2269
294 Ga0265322_10009410 3300028654 Bacteria 2837
295 Ga0265322_10022289 3300028654 Bacteria 1812
296 Ga0265336_10038511 3300028666 Unclassified 1467
297 Ga0265336_10183432 3300028666 Bacteria 622
298 Ga0265338_10106050 3300028800 Bacteria 2276
299 Ga0265338_10109029 3300028800 Bacteria 2235
300 Ga0265338_10326628 3300028800 Unclassified 1109
301 Ga0265324_10026902 3300029957 Bacteria 2034
302 Ga0265330_10073611 3300031235 Unclassified 1477
303 Ga0265330_10169071 3300031235 Unclassified 927
304 Ga0265332_10009447 3300031238 Bacteria 4354
305 Ga0265332_10041194 3300031238 Unclassified 1999
306 Ga0265332_10123355 3300031238 Bacteria 1088
307 Ga0265320_10006513 3300031240 Bacteria 7357
308 Ga0265320_10016150 3300031240 Bacteria 4194
309 Ga0265320_10020855 3300031240 Bacteria 3540
310 Ga0265320_10346483 3300031240 Unclassified 656
311 Ga0265325_10029964 3300031241 Bacteria 2921
312 Ga0265325_10081729 3300031241 Bacteria 1605
313 Ga0265325_10108496 3300031241 Bacteria 1352
314 Ga0265325_10113822 3300031241 Unclassified 1312
315 Ga0265329_10002514 3300031242 Bacteria 8278
316 Ga0265329_10005869 3300031242 Bacteria 4922
317 Ga0265329_10145894 3300031242 Unclassified 765
318 Ga0265340_10011524 3300031247 Bacteria 4697
319 Ga0265340_10013761 3300031247 Bacteria 4243
320 Ga0265339_10055404 3300031249 Bacteria 2151
321 Ga0265339_10147196 3300031249 Unclassified 1194
322 Ga0265339_10184469 3300031249 Unclassified 1037
323 Ga0265331_10023966 3300031250 Bacteria 3093
324 Ga0265331_10024165 3300031250 Bacteria 3078
325 Ga0265331_10143826 3300031250 Bacteria 1084
326 Ga0265316_10059121 3300031344 Bacteria 2982
327 Ga0265316_10069516 3300031344 Bacteria 2717
328 Ga0265316_10082574 3300031344 Bacteria 2462
329 Ga0265316_10137681 3300031344 Bacteria 1836
330 Ga0265316_10922924 3300031344 Unclassified 609
331 Ga0265314_10004439 3300031711 Bacteria 13024
332 Ga0265314_10020911 3300031711 Bacteria 5044
333 Ga0265314_10021387 3300031711 Bacteria 4974
334 Ga0265314_10320668 3300031711 Bacteria 862
335 Ga0265314_10494982 3300031711 Unclassified 644
336 Ga0265342_10028561 3300031712 Bacteria 3473
337 Ga0265342_10036239 3300031712 Bacteria 3015
338 Ga0265342_10046397 3300031712 Bacteria 2612
339 Ga0316576_10040749 3300031727 Bacteria 3339
340 Ga0316576_10149259 3300031727 Unclassified 1762
341 Ga0316578_10330238 3300031728 Bacteria 909
342 Ga0307405_10317922 3300031731 Unclassified 1188
343 Ga0316577_10006636 3300031733 Bacteria 6127
344 Ga0307413_10720004 3300031824 Bacteria 831
345 Ga0307406_10098808 3300031901 Unclassified 1983
346 Ga0307409_100590203 3300031995 Bacteria 1096
347 Ga0307409_100595061 3300031995 Bacteria 1092
348 Ga0307409_102379386 3300031995 Bacteria 559
349 Ga0307416_100009750 3300032002 Bacteria 6309
350 Ga0307416_100318507 3300032002 Bacteria 1556
351 Ga0307416_100666218 3300032002 Bacteria 1127
352 Ga0307414_10439129 3300032004 Bacteria 1142
353 Ga0307411_10116737 3300032005 Bacteria 1922
354 Ga0307411_10350905 3300032005 Bacteria 1203
355 Ga0307411_11533639 3300032005 Unclassified 613
356 Ga0307411_11816633 3300032005 Bacteria 566
357 Ga0307415_100049572 3300032126 Unclassified 2840
358 Ga0307415_100271254 3300032126 Bacteria 1390
359 Ga0316592_1003672 3300033524 Bacteria 2789
360 Ga0316586_1005815 3300033527 Unclassified 1750
361 Ga0316596_1016396 3300033541 Bacteria 1856
362 Ga0373932_0210354 3300035112 Unclassified 695
363 Ga0373939_0066274 3300035114 Bacteria 1164
364 Ga0373941_0051767 3300035115 Bacteria 1308
365 Ga0373960_0141878 3300035121 Archaea 814
366 Ga0373943_0049010 3300035170 Bacteria 2072
367 Ga0373943_0220913 3300035170 Unclassified 1055
368 Ga0373946_0370830 3300035171 Unclassified 719
369 Ga0373942_0014346 3300035207 Bacteria 1917
370 Ga0373961_0243217 3300035241 Unclassified 649
371 Ga0373962_0101374 3300035242 Unclassified 898
372 Ga0316574_0102454 3300035398 Bacteria 1832
373 Ga0316574_0182863 3300035398 Bacteria 1348
374 Ga0373931_0376764 3300035691 Bacteria 894
375 Ga0373935_1212834 3300035692 Unclassified 563
376 Ga0373933_0493891 3300035724 Unclassified 802
377 Ga0373937_0233145 3300036401 Bacteria 1734
378 Ga0373937_0586927 3300036401 Bacteria 1058
379 Ga0373937_1140598 3300036401 Bacteria 728
380 Ga0373937_1676381 3300036401 Unclassified 583
381 Ga0316582_0223627 3300036647 Bacteria 1287
382 Ga0316584_0018846 3300036712 Bacteria 4983
383 Ga0316584_0283478 3300036712 Bacteria 1203
384 Ga0373925_0346087 3300037068 Bacteria 1206
385 Ga0373925_0352089 3300037068 Unclassified 1196
386 Ga0373925_0700942 3300037068 Unclassified 835
387 Ga0316581_0020617 3300037588 Unclassified 1931
388 Ga0439461_0173613 3300041410 Unclassified 568
389 Ga0439466_0087280 3300041411 Unclassified 980
390 Ga0451789_1090341 3300041443 Unclassified 516
391 Ga0451835_0118627 3300041492 Unclassified 726
392 Ga0451855_1635569 3300041511 Unclassified 749
393 Ga0451853_0255912 3300041512 Unclassified 904
394 Ga0451853_2822633 3300041512 Bacteria 751
395 Ga0451853_3051530 3300041512 Unclassified 716
396 Ga0450919_004132 3300042121 Bacteria 1784
397 Ga0450920_011506 3300042122 Bacteria 1650
398 Ga0450923_000093 3300042125 Bacteria 7389
399 Ga0450923_056685 3300042125 Unclassified 849
400 Ga0450910_004880 3300042147 Bacteria 1821
401 Ga0450910_011009 3300042147 Bacteria 1294
402 Ga0439446_0095508 3300042156 Bacteria 935
403 Ga0439446_0320546 3300042156 Bacteria 547
404 Ga0450908_014990 3300042184 Bacteria 1389
405 Ga0439434_0114170 3300042435 Unclassified 877
406 Ga0439435_0010981 3300042436 Bacteria 2164
407 Ga0439459_0249662 3300042438 Unclassified 501
408 Ga0439460_0028510 3300042461 Bacteria 1576
409 Ga0450918_023111 3300042531 Bacteria 1087
410 Ga0451577_0014643 3300042876 Bacteria 7308
411 Ga0451577_0183675 3300042876 Bacteria 1886
412 Ga0451577_0409888 3300042876 Unclassified 1230
413 Ga0453684_0222250 3300044712 Bacteria 2187
414 Ga0453684_0480172 3300044712 Bacteria 1379
415 Ga0453684_1336077 3300044712 Bacteria 746
416 Ga0453684_2217502 3300044712 Unclassified 548
417 Ga0451576_0071187 3300045051 Bacteria 3619
418 Ga0451576_0208009 3300045051 Bacteria 2043
419 Ga0451576_0734492 3300045051 Bacteria 1037
420 Ga0451576_1407890 3300045051 Bacteria 725
421 Ga0451576_1422171 3300045051 Unclassified 721
422 Ga0451576_2347098 3300045051 Bacteria 546
423 Ga0495592_0157104 3300046454 Bacteria 1568
424 Ga0495603_0158973 3300046455 Bacteria 1311
425 Ga0495603_0462236 3300046455 Bacteria 727
426 Ga0495629_0253312 3300046459 Bacteria 1211
427 Ga0495629_0553687 3300046459 Bacteria 772
428 Ga0495651_0047581 3300046462 Bacteria 3315
429 Ga0495653_0205626 3300046463 Bacteria 1333
430 Ga0495653_0519798 3300046463 Bacteria 740
431 Ga0495653_0537853 3300046463 Bacteria 724
432 Ga0495582_0264676 3300046473 Unclassified 986
433 Ga0495662_0296940 3300046476 Unclassified 795
434 Ga0495664_0797029 3300046477 Bacteria 555
435 Ga0495608_0187236 3300046511 Bacteria 1308
436 Ga0495608_0388542 3300046511 Bacteria 855
437 Ga0495630_0216879 3300046517 Bacteria 1461
438 Ga0495630_0354393 3300046517 Bacteria 1123
439 Ga0495630_0379490 3300046517 Bacteria 1083
440 Ga0495586_0271352 3300046535 Unclassified 970
441 Ga0495587_0158057 3300046536 Bacteria 1291
442 Ga0495667_0034977 3300046559 Bacteria 3359
443 Ga0495656_0034059 3300046615 Unclassified 2083
444 Ga0495634_0042696 3300046642 Bacteria 3075
445 Ga0495635_0245516 3300046663 Bacteria 1208
446 Ga0495661_0467899 3300046665 Unclassified 605
447 Ga0495657_0210428 3300046675 Bacteria 1182
448 Ga0495646_0422756 3300046680 Bacteria 691
449 Ga0495658_0498755 3300046683 Bacteria 779
450 Ga0495613_0472958 3300046689 Bacteria 847
451 Ga0495624_0249396 3300046690 Bacteria 1074
452 Ga0495600_0097077 3300046809 Bacteria 1921
453 Ga0495581_0258140 3300047315 Unclassified 1019
454 Ga0495674_0159350 3300047319 Bacteria 1889
455 Ga0495674_0176547 3300047319 Bacteria 1780
456 Ga0495674_0554851 3300047319 Bacteria 914
457 Ga0495676_0184085 3300047321 Unclassified 1462
458 Ga0495680_0174420 3300047322 Bacteria 1555
459 Ga0495680_0498011 3300047322 Bacteria 827
460 Ga0495684_0044777 3300047471 Unclassified 3387
461 Ga0496100_0098275 3300048903 Bacteria 2012
462 Ga0496100_0489459 3300048903 Bacteria 947
463 Ga0496100_0541096 3300048903 Bacteria 900
464 Ga0496101_0029448 3300048904 Bacteria 3840
465 Ga0496101_0202892 3300048904 Archaea 1534
466 Ga0496101_0365800 3300048904 Bacteria 1134
467 Ga0496101_0855686 3300048904 Bacteria 716
468 Ga0496102_0329695 3300048905 Bacteria 1438
469 Ga0496102_0432322 3300048905 Bacteria 1236
470 Ga0496102_1189324 3300048905 Bacteria 682
471 Ga0496103_0271824 3300048906 Unclassified 1090
472 Ga0496104_0001663 3300048907 Bacteria 19213
473 Ga0496104_0003658 3300048907 Bacteria 13274
474 Ga0496104_0009378 3300048907 Bacteria 8705
475 Ga0496104_0019665 3300048907 Bacteria 6184
476 Ga0496104_0073010 3300048907 Bacteria 3264
477 Ga0496105_0005723 3300048908 Bacteria 9461
478 Ga0496105_0028741 3300048908 Bacteria 4549
479 Ga0496105_0050162 3300048908 Bacteria 3447
480 Ga0496105_0073139 3300048908 Bacteria 2832
481 Ga0496105_0216809 3300048908 Unclassified 1559
482 Ga0496105_0232199 3300048908 Bacteria 1499
483 Ga0496106_0077675 3300048909 Bacteria 2546
484 Ga0496106_0190833 3300048909 Bacteria 1629
485 Ga0496106_0686940 3300048909 Unclassified 816
486 Ga0496107_0107759 3300048910 Bacteria 2046
487 Ga0496107_0167919 3300048910 Bacteria 1627
488 Ga0496108_0001483 3300048911 Bacteria 18537
489 Ga0496108_0014798 3300048911 Bacteria 6367
490 Ga0496108_0028472 3300048911 Bacteria 4623
491 Ga0496108_0261472 3300048911 Bacteria 1506
492 Ga0496108_0357047 3300048911 Bacteria 1275
493 Ga0496108_0571208 3300048911 Unclassified 986
494 Ga0496108_0749151 3300048911 Bacteria 845
495 Ga0496108_1056924 3300048911 Unclassified 691
496 Ga0496108_1113143 3300048911 Bacteria 671
497 Ga0496109_0008709 3300048912 Bacteria 8638
498 Ga0496109_0015894 3300048912 Bacteria 6572
499 Ga0496109_0024552 3300048912 Bacteria 5360
500 Ga0496109_0081519 3300048912 Bacteria 2981
501 Ga0496109_0859596 3300048912 Unclassified 845
502 Ga0496109_1044104 3300048912 Bacteria 754
503 Ga0496109_1200379 3300048912 Archaea 695
504 Ga0496109_1489886 3300048912 Unclassified 612
505 Ga0496110_0008234 3300048913 Bacteria 8380
506 Ga0496110_0035729 3300048913 Bacteria 4313
507 Ga0496110_0059254 3300048913 Bacteria 3374
508 Ga0496110_0247589 3300048913 Unclassified 1622
509 Ga0496110_0701255 3300048913 Unclassified 914
510 Ga0496110_1146986 3300048913 Unclassified 686
511 Ga0496110_1148740 3300048913 Bacteria 685
512 Ga0496111_0001853 3300048914 Bacteria 12475
513 Ga0496111_0029048 3300048914 Bacteria 3923
514 Ga0496111_0246479 3300048914 Bacteria 1326
515 Ga0496112_0000012 3300048915 Bacteria 243643
516 Ga0496112_0002831 3300048915 Bacteria 14082
517 Ga0496112_0056967 3300048915 Bacteria 3847
518 Ga0496112_0438119 3300048915 Bacteria 1245
519 Ga0496112_0824185 3300048915 Unclassified 852
520 Ga0496112_1285304 3300048915 Unclassified 647
521 Ga0496113_0010670 3300048916 Bacteria 6084
522 Ga0496113_0518859 3300048916 Unclassified 956
523 Ga0496113_1193465 3300048916 Unclassified 594
524 Ga0496114_0005293 3300048917 Bacteria 10082
525 Ga0496114_0400803 3300048917 Unclassified 1215
526 Ga0496114_0686996 3300048917 Bacteria 898
527 Ga0501321_020666 3300049537 Bacteria 816
528 Ga0501031_0002020 3300049568 Bacteria 12777
529 Ga0501031_0004346 3300049568 Bacteria 9166
530 Ga0501031_0016100 3300049568 Bacteria 4855
531 Ga0501031_0110220 3300049568 Bacteria 1797
532 Ga0501031_0126364 3300049568 Unclassified 1670
533 Ga0501031_0143647 3300049568 Bacteria 1559
534 Ga0501031_0246550 3300049568 Bacteria 1161
535 Ga0501031_0255523 3300049568 Bacteria 1139
536 Ga0501031_1036955 3300049568 Bacteria 524
537 Ga0501032_0043392 3300049569 Bacteria 3046
538 Ga0501032_0063225 3300049569 Bacteria 2478
539 Ga0501032_0275014 3300049569 Bacteria 1091
540 Ga0501032_0380513 3300049569 Bacteria 908
541 Ga0501032_0653003 3300049569 Bacteria 668
542 Ga0501033_0014111 3300049570 Bacteria 6075
543 Ga0501033_0051950 3300049570 Bacteria 3038
544 Ga0501034_0134418 3300049571 Bacteria 2455
545 Ga0501034_0327434 3300049571 Bacteria 1464
546 Ga0501036_0006726 3300049572 Bacteria 9345
547 Ga0501036_0075284 3300049572 Bacteria 2855
548 Ga0501036_0078835 3300049572 Bacteria 2786
549 Ga0501036_0104531 3300049572 Bacteria 2395
550 Ga0501036_0105183 3300049572 Bacteria 2387
551 Ga0501036_0114741 3300049572 Bacteria 2276
552 Ga0501036_0438386 3300049572 Bacteria 1089
553 Ga0501036_0507809 3300049572 Unclassified 1003
554 Ga0501036_0634678 3300049572 Bacteria 885
555 Ga0501036_0694006 3300049572 Unclassified 841
556 Ga0501036_0736211 3300049572 Unclassified 814
557 Ga0501037_0058493 3300049573 Bacteria 2813
558 Ga0501037_0099383 3300049573 Bacteria 2101
559 Ga0501037_0172987 3300049573 Bacteria 1534
560 Ga0501038_0010392 3300049574 Bacteria 8509
561 Ga0501038_0027225 3300049574 Bacteria 5089
562 Ga0501038_0131056 3300049574 Bacteria 2059
563 Ga0501038_0136775 3300049574 Archaea 2007
564 Ga0501038_0188586 3300049574 Unclassified 1660
565 Ga0501038_0198573 3300049574 Bacteria 1611
566 Ga0501038_0311373 3300049574 Unclassified 1234
567 Ga0501039_0022486 3300049575 Bacteria 4840
568 Ga0501039_0036539 3300049575 Bacteria 3791
569 Ga0501039_0044398 3300049575 Bacteria 3433
570 Ga0501039_0047952 3300049575 Bacteria 3302
571 Ga0501039_0070644 3300049575 Bacteria 2712
572 Ga0501039_0225364 3300049575 Bacteria 1473
573 Ga0501039_0370044 3300049575 Unclassified 1126
574 Ga0501039_0414518 3300049575 Unclassified 1058
575 Ga0501039_0429278 3300049575 Unclassified 1038
576 Ga0501039_0605570 3300049575 Unclassified 859
577 Ga0501040_0002881 3300049576 Bacteria 11118
578 Ga0501040_0036632 3300049576 Bacteria 3330
579 Ga0501040_0089487 3300049576 Bacteria 2139
580 Ga0501040_0095884 3300049576 Bacteria 2065
581 Ga0501040_0099144 3300049576 Bacteria 2031
582 Ga0501040_0103176 3300049576 Unclassified 1991
583 Ga0501040_0138401 3300049576 Bacteria 1714
584 Ga0501040_0208750 3300049576 Bacteria 1388
585 Ga0501040_0269063 3300049576 Bacteria 1217
586 Ga0501040_0274204 3300049576 Bacteria 1204
587 Ga0501040_0334382 3300049576 Unclassified 1084
588 Ga0501040_0436755 3300049576 Unclassified 942
589 Ga0501040_1013381 3300049576 Unclassified 602
590 Ga0501040_1076188 3300049576 Unclassified 583
591 Ga0501041_0008168 3300049577 Bacteria 6158
592 Ga0501041_0026991 3300049577 Bacteria 3458
593 Ga0501041_0031133 3300049577 Bacteria 3221
594 Ga0501041_0091033 3300049577 Unclassified 1883
595 Ga0501041_0105098 3300049577 Unclassified 1750
596 Ga0501041_0181489 3300049577 Bacteria 1318
597 Ga0501041_0185618 3300049577 Bacteria 1302
598 Ga0501041_0204738 3300049577 Bacteria 1237
599 Ga0501041_0371925 3300049577 Unclassified 904
600 Ga0501041_0377359 3300049577 Bacteria 897
601 Ga0501041_0642030 3300049577 Unclassified 678
602 Ga0501041_0672850 3300049577 Unclassified 662
603 Ga0501042_0013717 3300049578 Bacteria 5519
604 Ga0501042_0102726 3300049578 Bacteria 2056
605 Ga0501042_0105477 3300049578 Unclassified 2028
606 Ga0501042_0203556 3300049578 Bacteria 1427
607 Ga0501042_0241580 3300049578 Bacteria 1303
608 Ga0501042_0270521 3300049578 Bacteria 1227
609 Ga0501042_0405468 3300049578 Bacteria 988
610 Ga0501042_0555024 3300049578 Unclassified 835
611 Ga0501042_0906405 3300049578 Bacteria 642
612 Ga0501043_0026684 3300049579 Bacteria 4531
613 Ga0501043_0216005 3300049579 Bacteria 1485
614 Ga0501043_0516454 3300049579 Bacteria 891
615 Ga0501043_0623537 3300049579 Bacteria 794
616 Ga0501043_0777199 3300049579 Bacteria 694
617 Ga0501046_0013151 3300049580 Bacteria 7022
618 Ga0501046_0025797 3300049580 Bacteria 4805
619 Ga0501046_0116414 3300049580 Unclassified 2037
620 Ga0501046_0308455 3300049580 Bacteria 1154
621 Ga0501046_0493645 3300049580 Unclassified 877
622 Ga0501048_0011975 3300049582 Bacteria 6467
623 Ga0501048_0023689 3300049582 Bacteria 4484
624 Ga0501048_0043639 3300049582 Bacteria 3209
625 Ga0501048_0154679 3300049582 Archaea 1622
626 Ga0501048_0222402 3300049582 Bacteria 1339
627 Ga0501048_0252619 3300049582 Bacteria 1252
628 Ga0501048_0286080 3300049582 Bacteria 1172
629 Ga0501048_0749176 3300049582 Bacteria 702
630 Ga0501067_0002476 3300049583 Bacteria 10192
631 Ga0501067_0009644 3300049583 Bacteria 5344
632 Ga0501067_0320455 3300049583 Unclassified 863
633 Ga0501067_0551040 3300049583 Unclassified 646
634 Ga0501068_0003199 3300049584 Bacteria 8773
635 Ga0501068_0011244 3300049584 Bacteria 5048
636 Ga0501068_0014796 3300049584 Bacteria 4465
637 Ga0501068_0106716 3300049584 Unclassified 1739
638 Ga0501068_0114740 3300049584 Bacteria 1677
639 Ga0501068_0182296 3300049584 Unclassified 1328
640 Ga0501068_0238324 3300049584 Bacteria 1157
641 Ga0501068_0307167 3300049584 Bacteria 1016
642 Ga0501069_0002734 3300049585 Bacteria 9005
643 Ga0501069_0003134 3300049585 Bacteria 8475
644 Ga0501069_0013735 3300049585 Bacteria 4320
645 Ga0501069_0015264 3300049585 Bacteria 4116
646 Ga0501069_0277094 3300049585 Bacteria 981
647 Ga0501069_0301759 3300049585 Bacteria 939
648 Ga0501069_0357993 3300049585 Bacteria 861
649 Ga0501069_0542838 3300049585 Unclassified 695
650 Ga0501070_0004617 3300049586 Bacteria 11811
651 Ga0501070_0011535 3300049586 Bacteria 7459
652 Ga0501070_0084747 3300049586 Bacteria 2624
653 Ga0501070_0838144 3300049586 Bacteria 720
654 Ga0501070_0926354 3300049586 Unclassified 679
655 Ga0501071_0002112 3300049587 Bacteria 11925
656 Ga0501071_0018211 3300049587 Bacteria 4859
657 Ga0501071_0028286 3300049587 Bacteria 3950
658 Ga0501071_0032462 3300049587 Bacteria 3707
659 Ga0501071_0035600 3300049587 Bacteria 3546
660 Ga0501071_0051534 3300049587 Unclassified 2966
661 Ga0501071_0123989 3300049587 Unclassified 1916
662 Ga0501071_0131714 3300049587 Bacteria 1858
663 Ga0501071_0134703 3300049587 Bacteria 1837
664 Ga0501071_0277364 3300049587 Unclassified 1268
665 Ga0501071_0341715 3300049587 Unclassified 1138
666 Ga0501071_0512748 3300049587 Bacteria 920
667 Ga0501071_0697984 3300049587 Unclassified 781
668 Ga0501071_0702540 3300049587 Bacteria 779
669 Ga0501071_0818022 3300049587 Bacteria 718
670 Ga0501071_0922816 3300049587 Bacteria 674
671 Ga0501071_0996835 3300049587 Bacteria 647
672 Ga0501071_1036227 3300049587 Unclassified 634
673 Ga0501072_0008858 3300049588 Bacteria 7644
674 Ga0501072_0026253 3300049588 Bacteria 4540
675 Ga0501072_0034022 3300049588 Bacteria 3992
676 Ga0501072_0042649 3300049588 Unclassified 3564
677 Ga0501072_0052670 3300049588 Unclassified 3204
678 Ga0501072_0074297 3300049588 Bacteria 2688
679 Ga0501072_0254120 3300049588 Bacteria 1399
680 Ga0501072_0262692 3300049588 Bacteria 1374
681 Ga0501072_0279686 3300049588 Bacteria 1327
682 Ga0501072_0606878 3300049588 Bacteria 862
683 Ga0501072_0679647 3300049588 Unclassified 810
684 Ga0501072_0789068 3300049588 Bacteria 744
685 Ga0501072_1137154 3300049588 Bacteria 607
686 Ga0501073_0021050 3300049589 Bacteria 4705
687 Ga0501073_0141795 3300049589 Bacteria 1665
688 Ga0501073_0174971 3300049589 Bacteria 1485
689 Ga0501073_0285026 3300049589 Bacteria 1140
690 Ga0501073_1169687 3300049589 Bacteria 528
691 Ga0501074_0001666 3300049590 Bacteria 15114
692 Ga0501074_0003913 3300049590 Bacteria 10610
693 Ga0501074_0116907 3300049590 Unclassified 1908
694 Ga0501074_0123611 3300049590 Bacteria 1851
695 Ga0501074_0166706 3300049590 Bacteria 1573
696 Ga0501074_0168230 3300049590 Unclassified 1565
697 Ga0501074_0247227 3300049590 Unclassified 1268
698 Ga0501074_0524190 3300049590 Bacteria 839
699 Ga0501074_0535284 3300049590 Bacteria 829
700 Ga0501074_0775915 3300049590 Bacteria 676
701 Ga0501074_1256990 3300049590 Bacteria 519
702 Ga0501075_0001781 3300049591 Bacteria 14177
703 Ga0501075_0004911 3300049591 Bacteria 9115
704 Ga0501075_0010519 3300049591 Bacteria 6503
705 Ga0501075_0013739 3300049591 Bacteria 5786
706 Ga0501075_0080017 3300049591 Bacteria 2473
707 Ga0501075_0127031 3300049591 Bacteria 1942
708 Ga0501075_0194046 3300049591 Bacteria 1549
709 Ga0501075_0224506 3300049591 Unclassified 1433
710 Ga0501075_0229391 3300049591 Unclassified 1416
711 Ga0501075_0238548 3300049591 Bacteria 1386
712 Ga0501076_0006758 3300049592 Bacteria 8325
713 Ga0501076_0027428 3300049592 Bacteria 4417
714 Ga0501076_0050210 3300049592 Bacteria 3300
715 Ga0501076_0053557 3300049592 Bacteria 3198
716 Ga0501076_0084096 3300049592 Unclassified 2556
717 Ga0501076_0100029 3300049592 Unclassified 2336
718 Ga0501076_0136327 3300049592 Bacteria 1992
719 Ga0501076_0223139 3300049592 Unclassified 1540
720 Ga0501076_0239469 3300049592 Bacteria 1484
721 Ga0501076_0254549 3300049592 Bacteria 1437
722 Ga0501076_0392712 3300049592 Bacteria 1141
723 Ga0501076_0396065 3300049592 Bacteria 1135
724 Ga0501076_0844947 3300049592 Unclassified 755
725 Ga0501076_0992232 3300049592 Bacteria 692
726 Ga0501076_1107643 3300049592 Bacteria 652
727 Ga0501077_0006742 3300049593 Bacteria 7067
728 Ga0501077_0014205 3300049593 Bacteria 4999
729 Ga0501077_0053413 3300049593 Unclassified 2565
730 Ga0501077_0061890 3300049593 Bacteria 2375
731 Ga0501077_0118041 3300049593 Unclassified 1681
732 Ga0501077_0130597 3300049593 Bacteria 1593
733 Ga0501077_0241273 3300049593 Unclassified 1149
734 Ga0501077_0521521 3300049593 Unclassified 762
735 Ga0501077_0566573 3300049593 Bacteria 729
736 Ga0501079_0002556 3300049741 Bacteria 13215
737 Ga0501079_0021490 3300049741 Unclassified 4936
738 Ga0501079_0029782 3300049741 Bacteria 4192
739 Ga0501079_0049592 3300049741 Bacteria 3240
740 Ga0501079_0051247 3300049741 Bacteria 3187
741 Ga0501079_0084061 3300049741 Bacteria 2462
742 Ga0501079_0098396 3300049741 Bacteria 2268
743 Ga0501079_0188031 3300049741 Bacteria 1612
744 Ga0501079_0284024 3300049741 Unclassified 1294
745 Ga0501079_0347759 3300049741 Bacteria 1161
746 Ga0501079_1057428 3300049741 Unclassified 639
747 Ga0501079_1616659 3300049741 Bacteria 510
748 Ga0501080_0018972 3300049742 Bacteria 6370
749 Ga0501080_0049582 3300049742 Bacteria 3907
750 Ga0501080_0093725 3300049742 Unclassified 2788
751 Ga0501080_0147768 3300049742 Bacteria 2173
752 Ga0501080_0276948 3300049742 Bacteria 1526
753 Ga0501080_0322490 3300049742 Archaea 1398
754 Ga0501080_0700447 3300049742 Unclassified 893
755 Ga0501080_0743961 3300049742 Unclassified 863
756 Ga0501080_0796928 3300049742 Bacteria 829
757 Ga0501080_0946248 3300049742 Bacteria 749
758 Ga0501080_1681475 3300049742 Bacteria 536
759 Ga0501080_1889748 3300049742 Unclassified 500
760 Ga0501081_0007332 3300049743 Bacteria 7158
761 Ga0501081_0019175 3300049743 Bacteria 4550
762 Ga0501081_0023814 3300049743 Bacteria 4106
763 Ga0501081_0071439 3300049743 Bacteria 2419
764 Ga0501081_0139699 3300049743 Bacteria 1736
765 Ga0501081_0222193 3300049743 Unclassified 1374
766 Ga0501081_0288607 3300049743 Bacteria 1202
767 Ga0501081_0313754 3300049743 Unclassified 1152
768 Ga0501081_0315208 3300049743 Bacteria 1149
769 Ga0501081_1261708 3300049743 Unclassified 560
770 Ga0501083_0079371 3300049744 Bacteria 2176
771 Ga0501083_0119285 3300049744 Unclassified 1731
772 Ga0501083_0183951 3300049744 Bacteria 1364
773 Ga0501083_0265000 3300049744 Unclassified 1118
774 Ga0501083_0467028 3300049744 Bacteria 821
775 Ga0501083_0885672 3300049744 Unclassified 581
776 Ga0501035_0004781 3300049822 Bacteria 12857
777 Ga0501035_0304902 3300049822 Unclassified 1341
778 Ga0501044_0082868 3300049823 Bacteria 3244
779 Ga0501044_0540163 3300049823 Unclassified 1064
780 Ga0501044_1674608 3300049823 Unclassified 501
781 Ga0501045_0009720 3300049824 Bacteria 6730
782 Ga0501045_0019962 3300049824 Bacteria 4783
783 Ga0501045_0041490 3300049824 Bacteria 3348
784 Ga0501045_0048391 3300049824 Bacteria 3099
785 Ga0501045_0064804 3300049824 Archaea 2682
786 Ga0501045_0146495 3300049824 Bacteria 1757
787 Ga0501045_0158223 3300049824 Bacteria 1686
788 Ga0501045_0325736 3300049824 Bacteria 1143
789 Ga0501045_0564190 3300049824 Unclassified 844
790 Ga0501045_0773173 3300049824 Bacteria 707
791 Ga0501045_1295277 3300049824 Bacteria 530
792 nmdc:mga05p37_1388272_c1 3300050507 Unclassified 708
793 nmdc:mga05p37_1968_c1 3300050507 Bacteria 23961
794 nmdc:mga06r32_628643_c1 3300050510 Unclassified 1043
795 nmdc:mga08y16_37726_c1 3300050511 Bacteria 5072
796 nmdc:mga0rr50_40033_c1 3300050513 Bacteria 3404
797 Ga0495601_0115449 3300053077 Bacteria 1741
798 Ga0495601_0147634 3300053077 Bacteria 1535
799 Ga0495601_0339046 3300053077 Bacteria 978
800 Ga0495612_0000203 3300053078 Bacteria 25447
801 Ga0495612_0054765 3300053078 Bacteria 1644
802 Ga0495595_0104603 3300053084 Bacteria 1368
803 Ga0495619_0209818 3300053085 Bacteria 1349
804 Ga0501084_0014654 3300054114 Bacteria 6499
805 Ga0501084_0019672 3300054114 Bacteria 5625
806 Ga0501084_0021496 3300054114 Bacteria 5379
807 Ga0501084_0048616 3300054114 Bacteria 3550
808 Ga0501084_0073678 3300054114 Unclassified 2859
809 Ga0501084_0090222 3300054114 Bacteria 2573
810 Ga0501084_0230299 3300054114 Unclassified 1564
811 Ga0501084_0316962 3300054114 Bacteria 1317
812 Ga0501084_0437174 3300054114 Bacteria 1106
813 Ga0501084_0458476 3300054114 Bacteria 1078
814 Ga0501084_0473013 3300054114 Bacteria 1059
815 Ga0501084_0557279 3300054114 Bacteria 968
816 Ga0501084_0660540 3300054114 Bacteria 882
817 Ga0501084_0758544 3300054114 Bacteria 817
818 Ga0501084_1055998 3300054114 Bacteria 682
819 Ga0501084_1537976 3300054114 Bacteria 556
820 Ga0501084_1647991 3300054114 Unclassified 536
821 Ga0590071_001997 3300059421 Bacteria 5218
822 Ga0590077_013955 3300059426 Bacteria 1672
823 Ga0501082_0002611 3300060353 Bacteria 15748
824 Ga0501082_0057220 3300060353 Bacteria 3359
825 Ga0501082_0091952 3300060353 Unclassified 2620
826 Ga0501082_0106552 3300060353 Bacteria 2425
827 Ga0501082_0144403 3300060353 Bacteria 2065
828 Ga0501082_0186115 3300060353 Bacteria 1807
829 Ga0501082_0240338 3300060353 Bacteria 1576
830 Ga0501082_0449209 3300060353 Unclassified 1126
831 Ga0530510_0002417 3300061734 Bacteria 12865
832 Ga0530510_0003002 3300061734 Bacteria 11570
833 Ga0530510_0003811 3300061734 Bacteria 10392
834 Ga0530510_0027651 3300061734 Unclassified 4064
835 Ga0530510_0031510 3300061734 Unclassified 3812
836 Ga0530510_0035273 3300061734 Bacteria 3605
837 Ga0530510_0037843 3300061734 Bacteria 3480
838 Ga0530510_0056080 3300061734 Bacteria 2846
839 Ga0530510_0060762 3300061734 Archaea 2735
840 Ga0530510_0104721 3300061734 Unclassified 2070
841 Ga0530510_0141774 3300061734 Bacteria 1771
842 Ga0530510_0156129 3300061734 Unclassified 1686
843 Ga0530510_0176177 3300061734 Bacteria 1585
844 Ga0530510_0216595 3300061734 Bacteria 1423
845 Ga0530510_0407032 3300061734 Bacteria 1026
846 Ga0530510_0892550 3300061734 Unclassified 679
847 Ga0495586_0313343
848 JGI24751J29686_10040609
849 JGI26129J50193_1000841
850 Ga0065715_10192854
851 Ga0070683_100141862
852 Ga0070683_100308656
853 Ga0070683_100348399
854 Ga0070683_100492560
855 Ga0070690_100588471
856 Ga0070670_101471874
857 Ga0068869_100375491
858 Ga0068869_100419639
859 Ga0070666_10181643
860 Ga0070680_100563290
861 Ga0070682_100145823
862 Ga0068868_100421540
863 Ga0068868_100571289
864 Ga0068868_100931016
865 Ga0068868_101173001
866 Ga0070660_100623906
867 Ga0070689_102195008
868 Ga0070687_100713026
869 Ga0070687_101348675
870 Ga0070661_101586125
871 Ga0070692_10076684
872 Ga0070692_10883176
873 Ga0070668_101079220
874 Ga0070669_100601685
875 Ga0070675_100395920
876 Ga0070674_100040870
877 Ga0070674_100102902
878 Ga0070674_100110206
879 Ga0070688_100644933
880 Ga0070688_101520373
881 Ga0070659_100822732
882 Ga0070667_100140020
883 Ga0070703_10113273
884 Ga0070714_100024950
885 Ga0070714_100287512
886 Ga0070701_10767800
887 Ga0070705_100278846
888 Ga0070705_101279677
889 Ga0070694_100001806
890 Ga0070694_100249381
891 Ga0070694_100545666
892 Ga0070694_100631096
893 Ga0070708_100008964
894 Ga0070708_100014992
895 Ga0070708_100079211
896 Ga0070708_100400820
897 Ga0070681_10091928
898 Ga0068867_100087308
899 Ga0070685_10143969
900 Ga0070706_100071595
901 Ga0070706_100127231
902 Ga0070707_100046795
903 Ga0070698_100038976
904 Ga0070698_100212429
905 Ga0070698_100926857
906 Ga0070684_100017931
907 Ga0070684_100303282
908 Ga0070684_100477814
909 Ga0070697_100343617
910 Ga0068853_100501264
911 Ga0070672_100386463
912 Ga0070686_100010945
913 Ga0070686_100108291
914 Ga0070696_100500915
915 Ga0070696_100738357
916 Ga0070693_100229336
917 Ga0070693_100243080
918 Ga0070665_101820598
919 Ga0070704_100151703
920 Ga0070704_101119232
921 Ga0070664_100073153
922 Ga0070664_100704851
923 Ga0070664_100875005
924 Ga0070664_101014800
925 Ga0068857_100062594
926 Ga0068857_100171149
927 Ga0068857_100407967
928 Ga0068857_100530487
929 Ga0068857_102490012
930 Ga0068854_100396563
931 Ga0068856_100241135
932 Ga0068856_102203087
933 Ga0068856_102383627
934 Ga0070702_100033848
935 Ga0070702_100947223
936 Ga0068859_100564913
937 Ga0068864_100035416
938 Ga0068864_100200705
939 Ga0068864_100367286
940 Ga0068864_100453016
941 Ga0068864_101289404
942 Ga0068861_100894666
943 Ga0068870_10189070
944 Ga0068863_100156394
945 Ga0068863_100876426
946 Ga0068863_101218035
947 Ga0068858_100774222
948 Ga0068858_101152220
949 Ga0068860_100355640
950 Ga0068862_100218939
951 Ga0068862_101157677
952 Ga0081455_10194303
953 Ga0070717_10004633
954 Ga0097621_100893756
955 Ga0075428_100001182
956 Ga0075431_100396446
957 Ga0075433_10051692
958 Ga0075434_100086236
959 Ga0097620_100564869
960 Ga0075435_100032533
961 Ga0075435_100263803
962 Ga0105251_10541692
963 Ga0105240_12374229
964 Ga0111539_10015824
965 Ga0105245_10115070
966 Ga0105245_10215866
967 Ga0105245_10230624
968 Ga0105245_10359110
969 Ga0105247_10073191
970 Ga0114129_10000286
971 Ga0114129_11434423
972 Ga0105243_10016596
973 Ga0105243_10022853
974 Ga0105243_10136985
975 Ga0105241_10588348
976 Ga0105242_10056453
977 Ga0105248_11283381
978 Ga0105249_10026689
979 Ga0105249_10387907
980 Ga0105249_10554939
981 Ga0105249_12001442
982 Ga0105246_10025408
983 Ga0105246_10166331
984 Ga0105246_11321905
985 Ga0157373_10416866
986 Ga0157374_10203916
987 Ga0157374_10612452
988 Ga0157378_10021069
989 Ga0157378_10082199
990 Ga0157378_10831700
991 Ga0163162_10145513
992 Ga0163162_10638955
993 Ga0157375_10015545
994 Ga0157375_10024796
995 Ga0157375_10161444
996 Ga0157375_10175692
997 Ga0163163_10017578
998 Ga0163163_10063661
999 Ga0163163_10070836
1000 Ga0163163_10272713
1001 Ga0163163_10471319
1002 Ga0163163_10504774
1003 Ga0163163_11197557
1004 Ga0163163_11718142
1005 Ga0163163_11783793
1006 Ga0163163_11926580
1007 Ga0163163_12067347
1008 Ga0157380_10151235
1009 Ga0157380_10526006
1010 Ga0157380_11082832
1011 Ga0157380_11125808
1012 Ga0157380_12660307
1013 Ga0157377_10068554
1014 Ga0157377_10106218
1015 Ga0157377_10365524
1016 Ga0157379_10027724
1017 Ga0157379_10170160
1018 Ga0157379_10398118
1019 Ga0157379_10494831
1020 Ga0157379_10731651
1021 Ga0157376_10252941
1022 Ga0157376_10998946
1023 Ga0163161_10010120
1024 Ga0163161_11930362
1025 Ga0207653_10104235
1026 Ga0207710_10037066
1027 Ga0207643_10176499
1028 Ga0207684_10065853
1029 Ga0207654_10786187
1030 Ga0207662_10661109
1031 Ga0207646_10013021
1032 Ga0207646_10759913
1033 Ga0207681_10578704
1034 Ga0207694_10345775
1035 Ga0207650_10334973
1036 Ga0207659_10172156
1037 Ga0207659_10434881
1038 Ga0207659_10718895
1039 Ga0207687_10302259
1040 Ga0207687_10412281
1041 Ga0207687_10515387
1042 Ga0207687_10626495
1043 Ga0207687_10676073
1044 Ga0207644_11766155
1045 Ga0207706_10861678
1046 Ga0207686_10096360
1047 Ga0207709_10164561
1048 Ga0207670_10707128
1049 Ga0207669_10063804
1050 Ga0207669_10068893
1051 Ga0207691_10270243
1052 Ga0207691_10347905
1053 Ga0207711_11100984
1054 Ga0207689_10258350
1055 Ga0207661_10162152
1056 Ga0207661_10287517
1057 Ga0207661_10378361
1058 Ga0207679_10031564
1059 Ga0207679_10042742
1060 Ga0207679_10765119
1061 Ga0207679_10827771
1062 Ga0207667_10324604
1063 Ga0207651_11342222
1064 Ga0207712_10118924
1065 Ga0207712_10959877
1066 Ga0207668_10380030
1067 Ga0207640_10110141
1068 Ga0207658_10645432
1069 Ga0207677_10345102
1070 Ga0207703_10235490
1071 Ga0207703_11353516
1072 Ga0207639_10445461
1073 Ga0207678_10634726
1074 Ga0207708_10105314
1075 Ga0207708_10410503
1076 Ga0207708_11423877
1077 Ga0207702_11364241
1078 Ga0207641_10106456
1079 Ga0207641_10114125
1080 Ga0207641_10474697
1081 Ga0207648_10016610
1082 Ga0207648_10398406
1083 Ga0207648_10884702
1084 Ga0207648_10886035
1085 Ga0207676_10120228
1086 Ga0207676_10148981
1087 Ga0207676_10568828
1088 Ga0207676_10857546
1089 Ga0207676_10978950
1090 Ga0207674_10862862
1091 Ga0207674_10890979
1092 Ga0207674_10909778
1093 Ga0207674_11007848
1094 Ga0207675_100397601
1095 Ga0207675_101533784
1096 Ga0207683_10991224
1097 Ga0207698_10213543
1098 Ga0209973_1007531
1099 Ga0209968_1003052
1100 Ga0209999_1020279
1101 Ga0209999_1093959
1102 Ga0209982_1050392
1103 Ga0209970_1021101
1104 Ga0209970_1047325
1105 Ga0209983_1014764
1106 Ga0209983_1044483
1107 Ga0209971_1002642
1108 Ga0209971_1009644
1109 Ga0209966_1001464
1110 Ga0209966_1006311
1111 Ga0209998_10000084
1112 Ga0209998_10007931
1113 Ga0209998_10020145
1114 Ga0209974_10000371
1115 Ga0209974_10001443
1116 Ga0209974_10115029
1117 Ga0207428_10070341
1118 Ga0268266_12184994
1119 Ga0268265_10339299
1120 Ga0268265_11192121
1121 Ga0268264_10032460
1122 Ga0268264_12110149
1123 Ga0265337_1024169
1124 Ga0265326_10024283
1125 Ga0265326_10120116
1126 Ga0265319_1001557
1127 Ga0265319_1019322
1128 Ga0265319_1030383
1129 Ga0265319_1041743
1130 Ga0265334_10009016
1131 Ga0265334_10031842
1132 Ga0265334_10063716
1133 Ga0265318_10003654
1134 Ga0265318_10011724
1135 Ga0265318_10034376
1136 Ga0265318_10038682
1137 Ga0265318_10059555
1138 Ga0265318_10097274
1139 Ga0265323_10024956
1140 Ga0265322_10009410
1141 Ga0265322_10022289
1142 Ga0265336_10038511
1143 Ga0265336_10183432
1144 Ga0265338_10106050
1145 Ga0265338_10109029
1146 Ga0265338_10326628
1147 Ga0265324_10026902
1148 Ga0265330_10073611
1149 Ga0265330_10169071
1150 Ga0265332_10009447
1151 Ga0265332_10041194
1152 Ga0265332_10123355
1153 Ga0265320_10006513
1154 Ga0265320_10016150
1155 Ga0265320_10020855
1156 Ga0265320_10346483
1157 Ga0265325_10029964
1158 Ga0265325_10081729
1159 Ga0265325_10108496
1160 Ga0265325_10113822
1161 Ga0265329_10002514
1162 Ga0265329_10005869
1163 Ga0265329_10145894
1164 Ga0265340_10011524
1165 Ga0265340_10013761
1166 Ga0265339_10055404
1167 Ga0265339_10147196
1168 Ga0265339_10184469
1169 Ga0265331_10023966
1170 Ga0265331_10024165
1171 Ga0265331_10143826
1172 Ga0265316_10059121
1173 Ga0265316_10069516
1174 Ga0265316_10082574
1175 Ga0265316_10137681
1176 Ga0265316_10922924
1177 Ga0265314_10004439
1178 Ga0265314_10020911
1179 Ga0265314_10021387
1180 Ga0265314_10320668
1181 Ga0265314_10494982
1182 Ga0265342_10028561
1183 Ga0265342_10036239
1184 Ga0265342_10046397
1185 Ga0316576_10040749
1186 Ga0316576_10149259
1187 Ga0316578_10330238
1188 Ga0307405_10317922
1189 Ga0316577_10006636
1190 Ga0307413_10720004
1191 Ga0307406_10098808
1192 Ga0307409_100590203
1193 Ga0307409_100595061
1194 Ga0307409_102379386
1195 Ga0307416_100009750
1196 Ga0307416_100318507
1197 Ga0307416_100666218
1198 Ga0307414_10439129
1199 Ga0307411_10116737
1200 Ga0307411_10350905
1201 Ga0307411_11533639
1202 Ga0307411_11816633
1203 Ga0307415_100049572
1204 Ga0307415_100271254
1205 Ga0316592_1003672
1206 Ga0316586_1005815
1207 Ga0316596_1016396
1208 Ga0373932_0210354
1209 Ga0373939_0066274
1210 Ga0373941_0051767
1211 Ga0373960_0141878
1212 Ga0373943_0049010
1213 Ga0373943_0220913
1214 Ga0373946_0370830
1215 Ga0373942_0014346
1216 Ga0373961_0243217
1217 Ga0373962_0101374
1218 Ga0316574_0102454
1219 Ga0316574_0182863
1220 Ga0373931_0376764
1221 Ga0373935_1212834
1222 Ga0373933_0493891
1223 Ga0373937_0233145
1224 Ga0373937_0586927
1225 Ga0373937_1140598
1226 Ga0373937_1676381
1227 Ga0316582_0223627
1228 Ga0316584_0018846
1229 Ga0316584_0283478
1230 Ga0373925_0346087
1231 Ga0373925_0352089
1232 Ga0373925_0700942
1233 Ga0316581_0020617
1234 Ga0439461_0173613
1235 Ga0439466_0087280
1236 Ga0451789_1090341
1237 Ga0451835_0118627
1238 Ga0451855_1635569
1239 Ga0451853_0255912
1240 Ga0451853_2822633
1241 Ga0451853_3051530
1242 Ga0450919_004132
1243 Ga0450920_011506
1244 Ga0450923_000093
1245 Ga0450923_056685
1246 Ga0450910_004880
1247 Ga0450910_011009
1248 Ga0439446_0095508
1249 Ga0439446_0320546
1250 Ga0450908_014990
1251 Ga0439434_0114170
1252 Ga0439435_0010981
1253 Ga0439459_0249662
1254 Ga0439460_0028510
1255 Ga0450918_023111
1256 Ga0451577_0014643
1257 Ga0451577_0183675
1258 Ga0451577_0409888
1259 Ga0453684_0222250
1260 Ga0453684_0480172
1261 Ga0453684_1336077
1262 Ga0453684_2217502
1263 Ga0451576_0071187
1264 Ga0451576_0208009
1265 Ga0451576_0734492
1266 Ga0451576_1407890
1267 Ga0451576_1422171
1268 Ga0451576_2347098
1269 Ga0495592_0157104
1270 Ga0495603_0158973
1271 Ga0495603_0462236
1272 Ga0495629_0253312
1273 Ga0495629_0553687
1274 Ga0495651_0047581
1275 Ga0495653_0205626
1276 Ga0495653_0519798
1277 Ga0495653_0537853
1278 Ga0495582_0264676
1279 Ga0495662_0296940
1280 Ga0495664_0797029
1281 Ga0495608_0187236
1282 Ga0495608_0388542
1283 Ga0495630_0216879
1284 Ga0495630_0354393
1285 Ga0495630_0379490
1286 Ga0495586_0271352
1287 Ga0495587_0158057
1288 Ga0495667_0034977
1289 Ga0495656_0034059
1290 Ga0495634_0042696
1291 Ga0495635_0245516
1292 Ga0495661_0467899
1293 Ga0495657_0210428
1294 Ga0495646_0422756
1295 Ga0495658_0498755
1296 Ga0495613_0472958
1297 Ga0495624_0249396
1298 Ga0495600_0097077
1299 Ga0495581_0258140
1300 Ga0495674_0159350
1301 Ga0495674_0176547
1302 Ga0495674_0554851
1303 Ga0495676_0184085
1304 Ga0495680_0174420
1305 Ga0495680_0498011
1306 Ga0495684_0044777
1307 Ga0496100_0098275
1308 Ga0496100_0489459
1309 Ga0496100_0541096
1310 Ga0496101_0029448
1311 Ga0496101_0202892
1312 Ga0496101_0365800
1313 Ga0496101_0855686
1314 Ga0496102_0329695
1315 Ga0496102_0432322
1316 Ga0496102_1189324
1317 Ga0496103_0271824
1318 Ga0496104_0001663
1319 Ga0496104_0003658
1320 Ga0496104_0009378
1321 Ga0496104_0019665
1322 Ga0496104_0073010
1323 Ga0496105_0005723
1324 Ga0496105_0028741
1325 Ga0496105_0050162
1326 Ga0496105_0073139
1327 Ga0496105_0216809
1328 Ga0496105_0232199
1329 Ga0496106_0077675
1330 Ga0496106_0190833
1331 Ga0496106_0686940
1332 Ga0496107_0107759
1333 Ga0496107_0167919
1334 Ga0496108_0001483
1335 Ga0496108_0014798
1336 Ga0496108_0028472
1337 Ga0496108_0261472
1338 Ga0496108_0357047
1339 Ga0496108_0571208
1340 Ga0496108_0749151
1341 Ga0496108_1056924
1342 Ga0496108_1113143
1343 Ga0496109_0008709
1344 Ga0496109_0015894
1345 Ga0496109_0024552
1346 Ga0496109_0081519
1347 Ga0496109_0859596
1348 Ga0496109_1044104
1349 Ga0496109_1200379
1350 Ga0496109_1489886
1351 Ga0496110_0008234
1352 Ga0496110_0035729
1353 Ga0496110_0059254
1354 Ga0496110_0247589
1355 Ga0496110_0701255
1356 Ga0496110_1146986
1357 Ga0496110_1148740
1358 Ga0496111_0001853
1359 Ga0496111_0029048
1360 Ga0496111_0246479
1361 Ga0496112_0000012
1362 Ga0496112_0002831
1363 Ga0496112_0056967
1364 Ga0496112_0438119
1365 Ga0496112_0824185
1366 Ga0496112_1285304
1367 Ga0496113_0010670
1368 Ga0496113_0518859
1369 Ga0496113_1193465
1370 Ga0496114_0005293
1371 Ga0496114_0400803
1372 Ga0496114_0686996
1373 Ga0501321_020666
1374 Ga0501031_0002020
1375 Ga0501031_0004346
1376 Ga0501031_0016100
1377 Ga0501031_0110220
1378 Ga0501031_0126364
1379 Ga0501031_0143647
1380 Ga0501031_0246550
1381 Ga0501031_0255523
1382 Ga0501031_1036955
1383 Ga0501032_0043392
1384 Ga0501032_0063225
1385 Ga0501032_0275014
1386 Ga0501032_0380513
1387 Ga0501032_0653003
1388 Ga0501033_0014111
1389 Ga0501033_0051950
1390 Ga0501034_0134418
1391 Ga0501034_0327434
1392 Ga0501036_0006726
1393 Ga0501036_0075284
1394 Ga0501036_0078835
1395 Ga0501036_0104531
1396 Ga0501036_0105183
1397 Ga0501036_0114741
1398 Ga0501036_0438386
1399 Ga0501036_0507809
1400 Ga0501036_0634678
1401 Ga0501036_0694006
1402 Ga0501036_0736211
1403 Ga0501037_0058493
1404 Ga0501037_0099383
1405 Ga0501037_0172987
1406 Ga0501038_0010392
1407 Ga0501038_0027225
1408 Ga0501038_0131056
1409 Ga0501038_0136775
1410 Ga0501038_0188586
1411 Ga0501038_0198573
1412 Ga0501038_0311373
1413 Ga0501039_0022486
1414 Ga0501039_0036539
1415 Ga0501039_0044398
1416 Ga0501039_0047952
1417 Ga0501039_0070644
1418 Ga0501039_0225364
1419 Ga0501039_0370044
1420 Ga0501039_0414518
1421 Ga0501039_0429278
1422 Ga0501039_0605570
1423 Ga0501040_0002881
1424 Ga0501040_0036632
1425 Ga0501040_0089487
1426 Ga0501040_0095884
1427 Ga0501040_0099144
1428 Ga0501040_0103176
1429 Ga0501040_0138401
1430 Ga0501040_0208750
1431 Ga0501040_0269063
1432 Ga0501040_0274204
1433 Ga0501040_0334382
1434 Ga0501040_0436755
1435 Ga0501040_1013381
1436 Ga0501040_1076188
1437 Ga0501041_0008168
1438 Ga0501041_0026991
1439 Ga0501041_0031133
1440 Ga0501041_0091033
1441 Ga0501041_0105098
1442 Ga0501041_0181489
1443 Ga0501041_0185618
1444 Ga0501041_0204738
1445 Ga0501041_0371925
1446 Ga0501041_0377359
1447 Ga0501041_0642030
1448 Ga0501041_0672850
1449 Ga0501042_0013717
1450 Ga0501042_0102726
1451 Ga0501042_0105477
1452 Ga0501042_0203556
1453 Ga0501042_0241580
1454 Ga0501042_0270521
1455 Ga0501042_0405468
1456 Ga0501042_0555024
1457 Ga0501042_0906405
1458 Ga0501043_0026684
1459 Ga0501043_0216005
1460 Ga0501043_0516454
1461 Ga0501043_0623537
1462 Ga0501043_0777199
1463 Ga0501046_0013151
1464 Ga0501046_0025797
1465 Ga0501046_0116414
1466 Ga0501046_0308455
1467 Ga0501046_0493645
1468 Ga0501048_0011975
1469 Ga0501048_0023689
1470 Ga0501048_0043639
1471 Ga0501048_0154679
1472 Ga0501048_0222402
1473 Ga0501048_0252619
1474 Ga0501048_0286080
1475 Ga0501048_0749176
1476 Ga0501067_0002476
1477 Ga0501067_0009644
1478 Ga0501067_0320455
1479 Ga0501067_0551040
1480 Ga0501068_0003199
1481 Ga0501068_0011244
1482 Ga0501068_0014796
1483 Ga0501068_0106716
1484 Ga0501068_0114740
1485 Ga0501068_0182296
1486 Ga0501068_0238324
1487 Ga0501068_0307167
1488 Ga0501069_0002734
1489 Ga0501069_0003134
1490 Ga0501069_0013735
1491 Ga0501069_0015264
1492 Ga0501069_0277094
1493 Ga0501069_0301759
1494 Ga0501069_0357993
1495 Ga0501069_0542838
1496 Ga0501070_0004617
1497 Ga0501070_0011535
1498 Ga0501070_0084747
1499 Ga0501070_0838144
1500 Ga0501070_0926354
1501 Ga0501071_0002112
1502 Ga0501071_0018211
1503 Ga0501071_0028286
1504 Ga0501071_0032462
1505 Ga0501071_0035600
1506 Ga0501071_0051534
1507 Ga0501071_0123989
1508 Ga0501071_0131714
1509 Ga0501071_0134703
1510 Ga0501071_0277364
1511 Ga0501071_0341715
1512 Ga0501071_0512748
1513 Ga0501071_0697984
1514 Ga0501071_0702540
1515 Ga0501071_0818022
1516 Ga0501071_0922816
1517 Ga0501071_0996835
1518 Ga0501071_1036227
1519 Ga0501072_0008858
1520 Ga0501072_0026253
1521 Ga0501072_0034022
1522 Ga0501072_0042649
1523 Ga0501072_0052670
1524 Ga0501072_0074297
1525 Ga0501072_0254120
1526 Ga0501072_0262692
1527 Ga0501072_0279686
1528 Ga0501072_0606878
1529 Ga0501072_0679647
1530 Ga0501072_0789068
1531 Ga0501072_1137154
1532 Ga0501073_0021050
1533 Ga0501073_0141795
1534 Ga0501073_0174971
1535 Ga0501073_0285026
1536 Ga0501073_1169687
1537 Ga0501074_0001666
1538 Ga0501074_0003913
1539 Ga0501074_0116907
1540 Ga0501074_0123611
1541 Ga0501074_0166706
1542 Ga0501074_0168230
1543 Ga0501074_0247227
1544 Ga0501074_0524190
1545 Ga0501074_0535284
1546 Ga0501074_0775915
1547 Ga0501074_1256990
1548 Ga0501075_0001781
1549 Ga0501075_0004911
1550 Ga0501075_0010519
1551 Ga0501075_0013739
1552 Ga0501075_0080017
1553 Ga0501075_0127031
1554 Ga0501075_0194046
1555 Ga0501075_0224506
1556 Ga0501075_0229391
1557 Ga0501075_0238548
1558 Ga0501076_0006758
1559 Ga0501076_0027428
1560 Ga0501076_0050210
1561 Ga0501076_0053557
1562 Ga0501076_0084096
1563 Ga0501076_0100029
1564 Ga0501076_0136327
1565 Ga0501076_0223139
1566 Ga0501076_0239469
1567 Ga0501076_0254549
1568 Ga0501076_0392712
1569 Ga0501076_0396065
1570 Ga0501076_0844947
1571 Ga0501076_0992232
1572 Ga0501076_1107643
1573 Ga0501077_0006742
1574 Ga0501077_0014205
1575 Ga0501077_0053413
1576 Ga0501077_0061890
1577 Ga0501077_0118041
1578 Ga0501077_0130597
1579 Ga0501077_0241273
1580 Ga0501077_0521521
1581 Ga0501077_0566573
1582 Ga0501079_0002556
1583 Ga0501079_0021490
1584 Ga0501079_0029782
1585 Ga0501079_0049592
1586 Ga0501079_0051247
1587 Ga0501079_0084061
1588 Ga0501079_0098396
1589 Ga0501079_0188031
1590 Ga0501079_0284024
1591 Ga0501079_0347759
1592 Ga0501079_1057428
1593 Ga0501079_1616659
1594 Ga0501080_0018972
1595 Ga0501080_0049582
1596 Ga0501080_0093725
1597 Ga0501080_0147768
1598 Ga0501080_0276948
1599 Ga0501080_0322490
1600 Ga0501080_0700447
1601 Ga0501080_0743961
1602 Ga0501080_0796928
1603 Ga0501080_0946248
1604 Ga0501080_1681475
1605 Ga0501080_1889748
1606 Ga0501081_0007332
1607 Ga0501081_0019175
1608 Ga0501081_0023814
1609 Ga0501081_0071439
1610 Ga0501081_0139699
1611 Ga0501081_0222193
1612 Ga0501081_0288607
1613 Ga0501081_0313754
1614 Ga0501081_0315208
1615 Ga0501081_1261708
1616 Ga0501083_0079371
1617 Ga0501083_0119285
1618 Ga0501083_0183951
1619 Ga0501083_0265000
1620 Ga0501083_0467028
1621 Ga0501083_0885672
1622 Ga0501035_0004781
1623 Ga0501035_0304902
1624 Ga0501044_0082868
1625 Ga0501044_0540163
1626 Ga0501044_1674608
1627 Ga0501045_0009720
1628 Ga0501045_0019962
1629 Ga0501045_0041490
1630 Ga0501045_0048391
1631 Ga0501045_0064804
1632 Ga0501045_0146495
1633 Ga0501045_0158223
1634 Ga0501045_0325736
1635 Ga0501045_0564190
1636 Ga0501045_0773173
1637 Ga0501045_1295277
1638 nmdc:mga05p37_1388272_c1
1639 nmdc:mga05p37_1968_c1
1640 nmdc:mga06r32_628643_c1
1641 nmdc:mga08y16_37726_c1
1642 nmdc:mga0rr50_40033_c1
1643 Ga0495601_0115449
1644 Ga0495601_0147634
1645 Ga0495601_0339046
1646 Ga0495612_0000203
1647 Ga0495612_0054765
1648 Ga0495595_0104603
1649 Ga0495619_0209818
1650 Ga0501084_0014654
1651 Ga0501084_0019672
1652 Ga0501084_0021496
1653 Ga0501084_0048616
1654 Ga0501084_0073678
1655 Ga0501084_0090222
1656 Ga0501084_0230299
1657 Ga0501084_0316962
1658 Ga0501084_0437174
1659 Ga0501084_0458476
1660 Ga0501084_0473013
1661 Ga0501084_0557279
1662 Ga0501084_0660540
1663 Ga0501084_0758544
1664 Ga0501084_1055998
1665 Ga0501084_1537976
1666 Ga0501084_1647991
1667 Ga0590071_001997
1668 Ga0590077_013955
1669 Ga0501082_0002611
1670 Ga0501082_0057220
1671 Ga0501082_0091952
1672 Ga0501082_0106552
1673 Ga0501082_0144403
1674 Ga0501082_0186115
1675 Ga0501082_0240338
1676 Ga0501082_0449209
1677 Ga0530510_0002417
1678 Ga0530510_0003002
1679 Ga0530510_0003811
1680 Ga0530510_0027651
1681 Ga0530510_0031510
1682 Ga0530510_0035273
1683 Ga0530510_0037843
1684 Ga0530510_0056080
1685 Ga0530510_0060762
1686 Ga0530510_0104721
1687 Ga0530510_0141774
1688 Ga0530510_0156129
1689 Ga0530510_0176177
1690 Ga0530510_0216595
1691 Ga0530510_0407032
1692 Ga0530510_0892550

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

20

79

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.9452 2 136
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.9319 2 136
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8319 2 136
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8217 2 136
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7744 1 136
ID Description Score Start End Superfamily
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9639 4 38 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9212 1 38 3.40.50.10860
2qs7B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8959 2 136 3.40.1260.10
2qs7B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8894 2 136 3.40.1260.10
af_Q21603_1_280_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8544 4 38 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1F8S2J6-F1-model_v4 Peroxiredoxin 0.9991 8 136
AF-A0A1F8S2J6-F1-model_v4 Peroxiredoxin 0.9763 8 136
AF-A0LS88-F1-model_v4 Peroxiredoxin 0.9604 1 136
AF-F4B6F5-F1-model_v4 Peroxiredoxin family 0.9596 10 136
AF-A0LS88-F1-model_v4 Peroxiredoxin 0.9536 1 136

Map