F483304
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 307 | 1692 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300046535|Ga0495586_0313343|Ga0495586_0313343_200_670 |
| Length | 156 |
| Sequence | MVGPQEGDRLPQIDHEVTEMDEPLNLVLFSGTDDKLQAAAVLTAGAAALGKPVNIFLQYWALDAFRADRIATDHGLAPEAGPAGRAAVDALAAAGQAPWSDTLRQAKELGGVDIEACSLSMDLLHLDQADLDPLVDGIEGVTAFYLAAGAGQVVFI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 200 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 201 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 202 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 204 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 205 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 206 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 207 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 208 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 209 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 210 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 211 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 214 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 215 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 216 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.92 |
| Rhizosphere | 91.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495586_0313343 | 3300046535 | Unclassified | 900 |
| 2 | JGI24751J29686_10040609 | 3300002459 | Bacteria | 963 |
| 3 | JGI26129J50193_1000841 | 3300003349 | Bacteria | 1997 |
| 4 | Ga0065715_10192854 | 3300005293 | Unclassified | 1405 |
| 5 | Ga0070683_100141862 | 3300005329 | Bacteria | 2276 |
| 6 | Ga0070683_100308656 | 3300005329 | Bacteria | 1505 |
| 7 | Ga0070683_100348399 | 3300005329 | Bacteria | 1410 |
| 8 | Ga0070683_100492560 | 3300005329 | Bacteria | 1171 |
| 9 | Ga0070690_100588471 | 3300005330 | Unclassified | 843 |
| 10 | Ga0070670_101471874 | 3300005331 | Unclassified | 625 |
| 11 | Ga0068869_100375491 | 3300005334 | Bacteria | 1164 |
| 12 | Ga0068869_100419639 | 3300005334 | Unclassified | 1104 |
| 13 | Ga0070666_10181643 | 3300005335 | Archaea | 1476 |
| 14 | Ga0070680_100563290 | 3300005336 | Unclassified | 977 |
| 15 | Ga0070682_100145823 | 3300005337 | Bacteria | 1619 |
| 16 | Ga0068868_100421540 | 3300005338 | Archaea | 1156 |
| 17 | Ga0068868_100571289 | 3300005338 | Bacteria | 999 |
| 18 | Ga0068868_100931016 | 3300005338 | Bacteria | 791 |
| 19 | Ga0068868_101173001 | 3300005338 | Bacteria | 709 |
| 20 | Ga0070660_100623906 | 3300005339 | Unclassified | 902 |
| 21 | Ga0070689_102195008 | 3300005340 | Bacteria | 506 |
| 22 | Ga0070687_100713026 | 3300005343 | Bacteria | 702 |
| 23 | Ga0070687_101348675 | 3300005343 | Unclassified | 531 |
| 24 | Ga0070661_101586125 | 3300005344 | Unclassified | 553 |
| 25 | Ga0070692_10076684 | 3300005345 | Unclassified | 1792 |
| 26 | Ga0070692_10883176 | 3300005345 | Unclassified | 617 |
| 27 | Ga0070668_101079220 | 3300005347 | Unclassified | 724 |
| 28 | Ga0070669_100601685 | 3300005353 | Unclassified | 921 |
| 29 | Ga0070675_100395920 | 3300005354 | Unclassified | 1231 |
| 30 | Ga0070674_100040870 | 3300005356 | Bacteria | 3139 |
| 31 | Ga0070674_100102902 | 3300005356 | Bacteria | 2084 |
| 32 | Ga0070674_100110206 | 3300005356 | Archaea | 2020 |
| 33 | Ga0070688_100644933 | 3300005365 | Bacteria | 815 |
| 34 | Ga0070688_101520373 | 3300005365 | Unclassified | 545 |
| 35 | Ga0070659_100822732 | 3300005366 | Unclassified | 809 |
| 36 | Ga0070667_100140020 | 3300005367 | Bacteria | 2118 |
| 37 | Ga0070703_10113273 | 3300005406 | Unclassified | 973 |
| 38 | Ga0070714_100024950 | 3300005435 | Bacteria | 4930 |
| 39 | Ga0070714_100287512 | 3300005435 | Bacteria | 1529 |
| 40 | Ga0070701_10767800 | 3300005438 | Unclassified | 654 |
| 41 | Ga0070705_100278846 | 3300005440 | Unclassified | 1187 |
| 42 | Ga0070705_101279677 | 3300005440 | Unclassified | 607 |
| 43 | Ga0070694_100001806 | 3300005444 | Bacteria | 12673 |
| 44 | Ga0070694_100249381 | 3300005444 | Unclassified | 1342 |
| 45 | Ga0070694_100545666 | 3300005444 | Bacteria | 928 |
| 46 | Ga0070694_100631096 | 3300005444 | Unclassified | 866 |
| 47 | Ga0070708_100008964 | 3300005445 | Bacteria | 8060 |
| 48 | Ga0070708_100014992 | 3300005445 | Bacteria | 6391 |
| 49 | Ga0070708_100079211 | 3300005445 | Bacteria | 2972 |
| 50 | Ga0070708_100400820 | 3300005445 | Bacteria | 1294 |
| 51 | Ga0070681_10091928 | 3300005458 | Bacteria | 2984 |
| 52 | Ga0068867_100087308 | 3300005459 | Archaea | 2361 |
| 53 | Ga0070685_10143969 | 3300005466 | Bacteria | 1504 |
| 54 | Ga0070706_100071595 | 3300005467 | Bacteria | 3207 |
| 55 | Ga0070706_100127231 | 3300005467 | Bacteria | 2376 |
| 56 | Ga0070707_100046795 | 3300005468 | Unclassified | 4140 |
| 57 | Ga0070698_100038976 | 3300005471 | Bacteria | 4895 |
| 58 | Ga0070698_100212429 | 3300005471 | Unclassified | 1869 |
| 59 | Ga0070698_100926857 | 3300005471 | Bacteria | 817 |
| 60 | Ga0070684_100017931 | 3300005535 | Bacteria | 5820 |
| 61 | Ga0070684_100303282 | 3300005535 | Bacteria | 1466 |
| 62 | Ga0070684_100477814 | 3300005535 | Bacteria | 1153 |
| 63 | Ga0070697_100343617 | 3300005536 | Bacteria | 1288 |
| 64 | Ga0068853_100501264 | 3300005539 | Unclassified | 1146 |
| 65 | Ga0070672_100386463 | 3300005543 | Unclassified | 1198 |
| 66 | Ga0070686_100010945 | 3300005544 | Bacteria | 5135 |
| 67 | Ga0070686_100108291 | 3300005544 | Bacteria | 1888 |
| 68 | Ga0070696_100500915 | 3300005546 | Bacteria | 966 |
| 69 | Ga0070696_100738357 | 3300005546 | Bacteria | 805 |
| 70 | Ga0070693_100229336 | 3300005547 | Archaea | 1221 |
| 71 | Ga0070693_100243080 | 3300005547 | Unclassified | 1190 |
| 72 | Ga0070665_101820598 | 3300005548 | Unclassified | 615 |
| 73 | Ga0070704_100151703 | 3300005549 | Unclassified | 1822 |
| 74 | Ga0070704_101119232 | 3300005549 | Bacteria | 716 |
| 75 | Ga0070664_100073153 | 3300005564 | Bacteria | 2940 |
| 76 | Ga0070664_100704851 | 3300005564 | Archaea | 941 |
| 77 | Ga0070664_100875005 | 3300005564 | Bacteria | 842 |
| 78 | Ga0070664_101014800 | 3300005564 | Bacteria | 780 |
| 79 | Ga0068857_100062594 | 3300005577 | Bacteria | 3308 |
| 80 | Ga0068857_100171149 | 3300005577 | Bacteria | 1974 |
| 81 | Ga0068857_100407967 | 3300005577 | Unclassified | 1265 |
| 82 | Ga0068857_100530487 | 3300005577 | Bacteria | 1107 |
| 83 | Ga0068857_102490012 | 3300005577 | Bacteria | 508 |
| 84 | Ga0068854_100396563 | 3300005578 | Archaea | 1141 |
| 85 | Ga0068856_100241135 | 3300005614 | Bacteria | 1823 |
| 86 | Ga0068856_102203087 | 3300005614 | Bacteria | 560 |
| 87 | Ga0068856_102383627 | 3300005614 | Bacteria | 537 |
| 88 | Ga0070702_100033848 | 3300005615 | Archaea | 2812 |
| 89 | Ga0070702_100947223 | 3300005615 | Bacteria | 678 |
| 90 | Ga0068859_100564913 | 3300005617 | Bacteria | 1232 |
| 91 | Ga0068864_100035416 | 3300005618 | Bacteria | 4249 |
| 92 | Ga0068864_100200705 | 3300005618 | Unclassified | 1832 |
| 93 | Ga0068864_100367286 | 3300005618 | Bacteria | 1361 |
| 94 | Ga0068864_100453016 | 3300005618 | Unclassified | 1227 |
| 95 | Ga0068864_101289404 | 3300005618 | Unclassified | 731 |
| 96 | Ga0068861_100894666 | 3300005719 | Archaea | 840 |
| 97 | Ga0068870_10189070 | 3300005840 | Unclassified | 1241 |
| 98 | Ga0068863_100156394 | 3300005841 | Bacteria | 2183 |
| 99 | Ga0068863_100876426 | 3300005841 | Archaea | 897 |
| 100 | Ga0068863_101218035 | 3300005841 | Bacteria | 759 |
| 101 | Ga0068858_100774222 | 3300005842 | Unclassified | 936 |
| 102 | Ga0068858_101152220 | 3300005842 | Bacteria | 762 |
| 103 | Ga0068860_100355640 | 3300005843 | Unclassified | 1442 |
| 104 | Ga0068862_100218939 | 3300005844 | Bacteria | 1723 |
| 105 | Ga0068862_101157677 | 3300005844 | Unclassified | 770 |
| 106 | Ga0081455_10194303 | 3300005937 | Bacteria | 1525 |
| 107 | Ga0070717_10004633 | 3300006028 | Bacteria | 9966 |
| 108 | Ga0097621_100893756 | 3300006237 | Bacteria | 827 |
| 109 | Ga0075428_100001182 | 3300006844 | Bacteria | 27941 |
| 110 | Ga0075431_100396446 | 3300006847 | Unclassified | 1382 |
| 111 | Ga0075433_10051692 | 3300006852 | Bacteria | 3579 |
| 112 | Ga0075434_100086236 | 3300006871 | Bacteria | 3140 |
| 113 | Ga0097620_100564869 | 3300006931 | Bacteria | 1232 |
| 114 | Ga0075435_100032533 | 3300007076 | Unclassified | 4120 |
| 115 | Ga0075435_100263803 | 3300007076 | Archaea | 1468 |
| 116 | Ga0105251_10541692 | 3300009011 | Unclassified | 547 |
| 117 | Ga0105240_12374229 | 3300009093 | Unclassified | 549 |
| 118 | Ga0111539_10015824 | 3300009094 | Bacteria | 9369 |
| 119 | Ga0105245_10115070 | 3300009098 | Bacteria | 2506 |
| 120 | Ga0105245_10215866 | 3300009098 | Bacteria | 1848 |
| 121 | Ga0105245_10230624 | 3300009098 | Archaea | 1790 |
| 122 | Ga0105245_10359110 | 3300009098 | Bacteria | 1445 |
| 123 | Ga0105247_10073191 | 3300009101 | Bacteria | 2147 |
| 124 | Ga0114129_10000286 | 3300009147 | Bacteria | 58249 |
| 125 | Ga0114129_11434423 | 3300009147 | Bacteria | 851 |
| 126 | Ga0105243_10016596 | 3300009148 | Bacteria | 5568 |
| 127 | Ga0105243_10022853 | 3300009148 | Archaea | 4754 |
| 128 | Ga0105243_10136985 | 3300009148 | Bacteria | 2084 |
| 129 | Ga0105241_10588348 | 3300009174 | Unclassified | 1004 |
| 130 | Ga0105242_10056453 | 3300009176 | Archaea | 3213 |
| 131 | Ga0105248_11283381 | 3300009177 | Unclassified | 828 |
| 132 | Ga0105249_10026689 | 3300009553 | Bacteria | 5207 |
| 133 | Ga0105249_10387907 | 3300009553 | Archaea | 1424 |
| 134 | Ga0105249_10554939 | 3300009553 | Bacteria | 1200 |
| 135 | Ga0105249_12001442 | 3300009553 | Bacteria | 652 |
| 136 | Ga0105246_10025408 | 3300011119 | Bacteria | 3860 |
| 137 | Ga0105246_10166331 | 3300011119 | Unclassified | 1685 |
| 138 | Ga0105246_11321905 | 3300011119 | Unclassified | 669 |
| 139 | Ga0157373_10416866 | 3300013100 | Bacteria | 964 |
| 140 | Ga0157374_10203916 | 3300013296 | Unclassified | 1937 |
| 141 | Ga0157374_10612452 | 3300013296 | Bacteria | 1099 |
| 142 | Ga0157378_10021069 | 3300013297 | Bacteria | 5735 |
| 143 | Ga0157378_10082199 | 3300013297 | Bacteria | 2912 |
| 144 | Ga0157378_10831700 | 3300013297 | Unclassified | 951 |
| 145 | Ga0163162_10145513 | 3300013306 | Unclassified | 2486 |
| 146 | Ga0163162_10638955 | 3300013306 | Bacteria | 1188 |
| 147 | Ga0157375_10015545 | 3300013308 | Bacteria | 6816 |
| 148 | Ga0157375_10024796 | 3300013308 | Bacteria | 5558 |
| 149 | Ga0157375_10161444 | 3300013308 | Bacteria | 2383 |
| 150 | Ga0157375_10175692 | 3300013308 | Bacteria | 2291 |
| 151 | Ga0163163_10017578 | 3300014325 | Bacteria | 6673 |
| 152 | Ga0163163_10063661 | 3300014325 | Bacteria | 3658 |
| 153 | Ga0163163_10070836 | 3300014325 | Unclassified | 3473 |
| 154 | Ga0163163_10272713 | 3300014325 | Bacteria | 1743 |
| 155 | Ga0163163_10471319 | 3300014325 | Bacteria | 1316 |
| 156 | Ga0163163_10504774 | 3300014325 | Bacteria | 1271 |
| 157 | Ga0163163_11197557 | 3300014325 | Unclassified | 822 |
| 158 | Ga0163163_11718142 | 3300014325 | Unclassified | 688 |
| 159 | Ga0163163_11783793 | 3300014325 | Bacteria | 676 |
| 160 | Ga0163163_11926580 | 3300014325 | Bacteria | 651 |
| 161 | Ga0163163_12067347 | 3300014325 | Bacteria | 629 |
| 162 | Ga0157380_10151235 | 3300014326 | Bacteria | 2007 |
| 163 | Ga0157380_10526006 | 3300014326 | Bacteria | 1155 |
| 164 | Ga0157380_11082832 | 3300014326 | Unclassified | 840 |
| 165 | Ga0157380_11125808 | 3300014326 | Bacteria | 825 |
| 166 | Ga0157380_12660307 | 3300014326 | Bacteria | 567 |
| 167 | Ga0157377_10068554 | 3300014745 | Unclassified | 2044 |
| 168 | Ga0157377_10106218 | 3300014745 | Unclassified | 1681 |
| 169 | Ga0157377_10365524 | 3300014745 | Unclassified | 972 |
| 170 | Ga0157379_10027724 | 3300014968 | Bacteria | 5042 |
| 171 | Ga0157379_10170160 | 3300014968 | Bacteria | 1967 |
| 172 | Ga0157379_10398118 | 3300014968 | Unclassified | 1265 |
| 173 | Ga0157379_10494831 | 3300014968 | Bacteria | 1133 |
| 174 | Ga0157379_10731651 | 3300014968 | Bacteria | 930 |
| 175 | Ga0157376_10252941 | 3300014969 | Bacteria | 1646 |
| 176 | Ga0157376_10998946 | 3300014969 | Unclassified | 859 |
| 177 | Ga0163161_10010120 | 3300017792 | Bacteria | 6526 |
| 178 | Ga0163161_11930362 | 3300017792 | Bacteria | 525 |
| 179 | Ga0207653_10104235 | 3300025885 | Bacteria | 1006 |
| 180 | Ga0207710_10037066 | 3300025900 | Bacteria | 2152 |
| 181 | Ga0207643_10176499 | 3300025908 | Unclassified | 1291 |
| 182 | Ga0207684_10065853 | 3300025910 | Bacteria | 3077 |
| 183 | Ga0207654_10786187 | 3300025911 | Bacteria | 687 |
| 184 | Ga0207662_10661109 | 3300025918 | Bacteria | 730 |
| 185 | Ga0207646_10013021 | 3300025922 | Bacteria | 7967 |
| 186 | Ga0207646_10759913 | 3300025922 | Bacteria | 865 |
| 187 | Ga0207681_10578704 | 3300025923 | Unclassified | 926 |
| 188 | Ga0207694_10345775 | 3300025924 | Unclassified | 1230 |
| 189 | Ga0207650_10334973 | 3300025925 | Bacteria | 1242 |
| 190 | Ga0207659_10172156 | 3300025926 | Unclassified | 1709 |
| 191 | Ga0207659_10434881 | 3300025926 | Bacteria | 1103 |
| 192 | Ga0207659_10718895 | 3300025926 | Bacteria | 856 |
| 193 | Ga0207687_10302259 | 3300025927 | Unclassified | 1289 |
| 194 | Ga0207687_10412281 | 3300025927 | Bacteria | 1113 |
| 195 | Ga0207687_10515387 | 3300025927 | Bacteria | 1000 |
| 196 | Ga0207687_10626495 | 3300025927 | Bacteria | 908 |
| 197 | Ga0207687_10676073 | 3300025927 | Bacteria | 875 |
| 198 | Ga0207644_11766155 | 3300025931 | Bacteria | 518 |
| 199 | Ga0207706_10861678 | 3300025933 | Bacteria | 767 |
| 200 | Ga0207686_10096360 | 3300025934 | Bacteria | 1966 |
| 201 | Ga0207709_10164561 | 3300025935 | Bacteria | 1550 |
| 202 | Ga0207670_10707128 | 3300025936 | Unclassified | 834 |
| 203 | Ga0207669_10063804 | 3300025937 | Archaea | 2276 |
| 204 | Ga0207669_10068893 | 3300025937 | Bacteria | 2212 |
| 205 | Ga0207691_10270243 | 3300025940 | Archaea | 1464 |
| 206 | Ga0207691_10347905 | 3300025940 | Unclassified | 1268 |
| 207 | Ga0207711_11100984 | 3300025941 | Unclassified | 735 |
| 208 | Ga0207689_10258350 | 3300025942 | Bacteria | 1441 |
| 209 | Ga0207661_10162152 | 3300025944 | Unclassified | 1941 |
| 210 | Ga0207661_10287517 | 3300025944 | Unclassified | 1471 |
| 211 | Ga0207661_10378361 | 3300025944 | Bacteria | 1281 |
| 212 | Ga0207679_10031564 | 3300025945 | Bacteria | 3709 |
| 213 | Ga0207679_10042742 | 3300025945 | Bacteria | 3259 |
| 214 | Ga0207679_10765119 | 3300025945 | Bacteria | 879 |
| 215 | Ga0207679_10827771 | 3300025945 | Unclassified | 845 |
| 216 | Ga0207667_10324604 | 3300025949 | Unclassified | 1572 |
| 217 | Ga0207651_11342222 | 3300025960 | Unclassified | 643 |
| 218 | Ga0207712_10118924 | 3300025961 | Unclassified | 1996 |
| 219 | Ga0207712_10959877 | 3300025961 | Bacteria | 757 |
| 220 | Ga0207668_10380030 | 3300025972 | Bacteria | 1189 |
| 221 | Ga0207640_10110141 | 3300025981 | Bacteria | 1950 |
| 222 | Ga0207658_10645432 | 3300025986 | Bacteria | 954 |
| 223 | Ga0207677_10345102 | 3300026023 | Bacteria | 1245 |
| 224 | Ga0207703_10235490 | 3300026035 | Bacteria | 1643 |
| 225 | Ga0207703_11353516 | 3300026035 | Bacteria | 685 |
| 226 | Ga0207639_10445461 | 3300026041 | Unclassified | 1175 |
| 227 | Ga0207678_10634726 | 3300026067 | Unclassified | 938 |
| 228 | Ga0207708_10105314 | 3300026075 | Unclassified | 2186 |
| 229 | Ga0207708_10410503 | 3300026075 | Bacteria | 1121 |
| 230 | Ga0207708_11423877 | 3300026075 | Bacteria | 608 |
| 231 | Ga0207702_11364241 | 3300026078 | Bacteria | 703 |
| 232 | Ga0207641_10106456 | 3300026088 | Bacteria | 2479 |
| 233 | Ga0207641_10114125 | 3300026088 | Unclassified | 2400 |
| 234 | Ga0207641_10474697 | 3300026088 | Unclassified | 1212 |
| 235 | Ga0207648_10016610 | 3300026089 | Bacteria | 6719 |
| 236 | Ga0207648_10398406 | 3300026089 | Bacteria | 1247 |
| 237 | Ga0207648_10884702 | 3300026089 | Bacteria | 834 |
| 238 | Ga0207648_10886035 | 3300026089 | Bacteria | 833 |
| 239 | Ga0207676_10120228 | 3300026095 | Bacteria | 2214 |
| 240 | Ga0207676_10148981 | 3300026095 | Bacteria | 2013 |
| 241 | Ga0207676_10568828 | 3300026095 | Bacteria | 1085 |
| 242 | Ga0207676_10857546 | 3300026095 | Unclassified | 889 |
| 243 | Ga0207676_10978950 | 3300026095 | Unclassified | 833 |
| 244 | Ga0207674_10862862 | 3300026116 | Bacteria | 873 |
| 245 | Ga0207674_10890979 | 3300026116 | Bacteria | 858 |
| 246 | Ga0207674_10909778 | 3300026116 | Bacteria | 848 |
| 247 | Ga0207674_11007848 | 3300026116 | Bacteria | 802 |
| 248 | Ga0207675_100397601 | 3300026118 | Unclassified | 1357 |
| 249 | Ga0207675_101533784 | 3300026118 | Unclassified | 687 |
| 250 | Ga0207683_10991224 | 3300026121 | Bacteria | 780 |
| 251 | Ga0207698_10213543 | 3300026142 | Unclassified | 1738 |
| 252 | Ga0209973_1007531 | 3300027252 | Bacteria | 1219 |
| 253 | Ga0209968_1003052 | 3300027526 | Unclassified | 2513 |
| 254 | Ga0209999_1020279 | 3300027543 | Bacteria | 1221 |
| 255 | Ga0209999_1093959 | 3300027543 | Unclassified | 582 |
| 256 | Ga0209982_1050392 | 3300027552 | Bacteria | 671 |
| 257 | Ga0209970_1021101 | 3300027614 | Bacteria | 1102 |
| 258 | Ga0209970_1047325 | 3300027614 | Unclassified | 773 |
| 259 | Ga0209983_1014764 | 3300027665 | Bacteria | 1610 |
| 260 | Ga0209983_1044483 | 3300027665 | Bacteria | 965 |
| 261 | Ga0209971_1002642 | 3300027682 | Bacteria | 4291 |
| 262 | Ga0209971_1009644 | 3300027682 | Bacteria | 2287 |
| 263 | Ga0209966_1001464 | 3300027695 | Bacteria | 4094 |
| 264 | Ga0209966_1006311 | 3300027695 | Bacteria | 2056 |
| 265 | Ga0209998_10000084 | 3300027717 | Bacteria | 36963 |
| 266 | Ga0209998_10007931 | 3300027717 | Bacteria | 2203 |
| 267 | Ga0209998_10020145 | 3300027717 | Bacteria | 1426 |
| 268 | Ga0209974_10000371 | 3300027876 | Bacteria | 14833 |
| 269 | Ga0209974_10001443 | 3300027876 | Bacteria | 8618 |
| 270 | Ga0209974_10115029 | 3300027876 | Unclassified | 949 |
| 271 | Ga0207428_10070341 | 3300027907 | Bacteria | 2750 |
| 272 | Ga0268266_12184994 | 3300028379 | Bacteria | 526 |
| 273 | Ga0268265_10339299 | 3300028380 | Bacteria | 1368 |
| 274 | Ga0268265_11192121 | 3300028380 | Archaea | 759 |
| 275 | Ga0268264_10032460 | 3300028381 | Bacteria | 4284 |
| 276 | Ga0268264_12110149 | 3300028381 | Bacteria | 572 |
| 277 | Ga0265337_1024169 | 3300028556 | Bacteria | 1862 |
| 278 | Ga0265326_10024283 | 3300028558 | Unclassified | 1730 |
| 279 | Ga0265326_10120116 | 3300028558 | Bacteria | 747 |
| 280 | Ga0265319_1001557 | 3300028563 | Bacteria | 13503 |
| 281 | Ga0265319_1019322 | 3300028563 | Bacteria | 2545 |
| 282 | Ga0265319_1030383 | 3300028563 | Bacteria | 1890 |
| 283 | Ga0265319_1041743 | 3300028563 | Unclassified | 1546 |
| 284 | Ga0265334_10009016 | 3300028573 | Bacteria | 4230 |
| 285 | Ga0265334_10031842 | 3300028573 | Bacteria | 2106 |
| 286 | Ga0265334_10063716 | 3300028573 | Unclassified | 1385 |
| 287 | Ga0265318_10003654 | 3300028577 | Bacteria | 7680 |
| 288 | Ga0265318_10011724 | 3300028577 | Bacteria | 3759 |
| 289 | Ga0265318_10034376 | 3300028577 | Bacteria | 1954 |
| 290 | Ga0265318_10038682 | 3300028577 | Unclassified | 1822 |
| 291 | Ga0265318_10059555 | 3300028577 | Bacteria | 1424 |
| 292 | Ga0265318_10097274 | 3300028577 | Bacteria | 1083 |
| 293 | Ga0265323_10024956 | 3300028653 | Bacteria | 2269 |
| 294 | Ga0265322_10009410 | 3300028654 | Bacteria | 2837 |
| 295 | Ga0265322_10022289 | 3300028654 | Bacteria | 1812 |
| 296 | Ga0265336_10038511 | 3300028666 | Unclassified | 1467 |
| 297 | Ga0265336_10183432 | 3300028666 | Bacteria | 622 |
| 298 | Ga0265338_10106050 | 3300028800 | Bacteria | 2276 |
| 299 | Ga0265338_10109029 | 3300028800 | Bacteria | 2235 |
| 300 | Ga0265338_10326628 | 3300028800 | Unclassified | 1109 |
| 301 | Ga0265324_10026902 | 3300029957 | Bacteria | 2034 |
| 302 | Ga0265330_10073611 | 3300031235 | Unclassified | 1477 |
| 303 | Ga0265330_10169071 | 3300031235 | Unclassified | 927 |
| 304 | Ga0265332_10009447 | 3300031238 | Bacteria | 4354 |
| 305 | Ga0265332_10041194 | 3300031238 | Unclassified | 1999 |
| 306 | Ga0265332_10123355 | 3300031238 | Bacteria | 1088 |
| 307 | Ga0265320_10006513 | 3300031240 | Bacteria | 7357 |
| 308 | Ga0265320_10016150 | 3300031240 | Bacteria | 4194 |
| 309 | Ga0265320_10020855 | 3300031240 | Bacteria | 3540 |
| 310 | Ga0265320_10346483 | 3300031240 | Unclassified | 656 |
| 311 | Ga0265325_10029964 | 3300031241 | Bacteria | 2921 |
| 312 | Ga0265325_10081729 | 3300031241 | Bacteria | 1605 |
| 313 | Ga0265325_10108496 | 3300031241 | Bacteria | 1352 |
| 314 | Ga0265325_10113822 | 3300031241 | Unclassified | 1312 |
| 315 | Ga0265329_10002514 | 3300031242 | Bacteria | 8278 |
| 316 | Ga0265329_10005869 | 3300031242 | Bacteria | 4922 |
| 317 | Ga0265329_10145894 | 3300031242 | Unclassified | 765 |
| 318 | Ga0265340_10011524 | 3300031247 | Bacteria | 4697 |
| 319 | Ga0265340_10013761 | 3300031247 | Bacteria | 4243 |
| 320 | Ga0265339_10055404 | 3300031249 | Bacteria | 2151 |
| 321 | Ga0265339_10147196 | 3300031249 | Unclassified | 1194 |
| 322 | Ga0265339_10184469 | 3300031249 | Unclassified | 1037 |
| 323 | Ga0265331_10023966 | 3300031250 | Bacteria | 3093 |
| 324 | Ga0265331_10024165 | 3300031250 | Bacteria | 3078 |
| 325 | Ga0265331_10143826 | 3300031250 | Bacteria | 1084 |
| 326 | Ga0265316_10059121 | 3300031344 | Bacteria | 2982 |
| 327 | Ga0265316_10069516 | 3300031344 | Bacteria | 2717 |
| 328 | Ga0265316_10082574 | 3300031344 | Bacteria | 2462 |
| 329 | Ga0265316_10137681 | 3300031344 | Bacteria | 1836 |
| 330 | Ga0265316_10922924 | 3300031344 | Unclassified | 609 |
| 331 | Ga0265314_10004439 | 3300031711 | Bacteria | 13024 |
| 332 | Ga0265314_10020911 | 3300031711 | Bacteria | 5044 |
| 333 | Ga0265314_10021387 | 3300031711 | Bacteria | 4974 |
| 334 | Ga0265314_10320668 | 3300031711 | Bacteria | 862 |
| 335 | Ga0265314_10494982 | 3300031711 | Unclassified | 644 |
| 336 | Ga0265342_10028561 | 3300031712 | Bacteria | 3473 |
| 337 | Ga0265342_10036239 | 3300031712 | Bacteria | 3015 |
| 338 | Ga0265342_10046397 | 3300031712 | Bacteria | 2612 |
| 339 | Ga0316576_10040749 | 3300031727 | Bacteria | 3339 |
| 340 | Ga0316576_10149259 | 3300031727 | Unclassified | 1762 |
| 341 | Ga0316578_10330238 | 3300031728 | Bacteria | 909 |
| 342 | Ga0307405_10317922 | 3300031731 | Unclassified | 1188 |
| 343 | Ga0316577_10006636 | 3300031733 | Bacteria | 6127 |
| 344 | Ga0307413_10720004 | 3300031824 | Bacteria | 831 |
| 345 | Ga0307406_10098808 | 3300031901 | Unclassified | 1983 |
| 346 | Ga0307409_100590203 | 3300031995 | Bacteria | 1096 |
| 347 | Ga0307409_100595061 | 3300031995 | Bacteria | 1092 |
| 348 | Ga0307409_102379386 | 3300031995 | Bacteria | 559 |
| 349 | Ga0307416_100009750 | 3300032002 | Bacteria | 6309 |
| 350 | Ga0307416_100318507 | 3300032002 | Bacteria | 1556 |
| 351 | Ga0307416_100666218 | 3300032002 | Bacteria | 1127 |
| 352 | Ga0307414_10439129 | 3300032004 | Bacteria | 1142 |
| 353 | Ga0307411_10116737 | 3300032005 | Bacteria | 1922 |
| 354 | Ga0307411_10350905 | 3300032005 | Bacteria | 1203 |
| 355 | Ga0307411_11533639 | 3300032005 | Unclassified | 613 |
| 356 | Ga0307411_11816633 | 3300032005 | Bacteria | 566 |
| 357 | Ga0307415_100049572 | 3300032126 | Unclassified | 2840 |
| 358 | Ga0307415_100271254 | 3300032126 | Bacteria | 1390 |
| 359 | Ga0316592_1003672 | 3300033524 | Bacteria | 2789 |
| 360 | Ga0316586_1005815 | 3300033527 | Unclassified | 1750 |
| 361 | Ga0316596_1016396 | 3300033541 | Bacteria | 1856 |
| 362 | Ga0373932_0210354 | 3300035112 | Unclassified | 695 |
| 363 | Ga0373939_0066274 | 3300035114 | Bacteria | 1164 |
| 364 | Ga0373941_0051767 | 3300035115 | Bacteria | 1308 |
| 365 | Ga0373960_0141878 | 3300035121 | Archaea | 814 |
| 366 | Ga0373943_0049010 | 3300035170 | Bacteria | 2072 |
| 367 | Ga0373943_0220913 | 3300035170 | Unclassified | 1055 |
| 368 | Ga0373946_0370830 | 3300035171 | Unclassified | 719 |
| 369 | Ga0373942_0014346 | 3300035207 | Bacteria | 1917 |
| 370 | Ga0373961_0243217 | 3300035241 | Unclassified | 649 |
| 371 | Ga0373962_0101374 | 3300035242 | Unclassified | 898 |
| 372 | Ga0316574_0102454 | 3300035398 | Bacteria | 1832 |
| 373 | Ga0316574_0182863 | 3300035398 | Bacteria | 1348 |
| 374 | Ga0373931_0376764 | 3300035691 | Bacteria | 894 |
| 375 | Ga0373935_1212834 | 3300035692 | Unclassified | 563 |
| 376 | Ga0373933_0493891 | 3300035724 | Unclassified | 802 |
| 377 | Ga0373937_0233145 | 3300036401 | Bacteria | 1734 |
| 378 | Ga0373937_0586927 | 3300036401 | Bacteria | 1058 |
| 379 | Ga0373937_1140598 | 3300036401 | Bacteria | 728 |
| 380 | Ga0373937_1676381 | 3300036401 | Unclassified | 583 |
| 381 | Ga0316582_0223627 | 3300036647 | Bacteria | 1287 |
| 382 | Ga0316584_0018846 | 3300036712 | Bacteria | 4983 |
| 383 | Ga0316584_0283478 | 3300036712 | Bacteria | 1203 |
| 384 | Ga0373925_0346087 | 3300037068 | Bacteria | 1206 |
| 385 | Ga0373925_0352089 | 3300037068 | Unclassified | 1196 |
| 386 | Ga0373925_0700942 | 3300037068 | Unclassified | 835 |
| 387 | Ga0316581_0020617 | 3300037588 | Unclassified | 1931 |
| 388 | Ga0439461_0173613 | 3300041410 | Unclassified | 568 |
| 389 | Ga0439466_0087280 | 3300041411 | Unclassified | 980 |
| 390 | Ga0451789_1090341 | 3300041443 | Unclassified | 516 |
| 391 | Ga0451835_0118627 | 3300041492 | Unclassified | 726 |
| 392 | Ga0451855_1635569 | 3300041511 | Unclassified | 749 |
| 393 | Ga0451853_0255912 | 3300041512 | Unclassified | 904 |
| 394 | Ga0451853_2822633 | 3300041512 | Bacteria | 751 |
| 395 | Ga0451853_3051530 | 3300041512 | Unclassified | 716 |
| 396 | Ga0450919_004132 | 3300042121 | Bacteria | 1784 |
| 397 | Ga0450920_011506 | 3300042122 | Bacteria | 1650 |
| 398 | Ga0450923_000093 | 3300042125 | Bacteria | 7389 |
| 399 | Ga0450923_056685 | 3300042125 | Unclassified | 849 |
| 400 | Ga0450910_004880 | 3300042147 | Bacteria | 1821 |
| 401 | Ga0450910_011009 | 3300042147 | Bacteria | 1294 |
| 402 | Ga0439446_0095508 | 3300042156 | Bacteria | 935 |
| 403 | Ga0439446_0320546 | 3300042156 | Bacteria | 547 |
| 404 | Ga0450908_014990 | 3300042184 | Bacteria | 1389 |
| 405 | Ga0439434_0114170 | 3300042435 | Unclassified | 877 |
| 406 | Ga0439435_0010981 | 3300042436 | Bacteria | 2164 |
| 407 | Ga0439459_0249662 | 3300042438 | Unclassified | 501 |
| 408 | Ga0439460_0028510 | 3300042461 | Bacteria | 1576 |
| 409 | Ga0450918_023111 | 3300042531 | Bacteria | 1087 |
| 410 | Ga0451577_0014643 | 3300042876 | Bacteria | 7308 |
| 411 | Ga0451577_0183675 | 3300042876 | Bacteria | 1886 |
| 412 | Ga0451577_0409888 | 3300042876 | Unclassified | 1230 |
| 413 | Ga0453684_0222250 | 3300044712 | Bacteria | 2187 |
| 414 | Ga0453684_0480172 | 3300044712 | Bacteria | 1379 |
| 415 | Ga0453684_1336077 | 3300044712 | Bacteria | 746 |
| 416 | Ga0453684_2217502 | 3300044712 | Unclassified | 548 |
| 417 | Ga0451576_0071187 | 3300045051 | Bacteria | 3619 |
| 418 | Ga0451576_0208009 | 3300045051 | Bacteria | 2043 |
| 419 | Ga0451576_0734492 | 3300045051 | Bacteria | 1037 |
| 420 | Ga0451576_1407890 | 3300045051 | Bacteria | 725 |
| 421 | Ga0451576_1422171 | 3300045051 | Unclassified | 721 |
| 422 | Ga0451576_2347098 | 3300045051 | Bacteria | 546 |
| 423 | Ga0495592_0157104 | 3300046454 | Bacteria | 1568 |
| 424 | Ga0495603_0158973 | 3300046455 | Bacteria | 1311 |
| 425 | Ga0495603_0462236 | 3300046455 | Bacteria | 727 |
| 426 | Ga0495629_0253312 | 3300046459 | Bacteria | 1211 |
| 427 | Ga0495629_0553687 | 3300046459 | Bacteria | 772 |
| 428 | Ga0495651_0047581 | 3300046462 | Bacteria | 3315 |
| 429 | Ga0495653_0205626 | 3300046463 | Bacteria | 1333 |
| 430 | Ga0495653_0519798 | 3300046463 | Bacteria | 740 |
| 431 | Ga0495653_0537853 | 3300046463 | Bacteria | 724 |
| 432 | Ga0495582_0264676 | 3300046473 | Unclassified | 986 |
| 433 | Ga0495662_0296940 | 3300046476 | Unclassified | 795 |
| 434 | Ga0495664_0797029 | 3300046477 | Bacteria | 555 |
| 435 | Ga0495608_0187236 | 3300046511 | Bacteria | 1308 |
| 436 | Ga0495608_0388542 | 3300046511 | Bacteria | 855 |
| 437 | Ga0495630_0216879 | 3300046517 | Bacteria | 1461 |
| 438 | Ga0495630_0354393 | 3300046517 | Bacteria | 1123 |
| 439 | Ga0495630_0379490 | 3300046517 | Bacteria | 1083 |
| 440 | Ga0495586_0271352 | 3300046535 | Unclassified | 970 |
| 441 | Ga0495587_0158057 | 3300046536 | Bacteria | 1291 |
| 442 | Ga0495667_0034977 | 3300046559 | Bacteria | 3359 |
| 443 | Ga0495656_0034059 | 3300046615 | Unclassified | 2083 |
| 444 | Ga0495634_0042696 | 3300046642 | Bacteria | 3075 |
| 445 | Ga0495635_0245516 | 3300046663 | Bacteria | 1208 |
| 446 | Ga0495661_0467899 | 3300046665 | Unclassified | 605 |
| 447 | Ga0495657_0210428 | 3300046675 | Bacteria | 1182 |
| 448 | Ga0495646_0422756 | 3300046680 | Bacteria | 691 |
| 449 | Ga0495658_0498755 | 3300046683 | Bacteria | 779 |
| 450 | Ga0495613_0472958 | 3300046689 | Bacteria | 847 |
| 451 | Ga0495624_0249396 | 3300046690 | Bacteria | 1074 |
| 452 | Ga0495600_0097077 | 3300046809 | Bacteria | 1921 |
| 453 | Ga0495581_0258140 | 3300047315 | Unclassified | 1019 |
| 454 | Ga0495674_0159350 | 3300047319 | Bacteria | 1889 |
| 455 | Ga0495674_0176547 | 3300047319 | Bacteria | 1780 |
| 456 | Ga0495674_0554851 | 3300047319 | Bacteria | 914 |
| 457 | Ga0495676_0184085 | 3300047321 | Unclassified | 1462 |
| 458 | Ga0495680_0174420 | 3300047322 | Bacteria | 1555 |
| 459 | Ga0495680_0498011 | 3300047322 | Bacteria | 827 |
| 460 | Ga0495684_0044777 | 3300047471 | Unclassified | 3387 |
| 461 | Ga0496100_0098275 | 3300048903 | Bacteria | 2012 |
| 462 | Ga0496100_0489459 | 3300048903 | Bacteria | 947 |
| 463 | Ga0496100_0541096 | 3300048903 | Bacteria | 900 |
| 464 | Ga0496101_0029448 | 3300048904 | Bacteria | 3840 |
| 465 | Ga0496101_0202892 | 3300048904 | Archaea | 1534 |
| 466 | Ga0496101_0365800 | 3300048904 | Bacteria | 1134 |
| 467 | Ga0496101_0855686 | 3300048904 | Bacteria | 716 |
| 468 | Ga0496102_0329695 | 3300048905 | Bacteria | 1438 |
| 469 | Ga0496102_0432322 | 3300048905 | Bacteria | 1236 |
| 470 | Ga0496102_1189324 | 3300048905 | Bacteria | 682 |
| 471 | Ga0496103_0271824 | 3300048906 | Unclassified | 1090 |
| 472 | Ga0496104_0001663 | 3300048907 | Bacteria | 19213 |
| 473 | Ga0496104_0003658 | 3300048907 | Bacteria | 13274 |
| 474 | Ga0496104_0009378 | 3300048907 | Bacteria | 8705 |
| 475 | Ga0496104_0019665 | 3300048907 | Bacteria | 6184 |
| 476 | Ga0496104_0073010 | 3300048907 | Bacteria | 3264 |
| 477 | Ga0496105_0005723 | 3300048908 | Bacteria | 9461 |
| 478 | Ga0496105_0028741 | 3300048908 | Bacteria | 4549 |
| 479 | Ga0496105_0050162 | 3300048908 | Bacteria | 3447 |
| 480 | Ga0496105_0073139 | 3300048908 | Bacteria | 2832 |
| 481 | Ga0496105_0216809 | 3300048908 | Unclassified | 1559 |
| 482 | Ga0496105_0232199 | 3300048908 | Bacteria | 1499 |
| 483 | Ga0496106_0077675 | 3300048909 | Bacteria | 2546 |
| 484 | Ga0496106_0190833 | 3300048909 | Bacteria | 1629 |
| 485 | Ga0496106_0686940 | 3300048909 | Unclassified | 816 |
| 486 | Ga0496107_0107759 | 3300048910 | Bacteria | 2046 |
| 487 | Ga0496107_0167919 | 3300048910 | Bacteria | 1627 |
| 488 | Ga0496108_0001483 | 3300048911 | Bacteria | 18537 |
| 489 | Ga0496108_0014798 | 3300048911 | Bacteria | 6367 |
| 490 | Ga0496108_0028472 | 3300048911 | Bacteria | 4623 |
| 491 | Ga0496108_0261472 | 3300048911 | Bacteria | 1506 |
| 492 | Ga0496108_0357047 | 3300048911 | Bacteria | 1275 |
| 493 | Ga0496108_0571208 | 3300048911 | Unclassified | 986 |
| 494 | Ga0496108_0749151 | 3300048911 | Bacteria | 845 |
| 495 | Ga0496108_1056924 | 3300048911 | Unclassified | 691 |
| 496 | Ga0496108_1113143 | 3300048911 | Bacteria | 671 |
| 497 | Ga0496109_0008709 | 3300048912 | Bacteria | 8638 |
| 498 | Ga0496109_0015894 | 3300048912 | Bacteria | 6572 |
| 499 | Ga0496109_0024552 | 3300048912 | Bacteria | 5360 |
| 500 | Ga0496109_0081519 | 3300048912 | Bacteria | 2981 |
| 501 | Ga0496109_0859596 | 3300048912 | Unclassified | 845 |
| 502 | Ga0496109_1044104 | 3300048912 | Bacteria | 754 |
| 503 | Ga0496109_1200379 | 3300048912 | Archaea | 695 |
| 504 | Ga0496109_1489886 | 3300048912 | Unclassified | 612 |
| 505 | Ga0496110_0008234 | 3300048913 | Bacteria | 8380 |
| 506 | Ga0496110_0035729 | 3300048913 | Bacteria | 4313 |
| 507 | Ga0496110_0059254 | 3300048913 | Bacteria | 3374 |
| 508 | Ga0496110_0247589 | 3300048913 | Unclassified | 1622 |
| 509 | Ga0496110_0701255 | 3300048913 | Unclassified | 914 |
| 510 | Ga0496110_1146986 | 3300048913 | Unclassified | 686 |
| 511 | Ga0496110_1148740 | 3300048913 | Bacteria | 685 |
| 512 | Ga0496111_0001853 | 3300048914 | Bacteria | 12475 |
| 513 | Ga0496111_0029048 | 3300048914 | Bacteria | 3923 |
| 514 | Ga0496111_0246479 | 3300048914 | Bacteria | 1326 |
| 515 | Ga0496112_0000012 | 3300048915 | Bacteria | 243643 |
| 516 | Ga0496112_0002831 | 3300048915 | Bacteria | 14082 |
| 517 | Ga0496112_0056967 | 3300048915 | Bacteria | 3847 |
| 518 | Ga0496112_0438119 | 3300048915 | Bacteria | 1245 |
| 519 | Ga0496112_0824185 | 3300048915 | Unclassified | 852 |
| 520 | Ga0496112_1285304 | 3300048915 | Unclassified | 647 |
| 521 | Ga0496113_0010670 | 3300048916 | Bacteria | 6084 |
| 522 | Ga0496113_0518859 | 3300048916 | Unclassified | 956 |
| 523 | Ga0496113_1193465 | 3300048916 | Unclassified | 594 |
| 524 | Ga0496114_0005293 | 3300048917 | Bacteria | 10082 |
| 525 | Ga0496114_0400803 | 3300048917 | Unclassified | 1215 |
| 526 | Ga0496114_0686996 | 3300048917 | Bacteria | 898 |
| 527 | Ga0501321_020666 | 3300049537 | Bacteria | 816 |
| 528 | Ga0501031_0002020 | 3300049568 | Bacteria | 12777 |
| 529 | Ga0501031_0004346 | 3300049568 | Bacteria | 9166 |
| 530 | Ga0501031_0016100 | 3300049568 | Bacteria | 4855 |
| 531 | Ga0501031_0110220 | 3300049568 | Bacteria | 1797 |
| 532 | Ga0501031_0126364 | 3300049568 | Unclassified | 1670 |
| 533 | Ga0501031_0143647 | 3300049568 | Bacteria | 1559 |
| 534 | Ga0501031_0246550 | 3300049568 | Bacteria | 1161 |
| 535 | Ga0501031_0255523 | 3300049568 | Bacteria | 1139 |
| 536 | Ga0501031_1036955 | 3300049568 | Bacteria | 524 |
| 537 | Ga0501032_0043392 | 3300049569 | Bacteria | 3046 |
| 538 | Ga0501032_0063225 | 3300049569 | Bacteria | 2478 |
| 539 | Ga0501032_0275014 | 3300049569 | Bacteria | 1091 |
| 540 | Ga0501032_0380513 | 3300049569 | Bacteria | 908 |
| 541 | Ga0501032_0653003 | 3300049569 | Bacteria | 668 |
| 542 | Ga0501033_0014111 | 3300049570 | Bacteria | 6075 |
| 543 | Ga0501033_0051950 | 3300049570 | Bacteria | 3038 |
| 544 | Ga0501034_0134418 | 3300049571 | Bacteria | 2455 |
| 545 | Ga0501034_0327434 | 3300049571 | Bacteria | 1464 |
| 546 | Ga0501036_0006726 | 3300049572 | Bacteria | 9345 |
| 547 | Ga0501036_0075284 | 3300049572 | Bacteria | 2855 |
| 548 | Ga0501036_0078835 | 3300049572 | Bacteria | 2786 |
| 549 | Ga0501036_0104531 | 3300049572 | Bacteria | 2395 |
| 550 | Ga0501036_0105183 | 3300049572 | Bacteria | 2387 |
| 551 | Ga0501036_0114741 | 3300049572 | Bacteria | 2276 |
| 552 | Ga0501036_0438386 | 3300049572 | Bacteria | 1089 |
| 553 | Ga0501036_0507809 | 3300049572 | Unclassified | 1003 |
| 554 | Ga0501036_0634678 | 3300049572 | Bacteria | 885 |
| 555 | Ga0501036_0694006 | 3300049572 | Unclassified | 841 |
| 556 | Ga0501036_0736211 | 3300049572 | Unclassified | 814 |
| 557 | Ga0501037_0058493 | 3300049573 | Bacteria | 2813 |
| 558 | Ga0501037_0099383 | 3300049573 | Bacteria | 2101 |
| 559 | Ga0501037_0172987 | 3300049573 | Bacteria | 1534 |
| 560 | Ga0501038_0010392 | 3300049574 | Bacteria | 8509 |
| 561 | Ga0501038_0027225 | 3300049574 | Bacteria | 5089 |
| 562 | Ga0501038_0131056 | 3300049574 | Bacteria | 2059 |
| 563 | Ga0501038_0136775 | 3300049574 | Archaea | 2007 |
| 564 | Ga0501038_0188586 | 3300049574 | Unclassified | 1660 |
| 565 | Ga0501038_0198573 | 3300049574 | Bacteria | 1611 |
| 566 | Ga0501038_0311373 | 3300049574 | Unclassified | 1234 |
| 567 | Ga0501039_0022486 | 3300049575 | Bacteria | 4840 |
| 568 | Ga0501039_0036539 | 3300049575 | Bacteria | 3791 |
| 569 | Ga0501039_0044398 | 3300049575 | Bacteria | 3433 |
| 570 | Ga0501039_0047952 | 3300049575 | Bacteria | 3302 |
| 571 | Ga0501039_0070644 | 3300049575 | Bacteria | 2712 |
| 572 | Ga0501039_0225364 | 3300049575 | Bacteria | 1473 |
| 573 | Ga0501039_0370044 | 3300049575 | Unclassified | 1126 |
| 574 | Ga0501039_0414518 | 3300049575 | Unclassified | 1058 |
| 575 | Ga0501039_0429278 | 3300049575 | Unclassified | 1038 |
| 576 | Ga0501039_0605570 | 3300049575 | Unclassified | 859 |
| 577 | Ga0501040_0002881 | 3300049576 | Bacteria | 11118 |
| 578 | Ga0501040_0036632 | 3300049576 | Bacteria | 3330 |
| 579 | Ga0501040_0089487 | 3300049576 | Bacteria | 2139 |
| 580 | Ga0501040_0095884 | 3300049576 | Bacteria | 2065 |
| 581 | Ga0501040_0099144 | 3300049576 | Bacteria | 2031 |
| 582 | Ga0501040_0103176 | 3300049576 | Unclassified | 1991 |
| 583 | Ga0501040_0138401 | 3300049576 | Bacteria | 1714 |
| 584 | Ga0501040_0208750 | 3300049576 | Bacteria | 1388 |
| 585 | Ga0501040_0269063 | 3300049576 | Bacteria | 1217 |
| 586 | Ga0501040_0274204 | 3300049576 | Bacteria | 1204 |
| 587 | Ga0501040_0334382 | 3300049576 | Unclassified | 1084 |
| 588 | Ga0501040_0436755 | 3300049576 | Unclassified | 942 |
| 589 | Ga0501040_1013381 | 3300049576 | Unclassified | 602 |
| 590 | Ga0501040_1076188 | 3300049576 | Unclassified | 583 |
| 591 | Ga0501041_0008168 | 3300049577 | Bacteria | 6158 |
| 592 | Ga0501041_0026991 | 3300049577 | Bacteria | 3458 |
| 593 | Ga0501041_0031133 | 3300049577 | Bacteria | 3221 |
| 594 | Ga0501041_0091033 | 3300049577 | Unclassified | 1883 |
| 595 | Ga0501041_0105098 | 3300049577 | Unclassified | 1750 |
| 596 | Ga0501041_0181489 | 3300049577 | Bacteria | 1318 |
| 597 | Ga0501041_0185618 | 3300049577 | Bacteria | 1302 |
| 598 | Ga0501041_0204738 | 3300049577 | Bacteria | 1237 |
| 599 | Ga0501041_0371925 | 3300049577 | Unclassified | 904 |
| 600 | Ga0501041_0377359 | 3300049577 | Bacteria | 897 |
| 601 | Ga0501041_0642030 | 3300049577 | Unclassified | 678 |
| 602 | Ga0501041_0672850 | 3300049577 | Unclassified | 662 |
| 603 | Ga0501042_0013717 | 3300049578 | Bacteria | 5519 |
| 604 | Ga0501042_0102726 | 3300049578 | Bacteria | 2056 |
| 605 | Ga0501042_0105477 | 3300049578 | Unclassified | 2028 |
| 606 | Ga0501042_0203556 | 3300049578 | Bacteria | 1427 |
| 607 | Ga0501042_0241580 | 3300049578 | Bacteria | 1303 |
| 608 | Ga0501042_0270521 | 3300049578 | Bacteria | 1227 |
| 609 | Ga0501042_0405468 | 3300049578 | Bacteria | 988 |
| 610 | Ga0501042_0555024 | 3300049578 | Unclassified | 835 |
| 611 | Ga0501042_0906405 | 3300049578 | Bacteria | 642 |
| 612 | Ga0501043_0026684 | 3300049579 | Bacteria | 4531 |
| 613 | Ga0501043_0216005 | 3300049579 | Bacteria | 1485 |
| 614 | Ga0501043_0516454 | 3300049579 | Bacteria | 891 |
| 615 | Ga0501043_0623537 | 3300049579 | Bacteria | 794 |
| 616 | Ga0501043_0777199 | 3300049579 | Bacteria | 694 |
| 617 | Ga0501046_0013151 | 3300049580 | Bacteria | 7022 |
| 618 | Ga0501046_0025797 | 3300049580 | Bacteria | 4805 |
| 619 | Ga0501046_0116414 | 3300049580 | Unclassified | 2037 |
| 620 | Ga0501046_0308455 | 3300049580 | Bacteria | 1154 |
| 621 | Ga0501046_0493645 | 3300049580 | Unclassified | 877 |
| 622 | Ga0501048_0011975 | 3300049582 | Bacteria | 6467 |
| 623 | Ga0501048_0023689 | 3300049582 | Bacteria | 4484 |
| 624 | Ga0501048_0043639 | 3300049582 | Bacteria | 3209 |
| 625 | Ga0501048_0154679 | 3300049582 | Archaea | 1622 |
| 626 | Ga0501048_0222402 | 3300049582 | Bacteria | 1339 |
| 627 | Ga0501048_0252619 | 3300049582 | Bacteria | 1252 |
| 628 | Ga0501048_0286080 | 3300049582 | Bacteria | 1172 |
| 629 | Ga0501048_0749176 | 3300049582 | Bacteria | 702 |
| 630 | Ga0501067_0002476 | 3300049583 | Bacteria | 10192 |
| 631 | Ga0501067_0009644 | 3300049583 | Bacteria | 5344 |
| 632 | Ga0501067_0320455 | 3300049583 | Unclassified | 863 |
| 633 | Ga0501067_0551040 | 3300049583 | Unclassified | 646 |
| 634 | Ga0501068_0003199 | 3300049584 | Bacteria | 8773 |
| 635 | Ga0501068_0011244 | 3300049584 | Bacteria | 5048 |
| 636 | Ga0501068_0014796 | 3300049584 | Bacteria | 4465 |
| 637 | Ga0501068_0106716 | 3300049584 | Unclassified | 1739 |
| 638 | Ga0501068_0114740 | 3300049584 | Bacteria | 1677 |
| 639 | Ga0501068_0182296 | 3300049584 | Unclassified | 1328 |
| 640 | Ga0501068_0238324 | 3300049584 | Bacteria | 1157 |
| 641 | Ga0501068_0307167 | 3300049584 | Bacteria | 1016 |
| 642 | Ga0501069_0002734 | 3300049585 | Bacteria | 9005 |
| 643 | Ga0501069_0003134 | 3300049585 | Bacteria | 8475 |
| 644 | Ga0501069_0013735 | 3300049585 | Bacteria | 4320 |
| 645 | Ga0501069_0015264 | 3300049585 | Bacteria | 4116 |
| 646 | Ga0501069_0277094 | 3300049585 | Bacteria | 981 |
| 647 | Ga0501069_0301759 | 3300049585 | Bacteria | 939 |
| 648 | Ga0501069_0357993 | 3300049585 | Bacteria | 861 |
| 649 | Ga0501069_0542838 | 3300049585 | Unclassified | 695 |
| 650 | Ga0501070_0004617 | 3300049586 | Bacteria | 11811 |
| 651 | Ga0501070_0011535 | 3300049586 | Bacteria | 7459 |
| 652 | Ga0501070_0084747 | 3300049586 | Bacteria | 2624 |
| 653 | Ga0501070_0838144 | 3300049586 | Bacteria | 720 |
| 654 | Ga0501070_0926354 | 3300049586 | Unclassified | 679 |
| 655 | Ga0501071_0002112 | 3300049587 | Bacteria | 11925 |
| 656 | Ga0501071_0018211 | 3300049587 | Bacteria | 4859 |
| 657 | Ga0501071_0028286 | 3300049587 | Bacteria | 3950 |
| 658 | Ga0501071_0032462 | 3300049587 | Bacteria | 3707 |
| 659 | Ga0501071_0035600 | 3300049587 | Bacteria | 3546 |
| 660 | Ga0501071_0051534 | 3300049587 | Unclassified | 2966 |
| 661 | Ga0501071_0123989 | 3300049587 | Unclassified | 1916 |
| 662 | Ga0501071_0131714 | 3300049587 | Bacteria | 1858 |
| 663 | Ga0501071_0134703 | 3300049587 | Bacteria | 1837 |
| 664 | Ga0501071_0277364 | 3300049587 | Unclassified | 1268 |
| 665 | Ga0501071_0341715 | 3300049587 | Unclassified | 1138 |
| 666 | Ga0501071_0512748 | 3300049587 | Bacteria | 920 |
| 667 | Ga0501071_0697984 | 3300049587 | Unclassified | 781 |
| 668 | Ga0501071_0702540 | 3300049587 | Bacteria | 779 |
| 669 | Ga0501071_0818022 | 3300049587 | Bacteria | 718 |
| 670 | Ga0501071_0922816 | 3300049587 | Bacteria | 674 |
| 671 | Ga0501071_0996835 | 3300049587 | Bacteria | 647 |
| 672 | Ga0501071_1036227 | 3300049587 | Unclassified | 634 |
| 673 | Ga0501072_0008858 | 3300049588 | Bacteria | 7644 |
| 674 | Ga0501072_0026253 | 3300049588 | Bacteria | 4540 |
| 675 | Ga0501072_0034022 | 3300049588 | Bacteria | 3992 |
| 676 | Ga0501072_0042649 | 3300049588 | Unclassified | 3564 |
| 677 | Ga0501072_0052670 | 3300049588 | Unclassified | 3204 |
| 678 | Ga0501072_0074297 | 3300049588 | Bacteria | 2688 |
| 679 | Ga0501072_0254120 | 3300049588 | Bacteria | 1399 |
| 680 | Ga0501072_0262692 | 3300049588 | Bacteria | 1374 |
| 681 | Ga0501072_0279686 | 3300049588 | Bacteria | 1327 |
| 682 | Ga0501072_0606878 | 3300049588 | Bacteria | 862 |
| 683 | Ga0501072_0679647 | 3300049588 | Unclassified | 810 |
| 684 | Ga0501072_0789068 | 3300049588 | Bacteria | 744 |
| 685 | Ga0501072_1137154 | 3300049588 | Bacteria | 607 |
| 686 | Ga0501073_0021050 | 3300049589 | Bacteria | 4705 |
| 687 | Ga0501073_0141795 | 3300049589 | Bacteria | 1665 |
| 688 | Ga0501073_0174971 | 3300049589 | Bacteria | 1485 |
| 689 | Ga0501073_0285026 | 3300049589 | Bacteria | 1140 |
| 690 | Ga0501073_1169687 | 3300049589 | Bacteria | 528 |
| 691 | Ga0501074_0001666 | 3300049590 | Bacteria | 15114 |
| 692 | Ga0501074_0003913 | 3300049590 | Bacteria | 10610 |
| 693 | Ga0501074_0116907 | 3300049590 | Unclassified | 1908 |
| 694 | Ga0501074_0123611 | 3300049590 | Bacteria | 1851 |
| 695 | Ga0501074_0166706 | 3300049590 | Bacteria | 1573 |
| 696 | Ga0501074_0168230 | 3300049590 | Unclassified | 1565 |
| 697 | Ga0501074_0247227 | 3300049590 | Unclassified | 1268 |
| 698 | Ga0501074_0524190 | 3300049590 | Bacteria | 839 |
| 699 | Ga0501074_0535284 | 3300049590 | Bacteria | 829 |
| 700 | Ga0501074_0775915 | 3300049590 | Bacteria | 676 |
| 701 | Ga0501074_1256990 | 3300049590 | Bacteria | 519 |
| 702 | Ga0501075_0001781 | 3300049591 | Bacteria | 14177 |
| 703 | Ga0501075_0004911 | 3300049591 | Bacteria | 9115 |
| 704 | Ga0501075_0010519 | 3300049591 | Bacteria | 6503 |
| 705 | Ga0501075_0013739 | 3300049591 | Bacteria | 5786 |
| 706 | Ga0501075_0080017 | 3300049591 | Bacteria | 2473 |
| 707 | Ga0501075_0127031 | 3300049591 | Bacteria | 1942 |
| 708 | Ga0501075_0194046 | 3300049591 | Bacteria | 1549 |
| 709 | Ga0501075_0224506 | 3300049591 | Unclassified | 1433 |
| 710 | Ga0501075_0229391 | 3300049591 | Unclassified | 1416 |
| 711 | Ga0501075_0238548 | 3300049591 | Bacteria | 1386 |
| 712 | Ga0501076_0006758 | 3300049592 | Bacteria | 8325 |
| 713 | Ga0501076_0027428 | 3300049592 | Bacteria | 4417 |
| 714 | Ga0501076_0050210 | 3300049592 | Bacteria | 3300 |
| 715 | Ga0501076_0053557 | 3300049592 | Bacteria | 3198 |
| 716 | Ga0501076_0084096 | 3300049592 | Unclassified | 2556 |
| 717 | Ga0501076_0100029 | 3300049592 | Unclassified | 2336 |
| 718 | Ga0501076_0136327 | 3300049592 | Bacteria | 1992 |
| 719 | Ga0501076_0223139 | 3300049592 | Unclassified | 1540 |
| 720 | Ga0501076_0239469 | 3300049592 | Bacteria | 1484 |
| 721 | Ga0501076_0254549 | 3300049592 | Bacteria | 1437 |
| 722 | Ga0501076_0392712 | 3300049592 | Bacteria | 1141 |
| 723 | Ga0501076_0396065 | 3300049592 | Bacteria | 1135 |
| 724 | Ga0501076_0844947 | 3300049592 | Unclassified | 755 |
| 725 | Ga0501076_0992232 | 3300049592 | Bacteria | 692 |
| 726 | Ga0501076_1107643 | 3300049592 | Bacteria | 652 |
| 727 | Ga0501077_0006742 | 3300049593 | Bacteria | 7067 |
| 728 | Ga0501077_0014205 | 3300049593 | Bacteria | 4999 |
| 729 | Ga0501077_0053413 | 3300049593 | Unclassified | 2565 |
| 730 | Ga0501077_0061890 | 3300049593 | Bacteria | 2375 |
| 731 | Ga0501077_0118041 | 3300049593 | Unclassified | 1681 |
| 732 | Ga0501077_0130597 | 3300049593 | Bacteria | 1593 |
| 733 | Ga0501077_0241273 | 3300049593 | Unclassified | 1149 |
| 734 | Ga0501077_0521521 | 3300049593 | Unclassified | 762 |
| 735 | Ga0501077_0566573 | 3300049593 | Bacteria | 729 |
| 736 | Ga0501079_0002556 | 3300049741 | Bacteria | 13215 |
| 737 | Ga0501079_0021490 | 3300049741 | Unclassified | 4936 |
| 738 | Ga0501079_0029782 | 3300049741 | Bacteria | 4192 |
| 739 | Ga0501079_0049592 | 3300049741 | Bacteria | 3240 |
| 740 | Ga0501079_0051247 | 3300049741 | Bacteria | 3187 |
| 741 | Ga0501079_0084061 | 3300049741 | Bacteria | 2462 |
| 742 | Ga0501079_0098396 | 3300049741 | Bacteria | 2268 |
| 743 | Ga0501079_0188031 | 3300049741 | Bacteria | 1612 |
| 744 | Ga0501079_0284024 | 3300049741 | Unclassified | 1294 |
| 745 | Ga0501079_0347759 | 3300049741 | Bacteria | 1161 |
| 746 | Ga0501079_1057428 | 3300049741 | Unclassified | 639 |
| 747 | Ga0501079_1616659 | 3300049741 | Bacteria | 510 |
| 748 | Ga0501080_0018972 | 3300049742 | Bacteria | 6370 |
| 749 | Ga0501080_0049582 | 3300049742 | Bacteria | 3907 |
| 750 | Ga0501080_0093725 | 3300049742 | Unclassified | 2788 |
| 751 | Ga0501080_0147768 | 3300049742 | Bacteria | 2173 |
| 752 | Ga0501080_0276948 | 3300049742 | Bacteria | 1526 |
| 753 | Ga0501080_0322490 | 3300049742 | Archaea | 1398 |
| 754 | Ga0501080_0700447 | 3300049742 | Unclassified | 893 |
| 755 | Ga0501080_0743961 | 3300049742 | Unclassified | 863 |
| 756 | Ga0501080_0796928 | 3300049742 | Bacteria | 829 |
| 757 | Ga0501080_0946248 | 3300049742 | Bacteria | 749 |
| 758 | Ga0501080_1681475 | 3300049742 | Bacteria | 536 |
| 759 | Ga0501080_1889748 | 3300049742 | Unclassified | 500 |
| 760 | Ga0501081_0007332 | 3300049743 | Bacteria | 7158 |
| 761 | Ga0501081_0019175 | 3300049743 | Bacteria | 4550 |
| 762 | Ga0501081_0023814 | 3300049743 | Bacteria | 4106 |
| 763 | Ga0501081_0071439 | 3300049743 | Bacteria | 2419 |
| 764 | Ga0501081_0139699 | 3300049743 | Bacteria | 1736 |
| 765 | Ga0501081_0222193 | 3300049743 | Unclassified | 1374 |
| 766 | Ga0501081_0288607 | 3300049743 | Bacteria | 1202 |
| 767 | Ga0501081_0313754 | 3300049743 | Unclassified | 1152 |
| 768 | Ga0501081_0315208 | 3300049743 | Bacteria | 1149 |
| 769 | Ga0501081_1261708 | 3300049743 | Unclassified | 560 |
| 770 | Ga0501083_0079371 | 3300049744 | Bacteria | 2176 |
| 771 | Ga0501083_0119285 | 3300049744 | Unclassified | 1731 |
| 772 | Ga0501083_0183951 | 3300049744 | Bacteria | 1364 |
| 773 | Ga0501083_0265000 | 3300049744 | Unclassified | 1118 |
| 774 | Ga0501083_0467028 | 3300049744 | Bacteria | 821 |
| 775 | Ga0501083_0885672 | 3300049744 | Unclassified | 581 |
| 776 | Ga0501035_0004781 | 3300049822 | Bacteria | 12857 |
| 777 | Ga0501035_0304902 | 3300049822 | Unclassified | 1341 |
| 778 | Ga0501044_0082868 | 3300049823 | Bacteria | 3244 |
| 779 | Ga0501044_0540163 | 3300049823 | Unclassified | 1064 |
| 780 | Ga0501044_1674608 | 3300049823 | Unclassified | 501 |
| 781 | Ga0501045_0009720 | 3300049824 | Bacteria | 6730 |
| 782 | Ga0501045_0019962 | 3300049824 | Bacteria | 4783 |
| 783 | Ga0501045_0041490 | 3300049824 | Bacteria | 3348 |
| 784 | Ga0501045_0048391 | 3300049824 | Bacteria | 3099 |
| 785 | Ga0501045_0064804 | 3300049824 | Archaea | 2682 |
| 786 | Ga0501045_0146495 | 3300049824 | Bacteria | 1757 |
| 787 | Ga0501045_0158223 | 3300049824 | Bacteria | 1686 |
| 788 | Ga0501045_0325736 | 3300049824 | Bacteria | 1143 |
| 789 | Ga0501045_0564190 | 3300049824 | Unclassified | 844 |
| 790 | Ga0501045_0773173 | 3300049824 | Bacteria | 707 |
| 791 | Ga0501045_1295277 | 3300049824 | Bacteria | 530 |
| 792 | nmdc:mga05p37_1388272_c1 | 3300050507 | Unclassified | 708 |
| 793 | nmdc:mga05p37_1968_c1 | 3300050507 | Bacteria | 23961 |
| 794 | nmdc:mga06r32_628643_c1 | 3300050510 | Unclassified | 1043 |
| 795 | nmdc:mga08y16_37726_c1 | 3300050511 | Bacteria | 5072 |
| 796 | nmdc:mga0rr50_40033_c1 | 3300050513 | Bacteria | 3404 |
| 797 | Ga0495601_0115449 | 3300053077 | Bacteria | 1741 |
| 798 | Ga0495601_0147634 | 3300053077 | Bacteria | 1535 |
| 799 | Ga0495601_0339046 | 3300053077 | Bacteria | 978 |
| 800 | Ga0495612_0000203 | 3300053078 | Bacteria | 25447 |
| 801 | Ga0495612_0054765 | 3300053078 | Bacteria | 1644 |
| 802 | Ga0495595_0104603 | 3300053084 | Bacteria | 1368 |
| 803 | Ga0495619_0209818 | 3300053085 | Bacteria | 1349 |
| 804 | Ga0501084_0014654 | 3300054114 | Bacteria | 6499 |
| 805 | Ga0501084_0019672 | 3300054114 | Bacteria | 5625 |
| 806 | Ga0501084_0021496 | 3300054114 | Bacteria | 5379 |
| 807 | Ga0501084_0048616 | 3300054114 | Bacteria | 3550 |
| 808 | Ga0501084_0073678 | 3300054114 | Unclassified | 2859 |
| 809 | Ga0501084_0090222 | 3300054114 | Bacteria | 2573 |
| 810 | Ga0501084_0230299 | 3300054114 | Unclassified | 1564 |
| 811 | Ga0501084_0316962 | 3300054114 | Bacteria | 1317 |
| 812 | Ga0501084_0437174 | 3300054114 | Bacteria | 1106 |
| 813 | Ga0501084_0458476 | 3300054114 | Bacteria | 1078 |
| 814 | Ga0501084_0473013 | 3300054114 | Bacteria | 1059 |
| 815 | Ga0501084_0557279 | 3300054114 | Bacteria | 968 |
| 816 | Ga0501084_0660540 | 3300054114 | Bacteria | 882 |
| 817 | Ga0501084_0758544 | 3300054114 | Bacteria | 817 |
| 818 | Ga0501084_1055998 | 3300054114 | Bacteria | 682 |
| 819 | Ga0501084_1537976 | 3300054114 | Bacteria | 556 |
| 820 | Ga0501084_1647991 | 3300054114 | Unclassified | 536 |
| 821 | Ga0590071_001997 | 3300059421 | Bacteria | 5218 |
| 822 | Ga0590077_013955 | 3300059426 | Bacteria | 1672 |
| 823 | Ga0501082_0002611 | 3300060353 | Bacteria | 15748 |
| 824 | Ga0501082_0057220 | 3300060353 | Bacteria | 3359 |
| 825 | Ga0501082_0091952 | 3300060353 | Unclassified | 2620 |
| 826 | Ga0501082_0106552 | 3300060353 | Bacteria | 2425 |
| 827 | Ga0501082_0144403 | 3300060353 | Bacteria | 2065 |
| 828 | Ga0501082_0186115 | 3300060353 | Bacteria | 1807 |
| 829 | Ga0501082_0240338 | 3300060353 | Bacteria | 1576 |
| 830 | Ga0501082_0449209 | 3300060353 | Unclassified | 1126 |
| 831 | Ga0530510_0002417 | 3300061734 | Bacteria | 12865 |
| 832 | Ga0530510_0003002 | 3300061734 | Bacteria | 11570 |
| 833 | Ga0530510_0003811 | 3300061734 | Bacteria | 10392 |
| 834 | Ga0530510_0027651 | 3300061734 | Unclassified | 4064 |
| 835 | Ga0530510_0031510 | 3300061734 | Unclassified | 3812 |
| 836 | Ga0530510_0035273 | 3300061734 | Bacteria | 3605 |
| 837 | Ga0530510_0037843 | 3300061734 | Bacteria | 3480 |
| 838 | Ga0530510_0056080 | 3300061734 | Bacteria | 2846 |
| 839 | Ga0530510_0060762 | 3300061734 | Archaea | 2735 |
| 840 | Ga0530510_0104721 | 3300061734 | Unclassified | 2070 |
| 841 | Ga0530510_0141774 | 3300061734 | Bacteria | 1771 |
| 842 | Ga0530510_0156129 | 3300061734 | Unclassified | 1686 |
| 843 | Ga0530510_0176177 | 3300061734 | Bacteria | 1585 |
| 844 | Ga0530510_0216595 | 3300061734 | Bacteria | 1423 |
| 845 | Ga0530510_0407032 | 3300061734 | Bacteria | 1026 |
| 846 | Ga0530510_0892550 | 3300061734 | Unclassified | 679 |
| 847 | Ga0495586_0313343 | |||
| 848 | JGI24751J29686_10040609 | |||
| 849 | JGI26129J50193_1000841 | |||
| 850 | Ga0065715_10192854 | |||
| 851 | Ga0070683_100141862 | |||
| 852 | Ga0070683_100308656 | |||
| 853 | Ga0070683_100348399 | |||
| 854 | Ga0070683_100492560 | |||
| 855 | Ga0070690_100588471 | |||
| 856 | Ga0070670_101471874 | |||
| 857 | Ga0068869_100375491 | |||
| 858 | Ga0068869_100419639 | |||
| 859 | Ga0070666_10181643 | |||
| 860 | Ga0070680_100563290 | |||
| 861 | Ga0070682_100145823 | |||
| 862 | Ga0068868_100421540 | |||
| 863 | Ga0068868_100571289 | |||
| 864 | Ga0068868_100931016 | |||
| 865 | Ga0068868_101173001 | |||
| 866 | Ga0070660_100623906 | |||
| 867 | Ga0070689_102195008 | |||
| 868 | Ga0070687_100713026 | |||
| 869 | Ga0070687_101348675 | |||
| 870 | Ga0070661_101586125 | |||
| 871 | Ga0070692_10076684 | |||
| 872 | Ga0070692_10883176 | |||
| 873 | Ga0070668_101079220 | |||
| 874 | Ga0070669_100601685 | |||
| 875 | Ga0070675_100395920 | |||
| 876 | Ga0070674_100040870 | |||
| 877 | Ga0070674_100102902 | |||
| 878 | Ga0070674_100110206 | |||
| 879 | Ga0070688_100644933 | |||
| 880 | Ga0070688_101520373 | |||
| 881 | Ga0070659_100822732 | |||
| 882 | Ga0070667_100140020 | |||
| 883 | Ga0070703_10113273 | |||
| 884 | Ga0070714_100024950 | |||
| 885 | Ga0070714_100287512 | |||
| 886 | Ga0070701_10767800 | |||
| 887 | Ga0070705_100278846 | |||
| 888 | Ga0070705_101279677 | |||
| 889 | Ga0070694_100001806 | |||
| 890 | Ga0070694_100249381 | |||
| 891 | Ga0070694_100545666 | |||
| 892 | Ga0070694_100631096 | |||
| 893 | Ga0070708_100008964 | |||
| 894 | Ga0070708_100014992 | |||
| 895 | Ga0070708_100079211 | |||
| 896 | Ga0070708_100400820 | |||
| 897 | Ga0070681_10091928 | |||
| 898 | Ga0068867_100087308 | |||
| 899 | Ga0070685_10143969 | |||
| 900 | Ga0070706_100071595 | |||
| 901 | Ga0070706_100127231 | |||
| 902 | Ga0070707_100046795 | |||
| 903 | Ga0070698_100038976 | |||
| 904 | Ga0070698_100212429 | |||
| 905 | Ga0070698_100926857 | |||
| 906 | Ga0070684_100017931 | |||
| 907 | Ga0070684_100303282 | |||
| 908 | Ga0070684_100477814 | |||
| 909 | Ga0070697_100343617 | |||
| 910 | Ga0068853_100501264 | |||
| 911 | Ga0070672_100386463 | |||
| 912 | Ga0070686_100010945 | |||
| 913 | Ga0070686_100108291 | |||
| 914 | Ga0070696_100500915 | |||
| 915 | Ga0070696_100738357 | |||
| 916 | Ga0070693_100229336 | |||
| 917 | Ga0070693_100243080 | |||
| 918 | Ga0070665_101820598 | |||
| 919 | Ga0070704_100151703 | |||
| 920 | Ga0070704_101119232 | |||
| 921 | Ga0070664_100073153 | |||
| 922 | Ga0070664_100704851 | |||
| 923 | Ga0070664_100875005 | |||
| 924 | Ga0070664_101014800 | |||
| 925 | Ga0068857_100062594 | |||
| 926 | Ga0068857_100171149 | |||
| 927 | Ga0068857_100407967 | |||
| 928 | Ga0068857_100530487 | |||
| 929 | Ga0068857_102490012 | |||
| 930 | Ga0068854_100396563 | |||
| 931 | Ga0068856_100241135 | |||
| 932 | Ga0068856_102203087 | |||
| 933 | Ga0068856_102383627 | |||
| 934 | Ga0070702_100033848 | |||
| 935 | Ga0070702_100947223 | |||
| 936 | Ga0068859_100564913 | |||
| 937 | Ga0068864_100035416 | |||
| 938 | Ga0068864_100200705 | |||
| 939 | Ga0068864_100367286 | |||
| 940 | Ga0068864_100453016 | |||
| 941 | Ga0068864_101289404 | |||
| 942 | Ga0068861_100894666 | |||
| 943 | Ga0068870_10189070 | |||
| 944 | Ga0068863_100156394 | |||
| 945 | Ga0068863_100876426 | |||
| 946 | Ga0068863_101218035 | |||
| 947 | Ga0068858_100774222 | |||
| 948 | Ga0068858_101152220 | |||
| 949 | Ga0068860_100355640 | |||
| 950 | Ga0068862_100218939 | |||
| 951 | Ga0068862_101157677 | |||
| 952 | Ga0081455_10194303 | |||
| 953 | Ga0070717_10004633 | |||
| 954 | Ga0097621_100893756 | |||
| 955 | Ga0075428_100001182 | |||
| 956 | Ga0075431_100396446 | |||
| 957 | Ga0075433_10051692 | |||
| 958 | Ga0075434_100086236 | |||
| 959 | Ga0097620_100564869 | |||
| 960 | Ga0075435_100032533 | |||
| 961 | Ga0075435_100263803 | |||
| 962 | Ga0105251_10541692 | |||
| 963 | Ga0105240_12374229 | |||
| 964 | Ga0111539_10015824 | |||
| 965 | Ga0105245_10115070 | |||
| 966 | Ga0105245_10215866 | |||
| 967 | Ga0105245_10230624 | |||
| 968 | Ga0105245_10359110 | |||
| 969 | Ga0105247_10073191 | |||
| 970 | Ga0114129_10000286 | |||
| 971 | Ga0114129_11434423 | |||
| 972 | Ga0105243_10016596 | |||
| 973 | Ga0105243_10022853 | |||
| 974 | Ga0105243_10136985 | |||
| 975 | Ga0105241_10588348 | |||
| 976 | Ga0105242_10056453 | |||
| 977 | Ga0105248_11283381 | |||
| 978 | Ga0105249_10026689 | |||
| 979 | Ga0105249_10387907 | |||
| 980 | Ga0105249_10554939 | |||
| 981 | Ga0105249_12001442 | |||
| 982 | Ga0105246_10025408 | |||
| 983 | Ga0105246_10166331 | |||
| 984 | Ga0105246_11321905 | |||
| 985 | Ga0157373_10416866 | |||
| 986 | Ga0157374_10203916 | |||
| 987 | Ga0157374_10612452 | |||
| 988 | Ga0157378_10021069 | |||
| 989 | Ga0157378_10082199 | |||
| 990 | Ga0157378_10831700 | |||
| 991 | Ga0163162_10145513 | |||
| 992 | Ga0163162_10638955 | |||
| 993 | Ga0157375_10015545 | |||
| 994 | Ga0157375_10024796 | |||
| 995 | Ga0157375_10161444 | |||
| 996 | Ga0157375_10175692 | |||
| 997 | Ga0163163_10017578 | |||
| 998 | Ga0163163_10063661 | |||
| 999 | Ga0163163_10070836 | |||
| 1000 | Ga0163163_10272713 | |||
| 1001 | Ga0163163_10471319 | |||
| 1002 | Ga0163163_10504774 | |||
| 1003 | Ga0163163_11197557 | |||
| 1004 | Ga0163163_11718142 | |||
| 1005 | Ga0163163_11783793 | |||
| 1006 | Ga0163163_11926580 | |||
| 1007 | Ga0163163_12067347 | |||
| 1008 | Ga0157380_10151235 | |||
| 1009 | Ga0157380_10526006 | |||
| 1010 | Ga0157380_11082832 | |||
| 1011 | Ga0157380_11125808 | |||
| 1012 | Ga0157380_12660307 | |||
| 1013 | Ga0157377_10068554 | |||
| 1014 | Ga0157377_10106218 | |||
| 1015 | Ga0157377_10365524 | |||
| 1016 | Ga0157379_10027724 | |||
| 1017 | Ga0157379_10170160 | |||
| 1018 | Ga0157379_10398118 | |||
| 1019 | Ga0157379_10494831 | |||
| 1020 | Ga0157379_10731651 | |||
| 1021 | Ga0157376_10252941 | |||
| 1022 | Ga0157376_10998946 | |||
| 1023 | Ga0163161_10010120 | |||
| 1024 | Ga0163161_11930362 | |||
| 1025 | Ga0207653_10104235 | |||
| 1026 | Ga0207710_10037066 | |||
| 1027 | Ga0207643_10176499 | |||
| 1028 | Ga0207684_10065853 | |||
| 1029 | Ga0207654_10786187 | |||
| 1030 | Ga0207662_10661109 | |||
| 1031 | Ga0207646_10013021 | |||
| 1032 | Ga0207646_10759913 | |||
| 1033 | Ga0207681_10578704 | |||
| 1034 | Ga0207694_10345775 | |||
| 1035 | Ga0207650_10334973 | |||
| 1036 | Ga0207659_10172156 | |||
| 1037 | Ga0207659_10434881 | |||
| 1038 | Ga0207659_10718895 | |||
| 1039 | Ga0207687_10302259 | |||
| 1040 | Ga0207687_10412281 | |||
| 1041 | Ga0207687_10515387 | |||
| 1042 | Ga0207687_10626495 | |||
| 1043 | Ga0207687_10676073 | |||
| 1044 | Ga0207644_11766155 | |||
| 1045 | Ga0207706_10861678 | |||
| 1046 | Ga0207686_10096360 | |||
| 1047 | Ga0207709_10164561 | |||
| 1048 | Ga0207670_10707128 | |||
| 1049 | Ga0207669_10063804 | |||
| 1050 | Ga0207669_10068893 | |||
| 1051 | Ga0207691_10270243 | |||
| 1052 | Ga0207691_10347905 | |||
| 1053 | Ga0207711_11100984 | |||
| 1054 | Ga0207689_10258350 | |||
| 1055 | Ga0207661_10162152 | |||
| 1056 | Ga0207661_10287517 | |||
| 1057 | Ga0207661_10378361 | |||
| 1058 | Ga0207679_10031564 | |||
| 1059 | Ga0207679_10042742 | |||
| 1060 | Ga0207679_10765119 | |||
| 1061 | Ga0207679_10827771 | |||
| 1062 | Ga0207667_10324604 | |||
| 1063 | Ga0207651_11342222 | |||
| 1064 | Ga0207712_10118924 | |||
| 1065 | Ga0207712_10959877 | |||
| 1066 | Ga0207668_10380030 | |||
| 1067 | Ga0207640_10110141 | |||
| 1068 | Ga0207658_10645432 | |||
| 1069 | Ga0207677_10345102 | |||
| 1070 | Ga0207703_10235490 | |||
| 1071 | Ga0207703_11353516 | |||
| 1072 | Ga0207639_10445461 | |||
| 1073 | Ga0207678_10634726 | |||
| 1074 | Ga0207708_10105314 | |||
| 1075 | Ga0207708_10410503 | |||
| 1076 | Ga0207708_11423877 | |||
| 1077 | Ga0207702_11364241 | |||
| 1078 | Ga0207641_10106456 | |||
| 1079 | Ga0207641_10114125 | |||
| 1080 | Ga0207641_10474697 | |||
| 1081 | Ga0207648_10016610 | |||
| 1082 | Ga0207648_10398406 | |||
| 1083 | Ga0207648_10884702 | |||
| 1084 | Ga0207648_10886035 | |||
| 1085 | Ga0207676_10120228 | |||
| 1086 | Ga0207676_10148981 | |||
| 1087 | Ga0207676_10568828 | |||
| 1088 | Ga0207676_10857546 | |||
| 1089 | Ga0207676_10978950 | |||
| 1090 | Ga0207674_10862862 | |||
| 1091 | Ga0207674_10890979 | |||
| 1092 | Ga0207674_10909778 | |||
| 1093 | Ga0207674_11007848 | |||
| 1094 | Ga0207675_100397601 | |||
| 1095 | Ga0207675_101533784 | |||
| 1096 | Ga0207683_10991224 | |||
| 1097 | Ga0207698_10213543 | |||
| 1098 | Ga0209973_1007531 | |||
| 1099 | Ga0209968_1003052 | |||
| 1100 | Ga0209999_1020279 | |||
| 1101 | Ga0209999_1093959 | |||
| 1102 | Ga0209982_1050392 | |||
| 1103 | Ga0209970_1021101 | |||
| 1104 | Ga0209970_1047325 | |||
| 1105 | Ga0209983_1014764 | |||
| 1106 | Ga0209983_1044483 | |||
| 1107 | Ga0209971_1002642 | |||
| 1108 | Ga0209971_1009644 | |||
| 1109 | Ga0209966_1001464 | |||
| 1110 | Ga0209966_1006311 | |||
| 1111 | Ga0209998_10000084 | |||
| 1112 | Ga0209998_10007931 | |||
| 1113 | Ga0209998_10020145 | |||
| 1114 | Ga0209974_10000371 | |||
| 1115 | Ga0209974_10001443 | |||
| 1116 | Ga0209974_10115029 | |||
| 1117 | Ga0207428_10070341 | |||
| 1118 | Ga0268266_12184994 | |||
| 1119 | Ga0268265_10339299 | |||
| 1120 | Ga0268265_11192121 | |||
| 1121 | Ga0268264_10032460 | |||
| 1122 | Ga0268264_12110149 | |||
| 1123 | Ga0265337_1024169 | |||
| 1124 | Ga0265326_10024283 | |||
| 1125 | Ga0265326_10120116 | |||
| 1126 | Ga0265319_1001557 | |||
| 1127 | Ga0265319_1019322 | |||
| 1128 | Ga0265319_1030383 | |||
| 1129 | Ga0265319_1041743 | |||
| 1130 | Ga0265334_10009016 | |||
| 1131 | Ga0265334_10031842 | |||
| 1132 | Ga0265334_10063716 | |||
| 1133 | Ga0265318_10003654 | |||
| 1134 | Ga0265318_10011724 | |||
| 1135 | Ga0265318_10034376 | |||
| 1136 | Ga0265318_10038682 | |||
| 1137 | Ga0265318_10059555 | |||
| 1138 | Ga0265318_10097274 | |||
| 1139 | Ga0265323_10024956 | |||
| 1140 | Ga0265322_10009410 | |||
| 1141 | Ga0265322_10022289 | |||
| 1142 | Ga0265336_10038511 | |||
| 1143 | Ga0265336_10183432 | |||
| 1144 | Ga0265338_10106050 | |||
| 1145 | Ga0265338_10109029 | |||
| 1146 | Ga0265338_10326628 | |||
| 1147 | Ga0265324_10026902 | |||
| 1148 | Ga0265330_10073611 | |||
| 1149 | Ga0265330_10169071 | |||
| 1150 | Ga0265332_10009447 | |||
| 1151 | Ga0265332_10041194 | |||
| 1152 | Ga0265332_10123355 | |||
| 1153 | Ga0265320_10006513 | |||
| 1154 | Ga0265320_10016150 | |||
| 1155 | Ga0265320_10020855 | |||
| 1156 | Ga0265320_10346483 | |||
| 1157 | Ga0265325_10029964 | |||
| 1158 | Ga0265325_10081729 | |||
| 1159 | Ga0265325_10108496 | |||
| 1160 | Ga0265325_10113822 | |||
| 1161 | Ga0265329_10002514 | |||
| 1162 | Ga0265329_10005869 | |||
| 1163 | Ga0265329_10145894 | |||
| 1164 | Ga0265340_10011524 | |||
| 1165 | Ga0265340_10013761 | |||
| 1166 | Ga0265339_10055404 | |||
| 1167 | Ga0265339_10147196 | |||
| 1168 | Ga0265339_10184469 | |||
| 1169 | Ga0265331_10023966 | |||
| 1170 | Ga0265331_10024165 | |||
| 1171 | Ga0265331_10143826 | |||
| 1172 | Ga0265316_10059121 | |||
| 1173 | Ga0265316_10069516 | |||
| 1174 | Ga0265316_10082574 | |||
| 1175 | Ga0265316_10137681 | |||
| 1176 | Ga0265316_10922924 | |||
| 1177 | Ga0265314_10004439 | |||
| 1178 | Ga0265314_10020911 | |||
| 1179 | Ga0265314_10021387 | |||
| 1180 | Ga0265314_10320668 | |||
| 1181 | Ga0265314_10494982 | |||
| 1182 | Ga0265342_10028561 | |||
| 1183 | Ga0265342_10036239 | |||
| 1184 | Ga0265342_10046397 | |||
| 1185 | Ga0316576_10040749 | |||
| 1186 | Ga0316576_10149259 | |||
| 1187 | Ga0316578_10330238 | |||
| 1188 | Ga0307405_10317922 | |||
| 1189 | Ga0316577_10006636 | |||
| 1190 | Ga0307413_10720004 | |||
| 1191 | Ga0307406_10098808 | |||
| 1192 | Ga0307409_100590203 | |||
| 1193 | Ga0307409_100595061 | |||
| 1194 | Ga0307409_102379386 | |||
| 1195 | Ga0307416_100009750 | |||
| 1196 | Ga0307416_100318507 | |||
| 1197 | Ga0307416_100666218 | |||
| 1198 | Ga0307414_10439129 | |||
| 1199 | Ga0307411_10116737 | |||
| 1200 | Ga0307411_10350905 | |||
| 1201 | Ga0307411_11533639 | |||
| 1202 | Ga0307411_11816633 | |||
| 1203 | Ga0307415_100049572 | |||
| 1204 | Ga0307415_100271254 | |||
| 1205 | Ga0316592_1003672 | |||
| 1206 | Ga0316586_1005815 | |||
| 1207 | Ga0316596_1016396 | |||
| 1208 | Ga0373932_0210354 | |||
| 1209 | Ga0373939_0066274 | |||
| 1210 | Ga0373941_0051767 | |||
| 1211 | Ga0373960_0141878 | |||
| 1212 | Ga0373943_0049010 | |||
| 1213 | Ga0373943_0220913 | |||
| 1214 | Ga0373946_0370830 | |||
| 1215 | Ga0373942_0014346 | |||
| 1216 | Ga0373961_0243217 | |||
| 1217 | Ga0373962_0101374 | |||
| 1218 | Ga0316574_0102454 | |||
| 1219 | Ga0316574_0182863 | |||
| 1220 | Ga0373931_0376764 | |||
| 1221 | Ga0373935_1212834 | |||
| 1222 | Ga0373933_0493891 | |||
| 1223 | Ga0373937_0233145 | |||
| 1224 | Ga0373937_0586927 | |||
| 1225 | Ga0373937_1140598 | |||
| 1226 | Ga0373937_1676381 | |||
| 1227 | Ga0316582_0223627 | |||
| 1228 | Ga0316584_0018846 | |||
| 1229 | Ga0316584_0283478 | |||
| 1230 | Ga0373925_0346087 | |||
| 1231 | Ga0373925_0352089 | |||
| 1232 | Ga0373925_0700942 | |||
| 1233 | Ga0316581_0020617 | |||
| 1234 | Ga0439461_0173613 | |||
| 1235 | Ga0439466_0087280 | |||
| 1236 | Ga0451789_1090341 | |||
| 1237 | Ga0451835_0118627 | |||
| 1238 | Ga0451855_1635569 | |||
| 1239 | Ga0451853_0255912 | |||
| 1240 | Ga0451853_2822633 | |||
| 1241 | Ga0451853_3051530 | |||
| 1242 | Ga0450919_004132 | |||
| 1243 | Ga0450920_011506 | |||
| 1244 | Ga0450923_000093 | |||
| 1245 | Ga0450923_056685 | |||
| 1246 | Ga0450910_004880 | |||
| 1247 | Ga0450910_011009 | |||
| 1248 | Ga0439446_0095508 | |||
| 1249 | Ga0439446_0320546 | |||
| 1250 | Ga0450908_014990 | |||
| 1251 | Ga0439434_0114170 | |||
| 1252 | Ga0439435_0010981 | |||
| 1253 | Ga0439459_0249662 | |||
| 1254 | Ga0439460_0028510 | |||
| 1255 | Ga0450918_023111 | |||
| 1256 | Ga0451577_0014643 | |||
| 1257 | Ga0451577_0183675 | |||
| 1258 | Ga0451577_0409888 | |||
| 1259 | Ga0453684_0222250 | |||
| 1260 | Ga0453684_0480172 | |||
| 1261 | Ga0453684_1336077 | |||
| 1262 | Ga0453684_2217502 | |||
| 1263 | Ga0451576_0071187 | |||
| 1264 | Ga0451576_0208009 | |||
| 1265 | Ga0451576_0734492 | |||
| 1266 | Ga0451576_1407890 | |||
| 1267 | Ga0451576_1422171 | |||
| 1268 | Ga0451576_2347098 | |||
| 1269 | Ga0495592_0157104 | |||
| 1270 | Ga0495603_0158973 | |||
| 1271 | Ga0495603_0462236 | |||
| 1272 | Ga0495629_0253312 | |||
| 1273 | Ga0495629_0553687 | |||
| 1274 | Ga0495651_0047581 | |||
| 1275 | Ga0495653_0205626 | |||
| 1276 | Ga0495653_0519798 | |||
| 1277 | Ga0495653_0537853 | |||
| 1278 | Ga0495582_0264676 | |||
| 1279 | Ga0495662_0296940 | |||
| 1280 | Ga0495664_0797029 | |||
| 1281 | Ga0495608_0187236 | |||
| 1282 | Ga0495608_0388542 | |||
| 1283 | Ga0495630_0216879 | |||
| 1284 | Ga0495630_0354393 | |||
| 1285 | Ga0495630_0379490 | |||
| 1286 | Ga0495586_0271352 | |||
| 1287 | Ga0495587_0158057 | |||
| 1288 | Ga0495667_0034977 | |||
| 1289 | Ga0495656_0034059 | |||
| 1290 | Ga0495634_0042696 | |||
| 1291 | Ga0495635_0245516 | |||
| 1292 | Ga0495661_0467899 | |||
| 1293 | Ga0495657_0210428 | |||
| 1294 | Ga0495646_0422756 | |||
| 1295 | Ga0495658_0498755 | |||
| 1296 | Ga0495613_0472958 | |||
| 1297 | Ga0495624_0249396 | |||
| 1298 | Ga0495600_0097077 | |||
| 1299 | Ga0495581_0258140 | |||
| 1300 | Ga0495674_0159350 | |||
| 1301 | Ga0495674_0176547 | |||
| 1302 | Ga0495674_0554851 | |||
| 1303 | Ga0495676_0184085 | |||
| 1304 | Ga0495680_0174420 | |||
| 1305 | Ga0495680_0498011 | |||
| 1306 | Ga0495684_0044777 | |||
| 1307 | Ga0496100_0098275 | |||
| 1308 | Ga0496100_0489459 | |||
| 1309 | Ga0496100_0541096 | |||
| 1310 | Ga0496101_0029448 | |||
| 1311 | Ga0496101_0202892 | |||
| 1312 | Ga0496101_0365800 | |||
| 1313 | Ga0496101_0855686 | |||
| 1314 | Ga0496102_0329695 | |||
| 1315 | Ga0496102_0432322 | |||
| 1316 | Ga0496102_1189324 | |||
| 1317 | Ga0496103_0271824 | |||
| 1318 | Ga0496104_0001663 | |||
| 1319 | Ga0496104_0003658 | |||
| 1320 | Ga0496104_0009378 | |||
| 1321 | Ga0496104_0019665 | |||
| 1322 | Ga0496104_0073010 | |||
| 1323 | Ga0496105_0005723 | |||
| 1324 | Ga0496105_0028741 | |||
| 1325 | Ga0496105_0050162 | |||
| 1326 | Ga0496105_0073139 | |||
| 1327 | Ga0496105_0216809 | |||
| 1328 | Ga0496105_0232199 | |||
| 1329 | Ga0496106_0077675 | |||
| 1330 | Ga0496106_0190833 | |||
| 1331 | Ga0496106_0686940 | |||
| 1332 | Ga0496107_0107759 | |||
| 1333 | Ga0496107_0167919 | |||
| 1334 | Ga0496108_0001483 | |||
| 1335 | Ga0496108_0014798 | |||
| 1336 | Ga0496108_0028472 | |||
| 1337 | Ga0496108_0261472 | |||
| 1338 | Ga0496108_0357047 | |||
| 1339 | Ga0496108_0571208 | |||
| 1340 | Ga0496108_0749151 | |||
| 1341 | Ga0496108_1056924 | |||
| 1342 | Ga0496108_1113143 | |||
| 1343 | Ga0496109_0008709 | |||
| 1344 | Ga0496109_0015894 | |||
| 1345 | Ga0496109_0024552 | |||
| 1346 | Ga0496109_0081519 | |||
| 1347 | Ga0496109_0859596 | |||
| 1348 | Ga0496109_1044104 | |||
| 1349 | Ga0496109_1200379 | |||
| 1350 | Ga0496109_1489886 | |||
| 1351 | Ga0496110_0008234 | |||
| 1352 | Ga0496110_0035729 | |||
| 1353 | Ga0496110_0059254 | |||
| 1354 | Ga0496110_0247589 | |||
| 1355 | Ga0496110_0701255 | |||
| 1356 | Ga0496110_1146986 | |||
| 1357 | Ga0496110_1148740 | |||
| 1358 | Ga0496111_0001853 | |||
| 1359 | Ga0496111_0029048 | |||
| 1360 | Ga0496111_0246479 | |||
| 1361 | Ga0496112_0000012 | |||
| 1362 | Ga0496112_0002831 | |||
| 1363 | Ga0496112_0056967 | |||
| 1364 | Ga0496112_0438119 | |||
| 1365 | Ga0496112_0824185 | |||
| 1366 | Ga0496112_1285304 | |||
| 1367 | Ga0496113_0010670 | |||
| 1368 | Ga0496113_0518859 | |||
| 1369 | Ga0496113_1193465 | |||
| 1370 | Ga0496114_0005293 | |||
| 1371 | Ga0496114_0400803 | |||
| 1372 | Ga0496114_0686996 | |||
| 1373 | Ga0501321_020666 | |||
| 1374 | Ga0501031_0002020 | |||
| 1375 | Ga0501031_0004346 | |||
| 1376 | Ga0501031_0016100 | |||
| 1377 | Ga0501031_0110220 | |||
| 1378 | Ga0501031_0126364 | |||
| 1379 | Ga0501031_0143647 | |||
| 1380 | Ga0501031_0246550 | |||
| 1381 | Ga0501031_0255523 | |||
| 1382 | Ga0501031_1036955 | |||
| 1383 | Ga0501032_0043392 | |||
| 1384 | Ga0501032_0063225 | |||
| 1385 | Ga0501032_0275014 | |||
| 1386 | Ga0501032_0380513 | |||
| 1387 | Ga0501032_0653003 | |||
| 1388 | Ga0501033_0014111 | |||
| 1389 | Ga0501033_0051950 | |||
| 1390 | Ga0501034_0134418 | |||
| 1391 | Ga0501034_0327434 | |||
| 1392 | Ga0501036_0006726 | |||
| 1393 | Ga0501036_0075284 | |||
| 1394 | Ga0501036_0078835 | |||
| 1395 | Ga0501036_0104531 | |||
| 1396 | Ga0501036_0105183 | |||
| 1397 | Ga0501036_0114741 | |||
| 1398 | Ga0501036_0438386 | |||
| 1399 | Ga0501036_0507809 | |||
| 1400 | Ga0501036_0634678 | |||
| 1401 | Ga0501036_0694006 | |||
| 1402 | Ga0501036_0736211 | |||
| 1403 | Ga0501037_0058493 | |||
| 1404 | Ga0501037_0099383 | |||
| 1405 | Ga0501037_0172987 | |||
| 1406 | Ga0501038_0010392 | |||
| 1407 | Ga0501038_0027225 | |||
| 1408 | Ga0501038_0131056 | |||
| 1409 | Ga0501038_0136775 | |||
| 1410 | Ga0501038_0188586 | |||
| 1411 | Ga0501038_0198573 | |||
| 1412 | Ga0501038_0311373 | |||
| 1413 | Ga0501039_0022486 | |||
| 1414 | Ga0501039_0036539 | |||
| 1415 | Ga0501039_0044398 | |||
| 1416 | Ga0501039_0047952 | |||
| 1417 | Ga0501039_0070644 | |||
| 1418 | Ga0501039_0225364 | |||
| 1419 | Ga0501039_0370044 | |||
| 1420 | Ga0501039_0414518 | |||
| 1421 | Ga0501039_0429278 | |||
| 1422 | Ga0501039_0605570 | |||
| 1423 | Ga0501040_0002881 | |||
| 1424 | Ga0501040_0036632 | |||
| 1425 | Ga0501040_0089487 | |||
| 1426 | Ga0501040_0095884 | |||
| 1427 | Ga0501040_0099144 | |||
| 1428 | Ga0501040_0103176 | |||
| 1429 | Ga0501040_0138401 | |||
| 1430 | Ga0501040_0208750 | |||
| 1431 | Ga0501040_0269063 | |||
| 1432 | Ga0501040_0274204 | |||
| 1433 | Ga0501040_0334382 | |||
| 1434 | Ga0501040_0436755 | |||
| 1435 | Ga0501040_1013381 | |||
| 1436 | Ga0501040_1076188 | |||
| 1437 | Ga0501041_0008168 | |||
| 1438 | Ga0501041_0026991 | |||
| 1439 | Ga0501041_0031133 | |||
| 1440 | Ga0501041_0091033 | |||
| 1441 | Ga0501041_0105098 | |||
| 1442 | Ga0501041_0181489 | |||
| 1443 | Ga0501041_0185618 | |||
| 1444 | Ga0501041_0204738 | |||
| 1445 | Ga0501041_0371925 | |||
| 1446 | Ga0501041_0377359 | |||
| 1447 | Ga0501041_0642030 | |||
| 1448 | Ga0501041_0672850 | |||
| 1449 | Ga0501042_0013717 | |||
| 1450 | Ga0501042_0102726 | |||
| 1451 | Ga0501042_0105477 | |||
| 1452 | Ga0501042_0203556 | |||
| 1453 | Ga0501042_0241580 | |||
| 1454 | Ga0501042_0270521 | |||
| 1455 | Ga0501042_0405468 | |||
| 1456 | Ga0501042_0555024 | |||
| 1457 | Ga0501042_0906405 | |||
| 1458 | Ga0501043_0026684 | |||
| 1459 | Ga0501043_0216005 | |||
| 1460 | Ga0501043_0516454 | |||
| 1461 | Ga0501043_0623537 | |||
| 1462 | Ga0501043_0777199 | |||
| 1463 | Ga0501046_0013151 | |||
| 1464 | Ga0501046_0025797 | |||
| 1465 | Ga0501046_0116414 | |||
| 1466 | Ga0501046_0308455 | |||
| 1467 | Ga0501046_0493645 | |||
| 1468 | Ga0501048_0011975 | |||
| 1469 | Ga0501048_0023689 | |||
| 1470 | Ga0501048_0043639 | |||
| 1471 | Ga0501048_0154679 | |||
| 1472 | Ga0501048_0222402 | |||
| 1473 | Ga0501048_0252619 | |||
| 1474 | Ga0501048_0286080 | |||
| 1475 | Ga0501048_0749176 | |||
| 1476 | Ga0501067_0002476 | |||
| 1477 | Ga0501067_0009644 | |||
| 1478 | Ga0501067_0320455 | |||
| 1479 | Ga0501067_0551040 | |||
| 1480 | Ga0501068_0003199 | |||
| 1481 | Ga0501068_0011244 | |||
| 1482 | Ga0501068_0014796 | |||
| 1483 | Ga0501068_0106716 | |||
| 1484 | Ga0501068_0114740 | |||
| 1485 | Ga0501068_0182296 | |||
| 1486 | Ga0501068_0238324 | |||
| 1487 | Ga0501068_0307167 | |||
| 1488 | Ga0501069_0002734 | |||
| 1489 | Ga0501069_0003134 | |||
| 1490 | Ga0501069_0013735 | |||
| 1491 | Ga0501069_0015264 | |||
| 1492 | Ga0501069_0277094 | |||
| 1493 | Ga0501069_0301759 | |||
| 1494 | Ga0501069_0357993 | |||
| 1495 | Ga0501069_0542838 | |||
| 1496 | Ga0501070_0004617 | |||
| 1497 | Ga0501070_0011535 | |||
| 1498 | Ga0501070_0084747 | |||
| 1499 | Ga0501070_0838144 | |||
| 1500 | Ga0501070_0926354 | |||
| 1501 | Ga0501071_0002112 | |||
| 1502 | Ga0501071_0018211 | |||
| 1503 | Ga0501071_0028286 | |||
| 1504 | Ga0501071_0032462 | |||
| 1505 | Ga0501071_0035600 | |||
| 1506 | Ga0501071_0051534 | |||
| 1507 | Ga0501071_0123989 | |||
| 1508 | Ga0501071_0131714 | |||
| 1509 | Ga0501071_0134703 | |||
| 1510 | Ga0501071_0277364 | |||
| 1511 | Ga0501071_0341715 | |||
| 1512 | Ga0501071_0512748 | |||
| 1513 | Ga0501071_0697984 | |||
| 1514 | Ga0501071_0702540 | |||
| 1515 | Ga0501071_0818022 | |||
| 1516 | Ga0501071_0922816 | |||
| 1517 | Ga0501071_0996835 | |||
| 1518 | Ga0501071_1036227 | |||
| 1519 | Ga0501072_0008858 | |||
| 1520 | Ga0501072_0026253 | |||
| 1521 | Ga0501072_0034022 | |||
| 1522 | Ga0501072_0042649 | |||
| 1523 | Ga0501072_0052670 | |||
| 1524 | Ga0501072_0074297 | |||
| 1525 | Ga0501072_0254120 | |||
| 1526 | Ga0501072_0262692 | |||
| 1527 | Ga0501072_0279686 | |||
| 1528 | Ga0501072_0606878 | |||
| 1529 | Ga0501072_0679647 | |||
| 1530 | Ga0501072_0789068 | |||
| 1531 | Ga0501072_1137154 | |||
| 1532 | Ga0501073_0021050 | |||
| 1533 | Ga0501073_0141795 | |||
| 1534 | Ga0501073_0174971 | |||
| 1535 | Ga0501073_0285026 | |||
| 1536 | Ga0501073_1169687 | |||
| 1537 | Ga0501074_0001666 | |||
| 1538 | Ga0501074_0003913 | |||
| 1539 | Ga0501074_0116907 | |||
| 1540 | Ga0501074_0123611 | |||
| 1541 | Ga0501074_0166706 | |||
| 1542 | Ga0501074_0168230 | |||
| 1543 | Ga0501074_0247227 | |||
| 1544 | Ga0501074_0524190 | |||
| 1545 | Ga0501074_0535284 | |||
| 1546 | Ga0501074_0775915 | |||
| 1547 | Ga0501074_1256990 | |||
| 1548 | Ga0501075_0001781 | |||
| 1549 | Ga0501075_0004911 | |||
| 1550 | Ga0501075_0010519 | |||
| 1551 | Ga0501075_0013739 | |||
| 1552 | Ga0501075_0080017 | |||
| 1553 | Ga0501075_0127031 | |||
| 1554 | Ga0501075_0194046 | |||
| 1555 | Ga0501075_0224506 | |||
| 1556 | Ga0501075_0229391 | |||
| 1557 | Ga0501075_0238548 | |||
| 1558 | Ga0501076_0006758 | |||
| 1559 | Ga0501076_0027428 | |||
| 1560 | Ga0501076_0050210 | |||
| 1561 | Ga0501076_0053557 | |||
| 1562 | Ga0501076_0084096 | |||
| 1563 | Ga0501076_0100029 | |||
| 1564 | Ga0501076_0136327 | |||
| 1565 | Ga0501076_0223139 | |||
| 1566 | Ga0501076_0239469 | |||
| 1567 | Ga0501076_0254549 | |||
| 1568 | Ga0501076_0392712 | |||
| 1569 | Ga0501076_0396065 | |||
| 1570 | Ga0501076_0844947 | |||
| 1571 | Ga0501076_0992232 | |||
| 1572 | Ga0501076_1107643 | |||
| 1573 | Ga0501077_0006742 | |||
| 1574 | Ga0501077_0014205 | |||
| 1575 | Ga0501077_0053413 | |||
| 1576 | Ga0501077_0061890 | |||
| 1577 | Ga0501077_0118041 | |||
| 1578 | Ga0501077_0130597 | |||
| 1579 | Ga0501077_0241273 | |||
| 1580 | Ga0501077_0521521 | |||
| 1581 | Ga0501077_0566573 | |||
| 1582 | Ga0501079_0002556 | |||
| 1583 | Ga0501079_0021490 | |||
| 1584 | Ga0501079_0029782 | |||
| 1585 | Ga0501079_0049592 | |||
| 1586 | Ga0501079_0051247 | |||
| 1587 | Ga0501079_0084061 | |||
| 1588 | Ga0501079_0098396 | |||
| 1589 | Ga0501079_0188031 | |||
| 1590 | Ga0501079_0284024 | |||
| 1591 | Ga0501079_0347759 | |||
| 1592 | Ga0501079_1057428 | |||
| 1593 | Ga0501079_1616659 | |||
| 1594 | Ga0501080_0018972 | |||
| 1595 | Ga0501080_0049582 | |||
| 1596 | Ga0501080_0093725 | |||
| 1597 | Ga0501080_0147768 | |||
| 1598 | Ga0501080_0276948 | |||
| 1599 | Ga0501080_0322490 | |||
| 1600 | Ga0501080_0700447 | |||
| 1601 | Ga0501080_0743961 | |||
| 1602 | Ga0501080_0796928 | |||
| 1603 | Ga0501080_0946248 | |||
| 1604 | Ga0501080_1681475 | |||
| 1605 | Ga0501080_1889748 | |||
| 1606 | Ga0501081_0007332 | |||
| 1607 | Ga0501081_0019175 | |||
| 1608 | Ga0501081_0023814 | |||
| 1609 | Ga0501081_0071439 | |||
| 1610 | Ga0501081_0139699 | |||
| 1611 | Ga0501081_0222193 | |||
| 1612 | Ga0501081_0288607 | |||
| 1613 | Ga0501081_0313754 | |||
| 1614 | Ga0501081_0315208 | |||
| 1615 | Ga0501081_1261708 | |||
| 1616 | Ga0501083_0079371 | |||
| 1617 | Ga0501083_0119285 | |||
| 1618 | Ga0501083_0183951 | |||
| 1619 | Ga0501083_0265000 | |||
| 1620 | Ga0501083_0467028 | |||
| 1621 | Ga0501083_0885672 | |||
| 1622 | Ga0501035_0004781 | |||
| 1623 | Ga0501035_0304902 | |||
| 1624 | Ga0501044_0082868 | |||
| 1625 | Ga0501044_0540163 | |||
| 1626 | Ga0501044_1674608 | |||
| 1627 | Ga0501045_0009720 | |||
| 1628 | Ga0501045_0019962 | |||
| 1629 | Ga0501045_0041490 | |||
| 1630 | Ga0501045_0048391 | |||
| 1631 | Ga0501045_0064804 | |||
| 1632 | Ga0501045_0146495 | |||
| 1633 | Ga0501045_0158223 | |||
| 1634 | Ga0501045_0325736 | |||
| 1635 | Ga0501045_0564190 | |||
| 1636 | Ga0501045_0773173 | |||
| 1637 | Ga0501045_1295277 | |||
| 1638 | nmdc:mga05p37_1388272_c1 | |||
| 1639 | nmdc:mga05p37_1968_c1 | |||
| 1640 | nmdc:mga06r32_628643_c1 | |||
| 1641 | nmdc:mga08y16_37726_c1 | |||
| 1642 | nmdc:mga0rr50_40033_c1 | |||
| 1643 | Ga0495601_0115449 | |||
| 1644 | Ga0495601_0147634 | |||
| 1645 | Ga0495601_0339046 | |||
| 1646 | Ga0495612_0000203 | |||
| 1647 | Ga0495612_0054765 | |||
| 1648 | Ga0495595_0104603 | |||
| 1649 | Ga0495619_0209818 | |||
| 1650 | Ga0501084_0014654 | |||
| 1651 | Ga0501084_0019672 | |||
| 1652 | Ga0501084_0021496 | |||
| 1653 | Ga0501084_0048616 | |||
| 1654 | Ga0501084_0073678 | |||
| 1655 | Ga0501084_0090222 | |||
| 1656 | Ga0501084_0230299 | |||
| 1657 | Ga0501084_0316962 | |||
| 1658 | Ga0501084_0437174 | |||
| 1659 | Ga0501084_0458476 | |||
| 1660 | Ga0501084_0473013 | |||
| 1661 | Ga0501084_0557279 | |||
| 1662 | Ga0501084_0660540 | |||
| 1663 | Ga0501084_0758544 | |||
| 1664 | Ga0501084_1055998 | |||
| 1665 | Ga0501084_1537976 | |||
| 1666 | Ga0501084_1647991 | |||
| 1667 | Ga0590071_001997 | |||
| 1668 | Ga0590077_013955 | |||
| 1669 | Ga0501082_0002611 | |||
| 1670 | Ga0501082_0057220 | |||
| 1671 | Ga0501082_0091952 | |||
| 1672 | Ga0501082_0106552 | |||
| 1673 | Ga0501082_0144403 | |||
| 1674 | Ga0501082_0186115 | |||
| 1675 | Ga0501082_0240338 | |||
| 1676 | Ga0501082_0449209 | |||
| 1677 | Ga0530510_0002417 | |||
| 1678 | Ga0530510_0003002 | |||
| 1679 | Ga0530510_0003811 | |||
| 1680 | Ga0530510_0027651 | |||
| 1681 | Ga0530510_0031510 | |||
| 1682 | Ga0530510_0035273 | |||
| 1683 | Ga0530510_0037843 | |||
| 1684 | Ga0530510_0056080 | |||
| 1685 | Ga0530510_0060762 | |||
| 1686 | Ga0530510_0104721 | |||
| 1687 | Ga0530510_0141774 | |||
| 1688 | Ga0530510_0156129 | |||
| 1689 | Ga0530510_0176177 | |||
| 1690 | Ga0530510_0216595 | |||
| 1691 | Ga0530510_0407032 | |||
| 1692 | Ga0530510_0892550 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.9452 | 2 | 136 |
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.9319 | 2 | 136 |
| 3pnx-assembly2.cif.gz_E | crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution | 0.8319 | 2 | 136 |
| 3pnx-assembly2.cif.gz_E | crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution | 0.8217 | 2 | 136 |
| 3mc3-assembly1.cif.gz_A | crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution | 0.7744 | 1 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4cjxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9639 | 4 | 38 | 3.40.50.10860 |
| 3l07A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9212 | 1 | 38 | 3.40.50.10860 |
| 2qs7B00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8959 | 2 | 136 | 3.40.1260.10 |
| 2qs7B00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8894 | 2 | 136 | 3.40.1260.10 |
| af_Q21603_1_280_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8544 | 4 | 38 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8S2J6-F1-model_v4 | Peroxiredoxin | 0.9991 | 8 | 136 |
|
| AF-A0A1F8S2J6-F1-model_v4 | Peroxiredoxin | 0.9763 | 8 | 136 |
|
| AF-A0LS88-F1-model_v4 | Peroxiredoxin | 0.9604 | 1 | 136 |
|
| AF-F4B6F5-F1-model_v4 | Peroxiredoxin family | 0.9596 | 10 | 136 |
|
| AF-A0LS88-F1-model_v4 | Peroxiredoxin | 0.9536 | 1 | 136 |
|