F483287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 339 | 1692 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300006173|Ga0070716_101201558|Ga0070716_1012015582 |
| Length | 79 |
| Sequence | MDDSQIHGTIEQLVAEEHELWARESADASDGDRRRLDQLKVSLDQCWDLLRQRRALRDASADPEGADVRRPEVVENYEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.71 |
| Nodule | 0 |
| Rhizoplane | 7.92 |
| Rhizosphere | 91.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070716_101201558 | 3300006173 | Bacteria | 609 |
| 2 | Ga0070658_10765235 | 3300005327 | Bacteria | 839 |
| 3 | Ga0070683_100061207 | 3300005329 | Bacteria | 3500 |
| 4 | Ga0070683_100188838 | 3300005329 | Bacteria | 1956 |
| 5 | Ga0070683_100479888 | 3300005329 | Bacteria | 1187 |
| 6 | Ga0070690_100161920 | 3300005330 | Bacteria | 1534 |
| 7 | Ga0070670_100158874 | 3300005331 | Bacteria | 1959 |
| 8 | Ga0070670_100851137 | 3300005331 | Unclassified | 825 |
| 9 | Ga0070677_10638275 | 3300005333 | Bacteria | 594 |
| 10 | Ga0068869_100022844 | 3300005334 | Bacteria | 4313 |
| 11 | Ga0068869_100188849 | 3300005334 | Bacteria | 1619 |
| 12 | Ga0070666_11434439 | 3300005335 | Unclassified | 516 |
| 13 | Ga0070682_100052575 | 3300005337 | Bacteria | 2550 |
| 14 | Ga0070682_101614601 | 3300005337 | Unclassified | 561 |
| 15 | Ga0068868_100561414 | 3300005338 | Bacteria | 1007 |
| 16 | Ga0068868_101318938 | 3300005338 | Bacteria | 671 |
| 17 | Ga0070689_100215348 | 3300005340 | Bacteria | 1574 |
| 18 | Ga0070675_100065831 | 3300005354 | Bacteria | 2997 |
| 19 | Ga0070675_100110021 | 3300005354 | Bacteria | 2330 |
| 20 | Ga0070675_100485583 | 3300005354 | Bacteria | 1112 |
| 21 | Ga0070675_100685175 | 3300005354 | Unclassified | 933 |
| 22 | Ga0070675_100737173 | 3300005354 | Bacteria | 899 |
| 23 | Ga0070675_101504095 | 3300005354 | Bacteria | 621 |
| 24 | Ga0070671_100064412 | 3300005355 | Bacteria | 3053 |
| 25 | Ga0070671_101373050 | 3300005355 | Bacteria | 624 |
| 26 | Ga0070674_100030970 | 3300005356 | Unclassified | 3540 |
| 27 | Ga0070674_100359736 | 3300005356 | Bacteria | 1178 |
| 28 | Ga0070674_101749891 | 3300005356 | Unclassified | 563 |
| 29 | Ga0070673_100224796 | 3300005364 | Bacteria | 1626 |
| 30 | Ga0070673_100378496 | 3300005364 | Bacteria | 1262 |
| 31 | Ga0070673_101679226 | 3300005364 | Bacteria | 601 |
| 32 | Ga0070659_101515674 | 3300005366 | Bacteria | 598 |
| 33 | Ga0070667_100752725 | 3300005367 | Unclassified | 903 |
| 34 | Ga0070709_11707383 | 3300005434 | Bacteria | 514 |
| 35 | Ga0070714_100011755 | 3300005435 | Bacteria | 6956 |
| 36 | Ga0070714_100021819 | 3300005435 | Bacteria | 5242 |
| 37 | Ga0070714_100040257 | 3300005435 | Bacteria | 3938 |
| 38 | Ga0070714_100042431 | 3300005435 | Bacteria | 3843 |
| 39 | Ga0070714_102270714 | 3300005435 | Bacteria | 528 |
| 40 | Ga0070713_100150590 | 3300005436 | Bacteria | 2069 |
| 41 | Ga0070713_100586933 | 3300005436 | Unclassified | 1057 |
| 42 | Ga0070713_100803859 | 3300005436 | Bacteria | 901 |
| 43 | Ga0070713_101100682 | 3300005436 | Bacteria | 768 |
| 44 | Ga0070713_102374609 | 3300005436 | Bacteria | 513 |
| 45 | Ga0070710_10001370 | 3300005437 | Bacteria | 11509 |
| 46 | Ga0070710_11229415 | 3300005437 | Bacteria | 555 |
| 47 | Ga0070711_100015124 | 3300005439 | Bacteria | 4878 |
| 48 | Ga0070711_100469979 | 3300005439 | Bacteria | 1032 |
| 49 | Ga0070705_100765232 | 3300005440 | Bacteria | 765 |
| 50 | Ga0070700_100090052 | 3300005441 | Bacteria | 2000 |
| 51 | Ga0070700_100122660 | 3300005441 | Bacteria | 1744 |
| 52 | Ga0070700_100439917 | 3300005441 | Bacteria | 990 |
| 53 | Ga0070694_100409225 | 3300005444 | Bacteria | 1064 |
| 54 | Ga0070663_100619393 | 3300005455 | Bacteria | 912 |
| 55 | Ga0070678_100016209 | 3300005456 | Bacteria | 4759 |
| 56 | Ga0070678_100387283 | 3300005456 | Bacteria | 1211 |
| 57 | Ga0070678_100430549 | 3300005456 | Unclassified | 1152 |
| 58 | Ga0070678_100453468 | 3300005456 | Bacteria | 1124 |
| 59 | Ga0070678_100753755 | 3300005456 | Unclassified | 881 |
| 60 | Ga0070678_100864508 | 3300005456 | Bacteria | 825 |
| 61 | Ga0070678_101012485 | 3300005456 | Bacteria | 764 |
| 62 | Ga0070662_100268554 | 3300005457 | Bacteria | 1377 |
| 63 | Ga0068867_100068104 | 3300005459 | Bacteria | 2656 |
| 64 | Ga0068867_100636550 | 3300005459 | Unclassified | 934 |
| 65 | Ga0068867_101122263 | 3300005459 | Bacteria | 719 |
| 66 | Ga0068867_101318143 | 3300005459 | Bacteria | 667 |
| 67 | Ga0068867_101515255 | 3300005459 | Bacteria | 625 |
| 68 | Ga0068867_101545739 | 3300005459 | Unclassified | 619 |
| 69 | Ga0070706_100601323 | 3300005467 | Bacteria | 1022 |
| 70 | Ga0070707_100001997 | 3300005468 | Bacteria | 19526 |
| 71 | Ga0070707_100619038 | 3300005468 | Bacteria | 1045 |
| 72 | Ga0070707_100666703 | 3300005468 | Bacteria | 1003 |
| 73 | Ga0070707_101256722 | 3300005468 | Bacteria | 707 |
| 74 | Ga0070707_102142581 | 3300005468 | Bacteria | 527 |
| 75 | Ga0070699_100239071 | 3300005518 | Unclassified | 1620 |
| 76 | Ga0070699_100767275 | 3300005518 | Bacteria | 882 |
| 77 | Ga0070684_100095896 | 3300005535 | Bacteria | 2643 |
| 78 | Ga0070684_100112531 | 3300005535 | Bacteria | 2442 |
| 79 | Ga0070684_100548281 | 3300005535 | Bacteria | 1073 |
| 80 | Ga0070672_100189582 | 3300005543 | Bacteria | 1716 |
| 81 | Ga0070672_100224678 | 3300005543 | Bacteria | 1576 |
| 82 | Ga0070672_100340618 | 3300005543 | Bacteria | 1277 |
| 83 | Ga0070672_101407259 | 3300005543 | Bacteria | 624 |
| 84 | Ga0070672_101704887 | 3300005543 | Bacteria | 566 |
| 85 | Ga0070686_100074782 | 3300005544 | Bacteria | 2227 |
| 86 | Ga0070693_100222664 | 3300005547 | Bacteria | 1237 |
| 87 | Ga0070693_101675783 | 3300005547 | Bacteria | 501 |
| 88 | Ga0070665_101101456 | 3300005548 | Unclassified | 806 |
| 89 | Ga0070665_101832294 | 3300005548 | Unclassified | 613 |
| 90 | Ga0070704_100297813 | 3300005549 | Bacteria | 1343 |
| 91 | Ga0070704_100390363 | 3300005549 | Bacteria | 1185 |
| 92 | Ga0070704_100555019 | 3300005549 | Unclassified | 1004 |
| 93 | Ga0070704_100995248 | 3300005549 | Bacteria | 758 |
| 94 | Ga0068855_100358846 | 3300005563 | Unclassified | 1604 |
| 95 | Ga0068855_101618773 | 3300005563 | Bacteria | 662 |
| 96 | Ga0070664_100104460 | 3300005564 | Bacteria | 2467 |
| 97 | Ga0070664_100300873 | 3300005564 | Bacteria | 1449 |
| 98 | Ga0070664_101486621 | 3300005564 | Bacteria | 641 |
| 99 | Ga0068857_100002779 | 3300005577 | Bacteria | 14392 |
| 100 | Ga0068857_100068858 | 3300005577 | Bacteria | 3150 |
| 101 | Ga0068857_102316150 | 3300005577 | Bacteria | 527 |
| 102 | Ga0068854_102262995 | 3300005578 | Unclassified | 503 |
| 103 | Ga0068856_100161663 | 3300005614 | Bacteria | 2250 |
| 104 | Ga0068856_100957436 | 3300005614 | Bacteria | 875 |
| 105 | Ga0070702_100296823 | 3300005615 | Bacteria | 1116 |
| 106 | Ga0070702_101098881 | 3300005615 | Unclassified | 635 |
| 107 | Ga0070702_101879911 | 3300005615 | Bacteria | 502 |
| 108 | Ga0068852_102446540 | 3300005616 | Bacteria | 543 |
| 109 | Ga0068864_100537370 | 3300005618 | Bacteria | 1128 |
| 110 | Ga0068866_10300209 | 3300005718 | Bacteria | 1003 |
| 111 | Ga0068866_10352090 | 3300005718 | Unclassified | 936 |
| 112 | Ga0068861_100487167 | 3300005719 | Unclassified | 1112 |
| 113 | Ga0068870_10148490 | 3300005840 | Bacteria | 1378 |
| 114 | Ga0068870_10268072 | 3300005840 | Unclassified | 1065 |
| 115 | Ga0068863_100418900 | 3300005841 | Bacteria | 1312 |
| 116 | Ga0068863_101084119 | 3300005841 | Bacteria | 805 |
| 117 | Ga0068863_101304086 | 3300005841 | Bacteria | 733 |
| 118 | Ga0068858_100111770 | 3300005842 | Bacteria | 2551 |
| 119 | Ga0081455_10006277 | 3300005937 | Bacteria | 12781 |
| 120 | Ga0081455_10033827 | 3300005937 | Unclassified | 4587 |
| 121 | Ga0081455_10055740 | 3300005937 | Bacteria | 3361 |
| 122 | Ga0081455_10238890 | 3300005937 | Bacteria | 1336 |
| 123 | Ga0081538_10003781 | 3300005981 | Bacteria | 14166 |
| 124 | Ga0081538_10005509 | 3300005981 | Bacteria | 11373 |
| 125 | Ga0070717_10010897 | 3300006028 | Bacteria | 6882 |
| 126 | Ga0070717_10021906 | 3300006028 | Bacteria | 5042 |
| 127 | Ga0070717_10623887 | 3300006028 | Bacteria | 978 |
| 128 | Ga0070717_10845315 | 3300006028 | Unclassified | 833 |
| 129 | Ga0075365_10547002 | 3300006038 | Bacteria | 819 |
| 130 | Ga0075365_11337933 | 3300006038 | Bacteria | 503 |
| 131 | Ga0075364_10704115 | 3300006051 | Bacteria | 689 |
| 132 | Ga0075432_10292267 | 3300006058 | Bacteria | 674 |
| 133 | Ga0075432_10314316 | 3300006058 | Bacteria | 654 |
| 134 | Ga0070715_10121394 | 3300006163 | Bacteria | 1246 |
| 135 | Ga0070715_10469802 | 3300006163 | Unclassified | 714 |
| 136 | Ga0070716_100412783 | 3300006173 | Bacteria | 974 |
| 137 | Ga0070716_100890658 | 3300006173 | Bacteria | 696 |
| 138 | Ga0070712_100329659 | 3300006175 | Bacteria | 1243 |
| 139 | Ga0070712_101247985 | 3300006175 | Bacteria | 647 |
| 140 | Ga0070712_101300400 | 3300006175 | Bacteria | 634 |
| 141 | Ga0075362_10100955 | 3300006177 | Bacteria | 1349 |
| 142 | Ga0097621_100199400 | 3300006237 | Bacteria | 1737 |
| 143 | Ga0097621_100573588 | 3300006237 | Bacteria | 1029 |
| 144 | Ga0097621_100924844 | 3300006237 | Bacteria | 813 |
| 145 | Ga0097621_101334858 | 3300006237 | Unclassified | 678 |
| 146 | Ga0068871_100074939 | 3300006358 | Bacteria | 2793 |
| 147 | Ga0068871_101147609 | 3300006358 | Bacteria | 728 |
| 148 | Ga0068871_102248694 | 3300006358 | Bacteria | 520 |
| 149 | Ga0075428_100074029 | 3300006844 | Bacteria | 3720 |
| 150 | Ga0075428_100404699 | 3300006844 | Bacteria | 1462 |
| 151 | Ga0075428_100701479 | 3300006844 | Bacteria | 1078 |
| 152 | Ga0075428_101327588 | 3300006844 | Bacteria | 756 |
| 153 | Ga0075428_101497787 | 3300006844 | Bacteria | 707 |
| 154 | Ga0075428_101548045 | 3300006844 | Bacteria | 694 |
| 155 | Ga0075428_101818605 | 3300006844 | Bacteria | 634 |
| 156 | Ga0075430_100029341 | 3300006846 | Bacteria | 4668 |
| 157 | Ga0075431_100427005 | 3300006847 | Bacteria | 1324 |
| 158 | Ga0075433_10166279 | 3300006852 | Bacteria | 1963 |
| 159 | Ga0075433_10271784 | 3300006852 | Bacteria | 1502 |
| 160 | Ga0075433_10297719 | 3300006852 | Bacteria | 1429 |
| 161 | Ga0075434_100002903 | 3300006871 | Bacteria | 15214 |
| 162 | Ga0075434_100134020 | 3300006871 | Bacteria | 2497 |
| 163 | Ga0075434_100469643 | 3300006871 | Unclassified | 1279 |
| 164 | Ga0075434_100638124 | 3300006871 | Bacteria | 1083 |
| 165 | Ga0075434_100800608 | 3300006871 | Bacteria | 959 |
| 166 | Ga0075434_100940230 | 3300006871 | Bacteria | 879 |
| 167 | Ga0075434_101823253 | 3300006871 | Bacteria | 615 |
| 168 | Ga0075429_100167594 | 3300006880 | Bacteria | 1924 |
| 169 | Ga0068865_100188631 | 3300006881 | Unclassified | 1593 |
| 170 | Ga0068865_100312315 | 3300006881 | Bacteria | 1262 |
| 171 | Ga0068865_100700913 | 3300006881 | Bacteria | 865 |
| 172 | Ga0068865_100844435 | 3300006881 | Bacteria | 793 |
| 173 | Ga0068865_101083678 | 3300006881 | Unclassified | 705 |
| 174 | Ga0068865_101134949 | 3300006881 | Bacteria | 690 |
| 175 | Ga0068865_101191142 | 3300006881 | Unclassified | 674 |
| 176 | Ga0068865_101543028 | 3300006881 | Unclassified | 596 |
| 177 | Ga0075436_100138182 | 3300006914 | Bacteria | 1712 |
| 178 | Ga0075436_101319974 | 3300006914 | Bacteria | 546 |
| 179 | Ga0075435_100054417 | 3300007076 | Bacteria | 3229 |
| 180 | Ga0075435_100443720 | 3300007076 | Bacteria | 1119 |
| 181 | Ga0075435_101253129 | 3300007076 | Bacteria | 649 |
| 182 | Ga0099795_10119329 | 3300007788 | Bacteria | 1053 |
| 183 | Ga0105240_10253298 | 3300009093 | Bacteria | 2035 |
| 184 | Ga0105240_10585685 | 3300009093 | Bacteria | 1230 |
| 185 | Ga0105240_11076712 | 3300009093 | Unclassified | 856 |
| 186 | Ga0105240_11260544 | 3300009093 | Bacteria | 781 |
| 187 | Ga0111539_10002177 | 3300009094 | Bacteria | 26179 |
| 188 | Ga0111539_10002716 | 3300009094 | Bacteria | 23474 |
| 189 | Ga0111539_10009380 | 3300009094 | Bacteria | 12355 |
| 190 | Ga0111539_10365326 | 3300009094 | Bacteria | 1680 |
| 191 | Ga0111539_10439858 | 3300009094 | Bacteria | 1518 |
| 192 | Ga0111539_10774499 | 3300009094 | Bacteria | 1117 |
| 193 | Ga0111539_12027372 | 3300009094 | Unclassified | 667 |
| 194 | Ga0111539_12334371 | 3300009094 | Bacteria | 621 |
| 195 | Ga0111539_12988246 | 3300009094 | Bacteria | 546 |
| 196 | Ga0105245_10052006 | 3300009098 | Bacteria | 3673 |
| 197 | Ga0105245_10135791 | 3300009098 | Bacteria | 2311 |
| 198 | Ga0105245_10260320 | 3300009098 | Bacteria | 1688 |
| 199 | Ga0105245_10396185 | 3300009098 | Unclassified | 1378 |
| 200 | Ga0105245_10532511 | 3300009098 | Unclassified | 1195 |
| 201 | Ga0105245_10692725 | 3300009098 | Bacteria | 1052 |
| 202 | Ga0105245_13292328 | 3300009098 | Bacteria | 500 |
| 203 | Ga0105247_10948548 | 3300009101 | Bacteria | 668 |
| 204 | Ga0114129_10041130 | 3300009147 | Bacteria | 6515 |
| 205 | Ga0114129_10068887 | 3300009147 | Bacteria | 4932 |
| 206 | Ga0114129_10196754 | 3300009147 | Bacteria | 2733 |
| 207 | Ga0114129_10306244 | 3300009147 | Bacteria | 2116 |
| 208 | Ga0114129_10619837 | 3300009147 | Bacteria | 1400 |
| 209 | Ga0114129_11064042 | 3300009147 | Bacteria | 1015 |
| 210 | Ga0105243_10172461 | 3300009148 | Bacteria | 1875 |
| 211 | Ga0105243_10206875 | 3300009148 | Unclassified | 1725 |
| 212 | Ga0105243_10325196 | 3300009148 | Bacteria | 1403 |
| 213 | Ga0105243_10358576 | 3300009148 | Bacteria | 1341 |
| 214 | Ga0105243_10623864 | 3300009148 | Bacteria | 1041 |
| 215 | Ga0105243_10669713 | 3300009148 | Bacteria | 1008 |
| 216 | Ga0105243_11640280 | 3300009148 | Bacteria | 671 |
| 217 | Ga0105243_11648967 | 3300009148 | Bacteria | 669 |
| 218 | Ga0105243_11766102 | 3300009148 | Bacteria | 649 |
| 219 | Ga0105243_12259124 | 3300009148 | Bacteria | 581 |
| 220 | Ga0105242_10015723 | 3300009176 | Bacteria | 5880 |
| 221 | Ga0105242_10070123 | 3300009176 | Bacteria | 2905 |
| 222 | Ga0105242_10135974 | 3300009176 | Unclassified | 2127 |
| 223 | Ga0105242_10255859 | 3300009176 | Unclassified | 1580 |
| 224 | Ga0105242_10413355 | 3300009176 | Bacteria | 1262 |
| 225 | Ga0105242_12056606 | 3300009176 | Bacteria | 614 |
| 226 | Ga0105242_12100386 | 3300009176 | Bacteria | 609 |
| 227 | Ga0105237_12048244 | 3300009545 | Bacteria | 581 |
| 228 | Ga0105237_12751476 | 3300009545 | Unclassified | 503 |
| 229 | Ga0105238_11870966 | 3300009551 | Bacteria | 633 |
| 230 | Ga0105249_11715144 | 3300009553 | Bacteria | 701 |
| 231 | Ga0105249_12194688 | 3300009553 | Bacteria | 625 |
| 232 | Ga0105249_13086294 | 3300009553 | Bacteria | 535 |
| 233 | Ga0105239_10220222 | 3300010375 | Unclassified | 2128 |
| 234 | Ga0105239_12056509 | 3300010375 | Bacteria | 663 |
| 235 | Ga0105246_10012010 | 3300011119 | Bacteria | 5394 |
| 236 | Ga0105246_10054984 | 3300011119 | Bacteria | 2745 |
| 237 | Ga0105246_10102666 | 3300011119 | Bacteria | 2085 |
| 238 | Ga0105246_10369240 | 3300011119 | Bacteria | 1182 |
| 239 | Ga0105246_10605510 | 3300011119 | Bacteria | 947 |
| 240 | Ga0105246_10826861 | 3300011119 | Unclassified | 824 |
| 241 | Ga0105246_11373692 | 3300011119 | Bacteria | 658 |
| 242 | Ga0105246_12219357 | 3300011119 | Bacteria | 535 |
| 243 | Ga0157345_1055310 | 3300012498 | Bacteria | 515 |
| 244 | Ga0157369_10584821 | 3300013105 | Bacteria | 1153 |
| 245 | Ga0157374_11272049 | 3300013296 | Bacteria | 757 |
| 246 | Ga0157374_12047630 | 3300013296 | Bacteria | 599 |
| 247 | Ga0157378_10477625 | 3300013297 | Bacteria | 1241 |
| 248 | Ga0157378_10692854 | 3300013297 | Unclassified | 1038 |
| 249 | Ga0157378_11284391 | 3300013297 | Unclassified | 773 |
| 250 | Ga0163162_10230108 | 3300013306 | Bacteria | 1984 |
| 251 | Ga0157372_10292548 | 3300013307 | Bacteria | 1894 |
| 252 | Ga0157375_10270163 | 3300013308 | Bacteria | 1862 |
| 253 | Ga0157375_10276947 | 3300013308 | Bacteria | 1840 |
| 254 | Ga0157375_10624856 | 3300013308 | Bacteria | 1235 |
| 255 | Ga0157375_11060798 | 3300013308 | Bacteria | 947 |
| 256 | Ga0157375_11343524 | 3300013308 | Bacteria | 841 |
| 257 | Ga0163163_10450763 | 3300014325 | Bacteria | 1347 |
| 258 | Ga0163163_10526763 | 3300014325 | Unclassified | 1244 |
| 259 | Ga0163163_10531370 | 3300014325 | Bacteria | 1238 |
| 260 | Ga0157380_10124679 | 3300014326 | Bacteria | 2187 |
| 261 | Ga0157380_10240518 | 3300014326 | Bacteria | 1632 |
| 262 | Ga0157380_10301595 | 3300014326 | Bacteria | 1476 |
| 263 | Ga0157380_12266735 | 3300014326 | Bacteria | 607 |
| 264 | Ga0157380_12351939 | 3300014326 | Unclassified | 598 |
| 265 | Ga0182008_10481158 | 3300014497 | Unclassified | 680 |
| 266 | Ga0182008_10931457 | 3300014497 | Bacteria | 513 |
| 267 | Ga0157377_10064225 | 3300014745 | Bacteria | 2105 |
| 268 | Ga0157377_10119784 | 3300014745 | Bacteria | 1594 |
| 269 | Ga0157377_10853291 | 3300014745 | Bacteria | 676 |
| 270 | Ga0157379_10107809 | 3300014968 | Bacteria | 2501 |
| 271 | Ga0157379_10249528 | 3300014968 | Bacteria | 1611 |
| 272 | Ga0157379_11922130 | 3300014968 | Bacteria | 583 |
| 273 | Ga0157376_10011165 | 3300014969 | Bacteria | 6608 |
| 274 | Ga0157376_10082624 | 3300014969 | Bacteria | 2761 |
| 275 | Ga0157376_10637443 | 3300014969 | Bacteria | 1065 |
| 276 | Ga0157376_11471249 | 3300014969 | Unclassified | 714 |
| 277 | Ga0157376_11795054 | 3300014969 | Bacteria | 649 |
| 278 | Ga0157376_12641095 | 3300014969 | Bacteria | 542 |
| 279 | Ga0157376_12759655 | 3300014969 | Bacteria | 531 |
| 280 | Ga0182006_1246530 | 3300015261 | Bacteria | 587 |
| 281 | Ga0163161_10354240 | 3300017792 | Bacteria | 1167 |
| 282 | Ga0206354_10406073 | 3300020081 | Bacteria | 602 |
| 283 | Ga0224712_10358608 | 3300022467 | Bacteria | 690 |
| 284 | Ga0207692_10082360 | 3300025898 | Bacteria | 1724 |
| 285 | Ga0207642_10219802 | 3300025899 | Unclassified | 1061 |
| 286 | Ga0207642_10531058 | 3300025899 | Bacteria | 724 |
| 287 | Ga0207688_10032300 | 3300025901 | Bacteria | 2893 |
| 288 | Ga0207680_11323403 | 3300025903 | Unclassified | 512 |
| 289 | Ga0207647_10768230 | 3300025904 | Unclassified | 520 |
| 290 | Ga0207699_10064650 | 3300025906 | Bacteria | 2214 |
| 291 | Ga0207699_10117481 | 3300025906 | Bacteria | 1714 |
| 292 | Ga0207699_10268760 | 3300025906 | Bacteria | 1181 |
| 293 | Ga0207645_10412896 | 3300025907 | Bacteria | 909 |
| 294 | Ga0207643_10132094 | 3300025908 | Bacteria | 1486 |
| 295 | Ga0207643_10333359 | 3300025908 | Bacteria | 950 |
| 296 | Ga0207684_10339408 | 3300025910 | Bacteria | 1294 |
| 297 | Ga0207695_10357450 | 3300025913 | Bacteria | 1347 |
| 298 | Ga0207695_10757686 | 3300025913 | Bacteria | 851 |
| 299 | Ga0207695_11274195 | 3300025913 | Bacteria | 615 |
| 300 | Ga0207693_10000954 | 3300025915 | Bacteria | 25940 |
| 301 | Ga0207693_10280824 | 3300025915 | Bacteria | 1305 |
| 302 | Ga0207663_10037687 | 3300025916 | Bacteria | 2916 |
| 303 | Ga0207663_10434112 | 3300025916 | Bacteria | 1010 |
| 304 | Ga0207662_10065009 | 3300025918 | Bacteria | 2196 |
| 305 | Ga0207657_10172751 | 3300025919 | Bacteria | 1750 |
| 306 | Ga0207649_10072226 | 3300025920 | Bacteria | 2207 |
| 307 | Ga0207646_10000129 | 3300025922 | Bacteria | 102411 |
| 308 | Ga0207646_10327674 | 3300025922 | Bacteria | 1384 |
| 309 | Ga0207646_10360902 | 3300025922 | Bacteria | 1313 |
| 310 | Ga0207646_10818524 | 3300025922 | Bacteria | 829 |
| 311 | Ga0207646_11080829 | 3300025922 | Bacteria | 707 |
| 312 | Ga0207646_11524592 | 3300025922 | Bacteria | 578 |
| 313 | Ga0207681_11001962 | 3300025923 | Unclassified | 701 |
| 314 | Ga0207650_11052098 | 3300025925 | Bacteria | 692 |
| 315 | Ga0207659_10167835 | 3300025926 | Bacteria | 1729 |
| 316 | Ga0207659_10225581 | 3300025926 | Bacteria | 1509 |
| 317 | Ga0207659_10296201 | 3300025926 | Bacteria | 1327 |
| 318 | Ga0207659_10346019 | 3300025926 | Bacteria | 1232 |
| 319 | Ga0207659_11007848 | 3300025926 | Bacteria | 717 |
| 320 | Ga0207659_11579875 | 3300025926 | Bacteria | 560 |
| 321 | Ga0207687_10076242 | 3300025927 | Bacteria | 2408 |
| 322 | Ga0207687_10111785 | 3300025927 | Bacteria | 2029 |
| 323 | Ga0207687_10214428 | 3300025927 | Bacteria | 1512 |
| 324 | Ga0207687_10261315 | 3300025927 | Bacteria | 1380 |
| 325 | Ga0207687_10376819 | 3300025927 | Bacteria | 1162 |
| 326 | Ga0207687_11042315 | 3300025927 | Unclassified | 702 |
| 327 | Ga0207700_10064543 | 3300025928 | Bacteria | 2790 |
| 328 | Ga0207700_10953908 | 3300025928 | Bacteria | 768 |
| 329 | Ga0207700_11306336 | 3300025928 | Bacteria | 646 |
| 330 | Ga0207664_10026178 | 3300025929 | Bacteria | 4405 |
| 331 | Ga0207664_10066818 | 3300025929 | Bacteria | 2883 |
| 332 | Ga0207664_10117872 | 3300025929 | Bacteria | 2217 |
| 333 | Ga0207664_10151260 | 3300025929 | Bacteria | 1972 |
| 334 | Ga0207664_10162029 | 3300025929 | Bacteria | 1908 |
| 335 | Ga0207664_10246223 | 3300025929 | Bacteria | 1558 |
| 336 | Ga0207664_10334027 | 3300025929 | Bacteria | 1339 |
| 337 | Ga0207644_10109285 | 3300025931 | Bacteria | 2089 |
| 338 | Ga0207644_10726559 | 3300025931 | Bacteria | 829 |
| 339 | Ga0207644_11060260 | 3300025931 | Unclassified | 681 |
| 340 | Ga0207690_11767477 | 3300025932 | Bacteria | 516 |
| 341 | Ga0207706_10071187 | 3300025933 | Bacteria | 3058 |
| 342 | Ga0207706_10087193 | 3300025933 | Bacteria | 2744 |
| 343 | Ga0207706_10436927 | 3300025933 | Bacteria | 1133 |
| 344 | Ga0207706_11021710 | 3300025933 | Bacteria | 694 |
| 345 | Ga0207686_10217586 | 3300025934 | Bacteria | 1377 |
| 346 | Ga0207686_10353958 | 3300025934 | Bacteria | 1106 |
| 347 | Ga0207686_10451099 | 3300025934 | Bacteria | 989 |
| 348 | Ga0207686_10655747 | 3300025934 | Unclassified | 831 |
| 349 | Ga0207686_11704588 | 3300025934 | Bacteria | 521 |
| 350 | Ga0207709_10111154 | 3300025935 | Bacteria | 1832 |
| 351 | Ga0207709_10442261 | 3300025935 | Unclassified | 1003 |
| 352 | Ga0207709_10891320 | 3300025935 | Bacteria | 723 |
| 353 | Ga0207669_10582846 | 3300025937 | Unclassified | 907 |
| 354 | Ga0207669_10670257 | 3300025937 | Bacteria | 850 |
| 355 | Ga0207669_10715293 | 3300025937 | Unclassified | 824 |
| 356 | Ga0207704_10986327 | 3300025938 | Bacteria | 712 |
| 357 | Ga0207704_11037903 | 3300025938 | Bacteria | 695 |
| 358 | Ga0207704_11311465 | 3300025938 | Unclassified | 619 |
| 359 | Ga0207704_11824433 | 3300025938 | Unclassified | 523 |
| 360 | Ga0207665_10015992 | 3300025939 | Bacteria | 4927 |
| 361 | Ga0207665_10164202 | 3300025939 | Bacteria | 1600 |
| 362 | Ga0207665_10786584 | 3300025939 | Bacteria | 751 |
| 363 | Ga0207665_11248606 | 3300025939 | Bacteria | 593 |
| 364 | Ga0207691_10228848 | 3300025940 | Bacteria | 1610 |
| 365 | Ga0207691_10241693 | 3300025940 | Bacteria | 1561 |
| 366 | Ga0207691_10307517 | 3300025940 | Bacteria | 1361 |
| 367 | Ga0207691_10678778 | 3300025940 | Bacteria | 869 |
| 368 | Ga0207691_11372667 | 3300025940 | Bacteria | 581 |
| 369 | Ga0207691_11636529 | 3300025940 | Unclassified | 523 |
| 370 | Ga0207689_11351422 | 3300025942 | Bacteria | 598 |
| 371 | Ga0207661_10099317 | 3300025944 | Bacteria | 2441 |
| 372 | Ga0207661_10179436 | 3300025944 | Bacteria | 1849 |
| 373 | Ga0207661_10546135 | 3300025944 | Bacteria | 1061 |
| 374 | Ga0207661_11744415 | 3300025944 | Unclassified | 568 |
| 375 | Ga0207679_10477042 | 3300025945 | Bacteria | 1110 |
| 376 | Ga0207679_10518202 | 3300025945 | Bacteria | 1066 |
| 377 | Ga0207679_10568922 | 3300025945 | Bacteria | 1018 |
| 378 | Ga0207679_10748822 | 3300025945 | Bacteria | 889 |
| 379 | Ga0207651_11068959 | 3300025960 | Unclassified | 723 |
| 380 | Ga0207668_11967160 | 3300025972 | Bacteria | 527 |
| 381 | Ga0207640_10551538 | 3300025981 | Bacteria | 968 |
| 382 | Ga0207640_12180700 | 3300025981 | Unclassified | 503 |
| 383 | Ga0207658_10576789 | 3300025986 | Bacteria | 1009 |
| 384 | Ga0207677_10861426 | 3300026023 | Bacteria | 815 |
| 385 | Ga0207677_10983162 | 3300026023 | Bacteria | 764 |
| 386 | Ga0207677_10994588 | 3300026023 | Bacteria | 760 |
| 387 | Ga0207677_11106823 | 3300026023 | Bacteria | 722 |
| 388 | Ga0207677_11663916 | 3300026023 | Unclassified | 591 |
| 389 | Ga0207677_11929373 | 3300026023 | Bacteria | 549 |
| 390 | Ga0207708_10319848 | 3300026075 | Bacteria | 1266 |
| 391 | Ga0207708_10390542 | 3300026075 | Bacteria | 1149 |
| 392 | Ga0207708_10650211 | 3300026075 | Bacteria | 897 |
| 393 | Ga0207708_11052095 | 3300026075 | Bacteria | 708 |
| 394 | Ga0207708_11731180 | 3300026075 | Unclassified | 549 |
| 395 | Ga0207702_10137343 | 3300026078 | Bacteria | 2208 |
| 396 | Ga0207702_10404762 | 3300026078 | Bacteria | 1317 |
| 397 | Ga0207641_11326779 | 3300026088 | Bacteria | 720 |
| 398 | Ga0207641_11773558 | 3300026088 | Unclassified | 619 |
| 399 | Ga0207648_10534429 | 3300026089 | Unclassified | 1075 |
| 400 | Ga0207648_10850590 | 3300026089 | Unclassified | 851 |
| 401 | Ga0207648_10914015 | 3300026089 | Unclassified | 820 |
| 402 | Ga0207648_11048842 | 3300026089 | Bacteria | 764 |
| 403 | Ga0207648_11377067 | 3300026089 | Unclassified | 663 |
| 404 | Ga0207648_11818366 | 3300026089 | Bacteria | 571 |
| 405 | Ga0207676_11877452 | 3300026095 | Bacteria | 598 |
| 406 | Ga0207674_10002068 | 3300026116 | Bacteria | 25444 |
| 407 | Ga0207674_10079133 | 3300026116 | Bacteria | 3292 |
| 408 | Ga0207674_11803000 | 3300026116 | Bacteria | 579 |
| 409 | Ga0207683_10054652 | 3300026121 | Unclassified | 3501 |
| 410 | Ga0207683_10226743 | 3300026121 | Bacteria | 1703 |
| 411 | Ga0207683_10441046 | 3300026121 | Bacteria | 1200 |
| 412 | Ga0207683_10688454 | 3300026121 | Bacteria | 948 |
| 413 | Ga0207683_11410908 | 3300026121 | Bacteria | 644 |
| 414 | Ga0207698_10650924 | 3300026142 | Bacteria | 1044 |
| 415 | Ga0207698_11947237 | 3300026142 | Bacteria | 602 |
| 416 | Ga0207428_10022243 | 3300027907 | Bacteria | 5354 |
| 417 | Ga0207428_10044037 | 3300027907 | Bacteria | 3601 |
| 418 | Ga0207428_10099482 | 3300027907 | Bacteria | 2249 |
| 419 | Ga0207428_10325325 | 3300027907 | Bacteria | 1135 |
| 420 | Ga0268266_11371210 | 3300028379 | Unclassified | 683 |
| 421 | Ga0268266_11402819 | 3300028379 | Unclassified | 674 |
| 422 | Ga0268266_11472539 | 3300028379 | Bacteria | 656 |
| 423 | Ga0268265_11316965 | 3300028380 | Bacteria | 723 |
| 424 | Ga0268264_11369442 | 3300028381 | Bacteria | 718 |
| 425 | Ga0265319_1002672 | 3300028563 | Bacteria | 9567 |
| 426 | Ga0265334_10001389 | 3300028573 | Bacteria | 11666 |
| 427 | Ga0265318_10000251 | 3300028577 | Bacteria | 46650 |
| 428 | Ga0265318_10357825 | 3300028577 | Bacteria | 533 |
| 429 | Ga0265323_10074877 | 3300028653 | Bacteria | 1151 |
| 430 | Ga0265322_10001345 | 3300028654 | Bacteria | 8164 |
| 431 | Ga0265336_10220883 | 3300028666 | Bacteria | 563 |
| 432 | Ga0265338_10002952 | 3300028800 | Bacteria | 24672 |
| 433 | Ga0265338_10004801 | 3300028800 | Bacteria | 18068 |
| 434 | Ga0265324_10054222 | 3300029957 | Bacteria | 1376 |
| 435 | Ga0265330_10001832 | 3300031235 | Bacteria | 11864 |
| 436 | Ga0265332_10001076 | 3300031238 | Bacteria | 15975 |
| 437 | Ga0265328_10116818 | 3300031239 | Bacteria | 993 |
| 438 | Ga0265320_10007521 | 3300031240 | Bacteria | 6756 |
| 439 | Ga0265325_10000789 | 3300031241 | Bacteria | 22904 |
| 440 | Ga0265329_10000737 | 3300031242 | Bacteria | 16603 |
| 441 | Ga0265340_10002224 | 3300031247 | Bacteria | 11098 |
| 442 | Ga0265339_10090865 | 3300031249 | Bacteria | 1600 |
| 443 | Ga0265331_10002864 | 3300031250 | Bacteria | 11416 |
| 444 | Ga0265331_10539456 | 3300031250 | Bacteria | 526 |
| 445 | Ga0265327_10004513 | 3300031251 | Bacteria | 12285 |
| 446 | Ga0265327_10009219 | 3300031251 | Bacteria | 7157 |
| 447 | Ga0265327_10402024 | 3300031251 | Bacteria | 595 |
| 448 | Ga0265316_10015955 | 3300031344 | Bacteria | 6538 |
| 449 | Ga0307408_100173181 | 3300031548 | Bacteria | 1725 |
| 450 | Ga0265313_10025485 | 3300031595 | Bacteria | 3132 |
| 451 | Ga0265314_10208683 | 3300031711 | Bacteria | 1148 |
| 452 | Ga0265342_10003926 | 3300031712 | Bacteria | 11940 |
| 453 | Ga0307405_11866370 | 3300031731 | Bacteria | 535 |
| 454 | Ga0307413_10413397 | 3300031824 | Bacteria | 1060 |
| 455 | Ga0307410_10039825 | 3300031852 | Bacteria | 3088 |
| 456 | Ga0307406_10691787 | 3300031901 | Bacteria | 850 |
| 457 | Ga0307407_10038517 | 3300031903 | Bacteria | 2650 |
| 458 | Ga0307412_10028568 | 3300031911 | Bacteria | 3491 |
| 459 | Ga0307409_100029582 | 3300031995 | Bacteria | 3922 |
| 460 | Ga0307409_101413563 | 3300031995 | Bacteria | 722 |
| 461 | Ga0307416_100239355 | 3300032002 | Bacteria | 1757 |
| 462 | Ga0307416_100358388 | 3300032002 | Bacteria | 1479 |
| 463 | Ga0307416_100847352 | 3300032002 | Bacteria | 1012 |
| 464 | Ga0307411_10200506 | 3300032005 | Bacteria | 1532 |
| 465 | Ga0307415_100059765 | 3300032126 | Bacteria | 2630 |
| 466 | Ga0307415_100166573 | 3300032126 | Bacteria | 1714 |
| 467 | Ga0373934_0184900 | 3300035086 | Bacteria | 857 |
| 468 | Ga0373934_0297808 | 3300035086 | Bacteria | 669 |
| 469 | Ga0373936_0201850 | 3300035113 | Bacteria | 878 |
| 470 | Ga0373936_0392261 | 3300035113 | Bacteria | 636 |
| 471 | Ga0373953_0097985 | 3300035117 | Bacteria | 1232 |
| 472 | Ga0373957_0310237 | 3300035120 | Bacteria | 670 |
| 473 | Ga0373943_0322145 | 3300035170 | Bacteria | 881 |
| 474 | Ga0373943_0436378 | 3300035170 | Bacteria | 759 |
| 475 | Ga0373943_0447912 | 3300035170 | Bacteria | 750 |
| 476 | Ga0373946_0032609 | 3300035171 | Bacteria | 2093 |
| 477 | Ga0373946_0270272 | 3300035171 | Bacteria | 834 |
| 478 | Ga0373955_0143483 | 3300035172 | Bacteria | 1402 |
| 479 | Ga0373955_0620078 | 3300035172 | Bacteria | 663 |
| 480 | Ga0373924_0257736 | 3300035410 | Bacteria | 773 |
| 481 | Ga0373935_0583905 | 3300035692 | Bacteria | 816 |
| 482 | Ga0373933_0072209 | 3300035724 | Bacteria | 2102 |
| 483 | Ga0373947_0039838 | 3300035725 | Bacteria | 2797 |
| 484 | Ga0373947_0205249 | 3300035725 | Bacteria | 1291 |
| 485 | Ga0373947_0352495 | 3300035725 | Bacteria | 988 |
| 486 | Ga0373937_0000364 | 3300036401 | Bacteria | 42155 |
| 487 | Ga0373937_0403472 | 3300036401 | Bacteria | 1297 |
| 488 | Ga0373937_0936355 | 3300036401 | Bacteria | 815 |
| 489 | Ga0373925_0725340 | 3300037068 | Bacteria | 819 |
| 490 | Ga0395899_0073951 | 3300037312 | Bacteria | 2491 |
| 491 | Ga0395899_0081645 | 3300037312 | Bacteria | 2352 |
| 492 | Ga0395899_0331009 | 3300037312 | Bacteria | 1023 |
| 493 | Ga0395899_0345791 | 3300037312 | Bacteria | 996 |
| 494 | Ga0395900_0069780 | 3300037418 | Bacteria | 3612 |
| 495 | Ga0395900_0229353 | 3300037418 | Bacteria | 1868 |
| 496 | Ga0395900_0259818 | 3300037418 | Bacteria | 1735 |
| 497 | Ga0395900_0461200 | 3300037418 | Bacteria | 1225 |
| 498 | Ga0395900_0504108 | 3300037418 | Bacteria | 1160 |
| 499 | Ga0395900_0596571 | 3300037418 | Bacteria | 1045 |
| 500 | Ga0395900_1313429 | 3300037418 | Bacteria | 637 |
| 501 | Ga0395900_1427053 | 3300037418 | Bacteria | 605 |
| 502 | Ga0395898_0040333 | 3300037466 | Bacteria | 4617 |
| 503 | Ga0395898_0050366 | 3300037466 | Bacteria | 4076 |
| 504 | Ga0395898_0311506 | 3300037466 | Bacteria | 1502 |
| 505 | Ga0395898_0403048 | 3300037466 | Bacteria | 1304 |
| 506 | Ga0395898_0409556 | 3300037466 | Bacteria | 1292 |
| 507 | Ga0395898_0586789 | 3300037466 | Bacteria | 1057 |
| 508 | Ga0395898_0606427 | 3300037466 | Bacteria | 1037 |
| 509 | Ga0395898_0858995 | 3300037466 | Unclassified | 846 |
| 510 | Ga0395898_1946895 | 3300037466 | Bacteria | 507 |
| 511 | Ga0395905_0213277 | 3300037471 | Bacteria | 1808 |
| 512 | Ga0395905_0225727 | 3300037471 | Bacteria | 1752 |
| 513 | Ga0395905_0235047 | 3300037471 | Bacteria | 1713 |
| 514 | Ga0395905_0259143 | 3300037471 | Bacteria | 1624 |
| 515 | Ga0395905_0263260 | 3300037471 | Bacteria | 1610 |
| 516 | Ga0395905_0566361 | 3300037471 | Unclassified | 1037 |
| 517 | Ga0395905_0818399 | 3300037471 | Bacteria | 834 |
| 518 | Ga0395901_0011484 | 3300038443 | Bacteria | 8976 |
| 519 | Ga0395901_0101707 | 3300038443 | Bacteria | 3015 |
| 520 | Ga0395901_0114839 | 3300038443 | Bacteria | 2828 |
| 521 | Ga0395901_0232628 | 3300038443 | Bacteria | 1924 |
| 522 | Ga0395901_0405455 | 3300038443 | Bacteria | 1400 |
| 523 | Ga0395901_0474127 | 3300038443 | Unclassified | 1277 |
| 524 | Ga0395901_0700511 | 3300038443 | Bacteria | 1010 |
| 525 | Ga0395901_1103552 | 3300038443 | Bacteria | 764 |
| 526 | Ga0451789_1029551 | 3300041443 | Unclassified | 628 |
| 527 | Ga0451804_0353585 | 3300041463 | Bacteria | 550 |
| 528 | Ga0451835_0979349 | 3300041492 | Unclassified | 624 |
| 529 | Ga0451853_0844785 | 3300041512 | Bacteria | 547 |
| 530 | Ga0451853_3134357 | 3300041512 | Unclassified | 1755 |
| 531 | Ga0439448_0024671 | 3300042005 | Bacteria | 1882 |
| 532 | Ga0466964_0083602 | 3300044706 | Bacteria | 1375 |
| 533 | Ga0466964_0335159 | 3300044706 | Bacteria | 773 |
| 534 | Ga0451576_2135519 | 3300045051 | Bacteria | 576 |
| 535 | Ga0466967_0750172 | 3300045976 | Bacteria | 968 |
| 536 | Ga0495617_143150 | 3300046452 | Bacteria | 763 |
| 537 | Ga0495592_0000050 | 3300046454 | Bacteria | 111971 |
| 538 | Ga0495592_0101188 | 3300046454 | Bacteria | 2053 |
| 539 | Ga0495592_0140504 | 3300046454 | Bacteria | 1680 |
| 540 | Ga0495592_0542737 | 3300046454 | Bacteria | 716 |
| 541 | Ga0495603_0210952 | 3300046455 | Bacteria | 1121 |
| 542 | Ga0495603_0224698 | 3300046455 | Bacteria | 1083 |
| 543 | Ga0495603_0229782 | 3300046455 | Bacteria | 1070 |
| 544 | Ga0495603_0255015 | 3300046455 | Bacteria | 1010 |
| 545 | Ga0495629_0007457 | 3300046459 | Bacteria | 8059 |
| 546 | Ga0495629_0994868 | 3300046459 | Bacteria | 546 |
| 547 | Ga0495641_0086436 | 3300046461 | Bacteria | 1403 |
| 548 | Ga0495641_0388200 | 3300046461 | Bacteria | 633 |
| 549 | Ga0495651_0000028 | 3300046462 | Bacteria | 105473 |
| 550 | Ga0495653_0002470 | 3300046463 | Bacteria | 14701 |
| 551 | Ga0495653_0030595 | 3300046463 | Bacteria | 4286 |
| 552 | Ga0495653_0369344 | 3300046463 | Bacteria | 919 |
| 553 | Ga0495653_0499266 | 3300046463 | Bacteria | 759 |
| 554 | Ga0495653_0657971 | 3300046463 | Bacteria | 639 |
| 555 | Ga0495582_0038950 | 3300046473 | Bacteria | 2617 |
| 556 | Ga0495582_0052623 | 3300046473 | Bacteria | 2245 |
| 557 | Ga0495582_0740967 | 3300046473 | Bacteria | 569 |
| 558 | Ga0495605_0018601 | 3300046474 | Bacteria | 3721 |
| 559 | Ga0495662_0091567 | 3300046476 | Bacteria | 1483 |
| 560 | Ga0495662_0349531 | 3300046476 | Bacteria | 727 |
| 561 | Ga0495664_0152378 | 3300046477 | Bacteria | 1402 |
| 562 | Ga0495664_0551937 | 3300046477 | Bacteria | 686 |
| 563 | Ga0495584_0026519 | 3300046491 | Bacteria | 2936 |
| 564 | Ga0495584_0158218 | 3300046491 | Bacteria | 1151 |
| 565 | Ga0495584_0266259 | 3300046491 | Bacteria | 871 |
| 566 | Ga0495584_0582663 | 3300046491 | Bacteria | 570 |
| 567 | Ga0495585_0080389 | 3300046492 | Bacteria | 1767 |
| 568 | Ga0495594_0368178 | 3300046499 | Bacteria | 818 |
| 569 | Ga0495596_0036967 | 3300046500 | Bacteria | 1933 |
| 570 | Ga0495596_0207476 | 3300046500 | Bacteria | 761 |
| 571 | Ga0495596_0339381 | 3300046500 | Unclassified | 585 |
| 572 | Ga0495607_0143079 | 3300046501 | Bacteria | 1232 |
| 573 | Ga0495607_0303986 | 3300046501 | Unclassified | 750 |
| 574 | Ga0495608_0002704 | 3300046511 | Bacteria | 12737 |
| 575 | Ga0495608_0011498 | 3300046511 | Bacteria | 6159 |
| 576 | Ga0495608_0046525 | 3300046511 | Bacteria | 2887 |
| 577 | Ga0495608_0761099 | 3300046511 | Bacteria | 573 |
| 578 | Ga0495616_0359999 | 3300046513 | Bacteria | 604 |
| 579 | Ga0495616_0442480 | 3300046513 | Bacteria | 528 |
| 580 | Ga0495618_0003120 | 3300046514 | Bacteria | 10436 |
| 581 | Ga0495618_0071632 | 3300046514 | Bacteria | 2205 |
| 582 | Ga0495618_0379584 | 3300046514 | Bacteria | 867 |
| 583 | Ga0495628_0000060 | 3300046516 | Bacteria | 87173 |
| 584 | Ga0495628_0033129 | 3300046516 | Bacteria | 4166 |
| 585 | Ga0495628_0181592 | 3300046516 | Bacteria | 1591 |
| 586 | Ga0495628_0663289 | 3300046516 | Bacteria | 740 |
| 587 | Ga0495630_0139293 | 3300046517 | Bacteria | 1844 |
| 588 | Ga0495630_0237895 | 3300046517 | Bacteria | 1391 |
| 589 | Ga0495630_0391240 | 3300046517 | Bacteria | 1065 |
| 590 | Ga0495630_0475513 | 3300046517 | Bacteria | 958 |
| 591 | Ga0495630_1119538 | 3300046517 | Bacteria | 597 |
| 592 | Ga0495630_1214379 | 3300046517 | Bacteria | 570 |
| 593 | Ga0495631_0302170 | 3300046518 | Bacteria | 681 |
| 594 | Ga0495631_0469815 | 3300046518 | Bacteria | 536 |
| 595 | Ga0495644_0004027 | 3300046523 | Bacteria | 5782 |
| 596 | Ga0495644_0019835 | 3300046523 | Bacteria | 2567 |
| 597 | Ga0495644_0167566 | 3300046523 | Bacteria | 843 |
| 598 | Ga0495644_0397680 | 3300046523 | Bacteria | 545 |
| 599 | Ga0495663_0051703 | 3300046525 | Bacteria | 1274 |
| 600 | Ga0495663_0382037 | 3300046525 | Bacteria | 516 |
| 601 | Ga0495652_0000512 | 3300046529 | Bacteria | 45282 |
| 602 | Ga0495652_0044756 | 3300046529 | Bacteria | 3810 |
| 603 | Ga0495652_0670543 | 3300046529 | Bacteria | 700 |
| 604 | Ga0495652_1149061 | 3300046529 | Bacteria | 502 |
| 605 | Ga0495654_0374508 | 3300046530 | Bacteria | 569 |
| 606 | Ga0495640_0022675 | 3300046533 | Bacteria | 4585 |
| 607 | Ga0495640_0506473 | 3300046533 | Bacteria | 734 |
| 608 | Ga0495640_0609281 | 3300046533 | Bacteria | 659 |
| 609 | Ga0495586_0284580 | 3300046535 | Bacteria | 946 |
| 610 | Ga0495587_0000062 | 3300046536 | Bacteria | 91862 |
| 611 | Ga0495598_0081670 | 3300046537 | Bacteria | 1038 |
| 612 | Ga0495621_0088937 | 3300046539 | Bacteria | 1162 |
| 613 | Ga0495645_0000028 | 3300046543 | Bacteria | 113461 |
| 614 | Ga0495645_0047808 | 3300046543 | Bacteria | 3116 |
| 615 | Ga0495645_0059670 | 3300046543 | Bacteria | 2765 |
| 616 | Ga0495667_0054102 | 3300046559 | Bacteria | 2642 |
| 617 | Ga0495667_0155944 | 3300046559 | Bacteria | 1469 |
| 618 | Ga0495667_0207919 | 3300046559 | Bacteria | 1251 |
| 619 | Ga0495667_0986300 | 3300046559 | Bacteria | 514 |
| 620 | Ga0495656_0006621 | 3300046615 | Bacteria | 4067 |
| 621 | Ga0495656_0014258 | 3300046615 | Bacteria | 2977 |
| 622 | Ga0495656_0052907 | 3300046615 | Bacteria | 1743 |
| 623 | Ga0495656_0098386 | 3300046615 | Bacteria | 1349 |
| 624 | Ga0495656_0142421 | 3300046615 | Bacteria | 1151 |
| 625 | Ga0495656_0356620 | 3300046615 | Bacteria | 759 |
| 626 | Ga0495656_0476161 | 3300046615 | Bacteria | 660 |
| 627 | Ga0495656_0610881 | 3300046615 | Bacteria | 584 |
| 628 | Ga0495668_0108969 | 3300046616 | Bacteria | 1515 |
| 629 | Ga0495634_0101232 | 3300046642 | Bacteria | 1861 |
| 630 | Ga0495634_0384805 | 3300046642 | Bacteria | 835 |
| 631 | Ga0495634_0398087 | 3300046642 | Bacteria | 818 |
| 632 | Ga0495634_0654961 | 3300046642 | Bacteria | 606 |
| 633 | Ga0495635_0056020 | 3300046663 | Bacteria | 2715 |
| 634 | Ga0495635_0281831 | 3300046663 | Bacteria | 1116 |
| 635 | Ga0495635_0812435 | 3300046663 | Bacteria | 602 |
| 636 | Ga0495659_0081780 | 3300046664 | Bacteria | 1227 |
| 637 | Ga0495588_0094706 | 3300046674 | Bacteria | 1566 |
| 638 | Ga0495657_0033992 | 3300046675 | Bacteria | 3545 |
| 639 | Ga0495657_0123617 | 3300046675 | Bacteria | 1627 |
| 640 | Ga0495657_0138041 | 3300046675 | Bacteria | 1522 |
| 641 | Ga0495657_0170372 | 3300046675 | Bacteria | 1341 |
| 642 | Ga0495599_0000059 | 3300046678 | Bacteria | 75747 |
| 643 | Ga0495599_0051968 | 3300046678 | Bacteria | 2567 |
| 644 | Ga0495599_0367171 | 3300046678 | Bacteria | 861 |
| 645 | Ga0495623_0000082 | 3300046679 | Bacteria | 56315 |
| 646 | Ga0495623_0131081 | 3300046679 | Bacteria | 1501 |
| 647 | Ga0495623_0168908 | 3300046679 | Bacteria | 1279 |
| 648 | Ga0495646_0003941 | 3300046680 | Bacteria | 9284 |
| 649 | Ga0495646_0416761 | 3300046680 | Bacteria | 697 |
| 650 | Ga0495647_0212521 | 3300046681 | Bacteria | 851 |
| 651 | Ga0495669_0456393 | 3300046684 | Bacteria | 621 |
| 652 | Ga0495613_0024755 | 3300046689 | Bacteria | 4472 |
| 653 | Ga0495613_0044964 | 3300046689 | Bacteria | 3266 |
| 654 | Ga0495613_0244484 | 3300046689 | Bacteria | 1254 |
| 655 | Ga0495613_0438176 | 3300046689 | Bacteria | 887 |
| 656 | Ga0495624_0032751 | 3300046690 | Bacteria | 3368 |
| 657 | Ga0495624_0501380 | 3300046690 | Bacteria | 726 |
| 658 | Ga0495670_0369768 | 3300046691 | Bacteria | 773 |
| 659 | Ga0495671_0293806 | 3300046692 | Bacteria | 782 |
| 660 | Ga0495600_0017901 | 3300046809 | Bacteria | 4510 |
| 661 | Ga0495600_0821689 | 3300046809 | Bacteria | 552 |
| 662 | Ga0495581_0289197 | 3300047315 | Bacteria | 958 |
| 663 | Ga0495581_0310474 | 3300047315 | Bacteria | 922 |
| 664 | Ga0495581_0464473 | 3300047315 | Bacteria | 737 |
| 665 | Ga0495604_0000242 | 3300047317 | Bacteria | 48737 |
| 666 | Ga0495636_0243750 | 3300047318 | Bacteria | 830 |
| 667 | Ga0495674_0012416 | 3300047319 | Bacteria | 8027 |
| 668 | Ga0495674_0263697 | 3300047319 | Bacteria | 1415 |
| 669 | Ga0495674_0362547 | 3300047319 | Bacteria | 1175 |
| 670 | Ga0495674_0450368 | 3300047319 | Bacteria | 1034 |
| 671 | Ga0495676_0038964 | 3300047321 | Bacteria | 3942 |
| 672 | Ga0495676_0087292 | 3300047321 | Bacteria | 2345 |
| 673 | Ga0495676_0100838 | 3300047321 | Bacteria | 2137 |
| 674 | Ga0495676_0173022 | 3300047321 | Bacteria | 1518 |
| 675 | Ga0495676_0565774 | 3300047321 | Bacteria | 742 |
| 676 | Ga0495680_0024954 | 3300047322 | Bacteria | 4951 |
| 677 | Ga0495680_0095540 | 3300047322 | Bacteria | 2222 |
| 678 | Ga0495680_0188435 | 3300047322 | Bacteria | 1485 |
| 679 | Ga0495680_0308590 | 3300047322 | Bacteria | 1109 |
| 680 | Ga0495680_0492561 | 3300047322 | Bacteria | 833 |
| 681 | Ga0495680_0538049 | 3300047322 | Bacteria | 789 |
| 682 | Ga0495675_0000020 | 3300047444 | Bacteria | 111526 |
| 683 | Ga0495675_0249792 | 3300047444 | Bacteria | 1066 |
| 684 | Ga0495684_0452558 | 3300047471 | Bacteria | 892 |
| 685 | Ga0495684_1088075 | 3300047471 | Bacteria | 502 |
| 686 | Ga0495593_0143960 | 3300047673 | Bacteria | 1207 |
| 687 | Ga0495602_0000600 | 3300048088 | Bacteria | 33812 |
| 688 | Ga0495602_0242106 | 3300048088 | Bacteria | 1349 |
| 689 | Ga0495602_0453376 | 3300048088 | Bacteria | 905 |
| 690 | Ga0496100_0011840 | 3300048903 | Bacteria | 4978 |
| 691 | Ga0496100_0135922 | 3300048903 | Bacteria | 1737 |
| 692 | Ga0496100_1686455 | 3300048903 | Bacteria | 501 |
| 693 | Ga0496101_0005375 | 3300048904 | Bacteria | 8160 |
| 694 | Ga0496101_0065915 | 3300048904 | Bacteria | 2640 |
| 695 | Ga0496101_0148878 | 3300048904 | Bacteria | 1789 |
| 696 | Ga0496101_1134835 | 3300048904 | Bacteria | 613 |
| 697 | Ga0496101_1480976 | 3300048904 | Unclassified | 529 |
| 698 | Ga0496102_0149665 | 3300048905 | Bacteria | 2193 |
| 699 | Ga0496102_0538178 | 3300048905 | Unclassified | 1091 |
| 700 | Ga0496102_0682892 | 3300048905 | Bacteria | 950 |
| 701 | Ga0496102_0752566 | 3300048905 | Bacteria | 897 |
| 702 | Ga0496102_0770497 | 3300048905 | Bacteria | 885 |
| 703 | Ga0496103_0140514 | 3300048906 | Bacteria | 1544 |
| 704 | Ga0496103_0345483 | 3300048906 | Bacteria | 957 |
| 705 | Ga0496104_0024698 | 3300048907 | Bacteria | 5531 |
| 706 | Ga0496104_0534421 | 3300048907 | Bacteria | 1083 |
| 707 | Ga0496104_0573663 | 3300048907 | Bacteria | 1039 |
| 708 | Ga0496104_0918942 | 3300048907 | Bacteria | 780 |
| 709 | Ga0496105_0005165 | 3300048908 | Bacteria | 9898 |
| 710 | Ga0496105_0347960 | 3300048908 | Bacteria | 1184 |
| 711 | Ga0496106_0030857 | 3300048909 | Bacteria | 3995 |
| 712 | Ga0496106_0134354 | 3300048909 | Bacteria | 1942 |
| 713 | Ga0496106_0949150 | 3300048909 | Bacteria | 678 |
| 714 | Ga0496106_1423059 | 3300048909 | Bacteria | 535 |
| 715 | Ga0496107_0019241 | 3300048910 | Bacteria | 4817 |
| 716 | Ga0496107_0064819 | 3300048910 | Bacteria | 2649 |
| 717 | Ga0496107_0141904 | 3300048910 | Bacteria | 1775 |
| 718 | Ga0496108_0285404 | 3300048911 | Bacteria | 1437 |
| 719 | Ga0496108_0347526 | 3300048911 | Bacteria | 1294 |
| 720 | Ga0496108_0728642 | 3300048911 | Bacteria | 859 |
| 721 | Ga0496108_0772423 | 3300048911 | Bacteria | 830 |
| 722 | Ga0496109_0001499 | 3300048912 | Bacteria | 19394 |
| 723 | Ga0496109_0145507 | 3300048912 | Bacteria | 2217 |
| 724 | Ga0496109_0203816 | 3300048912 | Bacteria | 1860 |
| 725 | Ga0496109_0558806 | 3300048912 | Unclassified | 1079 |
| 726 | Ga0496109_0681449 | 3300048912 | Bacteria | 965 |
| 727 | Ga0496109_0984292 | 3300048912 | Unclassified | 781 |
| 728 | Ga0496109_1422815 | 3300048912 | Unclassified | 629 |
| 729 | Ga0496109_1504046 | 3300048912 | Unclassified | 608 |
| 730 | Ga0496109_1723475 | 3300048912 | Bacteria | 560 |
| 731 | Ga0496109_1933379 | 3300048912 | Bacteria | 522 |
| 732 | Ga0496110_0008785 | 3300048913 | Bacteria | 8140 |
| 733 | Ga0496110_0183683 | 3300048913 | Bacteria | 1899 |
| 734 | Ga0496110_0209872 | 3300048913 | Unclassified | 1770 |
| 735 | Ga0496110_0382528 | 3300048913 | Bacteria | 1282 |
| 736 | Ga0496110_0985369 | 3300048913 | Bacteria | 750 |
| 737 | Ga0496110_1175641 | 3300048913 | Bacteria | 676 |
| 738 | Ga0496110_1616557 | 3300048913 | Bacteria | 558 |
| 739 | Ga0496111_0000138 | 3300048914 | Bacteria | 32480 |
| 740 | Ga0496111_0325756 | 3300048914 | Bacteria | 1138 |
| 741 | Ga0496111_0455019 | 3300048914 | Bacteria | 944 |
| 742 | Ga0496112_0345981 | 3300048915 | Bacteria | 1430 |
| 743 | Ga0496112_1802615 | 3300048915 | Bacteria | 524 |
| 744 | Ga0496113_0111822 | 3300048916 | Bacteria | 2127 |
| 745 | Ga0496113_1001101 | 3300048916 | Bacteria | 658 |
| 746 | Ga0496114_0059419 | 3300048917 | Bacteria | 3194 |
| 747 | Ga0496114_0070023 | 3300048917 | Bacteria | 2945 |
| 748 | Ga0496114_0077804 | 3300048917 | Bacteria | 2797 |
| 749 | Ga0496114_0134756 | 3300048917 | Bacteria | 2135 |
| 750 | Ga0496114_0466487 | 3300048917 | Bacteria | 1118 |
| 751 | Ga0496114_0935442 | 3300048917 | Bacteria | 749 |
| 752 | Ga0496114_1271704 | 3300048917 | Bacteria | 622 |
| 753 | Ga0496115_0212083 | 3300048918 | Bacteria | 1599 |
| 754 | Ga0496115_0439808 | 3300048918 | Bacteria | 1054 |
| 755 | Ga0501031_0000049 | 3300049568 | Bacteria | 65338 |
| 756 | Ga0501032_0001830 | 3300049569 | Bacteria | 16815 |
| 757 | Ga0501033_0000383 | 3300049570 | Bacteria | 42550 |
| 758 | Ga0501034_0129480 | 3300049571 | Bacteria | 2507 |
| 759 | Ga0501036_0000038 | 3300049572 | Bacteria | 84269 |
| 760 | Ga0501037_0000177 | 3300049573 | Bacteria | 59495 |
| 761 | Ga0501038_0000336 | 3300049574 | Bacteria | 40561 |
| 762 | Ga0501039_0000349 | 3300049575 | Bacteria | 33069 |
| 763 | Ga0501040_0000083 | 3300049576 | Bacteria | 46328 |
| 764 | Ga0501041_0000001 | 3300049577 | Bacteria | 96328 |
| 765 | Ga0501042_0000002 | 3300049578 | Bacteria | 79574 |
| 766 | Ga0501043_0000077 | 3300049579 | Bacteria | 86054 |
| 767 | Ga0501046_0000175 | 3300049580 | Bacteria | 65364 |
| 768 | Ga0501047_0000162 | 3300049581 | Bacteria | 81578 |
| 769 | Ga0501048_0000021 | 3300049582 | Bacteria | 69380 |
| 770 | Ga0501067_0010746 | 3300049583 | Bacteria | 5064 |
| 771 | Ga0501067_0033456 | 3300049583 | Bacteria | 2852 |
| 772 | Ga0501067_0170994 | 3300049583 | Bacteria | 1210 |
| 773 | Ga0501067_0546278 | 3300049583 | Bacteria | 649 |
| 774 | Ga0501068_0000020 | 3300049584 | Bacteria | 59613 |
| 775 | Ga0501068_0084413 | 3300049584 | Bacteria | 1953 |
| 776 | Ga0501068_0388410 | 3300049584 | Bacteria | 899 |
| 777 | Ga0501068_1116018 | 3300049584 | Bacteria | 522 |
| 778 | Ga0501069_0013111 | 3300049585 | Bacteria | 4420 |
| 779 | Ga0501069_0026738 | 3300049585 | Bacteria | 3160 |
| 780 | Ga0501069_0428422 | 3300049585 | Bacteria | 785 |
| 781 | Ga0501069_0432619 | 3300049585 | Bacteria | 781 |
| 782 | Ga0501070_0001426 | 3300049586 | Bacteria | 21410 |
| 783 | Ga0501070_0637104 | 3300049586 | Bacteria | 847 |
| 784 | Ga0501071_0000024 | 3300049587 | Bacteria | 49758 |
| 785 | Ga0501071_1543973 | 3300049587 | Unclassified | 513 |
| 786 | Ga0501072_0000074 | 3300049588 | Bacteria | 72534 |
| 787 | Ga0501073_0000105 | 3300049589 | Bacteria | 53900 |
| 788 | Ga0501074_0000013 | 3300049590 | Bacteria | 81009 |
| 789 | Ga0501075_0000056 | 3300049591 | Bacteria | 48279 |
| 790 | Ga0501076_0000039 | 3300049592 | Bacteria | 63618 |
| 791 | Ga0501076_1523791 | 3300049592 | Bacteria | 549 |
| 792 | Ga0501077_0000049 | 3300049593 | Bacteria | 61814 |
| 793 | Ga0501077_0871107 | 3300049593 | Bacteria | 579 |
| 794 | Ga0501079_0000012 | 3300049741 | Bacteria | 69559 |
| 795 | Ga0501080_0000031 | 3300049742 | Bacteria | 86869 |
| 796 | Ga0501081_0000004 | 3300049743 | Bacteria | 94770 |
| 797 | Ga0501083_0000091 | 3300049744 | Bacteria | 60492 |
| 798 | Ga0501035_0000244 | 3300049822 | Bacteria | 65327 |
| 799 | Ga0501044_0000481 | 3300049823 | Bacteria | 48516 |
| 800 | Ga0501045_0000016 | 3300049824 | Bacteria | 72118 |
| 801 | nmdc:mga03683_183746_c1 | 3300050489 | Bacteria | 954 |
| 802 | nmdc:mga0yw44_387762_c1 | 3300050492 | Bacteria | 943 |
| 803 | nmdc:mga05p37_1092990_c1 | 3300050507 | Bacteria | 836 |
| 804 | nmdc:mga05p37_137810_c1 | 3300050507 | Bacteria | 2991 |
| 805 | nmdc:mga05p37_1754268_c1 | 3300050507 | Bacteria | 602 |
| 806 | nmdc:mga05p37_193594_c1 | 3300050507 | Bacteria | 2467 |
| 807 | nmdc:mga05p37_659330_c1 | 3300050507 | Bacteria | 1170 |
| 808 | nmdc:mga05p37_85717_c1 | 3300050507 | Bacteria | 3882 |
| 809 | nmdc:mga09592_134240_c1 | 3300050508 | Bacteria | 2131 |
| 810 | nmdc:mga0qj67_102363_c1 | 3300050509 | Bacteria | 2309 |
| 811 | nmdc:mga06r32_959435_c1 | 3300050510 | Bacteria | 809 |
| 812 | nmdc:mga08y16_157721_c1 | 3300050511 | Bacteria | 2358 |
| 813 | nmdc:mga08y16_1604691_c1 | 3300050511 | Unclassified | 608 |
| 814 | nmdc:mga08y16_16523_c1 | 3300050511 | Bacteria | 7764 |
| 815 | nmdc:mga08y16_341629_c1 | 3300050511 | Bacteria | 1539 |
| 816 | nmdc:mga08y16_43268_c1 | 3300050511 | Bacteria | 4719 |
| 817 | nmdc:mga08y16_61061_c1 | 3300050511 | Bacteria | 3936 |
| 818 | nmdc:mga0n895_100046_c1 | 3300050512 | Bacteria | 2908 |
| 819 | nmdc:mga0n895_185094_c1 | 3300050512 | Bacteria | 2114 |
| 820 | nmdc:mga0n895_230799_c1 | 3300050512 | Bacteria | 1878 |
| 821 | nmdc:mga0n895_682064_c1 | 3300050512 | Bacteria | 1024 |
| 822 | nmdc:mga0n895_790446_c1 | 3300050512 | Bacteria | 940 |
| 823 | nmdc:mga0rr50_108774_c1 | 3300050513 | Bacteria | 2190 |
| 824 | nmdc:mga08x19_813817_c1 | 3300050514 | Bacteria | 663 |
| 825 | nmdc:mga08x19_97513_c1 | 3300050514 | Bacteria | 1946 |
| 826 | nmdc:mga0a205_1574353_c1 | 3300050515 | Unclassified | 505 |
| 827 | nmdc:mga0a205_188316_c1 | 3300050515 | Bacteria | 1956 |
| 828 | nmdc:mga0a205_291069_c1 | 3300050515 | Bacteria | 1507 |
| 829 | Ga0495601_0000241 | 3300053077 | Bacteria | 29180 |
| 830 | Ga0495601_0013901 | 3300053077 | Bacteria | 4846 |
| 831 | Ga0495601_0704381 | 3300053077 | Unclassified | 644 |
| 832 | Ga0495612_0024489 | 3300053078 | Bacteria | 2423 |
| 833 | Ga0495655_0008739 | 3300053083 | Bacteria | 1937 |
| 834 | Ga0495655_0029477 | 3300053083 | Bacteria | 1320 |
| 835 | Ga0495595_0009251 | 3300053084 | Bacteria | 4069 |
| 836 | Ga0495595_0027630 | 3300053084 | Bacteria | 2529 |
| 837 | Ga0495595_0229594 | 3300053084 | Bacteria | 927 |
| 838 | Ga0495619_0000316 | 3300053085 | Bacteria | 33863 |
| 839 | Ga0495619_0019352 | 3300053085 | Bacteria | 4327 |
| 840 | Ga0495619_0072189 | 3300053085 | Bacteria | 2311 |
| 841 | Ga0495619_0295967 | 3300053085 | Unclassified | 1121 |
| 842 | Ga0501084_0000635 | 3300054114 | Bacteria | 26802 |
| 843 | Ga0501084_1591250 | 3300054114 | Bacteria | 546 |
| 844 | Ga0501082_0000135 | 3300060353 | Bacteria | 60581 |
| 845 | Ga0530510_0004796 | 3300061734 | Bacteria | 9364 |
| 846 | Ga0530510_0178176 | 3300061734 | Bacteria | 1576 |
| 847 | Ga0070716_101201558 | |||
| 848 | Ga0070658_10765235 | |||
| 849 | Ga0070683_100061207 | |||
| 850 | Ga0070683_100188838 | |||
| 851 | Ga0070683_100479888 | |||
| 852 | Ga0070690_100161920 | |||
| 853 | Ga0070670_100158874 | |||
| 854 | Ga0070670_100851137 | |||
| 855 | Ga0070677_10638275 | |||
| 856 | Ga0068869_100022844 | |||
| 857 | Ga0068869_100188849 | |||
| 858 | Ga0070666_11434439 | |||
| 859 | Ga0070682_100052575 | |||
| 860 | Ga0070682_101614601 | |||
| 861 | Ga0068868_100561414 | |||
| 862 | Ga0068868_101318938 | |||
| 863 | Ga0070689_100215348 | |||
| 864 | Ga0070675_100065831 | |||
| 865 | Ga0070675_100110021 | |||
| 866 | Ga0070675_100485583 | |||
| 867 | Ga0070675_100685175 | |||
| 868 | Ga0070675_100737173 | |||
| 869 | Ga0070675_101504095 | |||
| 870 | Ga0070671_100064412 | |||
| 871 | Ga0070671_101373050 | |||
| 872 | Ga0070674_100030970 | |||
| 873 | Ga0070674_100359736 | |||
| 874 | Ga0070674_101749891 | |||
| 875 | Ga0070673_100224796 | |||
| 876 | Ga0070673_100378496 | |||
| 877 | Ga0070673_101679226 | |||
| 878 | Ga0070659_101515674 | |||
| 879 | Ga0070667_100752725 | |||
| 880 | Ga0070709_11707383 | |||
| 881 | Ga0070714_100011755 | |||
| 882 | Ga0070714_100021819 | |||
| 883 | Ga0070714_100040257 | |||
| 884 | Ga0070714_100042431 | |||
| 885 | Ga0070714_102270714 | |||
| 886 | Ga0070713_100150590 | |||
| 887 | Ga0070713_100586933 | |||
| 888 | Ga0070713_100803859 | |||
| 889 | Ga0070713_101100682 | |||
| 890 | Ga0070713_102374609 | |||
| 891 | Ga0070710_10001370 | |||
| 892 | Ga0070710_11229415 | |||
| 893 | Ga0070711_100015124 | |||
| 894 | Ga0070711_100469979 | |||
| 895 | Ga0070705_100765232 | |||
| 896 | Ga0070700_100090052 | |||
| 897 | Ga0070700_100122660 | |||
| 898 | Ga0070700_100439917 | |||
| 899 | Ga0070694_100409225 | |||
| 900 | Ga0070663_100619393 | |||
| 901 | Ga0070678_100016209 | |||
| 902 | Ga0070678_100387283 | |||
| 903 | Ga0070678_100430549 | |||
| 904 | Ga0070678_100453468 | |||
| 905 | Ga0070678_100753755 | |||
| 906 | Ga0070678_100864508 | |||
| 907 | Ga0070678_101012485 | |||
| 908 | Ga0070662_100268554 | |||
| 909 | Ga0068867_100068104 | |||
| 910 | Ga0068867_100636550 | |||
| 911 | Ga0068867_101122263 | |||
| 912 | Ga0068867_101318143 | |||
| 913 | Ga0068867_101515255 | |||
| 914 | Ga0068867_101545739 | |||
| 915 | Ga0070706_100601323 | |||
| 916 | Ga0070707_100001997 | |||
| 917 | Ga0070707_100619038 | |||
| 918 | Ga0070707_100666703 | |||
| 919 | Ga0070707_101256722 | |||
| 920 | Ga0070707_102142581 | |||
| 921 | Ga0070699_100239071 | |||
| 922 | Ga0070699_100767275 | |||
| 923 | Ga0070684_100095896 | |||
| 924 | Ga0070684_100112531 | |||
| 925 | Ga0070684_100548281 | |||
| 926 | Ga0070672_100189582 | |||
| 927 | Ga0070672_100224678 | |||
| 928 | Ga0070672_100340618 | |||
| 929 | Ga0070672_101407259 | |||
| 930 | Ga0070672_101704887 | |||
| 931 | Ga0070686_100074782 | |||
| 932 | Ga0070693_100222664 | |||
| 933 | Ga0070693_101675783 | |||
| 934 | Ga0070665_101101456 | |||
| 935 | Ga0070665_101832294 | |||
| 936 | Ga0070704_100297813 | |||
| 937 | Ga0070704_100390363 | |||
| 938 | Ga0070704_100555019 | |||
| 939 | Ga0070704_100995248 | |||
| 940 | Ga0068855_100358846 | |||
| 941 | Ga0068855_101618773 | |||
| 942 | Ga0070664_100104460 | |||
| 943 | Ga0070664_100300873 | |||
| 944 | Ga0070664_101486621 | |||
| 945 | Ga0068857_100002779 | |||
| 946 | Ga0068857_100068858 | |||
| 947 | Ga0068857_102316150 | |||
| 948 | Ga0068854_102262995 | |||
| 949 | Ga0068856_100161663 | |||
| 950 | Ga0068856_100957436 | |||
| 951 | Ga0070702_100296823 | |||
| 952 | Ga0070702_101098881 | |||
| 953 | Ga0070702_101879911 | |||
| 954 | Ga0068852_102446540 | |||
| 955 | Ga0068864_100537370 | |||
| 956 | Ga0068866_10300209 | |||
| 957 | Ga0068866_10352090 | |||
| 958 | Ga0068861_100487167 | |||
| 959 | Ga0068870_10148490 | |||
| 960 | Ga0068870_10268072 | |||
| 961 | Ga0068863_100418900 | |||
| 962 | Ga0068863_101084119 | |||
| 963 | Ga0068863_101304086 | |||
| 964 | Ga0068858_100111770 | |||
| 965 | Ga0081455_10006277 | |||
| 966 | Ga0081455_10033827 | |||
| 967 | Ga0081455_10055740 | |||
| 968 | Ga0081455_10238890 | |||
| 969 | Ga0081538_10003781 | |||
| 970 | Ga0081538_10005509 | |||
| 971 | Ga0070717_10010897 | |||
| 972 | Ga0070717_10021906 | |||
| 973 | Ga0070717_10623887 | |||
| 974 | Ga0070717_10845315 | |||
| 975 | Ga0075365_10547002 | |||
| 976 | Ga0075365_11337933 | |||
| 977 | Ga0075364_10704115 | |||
| 978 | Ga0075432_10292267 | |||
| 979 | Ga0075432_10314316 | |||
| 980 | Ga0070715_10121394 | |||
| 981 | Ga0070715_10469802 | |||
| 982 | Ga0070716_100412783 | |||
| 983 | Ga0070716_100890658 | |||
| 984 | Ga0070712_100329659 | |||
| 985 | Ga0070712_101247985 | |||
| 986 | Ga0070712_101300400 | |||
| 987 | Ga0075362_10100955 | |||
| 988 | Ga0097621_100199400 | |||
| 989 | Ga0097621_100573588 | |||
| 990 | Ga0097621_100924844 | |||
| 991 | Ga0097621_101334858 | |||
| 992 | Ga0068871_100074939 | |||
| 993 | Ga0068871_101147609 | |||
| 994 | Ga0068871_102248694 | |||
| 995 | Ga0075428_100074029 | |||
| 996 | Ga0075428_100404699 | |||
| 997 | Ga0075428_100701479 | |||
| 998 | Ga0075428_101327588 | |||
| 999 | Ga0075428_101497787 | |||
| 1000 | Ga0075428_101548045 | |||
| 1001 | Ga0075428_101818605 | |||
| 1002 | Ga0075430_100029341 | |||
| 1003 | Ga0075431_100427005 | |||
| 1004 | Ga0075433_10166279 | |||
| 1005 | Ga0075433_10271784 | |||
| 1006 | Ga0075433_10297719 | |||
| 1007 | Ga0075434_100002903 | |||
| 1008 | Ga0075434_100134020 | |||
| 1009 | Ga0075434_100469643 | |||
| 1010 | Ga0075434_100638124 | |||
| 1011 | Ga0075434_100800608 | |||
| 1012 | Ga0075434_100940230 | |||
| 1013 | Ga0075434_101823253 | |||
| 1014 | Ga0075429_100167594 | |||
| 1015 | Ga0068865_100188631 | |||
| 1016 | Ga0068865_100312315 | |||
| 1017 | Ga0068865_100700913 | |||
| 1018 | Ga0068865_100844435 | |||
| 1019 | Ga0068865_101083678 | |||
| 1020 | Ga0068865_101134949 | |||
| 1021 | Ga0068865_101191142 | |||
| 1022 | Ga0068865_101543028 | |||
| 1023 | Ga0075436_100138182 | |||
| 1024 | Ga0075436_101319974 | |||
| 1025 | Ga0075435_100054417 | |||
| 1026 | Ga0075435_100443720 | |||
| 1027 | Ga0075435_101253129 | |||
| 1028 | Ga0099795_10119329 | |||
| 1029 | Ga0105240_10253298 | |||
| 1030 | Ga0105240_10585685 | |||
| 1031 | Ga0105240_11076712 | |||
| 1032 | Ga0105240_11260544 | |||
| 1033 | Ga0111539_10002177 | |||
| 1034 | Ga0111539_10002716 | |||
| 1035 | Ga0111539_10009380 | |||
| 1036 | Ga0111539_10365326 | |||
| 1037 | Ga0111539_10439858 | |||
| 1038 | Ga0111539_10774499 | |||
| 1039 | Ga0111539_12027372 | |||
| 1040 | Ga0111539_12334371 | |||
| 1041 | Ga0111539_12988246 | |||
| 1042 | Ga0105245_10052006 | |||
| 1043 | Ga0105245_10135791 | |||
| 1044 | Ga0105245_10260320 | |||
| 1045 | Ga0105245_10396185 | |||
| 1046 | Ga0105245_10532511 | |||
| 1047 | Ga0105245_10692725 | |||
| 1048 | Ga0105245_13292328 | |||
| 1049 | Ga0105247_10948548 | |||
| 1050 | Ga0114129_10041130 | |||
| 1051 | Ga0114129_10068887 | |||
| 1052 | Ga0114129_10196754 | |||
| 1053 | Ga0114129_10306244 | |||
| 1054 | Ga0114129_10619837 | |||
| 1055 | Ga0114129_11064042 | |||
| 1056 | Ga0105243_10172461 | |||
| 1057 | Ga0105243_10206875 | |||
| 1058 | Ga0105243_10325196 | |||
| 1059 | Ga0105243_10358576 | |||
| 1060 | Ga0105243_10623864 | |||
| 1061 | Ga0105243_10669713 | |||
| 1062 | Ga0105243_11640280 | |||
| 1063 | Ga0105243_11648967 | |||
| 1064 | Ga0105243_11766102 | |||
| 1065 | Ga0105243_12259124 | |||
| 1066 | Ga0105242_10015723 | |||
| 1067 | Ga0105242_10070123 | |||
| 1068 | Ga0105242_10135974 | |||
| 1069 | Ga0105242_10255859 | |||
| 1070 | Ga0105242_10413355 | |||
| 1071 | Ga0105242_12056606 | |||
| 1072 | Ga0105242_12100386 | |||
| 1073 | Ga0105237_12048244 | |||
| 1074 | Ga0105237_12751476 | |||
| 1075 | Ga0105238_11870966 | |||
| 1076 | Ga0105249_11715144 | |||
| 1077 | Ga0105249_12194688 | |||
| 1078 | Ga0105249_13086294 | |||
| 1079 | Ga0105239_10220222 | |||
| 1080 | Ga0105239_12056509 | |||
| 1081 | Ga0105246_10012010 | |||
| 1082 | Ga0105246_10054984 | |||
| 1083 | Ga0105246_10102666 | |||
| 1084 | Ga0105246_10369240 | |||
| 1085 | Ga0105246_10605510 | |||
| 1086 | Ga0105246_10826861 | |||
| 1087 | Ga0105246_11373692 | |||
| 1088 | Ga0105246_12219357 | |||
| 1089 | Ga0157345_1055310 | |||
| 1090 | Ga0157369_10584821 | |||
| 1091 | Ga0157374_11272049 | |||
| 1092 | Ga0157374_12047630 | |||
| 1093 | Ga0157378_10477625 | |||
| 1094 | Ga0157378_10692854 | |||
| 1095 | Ga0157378_11284391 | |||
| 1096 | Ga0163162_10230108 | |||
| 1097 | Ga0157372_10292548 | |||
| 1098 | Ga0157375_10270163 | |||
| 1099 | Ga0157375_10276947 | |||
| 1100 | Ga0157375_10624856 | |||
| 1101 | Ga0157375_11060798 | |||
| 1102 | Ga0157375_11343524 | |||
| 1103 | Ga0163163_10450763 | |||
| 1104 | Ga0163163_10526763 | |||
| 1105 | Ga0163163_10531370 | |||
| 1106 | Ga0157380_10124679 | |||
| 1107 | Ga0157380_10240518 | |||
| 1108 | Ga0157380_10301595 | |||
| 1109 | Ga0157380_12266735 | |||
| 1110 | Ga0157380_12351939 | |||
| 1111 | Ga0182008_10481158 | |||
| 1112 | Ga0182008_10931457 | |||
| 1113 | Ga0157377_10064225 | |||
| 1114 | Ga0157377_10119784 | |||
| 1115 | Ga0157377_10853291 | |||
| 1116 | Ga0157379_10107809 | |||
| 1117 | Ga0157379_10249528 | |||
| 1118 | Ga0157379_11922130 | |||
| 1119 | Ga0157376_10011165 | |||
| 1120 | Ga0157376_10082624 | |||
| 1121 | Ga0157376_10637443 | |||
| 1122 | Ga0157376_11471249 | |||
| 1123 | Ga0157376_11795054 | |||
| 1124 | Ga0157376_12641095 | |||
| 1125 | Ga0157376_12759655 | |||
| 1126 | Ga0182006_1246530 | |||
| 1127 | Ga0163161_10354240 | |||
| 1128 | Ga0206354_10406073 | |||
| 1129 | Ga0224712_10358608 | |||
| 1130 | Ga0207692_10082360 | |||
| 1131 | Ga0207642_10219802 | |||
| 1132 | Ga0207642_10531058 | |||
| 1133 | Ga0207688_10032300 | |||
| 1134 | Ga0207680_11323403 | |||
| 1135 | Ga0207647_10768230 | |||
| 1136 | Ga0207699_10064650 | |||
| 1137 | Ga0207699_10117481 | |||
| 1138 | Ga0207699_10268760 | |||
| 1139 | Ga0207645_10412896 | |||
| 1140 | Ga0207643_10132094 | |||
| 1141 | Ga0207643_10333359 | |||
| 1142 | Ga0207684_10339408 | |||
| 1143 | Ga0207695_10357450 | |||
| 1144 | Ga0207695_10757686 | |||
| 1145 | Ga0207695_11274195 | |||
| 1146 | Ga0207693_10000954 | |||
| 1147 | Ga0207693_10280824 | |||
| 1148 | Ga0207663_10037687 | |||
| 1149 | Ga0207663_10434112 | |||
| 1150 | Ga0207662_10065009 | |||
| 1151 | Ga0207657_10172751 | |||
| 1152 | Ga0207649_10072226 | |||
| 1153 | Ga0207646_10000129 | |||
| 1154 | Ga0207646_10327674 | |||
| 1155 | Ga0207646_10360902 | |||
| 1156 | Ga0207646_10818524 | |||
| 1157 | Ga0207646_11080829 | |||
| 1158 | Ga0207646_11524592 | |||
| 1159 | Ga0207681_11001962 | |||
| 1160 | Ga0207650_11052098 | |||
| 1161 | Ga0207659_10167835 | |||
| 1162 | Ga0207659_10225581 | |||
| 1163 | Ga0207659_10296201 | |||
| 1164 | Ga0207659_10346019 | |||
| 1165 | Ga0207659_11007848 | |||
| 1166 | Ga0207659_11579875 | |||
| 1167 | Ga0207687_10076242 | |||
| 1168 | Ga0207687_10111785 | |||
| 1169 | Ga0207687_10214428 | |||
| 1170 | Ga0207687_10261315 | |||
| 1171 | Ga0207687_10376819 | |||
| 1172 | Ga0207687_11042315 | |||
| 1173 | Ga0207700_10064543 | |||
| 1174 | Ga0207700_10953908 | |||
| 1175 | Ga0207700_11306336 | |||
| 1176 | Ga0207664_10026178 | |||
| 1177 | Ga0207664_10066818 | |||
| 1178 | Ga0207664_10117872 | |||
| 1179 | Ga0207664_10151260 | |||
| 1180 | Ga0207664_10162029 | |||
| 1181 | Ga0207664_10246223 | |||
| 1182 | Ga0207664_10334027 | |||
| 1183 | Ga0207644_10109285 | |||
| 1184 | Ga0207644_10726559 | |||
| 1185 | Ga0207644_11060260 | |||
| 1186 | Ga0207690_11767477 | |||
| 1187 | Ga0207706_10071187 | |||
| 1188 | Ga0207706_10087193 | |||
| 1189 | Ga0207706_10436927 | |||
| 1190 | Ga0207706_11021710 | |||
| 1191 | Ga0207686_10217586 | |||
| 1192 | Ga0207686_10353958 | |||
| 1193 | Ga0207686_10451099 | |||
| 1194 | Ga0207686_10655747 | |||
| 1195 | Ga0207686_11704588 | |||
| 1196 | Ga0207709_10111154 | |||
| 1197 | Ga0207709_10442261 | |||
| 1198 | Ga0207709_10891320 | |||
| 1199 | Ga0207669_10582846 | |||
| 1200 | Ga0207669_10670257 | |||
| 1201 | Ga0207669_10715293 | |||
| 1202 | Ga0207704_10986327 | |||
| 1203 | Ga0207704_11037903 | |||
| 1204 | Ga0207704_11311465 | |||
| 1205 | Ga0207704_11824433 | |||
| 1206 | Ga0207665_10015992 | |||
| 1207 | Ga0207665_10164202 | |||
| 1208 | Ga0207665_10786584 | |||
| 1209 | Ga0207665_11248606 | |||
| 1210 | Ga0207691_10228848 | |||
| 1211 | Ga0207691_10241693 | |||
| 1212 | Ga0207691_10307517 | |||
| 1213 | Ga0207691_10678778 | |||
| 1214 | Ga0207691_11372667 | |||
| 1215 | Ga0207691_11636529 | |||
| 1216 | Ga0207689_11351422 | |||
| 1217 | Ga0207661_10099317 | |||
| 1218 | Ga0207661_10179436 | |||
| 1219 | Ga0207661_10546135 | |||
| 1220 | Ga0207661_11744415 | |||
| 1221 | Ga0207679_10477042 | |||
| 1222 | Ga0207679_10518202 | |||
| 1223 | Ga0207679_10568922 | |||
| 1224 | Ga0207679_10748822 | |||
| 1225 | Ga0207651_11068959 | |||
| 1226 | Ga0207668_11967160 | |||
| 1227 | Ga0207640_10551538 | |||
| 1228 | Ga0207640_12180700 | |||
| 1229 | Ga0207658_10576789 | |||
| 1230 | Ga0207677_10861426 | |||
| 1231 | Ga0207677_10983162 | |||
| 1232 | Ga0207677_10994588 | |||
| 1233 | Ga0207677_11106823 | |||
| 1234 | Ga0207677_11663916 | |||
| 1235 | Ga0207677_11929373 | |||
| 1236 | Ga0207708_10319848 | |||
| 1237 | Ga0207708_10390542 | |||
| 1238 | Ga0207708_10650211 | |||
| 1239 | Ga0207708_11052095 | |||
| 1240 | Ga0207708_11731180 | |||
| 1241 | Ga0207702_10137343 | |||
| 1242 | Ga0207702_10404762 | |||
| 1243 | Ga0207641_11326779 | |||
| 1244 | Ga0207641_11773558 | |||
| 1245 | Ga0207648_10534429 | |||
| 1246 | Ga0207648_10850590 | |||
| 1247 | Ga0207648_10914015 | |||
| 1248 | Ga0207648_11048842 | |||
| 1249 | Ga0207648_11377067 | |||
| 1250 | Ga0207648_11818366 | |||
| 1251 | Ga0207676_11877452 | |||
| 1252 | Ga0207674_10002068 | |||
| 1253 | Ga0207674_10079133 | |||
| 1254 | Ga0207674_11803000 | |||
| 1255 | Ga0207683_10054652 | |||
| 1256 | Ga0207683_10226743 | |||
| 1257 | Ga0207683_10441046 | |||
| 1258 | Ga0207683_10688454 | |||
| 1259 | Ga0207683_11410908 | |||
| 1260 | Ga0207698_10650924 | |||
| 1261 | Ga0207698_11947237 | |||
| 1262 | Ga0207428_10022243 | |||
| 1263 | Ga0207428_10044037 | |||
| 1264 | Ga0207428_10099482 | |||
| 1265 | Ga0207428_10325325 | |||
| 1266 | Ga0268266_11371210 | |||
| 1267 | Ga0268266_11402819 | |||
| 1268 | Ga0268266_11472539 | |||
| 1269 | Ga0268265_11316965 | |||
| 1270 | Ga0268264_11369442 | |||
| 1271 | Ga0265319_1002672 | |||
| 1272 | Ga0265334_10001389 | |||
| 1273 | Ga0265318_10000251 | |||
| 1274 | Ga0265318_10357825 | |||
| 1275 | Ga0265323_10074877 | |||
| 1276 | Ga0265322_10001345 | |||
| 1277 | Ga0265336_10220883 | |||
| 1278 | Ga0265338_10002952 | |||
| 1279 | Ga0265338_10004801 | |||
| 1280 | Ga0265324_10054222 | |||
| 1281 | Ga0265330_10001832 | |||
| 1282 | Ga0265332_10001076 | |||
| 1283 | Ga0265328_10116818 | |||
| 1284 | Ga0265320_10007521 | |||
| 1285 | Ga0265325_10000789 | |||
| 1286 | Ga0265329_10000737 | |||
| 1287 | Ga0265340_10002224 | |||
| 1288 | Ga0265339_10090865 | |||
| 1289 | Ga0265331_10002864 | |||
| 1290 | Ga0265331_10539456 | |||
| 1291 | Ga0265327_10004513 | |||
| 1292 | Ga0265327_10009219 | |||
| 1293 | Ga0265327_10402024 | |||
| 1294 | Ga0265316_10015955 | |||
| 1295 | Ga0307408_100173181 | |||
| 1296 | Ga0265313_10025485 | |||
| 1297 | Ga0265314_10208683 | |||
| 1298 | Ga0265342_10003926 | |||
| 1299 | Ga0307405_11866370 | |||
| 1300 | Ga0307413_10413397 | |||
| 1301 | Ga0307410_10039825 | |||
| 1302 | Ga0307406_10691787 | |||
| 1303 | Ga0307407_10038517 | |||
| 1304 | Ga0307412_10028568 | |||
| 1305 | Ga0307409_100029582 | |||
| 1306 | Ga0307409_101413563 | |||
| 1307 | Ga0307416_100239355 | |||
| 1308 | Ga0307416_100358388 | |||
| 1309 | Ga0307416_100847352 | |||
| 1310 | Ga0307411_10200506 | |||
| 1311 | Ga0307415_100059765 | |||
| 1312 | Ga0307415_100166573 | |||
| 1313 | Ga0373934_0184900 | |||
| 1314 | Ga0373934_0297808 | |||
| 1315 | Ga0373936_0201850 | |||
| 1316 | Ga0373936_0392261 | |||
| 1317 | Ga0373953_0097985 | |||
| 1318 | Ga0373957_0310237 | |||
| 1319 | Ga0373943_0322145 | |||
| 1320 | Ga0373943_0436378 | |||
| 1321 | Ga0373943_0447912 | |||
| 1322 | Ga0373946_0032609 | |||
| 1323 | Ga0373946_0270272 | |||
| 1324 | Ga0373955_0143483 | |||
| 1325 | Ga0373955_0620078 | |||
| 1326 | Ga0373924_0257736 | |||
| 1327 | Ga0373935_0583905 | |||
| 1328 | Ga0373933_0072209 | |||
| 1329 | Ga0373947_0039838 | |||
| 1330 | Ga0373947_0205249 | |||
| 1331 | Ga0373947_0352495 | |||
| 1332 | Ga0373937_0000364 | |||
| 1333 | Ga0373937_0403472 | |||
| 1334 | Ga0373937_0936355 | |||
| 1335 | Ga0373925_0725340 | |||
| 1336 | Ga0395899_0073951 | |||
| 1337 | Ga0395899_0081645 | |||
| 1338 | Ga0395899_0331009 | |||
| 1339 | Ga0395899_0345791 | |||
| 1340 | Ga0395900_0069780 | |||
| 1341 | Ga0395900_0229353 | |||
| 1342 | Ga0395900_0259818 | |||
| 1343 | Ga0395900_0461200 | |||
| 1344 | Ga0395900_0504108 | |||
| 1345 | Ga0395900_0596571 | |||
| 1346 | Ga0395900_1313429 | |||
| 1347 | Ga0395900_1427053 | |||
| 1348 | Ga0395898_0040333 | |||
| 1349 | Ga0395898_0050366 | |||
| 1350 | Ga0395898_0311506 | |||
| 1351 | Ga0395898_0403048 | |||
| 1352 | Ga0395898_0409556 | |||
| 1353 | Ga0395898_0586789 | |||
| 1354 | Ga0395898_0606427 | |||
| 1355 | Ga0395898_0858995 | |||
| 1356 | Ga0395898_1946895 | |||
| 1357 | Ga0395905_0213277 | |||
| 1358 | Ga0395905_0225727 | |||
| 1359 | Ga0395905_0235047 | |||
| 1360 | Ga0395905_0259143 | |||
| 1361 | Ga0395905_0263260 | |||
| 1362 | Ga0395905_0566361 | |||
| 1363 | Ga0395905_0818399 | |||
| 1364 | Ga0395901_0011484 | |||
| 1365 | Ga0395901_0101707 | |||
| 1366 | Ga0395901_0114839 | |||
| 1367 | Ga0395901_0232628 | |||
| 1368 | Ga0395901_0405455 | |||
| 1369 | Ga0395901_0474127 | |||
| 1370 | Ga0395901_0700511 | |||
| 1371 | Ga0395901_1103552 | |||
| 1372 | Ga0451789_1029551 | |||
| 1373 | Ga0451804_0353585 | |||
| 1374 | Ga0451835_0979349 | |||
| 1375 | Ga0451853_0844785 | |||
| 1376 | Ga0451853_3134357 | |||
| 1377 | Ga0439448_0024671 | |||
| 1378 | Ga0466964_0083602 | |||
| 1379 | Ga0466964_0335159 | |||
| 1380 | Ga0451576_2135519 | |||
| 1381 | Ga0466967_0750172 | |||
| 1382 | Ga0495617_143150 | |||
| 1383 | Ga0495592_0000050 | |||
| 1384 | Ga0495592_0101188 | |||
| 1385 | Ga0495592_0140504 | |||
| 1386 | Ga0495592_0542737 | |||
| 1387 | Ga0495603_0210952 | |||
| 1388 | Ga0495603_0224698 | |||
| 1389 | Ga0495603_0229782 | |||
| 1390 | Ga0495603_0255015 | |||
| 1391 | Ga0495629_0007457 | |||
| 1392 | Ga0495629_0994868 | |||
| 1393 | Ga0495641_0086436 | |||
| 1394 | Ga0495641_0388200 | |||
| 1395 | Ga0495651_0000028 | |||
| 1396 | Ga0495653_0002470 | |||
| 1397 | Ga0495653_0030595 | |||
| 1398 | Ga0495653_0369344 | |||
| 1399 | Ga0495653_0499266 | |||
| 1400 | Ga0495653_0657971 | |||
| 1401 | Ga0495582_0038950 | |||
| 1402 | Ga0495582_0052623 | |||
| 1403 | Ga0495582_0740967 | |||
| 1404 | Ga0495605_0018601 | |||
| 1405 | Ga0495662_0091567 | |||
| 1406 | Ga0495662_0349531 | |||
| 1407 | Ga0495664_0152378 | |||
| 1408 | Ga0495664_0551937 | |||
| 1409 | Ga0495584_0026519 | |||
| 1410 | Ga0495584_0158218 | |||
| 1411 | Ga0495584_0266259 | |||
| 1412 | Ga0495584_0582663 | |||
| 1413 | Ga0495585_0080389 | |||
| 1414 | Ga0495594_0368178 | |||
| 1415 | Ga0495596_0036967 | |||
| 1416 | Ga0495596_0207476 | |||
| 1417 | Ga0495596_0339381 | |||
| 1418 | Ga0495607_0143079 | |||
| 1419 | Ga0495607_0303986 | |||
| 1420 | Ga0495608_0002704 | |||
| 1421 | Ga0495608_0011498 | |||
| 1422 | Ga0495608_0046525 | |||
| 1423 | Ga0495608_0761099 | |||
| 1424 | Ga0495616_0359999 | |||
| 1425 | Ga0495616_0442480 | |||
| 1426 | Ga0495618_0003120 | |||
| 1427 | Ga0495618_0071632 | |||
| 1428 | Ga0495618_0379584 | |||
| 1429 | Ga0495628_0000060 | |||
| 1430 | Ga0495628_0033129 | |||
| 1431 | Ga0495628_0181592 | |||
| 1432 | Ga0495628_0663289 | |||
| 1433 | Ga0495630_0139293 | |||
| 1434 | Ga0495630_0237895 | |||
| 1435 | Ga0495630_0391240 | |||
| 1436 | Ga0495630_0475513 | |||
| 1437 | Ga0495630_1119538 | |||
| 1438 | Ga0495630_1214379 | |||
| 1439 | Ga0495631_0302170 | |||
| 1440 | Ga0495631_0469815 | |||
| 1441 | Ga0495644_0004027 | |||
| 1442 | Ga0495644_0019835 | |||
| 1443 | Ga0495644_0167566 | |||
| 1444 | Ga0495644_0397680 | |||
| 1445 | Ga0495663_0051703 | |||
| 1446 | Ga0495663_0382037 | |||
| 1447 | Ga0495652_0000512 | |||
| 1448 | Ga0495652_0044756 | |||
| 1449 | Ga0495652_0670543 | |||
| 1450 | Ga0495652_1149061 | |||
| 1451 | Ga0495654_0374508 | |||
| 1452 | Ga0495640_0022675 | |||
| 1453 | Ga0495640_0506473 | |||
| 1454 | Ga0495640_0609281 | |||
| 1455 | Ga0495586_0284580 | |||
| 1456 | Ga0495587_0000062 | |||
| 1457 | Ga0495598_0081670 | |||
| 1458 | Ga0495621_0088937 | |||
| 1459 | Ga0495645_0000028 | |||
| 1460 | Ga0495645_0047808 | |||
| 1461 | Ga0495645_0059670 | |||
| 1462 | Ga0495667_0054102 | |||
| 1463 | Ga0495667_0155944 | |||
| 1464 | Ga0495667_0207919 | |||
| 1465 | Ga0495667_0986300 | |||
| 1466 | Ga0495656_0006621 | |||
| 1467 | Ga0495656_0014258 | |||
| 1468 | Ga0495656_0052907 | |||
| 1469 | Ga0495656_0098386 | |||
| 1470 | Ga0495656_0142421 | |||
| 1471 | Ga0495656_0356620 | |||
| 1472 | Ga0495656_0476161 | |||
| 1473 | Ga0495656_0610881 | |||
| 1474 | Ga0495668_0108969 | |||
| 1475 | Ga0495634_0101232 | |||
| 1476 | Ga0495634_0384805 | |||
| 1477 | Ga0495634_0398087 | |||
| 1478 | Ga0495634_0654961 | |||
| 1479 | Ga0495635_0056020 | |||
| 1480 | Ga0495635_0281831 | |||
| 1481 | Ga0495635_0812435 | |||
| 1482 | Ga0495659_0081780 | |||
| 1483 | Ga0495588_0094706 | |||
| 1484 | Ga0495657_0033992 | |||
| 1485 | Ga0495657_0123617 | |||
| 1486 | Ga0495657_0138041 | |||
| 1487 | Ga0495657_0170372 | |||
| 1488 | Ga0495599_0000059 | |||
| 1489 | Ga0495599_0051968 | |||
| 1490 | Ga0495599_0367171 | |||
| 1491 | Ga0495623_0000082 | |||
| 1492 | Ga0495623_0131081 | |||
| 1493 | Ga0495623_0168908 | |||
| 1494 | Ga0495646_0003941 | |||
| 1495 | Ga0495646_0416761 | |||
| 1496 | Ga0495647_0212521 | |||
| 1497 | Ga0495669_0456393 | |||
| 1498 | Ga0495613_0024755 | |||
| 1499 | Ga0495613_0044964 | |||
| 1500 | Ga0495613_0244484 | |||
| 1501 | Ga0495613_0438176 | |||
| 1502 | Ga0495624_0032751 | |||
| 1503 | Ga0495624_0501380 | |||
| 1504 | Ga0495670_0369768 | |||
| 1505 | Ga0495671_0293806 | |||
| 1506 | Ga0495600_0017901 | |||
| 1507 | Ga0495600_0821689 | |||
| 1508 | Ga0495581_0289197 | |||
| 1509 | Ga0495581_0310474 | |||
| 1510 | Ga0495581_0464473 | |||
| 1511 | Ga0495604_0000242 | |||
| 1512 | Ga0495636_0243750 | |||
| 1513 | Ga0495674_0012416 | |||
| 1514 | Ga0495674_0263697 | |||
| 1515 | Ga0495674_0362547 | |||
| 1516 | Ga0495674_0450368 | |||
| 1517 | Ga0495676_0038964 | |||
| 1518 | Ga0495676_0087292 | |||
| 1519 | Ga0495676_0100838 | |||
| 1520 | Ga0495676_0173022 | |||
| 1521 | Ga0495676_0565774 | |||
| 1522 | Ga0495680_0024954 | |||
| 1523 | Ga0495680_0095540 | |||
| 1524 | Ga0495680_0188435 | |||
| 1525 | Ga0495680_0308590 | |||
| 1526 | Ga0495680_0492561 | |||
| 1527 | Ga0495680_0538049 | |||
| 1528 | Ga0495675_0000020 | |||
| 1529 | Ga0495675_0249792 | |||
| 1530 | Ga0495684_0452558 | |||
| 1531 | Ga0495684_1088075 | |||
| 1532 | Ga0495593_0143960 | |||
| 1533 | Ga0495602_0000600 | |||
| 1534 | Ga0495602_0242106 | |||
| 1535 | Ga0495602_0453376 | |||
| 1536 | Ga0496100_0011840 | |||
| 1537 | Ga0496100_0135922 | |||
| 1538 | Ga0496100_1686455 | |||
| 1539 | Ga0496101_0005375 | |||
| 1540 | Ga0496101_0065915 | |||
| 1541 | Ga0496101_0148878 | |||
| 1542 | Ga0496101_1134835 | |||
| 1543 | Ga0496101_1480976 | |||
| 1544 | Ga0496102_0149665 | |||
| 1545 | Ga0496102_0538178 | |||
| 1546 | Ga0496102_0682892 | |||
| 1547 | Ga0496102_0752566 | |||
| 1548 | Ga0496102_0770497 | |||
| 1549 | Ga0496103_0140514 | |||
| 1550 | Ga0496103_0345483 | |||
| 1551 | Ga0496104_0024698 | |||
| 1552 | Ga0496104_0534421 | |||
| 1553 | Ga0496104_0573663 | |||
| 1554 | Ga0496104_0918942 | |||
| 1555 | Ga0496105_0005165 | |||
| 1556 | Ga0496105_0347960 | |||
| 1557 | Ga0496106_0030857 | |||
| 1558 | Ga0496106_0134354 | |||
| 1559 | Ga0496106_0949150 | |||
| 1560 | Ga0496106_1423059 | |||
| 1561 | Ga0496107_0019241 | |||
| 1562 | Ga0496107_0064819 | |||
| 1563 | Ga0496107_0141904 | |||
| 1564 | Ga0496108_0285404 | |||
| 1565 | Ga0496108_0347526 | |||
| 1566 | Ga0496108_0728642 | |||
| 1567 | Ga0496108_0772423 | |||
| 1568 | Ga0496109_0001499 | |||
| 1569 | Ga0496109_0145507 | |||
| 1570 | Ga0496109_0203816 | |||
| 1571 | Ga0496109_0558806 | |||
| 1572 | Ga0496109_0681449 | |||
| 1573 | Ga0496109_0984292 | |||
| 1574 | Ga0496109_1422815 | |||
| 1575 | Ga0496109_1504046 | |||
| 1576 | Ga0496109_1723475 | |||
| 1577 | Ga0496109_1933379 | |||
| 1578 | Ga0496110_0008785 | |||
| 1579 | Ga0496110_0183683 | |||
| 1580 | Ga0496110_0209872 | |||
| 1581 | Ga0496110_0382528 | |||
| 1582 | Ga0496110_0985369 | |||
| 1583 | Ga0496110_1175641 | |||
| 1584 | Ga0496110_1616557 | |||
| 1585 | Ga0496111_0000138 | |||
| 1586 | Ga0496111_0325756 | |||
| 1587 | Ga0496111_0455019 | |||
| 1588 | Ga0496112_0345981 | |||
| 1589 | Ga0496112_1802615 | |||
| 1590 | Ga0496113_0111822 | |||
| 1591 | Ga0496113_1001101 | |||
| 1592 | Ga0496114_0059419 | |||
| 1593 | Ga0496114_0070023 | |||
| 1594 | Ga0496114_0077804 | |||
| 1595 | Ga0496114_0134756 | |||
| 1596 | Ga0496114_0466487 | |||
| 1597 | Ga0496114_0935442 | |||
| 1598 | Ga0496114_1271704 | |||
| 1599 | Ga0496115_0212083 | |||
| 1600 | Ga0496115_0439808 | |||
| 1601 | Ga0501031_0000049 | |||
| 1602 | Ga0501032_0001830 | |||
| 1603 | Ga0501033_0000383 | |||
| 1604 | Ga0501034_0129480 | |||
| 1605 | Ga0501036_0000038 | |||
| 1606 | Ga0501037_0000177 | |||
| 1607 | Ga0501038_0000336 | |||
| 1608 | Ga0501039_0000349 | |||
| 1609 | Ga0501040_0000083 | |||
| 1610 | Ga0501041_0000001 | |||
| 1611 | Ga0501042_0000002 | |||
| 1612 | Ga0501043_0000077 | |||
| 1613 | Ga0501046_0000175 | |||
| 1614 | Ga0501047_0000162 | |||
| 1615 | Ga0501048_0000021 | |||
| 1616 | Ga0501067_0010746 | |||
| 1617 | Ga0501067_0033456 | |||
| 1618 | Ga0501067_0170994 | |||
| 1619 | Ga0501067_0546278 | |||
| 1620 | Ga0501068_0000020 | |||
| 1621 | Ga0501068_0084413 | |||
| 1622 | Ga0501068_0388410 | |||
| 1623 | Ga0501068_1116018 | |||
| 1624 | Ga0501069_0013111 | |||
| 1625 | Ga0501069_0026738 | |||
| 1626 | Ga0501069_0428422 | |||
| 1627 | Ga0501069_0432619 | |||
| 1628 | Ga0501070_0001426 | |||
| 1629 | Ga0501070_0637104 | |||
| 1630 | Ga0501071_0000024 | |||
| 1631 | Ga0501071_1543973 | |||
| 1632 | Ga0501072_0000074 | |||
| 1633 | Ga0501073_0000105 | |||
| 1634 | Ga0501074_0000013 | |||
| 1635 | Ga0501075_0000056 | |||
| 1636 | Ga0501076_0000039 | |||
| 1637 | Ga0501076_1523791 | |||
| 1638 | Ga0501077_0000049 | |||
| 1639 | Ga0501077_0871107 | |||
| 1640 | Ga0501079_0000012 | |||
| 1641 | Ga0501080_0000031 | |||
| 1642 | Ga0501081_0000004 | |||
| 1643 | Ga0501083_0000091 | |||
| 1644 | Ga0501035_0000244 | |||
| 1645 | Ga0501044_0000481 | |||
| 1646 | Ga0501045_0000016 | |||
| 1647 | nmdc:mga03683_183746_c1 | |||
| 1648 | nmdc:mga0yw44_387762_c1 | |||
| 1649 | nmdc:mga05p37_1092990_c1 | |||
| 1650 | nmdc:mga05p37_137810_c1 | |||
| 1651 | nmdc:mga05p37_1754268_c1 | |||
| 1652 | nmdc:mga05p37_193594_c1 | |||
| 1653 | nmdc:mga05p37_659330_c1 | |||
| 1654 | nmdc:mga05p37_85717_c1 | |||
| 1655 | nmdc:mga09592_134240_c1 | |||
| 1656 | nmdc:mga0qj67_102363_c1 | |||
| 1657 | nmdc:mga06r32_959435_c1 | |||
| 1658 | nmdc:mga08y16_157721_c1 | |||
| 1659 | nmdc:mga08y16_1604691_c1 | |||
| 1660 | nmdc:mga08y16_16523_c1 | |||
| 1661 | nmdc:mga08y16_341629_c1 | |||
| 1662 | nmdc:mga08y16_43268_c1 | |||
| 1663 | nmdc:mga08y16_61061_c1 | |||
| 1664 | nmdc:mga0n895_100046_c1 | |||
| 1665 | nmdc:mga0n895_185094_c1 | |||
| 1666 | nmdc:mga0n895_230799_c1 | |||
| 1667 | nmdc:mga0n895_682064_c1 | |||
| 1668 | nmdc:mga0n895_790446_c1 | |||
| 1669 | nmdc:mga0rr50_108774_c1 | |||
| 1670 | nmdc:mga08x19_813817_c1 | |||
| 1671 | nmdc:mga08x19_97513_c1 | |||
| 1672 | nmdc:mga0a205_1574353_c1 | |||
| 1673 | nmdc:mga0a205_188316_c1 | |||
| 1674 | nmdc:mga0a205_291069_c1 | |||
| 1675 | Ga0495601_0000241 | |||
| 1676 | Ga0495601_0013901 | |||
| 1677 | Ga0495601_0704381 | |||
| 1678 | Ga0495612_0024489 | |||
| 1679 | Ga0495655_0008739 | |||
| 1680 | Ga0495655_0029477 | |||
| 1681 | Ga0495595_0009251 | |||
| 1682 | Ga0495595_0027630 | |||
| 1683 | Ga0495595_0229594 | |||
| 1684 | Ga0495619_0000316 | |||
| 1685 | Ga0495619_0019352 | |||
| 1686 | Ga0495619_0072189 | |||
| 1687 | Ga0495619_0295967 | |||
| 1688 | Ga0501084_0000635 | |||
| 1689 | Ga0501084_1591250 | |||
| 1690 | Ga0501082_0000135 | |||
| 1691 | Ga0530510_0004796 | |||
| 1692 | Ga0530510_0178176 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ls2-assembly1.cif.gz_b2 | 80s ribosome from mouse bound to eef2 (class i) | 0.957 | 1 | 58 |
| 6z6l-assembly1.cif.gz_Lh | cryo-em structure of human ccdc124 bound to 80s ribosomes | 0.9395 | 1 | 58 |
| 7cpv-assembly1.cif.gz_Lh | cryo-em structure of 80s ribosome from mouse testis | 0.9391 | 1 | 58 |
| 8bpo-assembly1.cif.gz_g2 | structure of rabbit 80s ribosome translating beta-tubulin in complex with tetratricopeptide protein 5 (ttc5) and s-phase cyclin a associated protein residing in the er (scaper) | 0.9368 | 1 | 58 |
| 8a3d-assembly1.cif.gz_b | human mature large subunit of the ribosome with eif6 and homoharringtonine bound | 0.933 | 1 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q15311_381_446_1.20.58.90 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9601 | 2 | 53 | 1.20.58.90 |
| af_Q2FZ34_110_392_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.933 | 4 | 49 | 3.40.630.30 |
| af_Q2FZ34_165_379_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.933 | 4 | 49 | 3.40.630.30 |
| af_Q54ND2_601_802_1.20.900.10 | Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain | 0.9296 | 4 | 50 | 1.20.900.10 |
| af_A0A1D8PEG6_32_281_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9267 | 4 | 47 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7M3MQP4-F1-model_v4 | DUF2203 family protein | 1.005 | 5 | 48 |
|
| AF-A0A7C8Q7T8-F1-model_v4 | SAGA HAT/Core module component | 0.9927 | 4 | 49 |
GO:0000124
GO:0035064 |
| AF-A0A6S7MHZ5-F1-model_v4 | deleted | 0.9911 | 4 | 49 |
|
| AF-A0A2N9FBR9-F1-model_v4 | Reverse transcriptase domain-containing protein | 0.9905 | 6 | 48 |
|
| AF-A0A0B7JSL5-F1-model_v4 | Uncharacterized protein | 0.9905 | 4 | 49 |
|