F483287

General Info

Members Datasets Scaffolds Average Seq Length
846 339 1692 80

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101201558|Ga0070716_1012015582
Length 79
Sequence MDDSQIHGTIEQLVAEEHELWARESADASDGDRRRLDQLKVSLDQCWDLLRQRRALRDASADPEGADVRRPEVVENYEQ

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
157 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
158 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 7.92
Rhizosphere 91.02
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101201558 3300006173 Bacteria 609
2 Ga0070658_10765235 3300005327 Bacteria 839
3 Ga0070683_100061207 3300005329 Bacteria 3500
4 Ga0070683_100188838 3300005329 Bacteria 1956
5 Ga0070683_100479888 3300005329 Bacteria 1187
6 Ga0070690_100161920 3300005330 Bacteria 1534
7 Ga0070670_100158874 3300005331 Bacteria 1959
8 Ga0070670_100851137 3300005331 Unclassified 825
9 Ga0070677_10638275 3300005333 Bacteria 594
10 Ga0068869_100022844 3300005334 Bacteria 4313
11 Ga0068869_100188849 3300005334 Bacteria 1619
12 Ga0070666_11434439 3300005335 Unclassified 516
13 Ga0070682_100052575 3300005337 Bacteria 2550
14 Ga0070682_101614601 3300005337 Unclassified 561
15 Ga0068868_100561414 3300005338 Bacteria 1007
16 Ga0068868_101318938 3300005338 Bacteria 671
17 Ga0070689_100215348 3300005340 Bacteria 1574
18 Ga0070675_100065831 3300005354 Bacteria 2997
19 Ga0070675_100110021 3300005354 Bacteria 2330
20 Ga0070675_100485583 3300005354 Bacteria 1112
21 Ga0070675_100685175 3300005354 Unclassified 933
22 Ga0070675_100737173 3300005354 Bacteria 899
23 Ga0070675_101504095 3300005354 Bacteria 621
24 Ga0070671_100064412 3300005355 Bacteria 3053
25 Ga0070671_101373050 3300005355 Bacteria 624
26 Ga0070674_100030970 3300005356 Unclassified 3540
27 Ga0070674_100359736 3300005356 Bacteria 1178
28 Ga0070674_101749891 3300005356 Unclassified 563
29 Ga0070673_100224796 3300005364 Bacteria 1626
30 Ga0070673_100378496 3300005364 Bacteria 1262
31 Ga0070673_101679226 3300005364 Bacteria 601
32 Ga0070659_101515674 3300005366 Bacteria 598
33 Ga0070667_100752725 3300005367 Unclassified 903
34 Ga0070709_11707383 3300005434 Bacteria 514
35 Ga0070714_100011755 3300005435 Bacteria 6956
36 Ga0070714_100021819 3300005435 Bacteria 5242
37 Ga0070714_100040257 3300005435 Bacteria 3938
38 Ga0070714_100042431 3300005435 Bacteria 3843
39 Ga0070714_102270714 3300005435 Bacteria 528
40 Ga0070713_100150590 3300005436 Bacteria 2069
41 Ga0070713_100586933 3300005436 Unclassified 1057
42 Ga0070713_100803859 3300005436 Bacteria 901
43 Ga0070713_101100682 3300005436 Bacteria 768
44 Ga0070713_102374609 3300005436 Bacteria 513
45 Ga0070710_10001370 3300005437 Bacteria 11509
46 Ga0070710_11229415 3300005437 Bacteria 555
47 Ga0070711_100015124 3300005439 Bacteria 4878
48 Ga0070711_100469979 3300005439 Bacteria 1032
49 Ga0070705_100765232 3300005440 Bacteria 765
50 Ga0070700_100090052 3300005441 Bacteria 2000
51 Ga0070700_100122660 3300005441 Bacteria 1744
52 Ga0070700_100439917 3300005441 Bacteria 990
53 Ga0070694_100409225 3300005444 Bacteria 1064
54 Ga0070663_100619393 3300005455 Bacteria 912
55 Ga0070678_100016209 3300005456 Bacteria 4759
56 Ga0070678_100387283 3300005456 Bacteria 1211
57 Ga0070678_100430549 3300005456 Unclassified 1152
58 Ga0070678_100453468 3300005456 Bacteria 1124
59 Ga0070678_100753755 3300005456 Unclassified 881
60 Ga0070678_100864508 3300005456 Bacteria 825
61 Ga0070678_101012485 3300005456 Bacteria 764
62 Ga0070662_100268554 3300005457 Bacteria 1377
63 Ga0068867_100068104 3300005459 Bacteria 2656
64 Ga0068867_100636550 3300005459 Unclassified 934
65 Ga0068867_101122263 3300005459 Bacteria 719
66 Ga0068867_101318143 3300005459 Bacteria 667
67 Ga0068867_101515255 3300005459 Bacteria 625
68 Ga0068867_101545739 3300005459 Unclassified 619
69 Ga0070706_100601323 3300005467 Bacteria 1022
70 Ga0070707_100001997 3300005468 Bacteria 19526
71 Ga0070707_100619038 3300005468 Bacteria 1045
72 Ga0070707_100666703 3300005468 Bacteria 1003
73 Ga0070707_101256722 3300005468 Bacteria 707
74 Ga0070707_102142581 3300005468 Bacteria 527
75 Ga0070699_100239071 3300005518 Unclassified 1620
76 Ga0070699_100767275 3300005518 Bacteria 882
77 Ga0070684_100095896 3300005535 Bacteria 2643
78 Ga0070684_100112531 3300005535 Bacteria 2442
79 Ga0070684_100548281 3300005535 Bacteria 1073
80 Ga0070672_100189582 3300005543 Bacteria 1716
81 Ga0070672_100224678 3300005543 Bacteria 1576
82 Ga0070672_100340618 3300005543 Bacteria 1277
83 Ga0070672_101407259 3300005543 Bacteria 624
84 Ga0070672_101704887 3300005543 Bacteria 566
85 Ga0070686_100074782 3300005544 Bacteria 2227
86 Ga0070693_100222664 3300005547 Bacteria 1237
87 Ga0070693_101675783 3300005547 Bacteria 501
88 Ga0070665_101101456 3300005548 Unclassified 806
89 Ga0070665_101832294 3300005548 Unclassified 613
90 Ga0070704_100297813 3300005549 Bacteria 1343
91 Ga0070704_100390363 3300005549 Bacteria 1185
92 Ga0070704_100555019 3300005549 Unclassified 1004
93 Ga0070704_100995248 3300005549 Bacteria 758
94 Ga0068855_100358846 3300005563 Unclassified 1604
95 Ga0068855_101618773 3300005563 Bacteria 662
96 Ga0070664_100104460 3300005564 Bacteria 2467
97 Ga0070664_100300873 3300005564 Bacteria 1449
98 Ga0070664_101486621 3300005564 Bacteria 641
99 Ga0068857_100002779 3300005577 Bacteria 14392
100 Ga0068857_100068858 3300005577 Bacteria 3150
101 Ga0068857_102316150 3300005577 Bacteria 527
102 Ga0068854_102262995 3300005578 Unclassified 503
103 Ga0068856_100161663 3300005614 Bacteria 2250
104 Ga0068856_100957436 3300005614 Bacteria 875
105 Ga0070702_100296823 3300005615 Bacteria 1116
106 Ga0070702_101098881 3300005615 Unclassified 635
107 Ga0070702_101879911 3300005615 Bacteria 502
108 Ga0068852_102446540 3300005616 Bacteria 543
109 Ga0068864_100537370 3300005618 Bacteria 1128
110 Ga0068866_10300209 3300005718 Bacteria 1003
111 Ga0068866_10352090 3300005718 Unclassified 936
112 Ga0068861_100487167 3300005719 Unclassified 1112
113 Ga0068870_10148490 3300005840 Bacteria 1378
114 Ga0068870_10268072 3300005840 Unclassified 1065
115 Ga0068863_100418900 3300005841 Bacteria 1312
116 Ga0068863_101084119 3300005841 Bacteria 805
117 Ga0068863_101304086 3300005841 Bacteria 733
118 Ga0068858_100111770 3300005842 Bacteria 2551
119 Ga0081455_10006277 3300005937 Bacteria 12781
120 Ga0081455_10033827 3300005937 Unclassified 4587
121 Ga0081455_10055740 3300005937 Bacteria 3361
122 Ga0081455_10238890 3300005937 Bacteria 1336
123 Ga0081538_10003781 3300005981 Bacteria 14166
124 Ga0081538_10005509 3300005981 Bacteria 11373
125 Ga0070717_10010897 3300006028 Bacteria 6882
126 Ga0070717_10021906 3300006028 Bacteria 5042
127 Ga0070717_10623887 3300006028 Bacteria 978
128 Ga0070717_10845315 3300006028 Unclassified 833
129 Ga0075365_10547002 3300006038 Bacteria 819
130 Ga0075365_11337933 3300006038 Bacteria 503
131 Ga0075364_10704115 3300006051 Bacteria 689
132 Ga0075432_10292267 3300006058 Bacteria 674
133 Ga0075432_10314316 3300006058 Bacteria 654
134 Ga0070715_10121394 3300006163 Bacteria 1246
135 Ga0070715_10469802 3300006163 Unclassified 714
136 Ga0070716_100412783 3300006173 Bacteria 974
137 Ga0070716_100890658 3300006173 Bacteria 696
138 Ga0070712_100329659 3300006175 Bacteria 1243
139 Ga0070712_101247985 3300006175 Bacteria 647
140 Ga0070712_101300400 3300006175 Bacteria 634
141 Ga0075362_10100955 3300006177 Bacteria 1349
142 Ga0097621_100199400 3300006237 Bacteria 1737
143 Ga0097621_100573588 3300006237 Bacteria 1029
144 Ga0097621_100924844 3300006237 Bacteria 813
145 Ga0097621_101334858 3300006237 Unclassified 678
146 Ga0068871_100074939 3300006358 Bacteria 2793
147 Ga0068871_101147609 3300006358 Bacteria 728
148 Ga0068871_102248694 3300006358 Bacteria 520
149 Ga0075428_100074029 3300006844 Bacteria 3720
150 Ga0075428_100404699 3300006844 Bacteria 1462
151 Ga0075428_100701479 3300006844 Bacteria 1078
152 Ga0075428_101327588 3300006844 Bacteria 756
153 Ga0075428_101497787 3300006844 Bacteria 707
154 Ga0075428_101548045 3300006844 Bacteria 694
155 Ga0075428_101818605 3300006844 Bacteria 634
156 Ga0075430_100029341 3300006846 Bacteria 4668
157 Ga0075431_100427005 3300006847 Bacteria 1324
158 Ga0075433_10166279 3300006852 Bacteria 1963
159 Ga0075433_10271784 3300006852 Bacteria 1502
160 Ga0075433_10297719 3300006852 Bacteria 1429
161 Ga0075434_100002903 3300006871 Bacteria 15214
162 Ga0075434_100134020 3300006871 Bacteria 2497
163 Ga0075434_100469643 3300006871 Unclassified 1279
164 Ga0075434_100638124 3300006871 Bacteria 1083
165 Ga0075434_100800608 3300006871 Bacteria 959
166 Ga0075434_100940230 3300006871 Bacteria 879
167 Ga0075434_101823253 3300006871 Bacteria 615
168 Ga0075429_100167594 3300006880 Bacteria 1924
169 Ga0068865_100188631 3300006881 Unclassified 1593
170 Ga0068865_100312315 3300006881 Bacteria 1262
171 Ga0068865_100700913 3300006881 Bacteria 865
172 Ga0068865_100844435 3300006881 Bacteria 793
173 Ga0068865_101083678 3300006881 Unclassified 705
174 Ga0068865_101134949 3300006881 Bacteria 690
175 Ga0068865_101191142 3300006881 Unclassified 674
176 Ga0068865_101543028 3300006881 Unclassified 596
177 Ga0075436_100138182 3300006914 Bacteria 1712
178 Ga0075436_101319974 3300006914 Bacteria 546
179 Ga0075435_100054417 3300007076 Bacteria 3229
180 Ga0075435_100443720 3300007076 Bacteria 1119
181 Ga0075435_101253129 3300007076 Bacteria 649
182 Ga0099795_10119329 3300007788 Bacteria 1053
183 Ga0105240_10253298 3300009093 Bacteria 2035
184 Ga0105240_10585685 3300009093 Bacteria 1230
185 Ga0105240_11076712 3300009093 Unclassified 856
186 Ga0105240_11260544 3300009093 Bacteria 781
187 Ga0111539_10002177 3300009094 Bacteria 26179
188 Ga0111539_10002716 3300009094 Bacteria 23474
189 Ga0111539_10009380 3300009094 Bacteria 12355
190 Ga0111539_10365326 3300009094 Bacteria 1680
191 Ga0111539_10439858 3300009094 Bacteria 1518
192 Ga0111539_10774499 3300009094 Bacteria 1117
193 Ga0111539_12027372 3300009094 Unclassified 667
194 Ga0111539_12334371 3300009094 Bacteria 621
195 Ga0111539_12988246 3300009094 Bacteria 546
196 Ga0105245_10052006 3300009098 Bacteria 3673
197 Ga0105245_10135791 3300009098 Bacteria 2311
198 Ga0105245_10260320 3300009098 Bacteria 1688
199 Ga0105245_10396185 3300009098 Unclassified 1378
200 Ga0105245_10532511 3300009098 Unclassified 1195
201 Ga0105245_10692725 3300009098 Bacteria 1052
202 Ga0105245_13292328 3300009098 Bacteria 500
203 Ga0105247_10948548 3300009101 Bacteria 668
204 Ga0114129_10041130 3300009147 Bacteria 6515
205 Ga0114129_10068887 3300009147 Bacteria 4932
206 Ga0114129_10196754 3300009147 Bacteria 2733
207 Ga0114129_10306244 3300009147 Bacteria 2116
208 Ga0114129_10619837 3300009147 Bacteria 1400
209 Ga0114129_11064042 3300009147 Bacteria 1015
210 Ga0105243_10172461 3300009148 Bacteria 1875
211 Ga0105243_10206875 3300009148 Unclassified 1725
212 Ga0105243_10325196 3300009148 Bacteria 1403
213 Ga0105243_10358576 3300009148 Bacteria 1341
214 Ga0105243_10623864 3300009148 Bacteria 1041
215 Ga0105243_10669713 3300009148 Bacteria 1008
216 Ga0105243_11640280 3300009148 Bacteria 671
217 Ga0105243_11648967 3300009148 Bacteria 669
218 Ga0105243_11766102 3300009148 Bacteria 649
219 Ga0105243_12259124 3300009148 Bacteria 581
220 Ga0105242_10015723 3300009176 Bacteria 5880
221 Ga0105242_10070123 3300009176 Bacteria 2905
222 Ga0105242_10135974 3300009176 Unclassified 2127
223 Ga0105242_10255859 3300009176 Unclassified 1580
224 Ga0105242_10413355 3300009176 Bacteria 1262
225 Ga0105242_12056606 3300009176 Bacteria 614
226 Ga0105242_12100386 3300009176 Bacteria 609
227 Ga0105237_12048244 3300009545 Bacteria 581
228 Ga0105237_12751476 3300009545 Unclassified 503
229 Ga0105238_11870966 3300009551 Bacteria 633
230 Ga0105249_11715144 3300009553 Bacteria 701
231 Ga0105249_12194688 3300009553 Bacteria 625
232 Ga0105249_13086294 3300009553 Bacteria 535
233 Ga0105239_10220222 3300010375 Unclassified 2128
234 Ga0105239_12056509 3300010375 Bacteria 663
235 Ga0105246_10012010 3300011119 Bacteria 5394
236 Ga0105246_10054984 3300011119 Bacteria 2745
237 Ga0105246_10102666 3300011119 Bacteria 2085
238 Ga0105246_10369240 3300011119 Bacteria 1182
239 Ga0105246_10605510 3300011119 Bacteria 947
240 Ga0105246_10826861 3300011119 Unclassified 824
241 Ga0105246_11373692 3300011119 Bacteria 658
242 Ga0105246_12219357 3300011119 Bacteria 535
243 Ga0157345_1055310 3300012498 Bacteria 515
244 Ga0157369_10584821 3300013105 Bacteria 1153
245 Ga0157374_11272049 3300013296 Bacteria 757
246 Ga0157374_12047630 3300013296 Bacteria 599
247 Ga0157378_10477625 3300013297 Bacteria 1241
248 Ga0157378_10692854 3300013297 Unclassified 1038
249 Ga0157378_11284391 3300013297 Unclassified 773
250 Ga0163162_10230108 3300013306 Bacteria 1984
251 Ga0157372_10292548 3300013307 Bacteria 1894
252 Ga0157375_10270163 3300013308 Bacteria 1862
253 Ga0157375_10276947 3300013308 Bacteria 1840
254 Ga0157375_10624856 3300013308 Bacteria 1235
255 Ga0157375_11060798 3300013308 Bacteria 947
256 Ga0157375_11343524 3300013308 Bacteria 841
257 Ga0163163_10450763 3300014325 Bacteria 1347
258 Ga0163163_10526763 3300014325 Unclassified 1244
259 Ga0163163_10531370 3300014325 Bacteria 1238
260 Ga0157380_10124679 3300014326 Bacteria 2187
261 Ga0157380_10240518 3300014326 Bacteria 1632
262 Ga0157380_10301595 3300014326 Bacteria 1476
263 Ga0157380_12266735 3300014326 Bacteria 607
264 Ga0157380_12351939 3300014326 Unclassified 598
265 Ga0182008_10481158 3300014497 Unclassified 680
266 Ga0182008_10931457 3300014497 Bacteria 513
267 Ga0157377_10064225 3300014745 Bacteria 2105
268 Ga0157377_10119784 3300014745 Bacteria 1594
269 Ga0157377_10853291 3300014745 Bacteria 676
270 Ga0157379_10107809 3300014968 Bacteria 2501
271 Ga0157379_10249528 3300014968 Bacteria 1611
272 Ga0157379_11922130 3300014968 Bacteria 583
273 Ga0157376_10011165 3300014969 Bacteria 6608
274 Ga0157376_10082624 3300014969 Bacteria 2761
275 Ga0157376_10637443 3300014969 Bacteria 1065
276 Ga0157376_11471249 3300014969 Unclassified 714
277 Ga0157376_11795054 3300014969 Bacteria 649
278 Ga0157376_12641095 3300014969 Bacteria 542
279 Ga0157376_12759655 3300014969 Bacteria 531
280 Ga0182006_1246530 3300015261 Bacteria 587
281 Ga0163161_10354240 3300017792 Bacteria 1167
282 Ga0206354_10406073 3300020081 Bacteria 602
283 Ga0224712_10358608 3300022467 Bacteria 690
284 Ga0207692_10082360 3300025898 Bacteria 1724
285 Ga0207642_10219802 3300025899 Unclassified 1061
286 Ga0207642_10531058 3300025899 Bacteria 724
287 Ga0207688_10032300 3300025901 Bacteria 2893
288 Ga0207680_11323403 3300025903 Unclassified 512
289 Ga0207647_10768230 3300025904 Unclassified 520
290 Ga0207699_10064650 3300025906 Bacteria 2214
291 Ga0207699_10117481 3300025906 Bacteria 1714
292 Ga0207699_10268760 3300025906 Bacteria 1181
293 Ga0207645_10412896 3300025907 Bacteria 909
294 Ga0207643_10132094 3300025908 Bacteria 1486
295 Ga0207643_10333359 3300025908 Bacteria 950
296 Ga0207684_10339408 3300025910 Bacteria 1294
297 Ga0207695_10357450 3300025913 Bacteria 1347
298 Ga0207695_10757686 3300025913 Bacteria 851
299 Ga0207695_11274195 3300025913 Bacteria 615
300 Ga0207693_10000954 3300025915 Bacteria 25940
301 Ga0207693_10280824 3300025915 Bacteria 1305
302 Ga0207663_10037687 3300025916 Bacteria 2916
303 Ga0207663_10434112 3300025916 Bacteria 1010
304 Ga0207662_10065009 3300025918 Bacteria 2196
305 Ga0207657_10172751 3300025919 Bacteria 1750
306 Ga0207649_10072226 3300025920 Bacteria 2207
307 Ga0207646_10000129 3300025922 Bacteria 102411
308 Ga0207646_10327674 3300025922 Bacteria 1384
309 Ga0207646_10360902 3300025922 Bacteria 1313
310 Ga0207646_10818524 3300025922 Bacteria 829
311 Ga0207646_11080829 3300025922 Bacteria 707
312 Ga0207646_11524592 3300025922 Bacteria 578
313 Ga0207681_11001962 3300025923 Unclassified 701
314 Ga0207650_11052098 3300025925 Bacteria 692
315 Ga0207659_10167835 3300025926 Bacteria 1729
316 Ga0207659_10225581 3300025926 Bacteria 1509
317 Ga0207659_10296201 3300025926 Bacteria 1327
318 Ga0207659_10346019 3300025926 Bacteria 1232
319 Ga0207659_11007848 3300025926 Bacteria 717
320 Ga0207659_11579875 3300025926 Bacteria 560
321 Ga0207687_10076242 3300025927 Bacteria 2408
322 Ga0207687_10111785 3300025927 Bacteria 2029
323 Ga0207687_10214428 3300025927 Bacteria 1512
324 Ga0207687_10261315 3300025927 Bacteria 1380
325 Ga0207687_10376819 3300025927 Bacteria 1162
326 Ga0207687_11042315 3300025927 Unclassified 702
327 Ga0207700_10064543 3300025928 Bacteria 2790
328 Ga0207700_10953908 3300025928 Bacteria 768
329 Ga0207700_11306336 3300025928 Bacteria 646
330 Ga0207664_10026178 3300025929 Bacteria 4405
331 Ga0207664_10066818 3300025929 Bacteria 2883
332 Ga0207664_10117872 3300025929 Bacteria 2217
333 Ga0207664_10151260 3300025929 Bacteria 1972
334 Ga0207664_10162029 3300025929 Bacteria 1908
335 Ga0207664_10246223 3300025929 Bacteria 1558
336 Ga0207664_10334027 3300025929 Bacteria 1339
337 Ga0207644_10109285 3300025931 Bacteria 2089
338 Ga0207644_10726559 3300025931 Bacteria 829
339 Ga0207644_11060260 3300025931 Unclassified 681
340 Ga0207690_11767477 3300025932 Bacteria 516
341 Ga0207706_10071187 3300025933 Bacteria 3058
342 Ga0207706_10087193 3300025933 Bacteria 2744
343 Ga0207706_10436927 3300025933 Bacteria 1133
344 Ga0207706_11021710 3300025933 Bacteria 694
345 Ga0207686_10217586 3300025934 Bacteria 1377
346 Ga0207686_10353958 3300025934 Bacteria 1106
347 Ga0207686_10451099 3300025934 Bacteria 989
348 Ga0207686_10655747 3300025934 Unclassified 831
349 Ga0207686_11704588 3300025934 Bacteria 521
350 Ga0207709_10111154 3300025935 Bacteria 1832
351 Ga0207709_10442261 3300025935 Unclassified 1003
352 Ga0207709_10891320 3300025935 Bacteria 723
353 Ga0207669_10582846 3300025937 Unclassified 907
354 Ga0207669_10670257 3300025937 Bacteria 850
355 Ga0207669_10715293 3300025937 Unclassified 824
356 Ga0207704_10986327 3300025938 Bacteria 712
357 Ga0207704_11037903 3300025938 Bacteria 695
358 Ga0207704_11311465 3300025938 Unclassified 619
359 Ga0207704_11824433 3300025938 Unclassified 523
360 Ga0207665_10015992 3300025939 Bacteria 4927
361 Ga0207665_10164202 3300025939 Bacteria 1600
362 Ga0207665_10786584 3300025939 Bacteria 751
363 Ga0207665_11248606 3300025939 Bacteria 593
364 Ga0207691_10228848 3300025940 Bacteria 1610
365 Ga0207691_10241693 3300025940 Bacteria 1561
366 Ga0207691_10307517 3300025940 Bacteria 1361
367 Ga0207691_10678778 3300025940 Bacteria 869
368 Ga0207691_11372667 3300025940 Bacteria 581
369 Ga0207691_11636529 3300025940 Unclassified 523
370 Ga0207689_11351422 3300025942 Bacteria 598
371 Ga0207661_10099317 3300025944 Bacteria 2441
372 Ga0207661_10179436 3300025944 Bacteria 1849
373 Ga0207661_10546135 3300025944 Bacteria 1061
374 Ga0207661_11744415 3300025944 Unclassified 568
375 Ga0207679_10477042 3300025945 Bacteria 1110
376 Ga0207679_10518202 3300025945 Bacteria 1066
377 Ga0207679_10568922 3300025945 Bacteria 1018
378 Ga0207679_10748822 3300025945 Bacteria 889
379 Ga0207651_11068959 3300025960 Unclassified 723
380 Ga0207668_11967160 3300025972 Bacteria 527
381 Ga0207640_10551538 3300025981 Bacteria 968
382 Ga0207640_12180700 3300025981 Unclassified 503
383 Ga0207658_10576789 3300025986 Bacteria 1009
384 Ga0207677_10861426 3300026023 Bacteria 815
385 Ga0207677_10983162 3300026023 Bacteria 764
386 Ga0207677_10994588 3300026023 Bacteria 760
387 Ga0207677_11106823 3300026023 Bacteria 722
388 Ga0207677_11663916 3300026023 Unclassified 591
389 Ga0207677_11929373 3300026023 Bacteria 549
390 Ga0207708_10319848 3300026075 Bacteria 1266
391 Ga0207708_10390542 3300026075 Bacteria 1149
392 Ga0207708_10650211 3300026075 Bacteria 897
393 Ga0207708_11052095 3300026075 Bacteria 708
394 Ga0207708_11731180 3300026075 Unclassified 549
395 Ga0207702_10137343 3300026078 Bacteria 2208
396 Ga0207702_10404762 3300026078 Bacteria 1317
397 Ga0207641_11326779 3300026088 Bacteria 720
398 Ga0207641_11773558 3300026088 Unclassified 619
399 Ga0207648_10534429 3300026089 Unclassified 1075
400 Ga0207648_10850590 3300026089 Unclassified 851
401 Ga0207648_10914015 3300026089 Unclassified 820
402 Ga0207648_11048842 3300026089 Bacteria 764
403 Ga0207648_11377067 3300026089 Unclassified 663
404 Ga0207648_11818366 3300026089 Bacteria 571
405 Ga0207676_11877452 3300026095 Bacteria 598
406 Ga0207674_10002068 3300026116 Bacteria 25444
407 Ga0207674_10079133 3300026116 Bacteria 3292
408 Ga0207674_11803000 3300026116 Bacteria 579
409 Ga0207683_10054652 3300026121 Unclassified 3501
410 Ga0207683_10226743 3300026121 Bacteria 1703
411 Ga0207683_10441046 3300026121 Bacteria 1200
412 Ga0207683_10688454 3300026121 Bacteria 948
413 Ga0207683_11410908 3300026121 Bacteria 644
414 Ga0207698_10650924 3300026142 Bacteria 1044
415 Ga0207698_11947237 3300026142 Bacteria 602
416 Ga0207428_10022243 3300027907 Bacteria 5354
417 Ga0207428_10044037 3300027907 Bacteria 3601
418 Ga0207428_10099482 3300027907 Bacteria 2249
419 Ga0207428_10325325 3300027907 Bacteria 1135
420 Ga0268266_11371210 3300028379 Unclassified 683
421 Ga0268266_11402819 3300028379 Unclassified 674
422 Ga0268266_11472539 3300028379 Bacteria 656
423 Ga0268265_11316965 3300028380 Bacteria 723
424 Ga0268264_11369442 3300028381 Bacteria 718
425 Ga0265319_1002672 3300028563 Bacteria 9567
426 Ga0265334_10001389 3300028573 Bacteria 11666
427 Ga0265318_10000251 3300028577 Bacteria 46650
428 Ga0265318_10357825 3300028577 Bacteria 533
429 Ga0265323_10074877 3300028653 Bacteria 1151
430 Ga0265322_10001345 3300028654 Bacteria 8164
431 Ga0265336_10220883 3300028666 Bacteria 563
432 Ga0265338_10002952 3300028800 Bacteria 24672
433 Ga0265338_10004801 3300028800 Bacteria 18068
434 Ga0265324_10054222 3300029957 Bacteria 1376
435 Ga0265330_10001832 3300031235 Bacteria 11864
436 Ga0265332_10001076 3300031238 Bacteria 15975
437 Ga0265328_10116818 3300031239 Bacteria 993
438 Ga0265320_10007521 3300031240 Bacteria 6756
439 Ga0265325_10000789 3300031241 Bacteria 22904
440 Ga0265329_10000737 3300031242 Bacteria 16603
441 Ga0265340_10002224 3300031247 Bacteria 11098
442 Ga0265339_10090865 3300031249 Bacteria 1600
443 Ga0265331_10002864 3300031250 Bacteria 11416
444 Ga0265331_10539456 3300031250 Bacteria 526
445 Ga0265327_10004513 3300031251 Bacteria 12285
446 Ga0265327_10009219 3300031251 Bacteria 7157
447 Ga0265327_10402024 3300031251 Bacteria 595
448 Ga0265316_10015955 3300031344 Bacteria 6538
449 Ga0307408_100173181 3300031548 Bacteria 1725
450 Ga0265313_10025485 3300031595 Bacteria 3132
451 Ga0265314_10208683 3300031711 Bacteria 1148
452 Ga0265342_10003926 3300031712 Bacteria 11940
453 Ga0307405_11866370 3300031731 Bacteria 535
454 Ga0307413_10413397 3300031824 Bacteria 1060
455 Ga0307410_10039825 3300031852 Bacteria 3088
456 Ga0307406_10691787 3300031901 Bacteria 850
457 Ga0307407_10038517 3300031903 Bacteria 2650
458 Ga0307412_10028568 3300031911 Bacteria 3491
459 Ga0307409_100029582 3300031995 Bacteria 3922
460 Ga0307409_101413563 3300031995 Bacteria 722
461 Ga0307416_100239355 3300032002 Bacteria 1757
462 Ga0307416_100358388 3300032002 Bacteria 1479
463 Ga0307416_100847352 3300032002 Bacteria 1012
464 Ga0307411_10200506 3300032005 Bacteria 1532
465 Ga0307415_100059765 3300032126 Bacteria 2630
466 Ga0307415_100166573 3300032126 Bacteria 1714
467 Ga0373934_0184900 3300035086 Bacteria 857
468 Ga0373934_0297808 3300035086 Bacteria 669
469 Ga0373936_0201850 3300035113 Bacteria 878
470 Ga0373936_0392261 3300035113 Bacteria 636
471 Ga0373953_0097985 3300035117 Bacteria 1232
472 Ga0373957_0310237 3300035120 Bacteria 670
473 Ga0373943_0322145 3300035170 Bacteria 881
474 Ga0373943_0436378 3300035170 Bacteria 759
475 Ga0373943_0447912 3300035170 Bacteria 750
476 Ga0373946_0032609 3300035171 Bacteria 2093
477 Ga0373946_0270272 3300035171 Bacteria 834
478 Ga0373955_0143483 3300035172 Bacteria 1402
479 Ga0373955_0620078 3300035172 Bacteria 663
480 Ga0373924_0257736 3300035410 Bacteria 773
481 Ga0373935_0583905 3300035692 Bacteria 816
482 Ga0373933_0072209 3300035724 Bacteria 2102
483 Ga0373947_0039838 3300035725 Bacteria 2797
484 Ga0373947_0205249 3300035725 Bacteria 1291
485 Ga0373947_0352495 3300035725 Bacteria 988
486 Ga0373937_0000364 3300036401 Bacteria 42155
487 Ga0373937_0403472 3300036401 Bacteria 1297
488 Ga0373937_0936355 3300036401 Bacteria 815
489 Ga0373925_0725340 3300037068 Bacteria 819
490 Ga0395899_0073951 3300037312 Bacteria 2491
491 Ga0395899_0081645 3300037312 Bacteria 2352
492 Ga0395899_0331009 3300037312 Bacteria 1023
493 Ga0395899_0345791 3300037312 Bacteria 996
494 Ga0395900_0069780 3300037418 Bacteria 3612
495 Ga0395900_0229353 3300037418 Bacteria 1868
496 Ga0395900_0259818 3300037418 Bacteria 1735
497 Ga0395900_0461200 3300037418 Bacteria 1225
498 Ga0395900_0504108 3300037418 Bacteria 1160
499 Ga0395900_0596571 3300037418 Bacteria 1045
500 Ga0395900_1313429 3300037418 Bacteria 637
501 Ga0395900_1427053 3300037418 Bacteria 605
502 Ga0395898_0040333 3300037466 Bacteria 4617
503 Ga0395898_0050366 3300037466 Bacteria 4076
504 Ga0395898_0311506 3300037466 Bacteria 1502
505 Ga0395898_0403048 3300037466 Bacteria 1304
506 Ga0395898_0409556 3300037466 Bacteria 1292
507 Ga0395898_0586789 3300037466 Bacteria 1057
508 Ga0395898_0606427 3300037466 Bacteria 1037
509 Ga0395898_0858995 3300037466 Unclassified 846
510 Ga0395898_1946895 3300037466 Bacteria 507
511 Ga0395905_0213277 3300037471 Bacteria 1808
512 Ga0395905_0225727 3300037471 Bacteria 1752
513 Ga0395905_0235047 3300037471 Bacteria 1713
514 Ga0395905_0259143 3300037471 Bacteria 1624
515 Ga0395905_0263260 3300037471 Bacteria 1610
516 Ga0395905_0566361 3300037471 Unclassified 1037
517 Ga0395905_0818399 3300037471 Bacteria 834
518 Ga0395901_0011484 3300038443 Bacteria 8976
519 Ga0395901_0101707 3300038443 Bacteria 3015
520 Ga0395901_0114839 3300038443 Bacteria 2828
521 Ga0395901_0232628 3300038443 Bacteria 1924
522 Ga0395901_0405455 3300038443 Bacteria 1400
523 Ga0395901_0474127 3300038443 Unclassified 1277
524 Ga0395901_0700511 3300038443 Bacteria 1010
525 Ga0395901_1103552 3300038443 Bacteria 764
526 Ga0451789_1029551 3300041443 Unclassified 628
527 Ga0451804_0353585 3300041463 Bacteria 550
528 Ga0451835_0979349 3300041492 Unclassified 624
529 Ga0451853_0844785 3300041512 Bacteria 547
530 Ga0451853_3134357 3300041512 Unclassified 1755
531 Ga0439448_0024671 3300042005 Bacteria 1882
532 Ga0466964_0083602 3300044706 Bacteria 1375
533 Ga0466964_0335159 3300044706 Bacteria 773
534 Ga0451576_2135519 3300045051 Bacteria 576
535 Ga0466967_0750172 3300045976 Bacteria 968
536 Ga0495617_143150 3300046452 Bacteria 763
537 Ga0495592_0000050 3300046454 Bacteria 111971
538 Ga0495592_0101188 3300046454 Bacteria 2053
539 Ga0495592_0140504 3300046454 Bacteria 1680
540 Ga0495592_0542737 3300046454 Bacteria 716
541 Ga0495603_0210952 3300046455 Bacteria 1121
542 Ga0495603_0224698 3300046455 Bacteria 1083
543 Ga0495603_0229782 3300046455 Bacteria 1070
544 Ga0495603_0255015 3300046455 Bacteria 1010
545 Ga0495629_0007457 3300046459 Bacteria 8059
546 Ga0495629_0994868 3300046459 Bacteria 546
547 Ga0495641_0086436 3300046461 Bacteria 1403
548 Ga0495641_0388200 3300046461 Bacteria 633
549 Ga0495651_0000028 3300046462 Bacteria 105473
550 Ga0495653_0002470 3300046463 Bacteria 14701
551 Ga0495653_0030595 3300046463 Bacteria 4286
552 Ga0495653_0369344 3300046463 Bacteria 919
553 Ga0495653_0499266 3300046463 Bacteria 759
554 Ga0495653_0657971 3300046463 Bacteria 639
555 Ga0495582_0038950 3300046473 Bacteria 2617
556 Ga0495582_0052623 3300046473 Bacteria 2245
557 Ga0495582_0740967 3300046473 Bacteria 569
558 Ga0495605_0018601 3300046474 Bacteria 3721
559 Ga0495662_0091567 3300046476 Bacteria 1483
560 Ga0495662_0349531 3300046476 Bacteria 727
561 Ga0495664_0152378 3300046477 Bacteria 1402
562 Ga0495664_0551937 3300046477 Bacteria 686
563 Ga0495584_0026519 3300046491 Bacteria 2936
564 Ga0495584_0158218 3300046491 Bacteria 1151
565 Ga0495584_0266259 3300046491 Bacteria 871
566 Ga0495584_0582663 3300046491 Bacteria 570
567 Ga0495585_0080389 3300046492 Bacteria 1767
568 Ga0495594_0368178 3300046499 Bacteria 818
569 Ga0495596_0036967 3300046500 Bacteria 1933
570 Ga0495596_0207476 3300046500 Bacteria 761
571 Ga0495596_0339381 3300046500 Unclassified 585
572 Ga0495607_0143079 3300046501 Bacteria 1232
573 Ga0495607_0303986 3300046501 Unclassified 750
574 Ga0495608_0002704 3300046511 Bacteria 12737
575 Ga0495608_0011498 3300046511 Bacteria 6159
576 Ga0495608_0046525 3300046511 Bacteria 2887
577 Ga0495608_0761099 3300046511 Bacteria 573
578 Ga0495616_0359999 3300046513 Bacteria 604
579 Ga0495616_0442480 3300046513 Bacteria 528
580 Ga0495618_0003120 3300046514 Bacteria 10436
581 Ga0495618_0071632 3300046514 Bacteria 2205
582 Ga0495618_0379584 3300046514 Bacteria 867
583 Ga0495628_0000060 3300046516 Bacteria 87173
584 Ga0495628_0033129 3300046516 Bacteria 4166
585 Ga0495628_0181592 3300046516 Bacteria 1591
586 Ga0495628_0663289 3300046516 Bacteria 740
587 Ga0495630_0139293 3300046517 Bacteria 1844
588 Ga0495630_0237895 3300046517 Bacteria 1391
589 Ga0495630_0391240 3300046517 Bacteria 1065
590 Ga0495630_0475513 3300046517 Bacteria 958
591 Ga0495630_1119538 3300046517 Bacteria 597
592 Ga0495630_1214379 3300046517 Bacteria 570
593 Ga0495631_0302170 3300046518 Bacteria 681
594 Ga0495631_0469815 3300046518 Bacteria 536
595 Ga0495644_0004027 3300046523 Bacteria 5782
596 Ga0495644_0019835 3300046523 Bacteria 2567
597 Ga0495644_0167566 3300046523 Bacteria 843
598 Ga0495644_0397680 3300046523 Bacteria 545
599 Ga0495663_0051703 3300046525 Bacteria 1274
600 Ga0495663_0382037 3300046525 Bacteria 516
601 Ga0495652_0000512 3300046529 Bacteria 45282
602 Ga0495652_0044756 3300046529 Bacteria 3810
603 Ga0495652_0670543 3300046529 Bacteria 700
604 Ga0495652_1149061 3300046529 Bacteria 502
605 Ga0495654_0374508 3300046530 Bacteria 569
606 Ga0495640_0022675 3300046533 Bacteria 4585
607 Ga0495640_0506473 3300046533 Bacteria 734
608 Ga0495640_0609281 3300046533 Bacteria 659
609 Ga0495586_0284580 3300046535 Bacteria 946
610 Ga0495587_0000062 3300046536 Bacteria 91862
611 Ga0495598_0081670 3300046537 Bacteria 1038
612 Ga0495621_0088937 3300046539 Bacteria 1162
613 Ga0495645_0000028 3300046543 Bacteria 113461
614 Ga0495645_0047808 3300046543 Bacteria 3116
615 Ga0495645_0059670 3300046543 Bacteria 2765
616 Ga0495667_0054102 3300046559 Bacteria 2642
617 Ga0495667_0155944 3300046559 Bacteria 1469
618 Ga0495667_0207919 3300046559 Bacteria 1251
619 Ga0495667_0986300 3300046559 Bacteria 514
620 Ga0495656_0006621 3300046615 Bacteria 4067
621 Ga0495656_0014258 3300046615 Bacteria 2977
622 Ga0495656_0052907 3300046615 Bacteria 1743
623 Ga0495656_0098386 3300046615 Bacteria 1349
624 Ga0495656_0142421 3300046615 Bacteria 1151
625 Ga0495656_0356620 3300046615 Bacteria 759
626 Ga0495656_0476161 3300046615 Bacteria 660
627 Ga0495656_0610881 3300046615 Bacteria 584
628 Ga0495668_0108969 3300046616 Bacteria 1515
629 Ga0495634_0101232 3300046642 Bacteria 1861
630 Ga0495634_0384805 3300046642 Bacteria 835
631 Ga0495634_0398087 3300046642 Bacteria 818
632 Ga0495634_0654961 3300046642 Bacteria 606
633 Ga0495635_0056020 3300046663 Bacteria 2715
634 Ga0495635_0281831 3300046663 Bacteria 1116
635 Ga0495635_0812435 3300046663 Bacteria 602
636 Ga0495659_0081780 3300046664 Bacteria 1227
637 Ga0495588_0094706 3300046674 Bacteria 1566
638 Ga0495657_0033992 3300046675 Bacteria 3545
639 Ga0495657_0123617 3300046675 Bacteria 1627
640 Ga0495657_0138041 3300046675 Bacteria 1522
641 Ga0495657_0170372 3300046675 Bacteria 1341
642 Ga0495599_0000059 3300046678 Bacteria 75747
643 Ga0495599_0051968 3300046678 Bacteria 2567
644 Ga0495599_0367171 3300046678 Bacteria 861
645 Ga0495623_0000082 3300046679 Bacteria 56315
646 Ga0495623_0131081 3300046679 Bacteria 1501
647 Ga0495623_0168908 3300046679 Bacteria 1279
648 Ga0495646_0003941 3300046680 Bacteria 9284
649 Ga0495646_0416761 3300046680 Bacteria 697
650 Ga0495647_0212521 3300046681 Bacteria 851
651 Ga0495669_0456393 3300046684 Bacteria 621
652 Ga0495613_0024755 3300046689 Bacteria 4472
653 Ga0495613_0044964 3300046689 Bacteria 3266
654 Ga0495613_0244484 3300046689 Bacteria 1254
655 Ga0495613_0438176 3300046689 Bacteria 887
656 Ga0495624_0032751 3300046690 Bacteria 3368
657 Ga0495624_0501380 3300046690 Bacteria 726
658 Ga0495670_0369768 3300046691 Bacteria 773
659 Ga0495671_0293806 3300046692 Bacteria 782
660 Ga0495600_0017901 3300046809 Bacteria 4510
661 Ga0495600_0821689 3300046809 Bacteria 552
662 Ga0495581_0289197 3300047315 Bacteria 958
663 Ga0495581_0310474 3300047315 Bacteria 922
664 Ga0495581_0464473 3300047315 Bacteria 737
665 Ga0495604_0000242 3300047317 Bacteria 48737
666 Ga0495636_0243750 3300047318 Bacteria 830
667 Ga0495674_0012416 3300047319 Bacteria 8027
668 Ga0495674_0263697 3300047319 Bacteria 1415
669 Ga0495674_0362547 3300047319 Bacteria 1175
670 Ga0495674_0450368 3300047319 Bacteria 1034
671 Ga0495676_0038964 3300047321 Bacteria 3942
672 Ga0495676_0087292 3300047321 Bacteria 2345
673 Ga0495676_0100838 3300047321 Bacteria 2137
674 Ga0495676_0173022 3300047321 Bacteria 1518
675 Ga0495676_0565774 3300047321 Bacteria 742
676 Ga0495680_0024954 3300047322 Bacteria 4951
677 Ga0495680_0095540 3300047322 Bacteria 2222
678 Ga0495680_0188435 3300047322 Bacteria 1485
679 Ga0495680_0308590 3300047322 Bacteria 1109
680 Ga0495680_0492561 3300047322 Bacteria 833
681 Ga0495680_0538049 3300047322 Bacteria 789
682 Ga0495675_0000020 3300047444 Bacteria 111526
683 Ga0495675_0249792 3300047444 Bacteria 1066
684 Ga0495684_0452558 3300047471 Bacteria 892
685 Ga0495684_1088075 3300047471 Bacteria 502
686 Ga0495593_0143960 3300047673 Bacteria 1207
687 Ga0495602_0000600 3300048088 Bacteria 33812
688 Ga0495602_0242106 3300048088 Bacteria 1349
689 Ga0495602_0453376 3300048088 Bacteria 905
690 Ga0496100_0011840 3300048903 Bacteria 4978
691 Ga0496100_0135922 3300048903 Bacteria 1737
692 Ga0496100_1686455 3300048903 Bacteria 501
693 Ga0496101_0005375 3300048904 Bacteria 8160
694 Ga0496101_0065915 3300048904 Bacteria 2640
695 Ga0496101_0148878 3300048904 Bacteria 1789
696 Ga0496101_1134835 3300048904 Bacteria 613
697 Ga0496101_1480976 3300048904 Unclassified 529
698 Ga0496102_0149665 3300048905 Bacteria 2193
699 Ga0496102_0538178 3300048905 Unclassified 1091
700 Ga0496102_0682892 3300048905 Bacteria 950
701 Ga0496102_0752566 3300048905 Bacteria 897
702 Ga0496102_0770497 3300048905 Bacteria 885
703 Ga0496103_0140514 3300048906 Bacteria 1544
704 Ga0496103_0345483 3300048906 Bacteria 957
705 Ga0496104_0024698 3300048907 Bacteria 5531
706 Ga0496104_0534421 3300048907 Bacteria 1083
707 Ga0496104_0573663 3300048907 Bacteria 1039
708 Ga0496104_0918942 3300048907 Bacteria 780
709 Ga0496105_0005165 3300048908 Bacteria 9898
710 Ga0496105_0347960 3300048908 Bacteria 1184
711 Ga0496106_0030857 3300048909 Bacteria 3995
712 Ga0496106_0134354 3300048909 Bacteria 1942
713 Ga0496106_0949150 3300048909 Bacteria 678
714 Ga0496106_1423059 3300048909 Bacteria 535
715 Ga0496107_0019241 3300048910 Bacteria 4817
716 Ga0496107_0064819 3300048910 Bacteria 2649
717 Ga0496107_0141904 3300048910 Bacteria 1775
718 Ga0496108_0285404 3300048911 Bacteria 1437
719 Ga0496108_0347526 3300048911 Bacteria 1294
720 Ga0496108_0728642 3300048911 Bacteria 859
721 Ga0496108_0772423 3300048911 Bacteria 830
722 Ga0496109_0001499 3300048912 Bacteria 19394
723 Ga0496109_0145507 3300048912 Bacteria 2217
724 Ga0496109_0203816 3300048912 Bacteria 1860
725 Ga0496109_0558806 3300048912 Unclassified 1079
726 Ga0496109_0681449 3300048912 Bacteria 965
727 Ga0496109_0984292 3300048912 Unclassified 781
728 Ga0496109_1422815 3300048912 Unclassified 629
729 Ga0496109_1504046 3300048912 Unclassified 608
730 Ga0496109_1723475 3300048912 Bacteria 560
731 Ga0496109_1933379 3300048912 Bacteria 522
732 Ga0496110_0008785 3300048913 Bacteria 8140
733 Ga0496110_0183683 3300048913 Bacteria 1899
734 Ga0496110_0209872 3300048913 Unclassified 1770
735 Ga0496110_0382528 3300048913 Bacteria 1282
736 Ga0496110_0985369 3300048913 Bacteria 750
737 Ga0496110_1175641 3300048913 Bacteria 676
738 Ga0496110_1616557 3300048913 Bacteria 558
739 Ga0496111_0000138 3300048914 Bacteria 32480
740 Ga0496111_0325756 3300048914 Bacteria 1138
741 Ga0496111_0455019 3300048914 Bacteria 944
742 Ga0496112_0345981 3300048915 Bacteria 1430
743 Ga0496112_1802615 3300048915 Bacteria 524
744 Ga0496113_0111822 3300048916 Bacteria 2127
745 Ga0496113_1001101 3300048916 Bacteria 658
746 Ga0496114_0059419 3300048917 Bacteria 3194
747 Ga0496114_0070023 3300048917 Bacteria 2945
748 Ga0496114_0077804 3300048917 Bacteria 2797
749 Ga0496114_0134756 3300048917 Bacteria 2135
750 Ga0496114_0466487 3300048917 Bacteria 1118
751 Ga0496114_0935442 3300048917 Bacteria 749
752 Ga0496114_1271704 3300048917 Bacteria 622
753 Ga0496115_0212083 3300048918 Bacteria 1599
754 Ga0496115_0439808 3300048918 Bacteria 1054
755 Ga0501031_0000049 3300049568 Bacteria 65338
756 Ga0501032_0001830 3300049569 Bacteria 16815
757 Ga0501033_0000383 3300049570 Bacteria 42550
758 Ga0501034_0129480 3300049571 Bacteria 2507
759 Ga0501036_0000038 3300049572 Bacteria 84269
760 Ga0501037_0000177 3300049573 Bacteria 59495
761 Ga0501038_0000336 3300049574 Bacteria 40561
762 Ga0501039_0000349 3300049575 Bacteria 33069
763 Ga0501040_0000083 3300049576 Bacteria 46328
764 Ga0501041_0000001 3300049577 Bacteria 96328
765 Ga0501042_0000002 3300049578 Bacteria 79574
766 Ga0501043_0000077 3300049579 Bacteria 86054
767 Ga0501046_0000175 3300049580 Bacteria 65364
768 Ga0501047_0000162 3300049581 Bacteria 81578
769 Ga0501048_0000021 3300049582 Bacteria 69380
770 Ga0501067_0010746 3300049583 Bacteria 5064
771 Ga0501067_0033456 3300049583 Bacteria 2852
772 Ga0501067_0170994 3300049583 Bacteria 1210
773 Ga0501067_0546278 3300049583 Bacteria 649
774 Ga0501068_0000020 3300049584 Bacteria 59613
775 Ga0501068_0084413 3300049584 Bacteria 1953
776 Ga0501068_0388410 3300049584 Bacteria 899
777 Ga0501068_1116018 3300049584 Bacteria 522
778 Ga0501069_0013111 3300049585 Bacteria 4420
779 Ga0501069_0026738 3300049585 Bacteria 3160
780 Ga0501069_0428422 3300049585 Bacteria 785
781 Ga0501069_0432619 3300049585 Bacteria 781
782 Ga0501070_0001426 3300049586 Bacteria 21410
783 Ga0501070_0637104 3300049586 Bacteria 847
784 Ga0501071_0000024 3300049587 Bacteria 49758
785 Ga0501071_1543973 3300049587 Unclassified 513
786 Ga0501072_0000074 3300049588 Bacteria 72534
787 Ga0501073_0000105 3300049589 Bacteria 53900
788 Ga0501074_0000013 3300049590 Bacteria 81009
789 Ga0501075_0000056 3300049591 Bacteria 48279
790 Ga0501076_0000039 3300049592 Bacteria 63618
791 Ga0501076_1523791 3300049592 Bacteria 549
792 Ga0501077_0000049 3300049593 Bacteria 61814
793 Ga0501077_0871107 3300049593 Bacteria 579
794 Ga0501079_0000012 3300049741 Bacteria 69559
795 Ga0501080_0000031 3300049742 Bacteria 86869
796 Ga0501081_0000004 3300049743 Bacteria 94770
797 Ga0501083_0000091 3300049744 Bacteria 60492
798 Ga0501035_0000244 3300049822 Bacteria 65327
799 Ga0501044_0000481 3300049823 Bacteria 48516
800 Ga0501045_0000016 3300049824 Bacteria 72118
801 nmdc:mga03683_183746_c1 3300050489 Bacteria 954
802 nmdc:mga0yw44_387762_c1 3300050492 Bacteria 943
803 nmdc:mga05p37_1092990_c1 3300050507 Bacteria 836
804 nmdc:mga05p37_137810_c1 3300050507 Bacteria 2991
805 nmdc:mga05p37_1754268_c1 3300050507 Bacteria 602
806 nmdc:mga05p37_193594_c1 3300050507 Bacteria 2467
807 nmdc:mga05p37_659330_c1 3300050507 Bacteria 1170
808 nmdc:mga05p37_85717_c1 3300050507 Bacteria 3882
809 nmdc:mga09592_134240_c1 3300050508 Bacteria 2131
810 nmdc:mga0qj67_102363_c1 3300050509 Bacteria 2309
811 nmdc:mga06r32_959435_c1 3300050510 Bacteria 809
812 nmdc:mga08y16_157721_c1 3300050511 Bacteria 2358
813 nmdc:mga08y16_1604691_c1 3300050511 Unclassified 608
814 nmdc:mga08y16_16523_c1 3300050511 Bacteria 7764
815 nmdc:mga08y16_341629_c1 3300050511 Bacteria 1539
816 nmdc:mga08y16_43268_c1 3300050511 Bacteria 4719
817 nmdc:mga08y16_61061_c1 3300050511 Bacteria 3936
818 nmdc:mga0n895_100046_c1 3300050512 Bacteria 2908
819 nmdc:mga0n895_185094_c1 3300050512 Bacteria 2114
820 nmdc:mga0n895_230799_c1 3300050512 Bacteria 1878
821 nmdc:mga0n895_682064_c1 3300050512 Bacteria 1024
822 nmdc:mga0n895_790446_c1 3300050512 Bacteria 940
823 nmdc:mga0rr50_108774_c1 3300050513 Bacteria 2190
824 nmdc:mga08x19_813817_c1 3300050514 Bacteria 663
825 nmdc:mga08x19_97513_c1 3300050514 Bacteria 1946
826 nmdc:mga0a205_1574353_c1 3300050515 Unclassified 505
827 nmdc:mga0a205_188316_c1 3300050515 Bacteria 1956
828 nmdc:mga0a205_291069_c1 3300050515 Bacteria 1507
829 Ga0495601_0000241 3300053077 Bacteria 29180
830 Ga0495601_0013901 3300053077 Bacteria 4846
831 Ga0495601_0704381 3300053077 Unclassified 644
832 Ga0495612_0024489 3300053078 Bacteria 2423
833 Ga0495655_0008739 3300053083 Bacteria 1937
834 Ga0495655_0029477 3300053083 Bacteria 1320
835 Ga0495595_0009251 3300053084 Bacteria 4069
836 Ga0495595_0027630 3300053084 Bacteria 2529
837 Ga0495595_0229594 3300053084 Bacteria 927
838 Ga0495619_0000316 3300053085 Bacteria 33863
839 Ga0495619_0019352 3300053085 Bacteria 4327
840 Ga0495619_0072189 3300053085 Bacteria 2311
841 Ga0495619_0295967 3300053085 Unclassified 1121
842 Ga0501084_0000635 3300054114 Bacteria 26802
843 Ga0501084_1591250 3300054114 Bacteria 546
844 Ga0501082_0000135 3300060353 Bacteria 60581
845 Ga0530510_0004796 3300061734 Bacteria 9364
846 Ga0530510_0178176 3300061734 Bacteria 1576
847 Ga0070716_101201558
848 Ga0070658_10765235
849 Ga0070683_100061207
850 Ga0070683_100188838
851 Ga0070683_100479888
852 Ga0070690_100161920
853 Ga0070670_100158874
854 Ga0070670_100851137
855 Ga0070677_10638275
856 Ga0068869_100022844
857 Ga0068869_100188849
858 Ga0070666_11434439
859 Ga0070682_100052575
860 Ga0070682_101614601
861 Ga0068868_100561414
862 Ga0068868_101318938
863 Ga0070689_100215348
864 Ga0070675_100065831
865 Ga0070675_100110021
866 Ga0070675_100485583
867 Ga0070675_100685175
868 Ga0070675_100737173
869 Ga0070675_101504095
870 Ga0070671_100064412
871 Ga0070671_101373050
872 Ga0070674_100030970
873 Ga0070674_100359736
874 Ga0070674_101749891
875 Ga0070673_100224796
876 Ga0070673_100378496
877 Ga0070673_101679226
878 Ga0070659_101515674
879 Ga0070667_100752725
880 Ga0070709_11707383
881 Ga0070714_100011755
882 Ga0070714_100021819
883 Ga0070714_100040257
884 Ga0070714_100042431
885 Ga0070714_102270714
886 Ga0070713_100150590
887 Ga0070713_100586933
888 Ga0070713_100803859
889 Ga0070713_101100682
890 Ga0070713_102374609
891 Ga0070710_10001370
892 Ga0070710_11229415
893 Ga0070711_100015124
894 Ga0070711_100469979
895 Ga0070705_100765232
896 Ga0070700_100090052
897 Ga0070700_100122660
898 Ga0070700_100439917
899 Ga0070694_100409225
900 Ga0070663_100619393
901 Ga0070678_100016209
902 Ga0070678_100387283
903 Ga0070678_100430549
904 Ga0070678_100453468
905 Ga0070678_100753755
906 Ga0070678_100864508
907 Ga0070678_101012485
908 Ga0070662_100268554
909 Ga0068867_100068104
910 Ga0068867_100636550
911 Ga0068867_101122263
912 Ga0068867_101318143
913 Ga0068867_101515255
914 Ga0068867_101545739
915 Ga0070706_100601323
916 Ga0070707_100001997
917 Ga0070707_100619038
918 Ga0070707_100666703
919 Ga0070707_101256722
920 Ga0070707_102142581
921 Ga0070699_100239071
922 Ga0070699_100767275
923 Ga0070684_100095896
924 Ga0070684_100112531
925 Ga0070684_100548281
926 Ga0070672_100189582
927 Ga0070672_100224678
928 Ga0070672_100340618
929 Ga0070672_101407259
930 Ga0070672_101704887
931 Ga0070686_100074782
932 Ga0070693_100222664
933 Ga0070693_101675783
934 Ga0070665_101101456
935 Ga0070665_101832294
936 Ga0070704_100297813
937 Ga0070704_100390363
938 Ga0070704_100555019
939 Ga0070704_100995248
940 Ga0068855_100358846
941 Ga0068855_101618773
942 Ga0070664_100104460
943 Ga0070664_100300873
944 Ga0070664_101486621
945 Ga0068857_100002779
946 Ga0068857_100068858
947 Ga0068857_102316150
948 Ga0068854_102262995
949 Ga0068856_100161663
950 Ga0068856_100957436
951 Ga0070702_100296823
952 Ga0070702_101098881
953 Ga0070702_101879911
954 Ga0068852_102446540
955 Ga0068864_100537370
956 Ga0068866_10300209
957 Ga0068866_10352090
958 Ga0068861_100487167
959 Ga0068870_10148490
960 Ga0068870_10268072
961 Ga0068863_100418900
962 Ga0068863_101084119
963 Ga0068863_101304086
964 Ga0068858_100111770
965 Ga0081455_10006277
966 Ga0081455_10033827
967 Ga0081455_10055740
968 Ga0081455_10238890
969 Ga0081538_10003781
970 Ga0081538_10005509
971 Ga0070717_10010897
972 Ga0070717_10021906
973 Ga0070717_10623887
974 Ga0070717_10845315
975 Ga0075365_10547002
976 Ga0075365_11337933
977 Ga0075364_10704115
978 Ga0075432_10292267
979 Ga0075432_10314316
980 Ga0070715_10121394
981 Ga0070715_10469802
982 Ga0070716_100412783
983 Ga0070716_100890658
984 Ga0070712_100329659
985 Ga0070712_101247985
986 Ga0070712_101300400
987 Ga0075362_10100955
988 Ga0097621_100199400
989 Ga0097621_100573588
990 Ga0097621_100924844
991 Ga0097621_101334858
992 Ga0068871_100074939
993 Ga0068871_101147609
994 Ga0068871_102248694
995 Ga0075428_100074029
996 Ga0075428_100404699
997 Ga0075428_100701479
998 Ga0075428_101327588
999 Ga0075428_101497787
1000 Ga0075428_101548045
1001 Ga0075428_101818605
1002 Ga0075430_100029341
1003 Ga0075431_100427005
1004 Ga0075433_10166279
1005 Ga0075433_10271784
1006 Ga0075433_10297719
1007 Ga0075434_100002903
1008 Ga0075434_100134020
1009 Ga0075434_100469643
1010 Ga0075434_100638124
1011 Ga0075434_100800608
1012 Ga0075434_100940230
1013 Ga0075434_101823253
1014 Ga0075429_100167594
1015 Ga0068865_100188631
1016 Ga0068865_100312315
1017 Ga0068865_100700913
1018 Ga0068865_100844435
1019 Ga0068865_101083678
1020 Ga0068865_101134949
1021 Ga0068865_101191142
1022 Ga0068865_101543028
1023 Ga0075436_100138182
1024 Ga0075436_101319974
1025 Ga0075435_100054417
1026 Ga0075435_100443720
1027 Ga0075435_101253129
1028 Ga0099795_10119329
1029 Ga0105240_10253298
1030 Ga0105240_10585685
1031 Ga0105240_11076712
1032 Ga0105240_11260544
1033 Ga0111539_10002177
1034 Ga0111539_10002716
1035 Ga0111539_10009380
1036 Ga0111539_10365326
1037 Ga0111539_10439858
1038 Ga0111539_10774499
1039 Ga0111539_12027372
1040 Ga0111539_12334371
1041 Ga0111539_12988246
1042 Ga0105245_10052006
1043 Ga0105245_10135791
1044 Ga0105245_10260320
1045 Ga0105245_10396185
1046 Ga0105245_10532511
1047 Ga0105245_10692725
1048 Ga0105245_13292328
1049 Ga0105247_10948548
1050 Ga0114129_10041130
1051 Ga0114129_10068887
1052 Ga0114129_10196754
1053 Ga0114129_10306244
1054 Ga0114129_10619837
1055 Ga0114129_11064042
1056 Ga0105243_10172461
1057 Ga0105243_10206875
1058 Ga0105243_10325196
1059 Ga0105243_10358576
1060 Ga0105243_10623864
1061 Ga0105243_10669713
1062 Ga0105243_11640280
1063 Ga0105243_11648967
1064 Ga0105243_11766102
1065 Ga0105243_12259124
1066 Ga0105242_10015723
1067 Ga0105242_10070123
1068 Ga0105242_10135974
1069 Ga0105242_10255859
1070 Ga0105242_10413355
1071 Ga0105242_12056606
1072 Ga0105242_12100386
1073 Ga0105237_12048244
1074 Ga0105237_12751476
1075 Ga0105238_11870966
1076 Ga0105249_11715144
1077 Ga0105249_12194688
1078 Ga0105249_13086294
1079 Ga0105239_10220222
1080 Ga0105239_12056509
1081 Ga0105246_10012010
1082 Ga0105246_10054984
1083 Ga0105246_10102666
1084 Ga0105246_10369240
1085 Ga0105246_10605510
1086 Ga0105246_10826861
1087 Ga0105246_11373692
1088 Ga0105246_12219357
1089 Ga0157345_1055310
1090 Ga0157369_10584821
1091 Ga0157374_11272049
1092 Ga0157374_12047630
1093 Ga0157378_10477625
1094 Ga0157378_10692854
1095 Ga0157378_11284391
1096 Ga0163162_10230108
1097 Ga0157372_10292548
1098 Ga0157375_10270163
1099 Ga0157375_10276947
1100 Ga0157375_10624856
1101 Ga0157375_11060798
1102 Ga0157375_11343524
1103 Ga0163163_10450763
1104 Ga0163163_10526763
1105 Ga0163163_10531370
1106 Ga0157380_10124679
1107 Ga0157380_10240518
1108 Ga0157380_10301595
1109 Ga0157380_12266735
1110 Ga0157380_12351939
1111 Ga0182008_10481158
1112 Ga0182008_10931457
1113 Ga0157377_10064225
1114 Ga0157377_10119784
1115 Ga0157377_10853291
1116 Ga0157379_10107809
1117 Ga0157379_10249528
1118 Ga0157379_11922130
1119 Ga0157376_10011165
1120 Ga0157376_10082624
1121 Ga0157376_10637443
1122 Ga0157376_11471249
1123 Ga0157376_11795054
1124 Ga0157376_12641095
1125 Ga0157376_12759655
1126 Ga0182006_1246530
1127 Ga0163161_10354240
1128 Ga0206354_10406073
1129 Ga0224712_10358608
1130 Ga0207692_10082360
1131 Ga0207642_10219802
1132 Ga0207642_10531058
1133 Ga0207688_10032300
1134 Ga0207680_11323403
1135 Ga0207647_10768230
1136 Ga0207699_10064650
1137 Ga0207699_10117481
1138 Ga0207699_10268760
1139 Ga0207645_10412896
1140 Ga0207643_10132094
1141 Ga0207643_10333359
1142 Ga0207684_10339408
1143 Ga0207695_10357450
1144 Ga0207695_10757686
1145 Ga0207695_11274195
1146 Ga0207693_10000954
1147 Ga0207693_10280824
1148 Ga0207663_10037687
1149 Ga0207663_10434112
1150 Ga0207662_10065009
1151 Ga0207657_10172751
1152 Ga0207649_10072226
1153 Ga0207646_10000129
1154 Ga0207646_10327674
1155 Ga0207646_10360902
1156 Ga0207646_10818524
1157 Ga0207646_11080829
1158 Ga0207646_11524592
1159 Ga0207681_11001962
1160 Ga0207650_11052098
1161 Ga0207659_10167835
1162 Ga0207659_10225581
1163 Ga0207659_10296201
1164 Ga0207659_10346019
1165 Ga0207659_11007848
1166 Ga0207659_11579875
1167 Ga0207687_10076242
1168 Ga0207687_10111785
1169 Ga0207687_10214428
1170 Ga0207687_10261315
1171 Ga0207687_10376819
1172 Ga0207687_11042315
1173 Ga0207700_10064543
1174 Ga0207700_10953908
1175 Ga0207700_11306336
1176 Ga0207664_10026178
1177 Ga0207664_10066818
1178 Ga0207664_10117872
1179 Ga0207664_10151260
1180 Ga0207664_10162029
1181 Ga0207664_10246223
1182 Ga0207664_10334027
1183 Ga0207644_10109285
1184 Ga0207644_10726559
1185 Ga0207644_11060260
1186 Ga0207690_11767477
1187 Ga0207706_10071187
1188 Ga0207706_10087193
1189 Ga0207706_10436927
1190 Ga0207706_11021710
1191 Ga0207686_10217586
1192 Ga0207686_10353958
1193 Ga0207686_10451099
1194 Ga0207686_10655747
1195 Ga0207686_11704588
1196 Ga0207709_10111154
1197 Ga0207709_10442261
1198 Ga0207709_10891320
1199 Ga0207669_10582846
1200 Ga0207669_10670257
1201 Ga0207669_10715293
1202 Ga0207704_10986327
1203 Ga0207704_11037903
1204 Ga0207704_11311465
1205 Ga0207704_11824433
1206 Ga0207665_10015992
1207 Ga0207665_10164202
1208 Ga0207665_10786584
1209 Ga0207665_11248606
1210 Ga0207691_10228848
1211 Ga0207691_10241693
1212 Ga0207691_10307517
1213 Ga0207691_10678778
1214 Ga0207691_11372667
1215 Ga0207691_11636529
1216 Ga0207689_11351422
1217 Ga0207661_10099317
1218 Ga0207661_10179436
1219 Ga0207661_10546135
1220 Ga0207661_11744415
1221 Ga0207679_10477042
1222 Ga0207679_10518202
1223 Ga0207679_10568922
1224 Ga0207679_10748822
1225 Ga0207651_11068959
1226 Ga0207668_11967160
1227 Ga0207640_10551538
1228 Ga0207640_12180700
1229 Ga0207658_10576789
1230 Ga0207677_10861426
1231 Ga0207677_10983162
1232 Ga0207677_10994588
1233 Ga0207677_11106823
1234 Ga0207677_11663916
1235 Ga0207677_11929373
1236 Ga0207708_10319848
1237 Ga0207708_10390542
1238 Ga0207708_10650211
1239 Ga0207708_11052095
1240 Ga0207708_11731180
1241 Ga0207702_10137343
1242 Ga0207702_10404762
1243 Ga0207641_11326779
1244 Ga0207641_11773558
1245 Ga0207648_10534429
1246 Ga0207648_10850590
1247 Ga0207648_10914015
1248 Ga0207648_11048842
1249 Ga0207648_11377067
1250 Ga0207648_11818366
1251 Ga0207676_11877452
1252 Ga0207674_10002068
1253 Ga0207674_10079133
1254 Ga0207674_11803000
1255 Ga0207683_10054652
1256 Ga0207683_10226743
1257 Ga0207683_10441046
1258 Ga0207683_10688454
1259 Ga0207683_11410908
1260 Ga0207698_10650924
1261 Ga0207698_11947237
1262 Ga0207428_10022243
1263 Ga0207428_10044037
1264 Ga0207428_10099482
1265 Ga0207428_10325325
1266 Ga0268266_11371210
1267 Ga0268266_11402819
1268 Ga0268266_11472539
1269 Ga0268265_11316965
1270 Ga0268264_11369442
1271 Ga0265319_1002672
1272 Ga0265334_10001389
1273 Ga0265318_10000251
1274 Ga0265318_10357825
1275 Ga0265323_10074877
1276 Ga0265322_10001345
1277 Ga0265336_10220883
1278 Ga0265338_10002952
1279 Ga0265338_10004801
1280 Ga0265324_10054222
1281 Ga0265330_10001832
1282 Ga0265332_10001076
1283 Ga0265328_10116818
1284 Ga0265320_10007521
1285 Ga0265325_10000789
1286 Ga0265329_10000737
1287 Ga0265340_10002224
1288 Ga0265339_10090865
1289 Ga0265331_10002864
1290 Ga0265331_10539456
1291 Ga0265327_10004513
1292 Ga0265327_10009219
1293 Ga0265327_10402024
1294 Ga0265316_10015955
1295 Ga0307408_100173181
1296 Ga0265313_10025485
1297 Ga0265314_10208683
1298 Ga0265342_10003926
1299 Ga0307405_11866370
1300 Ga0307413_10413397
1301 Ga0307410_10039825
1302 Ga0307406_10691787
1303 Ga0307407_10038517
1304 Ga0307412_10028568
1305 Ga0307409_100029582
1306 Ga0307409_101413563
1307 Ga0307416_100239355
1308 Ga0307416_100358388
1309 Ga0307416_100847352
1310 Ga0307411_10200506
1311 Ga0307415_100059765
1312 Ga0307415_100166573
1313 Ga0373934_0184900
1314 Ga0373934_0297808
1315 Ga0373936_0201850
1316 Ga0373936_0392261
1317 Ga0373953_0097985
1318 Ga0373957_0310237
1319 Ga0373943_0322145
1320 Ga0373943_0436378
1321 Ga0373943_0447912
1322 Ga0373946_0032609
1323 Ga0373946_0270272
1324 Ga0373955_0143483
1325 Ga0373955_0620078
1326 Ga0373924_0257736
1327 Ga0373935_0583905
1328 Ga0373933_0072209
1329 Ga0373947_0039838
1330 Ga0373947_0205249
1331 Ga0373947_0352495
1332 Ga0373937_0000364
1333 Ga0373937_0403472
1334 Ga0373937_0936355
1335 Ga0373925_0725340
1336 Ga0395899_0073951
1337 Ga0395899_0081645
1338 Ga0395899_0331009
1339 Ga0395899_0345791
1340 Ga0395900_0069780
1341 Ga0395900_0229353
1342 Ga0395900_0259818
1343 Ga0395900_0461200
1344 Ga0395900_0504108
1345 Ga0395900_0596571
1346 Ga0395900_1313429
1347 Ga0395900_1427053
1348 Ga0395898_0040333
1349 Ga0395898_0050366
1350 Ga0395898_0311506
1351 Ga0395898_0403048
1352 Ga0395898_0409556
1353 Ga0395898_0586789
1354 Ga0395898_0606427
1355 Ga0395898_0858995
1356 Ga0395898_1946895
1357 Ga0395905_0213277
1358 Ga0395905_0225727
1359 Ga0395905_0235047
1360 Ga0395905_0259143
1361 Ga0395905_0263260
1362 Ga0395905_0566361
1363 Ga0395905_0818399
1364 Ga0395901_0011484
1365 Ga0395901_0101707
1366 Ga0395901_0114839
1367 Ga0395901_0232628
1368 Ga0395901_0405455
1369 Ga0395901_0474127
1370 Ga0395901_0700511
1371 Ga0395901_1103552
1372 Ga0451789_1029551
1373 Ga0451804_0353585
1374 Ga0451835_0979349
1375 Ga0451853_0844785
1376 Ga0451853_3134357
1377 Ga0439448_0024671
1378 Ga0466964_0083602
1379 Ga0466964_0335159
1380 Ga0451576_2135519
1381 Ga0466967_0750172
1382 Ga0495617_143150
1383 Ga0495592_0000050
1384 Ga0495592_0101188
1385 Ga0495592_0140504
1386 Ga0495592_0542737
1387 Ga0495603_0210952
1388 Ga0495603_0224698
1389 Ga0495603_0229782
1390 Ga0495603_0255015
1391 Ga0495629_0007457
1392 Ga0495629_0994868
1393 Ga0495641_0086436
1394 Ga0495641_0388200
1395 Ga0495651_0000028
1396 Ga0495653_0002470
1397 Ga0495653_0030595
1398 Ga0495653_0369344
1399 Ga0495653_0499266
1400 Ga0495653_0657971
1401 Ga0495582_0038950
1402 Ga0495582_0052623
1403 Ga0495582_0740967
1404 Ga0495605_0018601
1405 Ga0495662_0091567
1406 Ga0495662_0349531
1407 Ga0495664_0152378
1408 Ga0495664_0551937
1409 Ga0495584_0026519
1410 Ga0495584_0158218
1411 Ga0495584_0266259
1412 Ga0495584_0582663
1413 Ga0495585_0080389
1414 Ga0495594_0368178
1415 Ga0495596_0036967
1416 Ga0495596_0207476
1417 Ga0495596_0339381
1418 Ga0495607_0143079
1419 Ga0495607_0303986
1420 Ga0495608_0002704
1421 Ga0495608_0011498
1422 Ga0495608_0046525
1423 Ga0495608_0761099
1424 Ga0495616_0359999
1425 Ga0495616_0442480
1426 Ga0495618_0003120
1427 Ga0495618_0071632
1428 Ga0495618_0379584
1429 Ga0495628_0000060
1430 Ga0495628_0033129
1431 Ga0495628_0181592
1432 Ga0495628_0663289
1433 Ga0495630_0139293
1434 Ga0495630_0237895
1435 Ga0495630_0391240
1436 Ga0495630_0475513
1437 Ga0495630_1119538
1438 Ga0495630_1214379
1439 Ga0495631_0302170
1440 Ga0495631_0469815
1441 Ga0495644_0004027
1442 Ga0495644_0019835
1443 Ga0495644_0167566
1444 Ga0495644_0397680
1445 Ga0495663_0051703
1446 Ga0495663_0382037
1447 Ga0495652_0000512
1448 Ga0495652_0044756
1449 Ga0495652_0670543
1450 Ga0495652_1149061
1451 Ga0495654_0374508
1452 Ga0495640_0022675
1453 Ga0495640_0506473
1454 Ga0495640_0609281
1455 Ga0495586_0284580
1456 Ga0495587_0000062
1457 Ga0495598_0081670
1458 Ga0495621_0088937
1459 Ga0495645_0000028
1460 Ga0495645_0047808
1461 Ga0495645_0059670
1462 Ga0495667_0054102
1463 Ga0495667_0155944
1464 Ga0495667_0207919
1465 Ga0495667_0986300
1466 Ga0495656_0006621
1467 Ga0495656_0014258
1468 Ga0495656_0052907
1469 Ga0495656_0098386
1470 Ga0495656_0142421
1471 Ga0495656_0356620
1472 Ga0495656_0476161
1473 Ga0495656_0610881
1474 Ga0495668_0108969
1475 Ga0495634_0101232
1476 Ga0495634_0384805
1477 Ga0495634_0398087
1478 Ga0495634_0654961
1479 Ga0495635_0056020
1480 Ga0495635_0281831
1481 Ga0495635_0812435
1482 Ga0495659_0081780
1483 Ga0495588_0094706
1484 Ga0495657_0033992
1485 Ga0495657_0123617
1486 Ga0495657_0138041
1487 Ga0495657_0170372
1488 Ga0495599_0000059
1489 Ga0495599_0051968
1490 Ga0495599_0367171
1491 Ga0495623_0000082
1492 Ga0495623_0131081
1493 Ga0495623_0168908
1494 Ga0495646_0003941
1495 Ga0495646_0416761
1496 Ga0495647_0212521
1497 Ga0495669_0456393
1498 Ga0495613_0024755
1499 Ga0495613_0044964
1500 Ga0495613_0244484
1501 Ga0495613_0438176
1502 Ga0495624_0032751
1503 Ga0495624_0501380
1504 Ga0495670_0369768
1505 Ga0495671_0293806
1506 Ga0495600_0017901
1507 Ga0495600_0821689
1508 Ga0495581_0289197
1509 Ga0495581_0310474
1510 Ga0495581_0464473
1511 Ga0495604_0000242
1512 Ga0495636_0243750
1513 Ga0495674_0012416
1514 Ga0495674_0263697
1515 Ga0495674_0362547
1516 Ga0495674_0450368
1517 Ga0495676_0038964
1518 Ga0495676_0087292
1519 Ga0495676_0100838
1520 Ga0495676_0173022
1521 Ga0495676_0565774
1522 Ga0495680_0024954
1523 Ga0495680_0095540
1524 Ga0495680_0188435
1525 Ga0495680_0308590
1526 Ga0495680_0492561
1527 Ga0495680_0538049
1528 Ga0495675_0000020
1529 Ga0495675_0249792
1530 Ga0495684_0452558
1531 Ga0495684_1088075
1532 Ga0495593_0143960
1533 Ga0495602_0000600
1534 Ga0495602_0242106
1535 Ga0495602_0453376
1536 Ga0496100_0011840
1537 Ga0496100_0135922
1538 Ga0496100_1686455
1539 Ga0496101_0005375
1540 Ga0496101_0065915
1541 Ga0496101_0148878
1542 Ga0496101_1134835
1543 Ga0496101_1480976
1544 Ga0496102_0149665
1545 Ga0496102_0538178
1546 Ga0496102_0682892
1547 Ga0496102_0752566
1548 Ga0496102_0770497
1549 Ga0496103_0140514
1550 Ga0496103_0345483
1551 Ga0496104_0024698
1552 Ga0496104_0534421
1553 Ga0496104_0573663
1554 Ga0496104_0918942
1555 Ga0496105_0005165
1556 Ga0496105_0347960
1557 Ga0496106_0030857
1558 Ga0496106_0134354
1559 Ga0496106_0949150
1560 Ga0496106_1423059
1561 Ga0496107_0019241
1562 Ga0496107_0064819
1563 Ga0496107_0141904
1564 Ga0496108_0285404
1565 Ga0496108_0347526
1566 Ga0496108_0728642
1567 Ga0496108_0772423
1568 Ga0496109_0001499
1569 Ga0496109_0145507
1570 Ga0496109_0203816
1571 Ga0496109_0558806
1572 Ga0496109_0681449
1573 Ga0496109_0984292
1574 Ga0496109_1422815
1575 Ga0496109_1504046
1576 Ga0496109_1723475
1577 Ga0496109_1933379
1578 Ga0496110_0008785
1579 Ga0496110_0183683
1580 Ga0496110_0209872
1581 Ga0496110_0382528
1582 Ga0496110_0985369
1583 Ga0496110_1175641
1584 Ga0496110_1616557
1585 Ga0496111_0000138
1586 Ga0496111_0325756
1587 Ga0496111_0455019
1588 Ga0496112_0345981
1589 Ga0496112_1802615
1590 Ga0496113_0111822
1591 Ga0496113_1001101
1592 Ga0496114_0059419
1593 Ga0496114_0070023
1594 Ga0496114_0077804
1595 Ga0496114_0134756
1596 Ga0496114_0466487
1597 Ga0496114_0935442
1598 Ga0496114_1271704
1599 Ga0496115_0212083
1600 Ga0496115_0439808
1601 Ga0501031_0000049
1602 Ga0501032_0001830
1603 Ga0501033_0000383
1604 Ga0501034_0129480
1605 Ga0501036_0000038
1606 Ga0501037_0000177
1607 Ga0501038_0000336
1608 Ga0501039_0000349
1609 Ga0501040_0000083
1610 Ga0501041_0000001
1611 Ga0501042_0000002
1612 Ga0501043_0000077
1613 Ga0501046_0000175
1614 Ga0501047_0000162
1615 Ga0501048_0000021
1616 Ga0501067_0010746
1617 Ga0501067_0033456
1618 Ga0501067_0170994
1619 Ga0501067_0546278
1620 Ga0501068_0000020
1621 Ga0501068_0084413
1622 Ga0501068_0388410
1623 Ga0501068_1116018
1624 Ga0501069_0013111
1625 Ga0501069_0026738
1626 Ga0501069_0428422
1627 Ga0501069_0432619
1628 Ga0501070_0001426
1629 Ga0501070_0637104
1630 Ga0501071_0000024
1631 Ga0501071_1543973
1632 Ga0501072_0000074
1633 Ga0501073_0000105
1634 Ga0501074_0000013
1635 Ga0501075_0000056
1636 Ga0501076_0000039
1637 Ga0501076_1523791
1638 Ga0501077_0000049
1639 Ga0501077_0871107
1640 Ga0501079_0000012
1641 Ga0501080_0000031
1642 Ga0501081_0000004
1643 Ga0501083_0000091
1644 Ga0501035_0000244
1645 Ga0501044_0000481
1646 Ga0501045_0000016
1647 nmdc:mga03683_183746_c1
1648 nmdc:mga0yw44_387762_c1
1649 nmdc:mga05p37_1092990_c1
1650 nmdc:mga05p37_137810_c1
1651 nmdc:mga05p37_1754268_c1
1652 nmdc:mga05p37_193594_c1
1653 nmdc:mga05p37_659330_c1
1654 nmdc:mga05p37_85717_c1
1655 nmdc:mga09592_134240_c1
1656 nmdc:mga0qj67_102363_c1
1657 nmdc:mga06r32_959435_c1
1658 nmdc:mga08y16_157721_c1
1659 nmdc:mga08y16_1604691_c1
1660 nmdc:mga08y16_16523_c1
1661 nmdc:mga08y16_341629_c1
1662 nmdc:mga08y16_43268_c1
1663 nmdc:mga08y16_61061_c1
1664 nmdc:mga0n895_100046_c1
1665 nmdc:mga0n895_185094_c1
1666 nmdc:mga0n895_230799_c1
1667 nmdc:mga0n895_682064_c1
1668 nmdc:mga0n895_790446_c1
1669 nmdc:mga0rr50_108774_c1
1670 nmdc:mga08x19_813817_c1
1671 nmdc:mga08x19_97513_c1
1672 nmdc:mga0a205_1574353_c1
1673 nmdc:mga0a205_188316_c1
1674 nmdc:mga0a205_291069_c1
1675 Ga0495601_0000241
1676 Ga0495601_0013901
1677 Ga0495601_0704381
1678 Ga0495612_0024489
1679 Ga0495655_0008739
1680 Ga0495655_0029477
1681 Ga0495595_0009251
1682 Ga0495595_0027630
1683 Ga0495595_0229594
1684 Ga0495619_0000316
1685 Ga0495619_0019352
1686 Ga0495619_0072189
1687 Ga0495619_0295967
1688 Ga0501084_0000635
1689 Ga0501084_1591250
1690 Ga0501082_0000135
1691 Ga0530510_0004796
1692 Ga0530510_0178176

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10944

DUF2630

Protein of unknown function (DUF2630)

2

79

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ls2-assembly1.cif.gz_b2 80s ribosome from mouse bound to eef2 (class i) 0.957 1 58
6z6l-assembly1.cif.gz_Lh cryo-em structure of human ccdc124 bound to 80s ribosomes 0.9395 1 58
7cpv-assembly1.cif.gz_Lh cryo-em structure of 80s ribosome from mouse testis 0.9391 1 58
8bpo-assembly1.cif.gz_g2 structure of rabbit 80s ribosome translating beta-tubulin in complex with tetratricopeptide protein 5 (ttc5) and s-phase cyclin a associated protein residing in the er (scaper) 0.9368 1 58
8a3d-assembly1.cif.gz_b human mature large subunit of the ribosome with eif6 and homoharringtonine bound 0.933 1 58
ID Description Score Start End Superfamily
af_Q15311_381_446_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9601 2 53 1.20.58.90
af_Q2FZ34_110_392_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.933 4 49 3.40.630.30
af_Q2FZ34_165_379_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.933 4 49 3.40.630.30
af_Q54ND2_601_802_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.9296 4 50 1.20.900.10
af_A0A1D8PEG6_32_281_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9267 4 47 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A7M3MQP4-F1-model_v4 DUF2203 family protein 1.005 5 48
AF-A0A7C8Q7T8-F1-model_v4 SAGA HAT/Core module component 0.9927 4 49 GO:0000124
GO:0035064
AF-A0A6S7MHZ5-F1-model_v4 deleted 0.9911 4 49
AF-A0A2N9FBR9-F1-model_v4 Reverse transcriptase domain-containing protein 0.9905 6 48
AF-A0A0B7JSL5-F1-model_v4 Uncharacterized protein 0.9905 4 49

Map